F483203

General Info

Members Datasets Scaffolds Average Seq Length
844 556 538 233

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1013091|JGI25154J39366_10130912
Length 226
Sequence MTQRPLTTIGFDADDTLWQNEQFYRLTELQFTELLADHAPSDVISARLLEAEKRNLRHYGFGIKGFTLSMIETAIEITEGEVPSTVIAQILDIGRDLLAHPVETLPHSGKYLLVLITKGDLFDQERKLAQSGLGDLFDAVEIVSDKNASTYRRIFSKVGDGPERAMMIGNSLKSDIVPALAAGSYGVFVPHELTWSFEHVEEPTDAPRFRKIGHLGELHDVIEALQ

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
16 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
17 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
18 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
19 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
20 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
23 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
24 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
25 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
26 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
27 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
28 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
29 2519899620 Rhizobium sp. Pop5 Isolate Nodule
30 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
31 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
32 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
33 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
34 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
35 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
36 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
39 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
40 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
41 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
42 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
43 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
44 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
45 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
46 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
47 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
48 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
49 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
50 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
51 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
52 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
53 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
54 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
55 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
56 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
57 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
58 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
59 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
60 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
61 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
62 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
63 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
64 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
65 2643221557 Ensifer sp. Root558 Isolate Unclassified
66 2643221558 Rhizobium sp. Root149 Isolate Unclassified
67 2643221599 Rhizobium sp. Root708 Isolate Unclassified
68 2643221610 Ensifer sp. Root74 Isolate Unclassified
69 2643221618 Ensifer sp. Root231 Isolate Unclassified
70 2643221626 Ensifer sp. Root31 Isolate Unclassified
71 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
72 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
73 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
74 2643221655 Ensifer sp. Root1252 Isolate Unclassified
75 2643221659 Ensifer sp. Root127 Isolate Unclassified
76 2643221668 Ensifer sp. Root423 Isolate Unclassified
77 2643221675 Ensifer sp. Root1298 Isolate Unclassified
78 2643221680 Ensifer sp. Root1312 Isolate Unclassified
79 2643221698 Ensifer sp. Root142 Isolate Unclassified
80 2643221712 Ensifer sp. Root258 Isolate Unclassified
81 2643221719 Rhizobium sp. Root274 Isolate Unclassified
82 2643221723 Ensifer sp. Root278 Isolate Unclassified
83 2643221726 Ensifer sp. Root954 Isolate Unclassified
84 2643221734 Bosea sp. Root670 Isolate Unclassified
85 2643221736 Bosea sp. Root483D1 Isolate Unclassified
86 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
87 2718217882 Rhizobium sp. N741 Isolate Nodule
88 2718217927 Rhizobium sp. N324 Isolate Nodule
89 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
90 2718218009 Rhizobium sp. N561 Isolate Nodule
91 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
92 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
93 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
94 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
95 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
96 2718218363 Rhizobium sp. N113 Isolate Nodule
97 2718218365 Rhizobium sp. N731 Isolate Nodule
98 2718218366 Rhizobium sp. N621 Isolate Nodule
99 2718218423 Rhizobium sp. N941 Isolate Nodule
100 2721755514 Rhizobium sp. N6212 Isolate Nodule
101 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
102 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
103 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
104 2721755809 Rhizobium sp. N541 Isolate Nodule
105 2721755810 Rhizobium sp. N871 Isolate Nodule
106 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
107 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
108 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
109 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
110 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
111 2728369365 Rhizobium sp. N1341 Isolate Nodule
112 2728369397 Rhizobium sp. N1314 Isolate Nodule
113 2738541293 Rhizobium sp. GV031 Isolate Unclassified
114 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
115 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
116 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
117 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
118 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
119 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
120 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
121 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
122 2791355256 Rhizobium sp. M10 Isolate Nodule
123 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
124 2791355260 Rhizobium sp. L9 Isolate Nodule
125 2791355261 Rhizobium sp. J15 Isolate Nodule
126 2791355262 Rhizobium sp. M1 Isolate Nodule
127 2791355263 Rhizobium chutanense C5 Isolate Nodule
128 2791355264 Rhizobium sp. S9 Isolate Nodule
129 2791355265 Rhizobium sp. H4 Isolate Nodule
130 2791355266 Rhizobium sp. L43 Isolate Nodule
131 2791355267 Rhizobium sp. L18 Isolate Nodule
132 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
133 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
134 2802429633 Rhizobium anhuiense J3 Isolate Nodule
135 2802429634 Rhizobium anhuiense S10 Isolate Nodule
136 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
137 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
138 2802429637 Rhizobium anhuiense C15 Isolate Nodule
139 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
140 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
141 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
142 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
143 2818991467 Bosea vestrisii 3192 Isolate Unclassified
144 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
145 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
146 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
147 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
148 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
149 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
150 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
151 2838048938 Rhizobium pisi 27/80 Isolate Nodule
152 2838061910 Rhizobium phaseoli L15 Isolate Nodule
153 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
154 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
155 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
156 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
157 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
158 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
159 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
160 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
161 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
162 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
163 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
164 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
165 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
166 2841760612 Bosea sp. Tri-49 Isolate Nodule
167 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
168 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
169 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
170 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
171 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
172 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
173 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
174 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
175 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
176 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
177 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
178 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
179 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
180 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
181 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
182 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
183 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
184 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
185 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
186 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
187 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
188 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
189 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
190 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
191 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
192 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
193 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
194 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
195 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
196 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
197 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
198 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
199 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
200 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
201 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
202 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
203 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
204 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
205 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
206 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
207 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
208 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
209 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
210 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
211 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
212 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
213 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
214 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
215 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
216 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
217 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
218 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
219 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
220 2844104063 Bosea sp. Tri-39 Isolate Nodule
221 2844163670 Ensifer sp. 1H6 Isolate Unclassified
222 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
223 2851182111 Bosea sp. Tri-44 Isolate Nodule
224 2851246043 Bosea sp. Tri-54 Isolate Nodule
225 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
226 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
227 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
228 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
229 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
230 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
231 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
232 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
233 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
234 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
235 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
236 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
237 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
238 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
239 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
240 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
241 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
242 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
243 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
244 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
245 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
246 2933599457 Rhizobium phaseoli M3 Isolate Nodule
247 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
248 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
249 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
250 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
251 2936381700 Rhizobium chutanense C16 Isolate Unclassified
252 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
253 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
254 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
255 2996887358 Rhizobium sp. R711 Isolate Nodule
256 2996893221 Rhizobium sp. R635 Isolate Nodule
257 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
258 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
259 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
260 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
261 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
262 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
263 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
264 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
265 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
266 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
267 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
268 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
269 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
270 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
271 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
272 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
273 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
274 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
275 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
276 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
277 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
278 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
279 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
280 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
281 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
282 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
283 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
284 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
285 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
286 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
287 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
288 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
289 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
290 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
291 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
292 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
293 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
294 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
295 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
296 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
297 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
298 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
299 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
300 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
301 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
302 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
303 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
304 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
305 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
306 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
307 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
308 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
309 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
310 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
311 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
312 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
313 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
314 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
315 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
316 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
317 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
318 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
319 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
320 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
321 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
322 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
323 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
324 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
325 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
326 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
327 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
328 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
329 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
330 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
331 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
332 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
333 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
334 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
335 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
336 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
337 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
338 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
339 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
340 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
341 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
342 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
343 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
344 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
345 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
348 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
349 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
350 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
352 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
353 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
370 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
371 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
373 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
374 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
375 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
376 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
377 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
378 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
379 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
380 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
381 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
382 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
383 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
384 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
385 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
386 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
387 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
388 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
389 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
390 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
391 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
392 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
393 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
394 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
395 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
396 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
397 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
398 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
399 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
400 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
401 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
402 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
403 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
404 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
405 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
406 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
407 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
408 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
409 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
410 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
411 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
412 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
413 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
414 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
415 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
416 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
417 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
418 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
419 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
420 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
421 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
422 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
423 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
424 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
425 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
426 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
427 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
428 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
429 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
430 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
431 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
432 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
433 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
434 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
435 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
436 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
437 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
438 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
439 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
440 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
441 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
442 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
443 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
444 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
445 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
446 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
447 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
448 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
449 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
450 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
451 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
452 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
453 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
454 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
455 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
456 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
457 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
458 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
459 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
460 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
461 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
462 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
463 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
464 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
465 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
477 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
480 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
481 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
482 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
484 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
488 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
489 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
490 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
491 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
492 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
493 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
494 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
495 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
496 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
497 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
498 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
499 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
500 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
501 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
502 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
503 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
504 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
505 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
506 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
507 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
508 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
509 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
510 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
511 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
512 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
513 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
514 8005258706 Rhizobium sp. R693 Isolate Nodule
515 8005275841 Rhizobium sp. N4311 Isolate Nodule
516 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
517 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
518 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
519 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
520 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
521 8005321885 Rhizobium sp. R72 Isolate Nodule
522 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
523 8005382845 Rhizobium sp. R634 Isolate Nodule
524 8005395548 Rhizobium sp. R339 Isolate Nodule
525 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
526 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
527 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
528 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
529 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
530 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
531 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
532 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
533 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
534 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
535 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
536 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
537 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
538 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
539 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
540 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
541 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
542 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
543 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
544 8018176218 Rhizobium sp. N122 Isolate Nodule
545 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
546 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
547 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
548 8024501048 Rhizobium sp. H4 Isolate Nodule
549 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
550 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
551 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
552 8056382006 Rhizobium croatiense 13T Isolate Nodule
553 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
554 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
555 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
556 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.74
Metatranscriptomes 0
Isolates 36.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.13
Nodule 23.7
Rhizoplane 1.78
Rhizosphere 28.2
Stem 0
Stem Tuber 0
Unclassified 19.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000263 3300001979 Bacteria 22167
2 JGI25155J39150_1000023 3300002704 Bacteria 136961
3 JGI25156J39149_1000094 3300002705 Bacteria 65145
4 JGI25162J39368_1000177 3300002737 Bacteria 68786
5 JGI25162J39368_1000788 3300002737 Bacteria 21288
6 JGI25154J39366_1000213 3300002738 Bacteria 40261
7 JGI25154J39366_1013091 3300002738 Bacteria 899
8 JGI25154J39366_1013929 3300002738 Bacteria 854
9 JGI25158J39367_1000158 3300002739 Bacteria 16044
10 JGI25158J39367_1001611 3300002739 Bacteria 3897
11 JGI25157J39369_1000043 3300002741 Bacteria 122537
12 JGI25152J39213_1001662 3300002773 Bacteria 9230
13 JGI25152J39213_1003959 3300002773 Bacteria 4837
14 JGI25152J39213_1004756 3300002773 Bacteria 4178
15 JGI25152J39213_1012579 3300002773 Bacteria 1805
16 JGI25152J39213_1014458 3300002773 Bacteria 1600
17 JGI25152J39213_1015644 3300002773 Bacteria 1490
18 JGI25150J39212_1000378 3300002774 Bacteria 21367
19 JGI25150J39212_1004689 3300002774 Bacteria 3007
20 JGI25150J39212_1006376 3300002774 Bacteria 2439
21 JGI25150J39212_1010896 3300002774 Bacteria 1670
22 JGI25150J39212_1023141 3300002774 Bacteria 926
23 JGI25159J45721_1000034 3300002987 Bacteria 87743
24 JGI25159J45721_1000489 3300002987 Bacteria 18119
25 JGI25159J45721_1009426 3300002987 Bacteria 2578
26 JGI25151J46595_10000565 3300003187 Bacteria 33453
27 JGI25151J46595_10001463 3300003187 Bacteria 16008
28 JGI25151J46595_10002461 3300003187 Bacteria 11106
29 JGI25151J46595_10006390 3300003187 Bacteria 5925
30 JGI25151J46595_10022314 3300003187 Bacteria 2631
31 JGI25151J46595_10048823 3300003187 Bacteria 1458
32 JGI25151J46595_10062025 3300003187 Bacteria 1186
33 JGI25165J46597_1000415 3300003214 Bacteria 44714
34 JGI25165J46597_1000555 3300003214 Bacteria 34009
35 JGI25165J46597_1003155 3300003214 Bacteria 4374
36 JGI25153J46596_10000833 3300003215 Bacteria 18843
37 JGI25153J46596_10007280 3300003215 Bacteria 5470
38 JGI25153J46596_10010202 3300003215 Bacteria 4271
39 JGI25153J46596_10026027 3300003215 Bacteria 2079
40 JGI25153J46596_10037224 3300003215 Bacteria 1550
41 JGI25153J46596_10037406 3300003215 Bacteria 1543
42 rootH1_10012486 3300003323 Bacteria 7405
43 rootH1_10156603 3300003323 Bacteria 1618
44 JGI25160J50197_1000046 3300003354 Bacteria 141352
45 JGI25160J50197_1000096 3300003354 Bacteria 87743
46 JGI25160J50197_1000703 3300003354 Bacteria 18438
47 JGI25160J50197_1008324 3300003354 Bacteria 3960
48 JGI25160J50197_1029684 3300003354 Bacteria 1440
49 JGI25161J50226_1000031 3300003374 Bacteria 141352
50 JGI25161J50226_1000735 3300003374 Bacteria 12661
51 JGI25161J50226_1001481 3300003374 Bacteria 7029
52 Ga0055526_1002004 3300003771 Bacteria 14027
53 Ga0055526_1004323 3300003771 Bacteria 8579
54 Ga0055526_1004833 3300003771 Bacteria 7955
55 Ga0055526_1016842 3300003771 Bacteria 2830
56 Ga0055524_1001011 3300003775 Bacteria 17415
57 Ga0055524_1003205 3300003775 Bacteria 8026
58 Ga0055524_1006519 3300003775 Bacteria 5053
59 Ga0055524_1007117 3300003775 Bacteria 4792
60 Ga0055524_1018423 3300003775 Bacteria 2425
61 Ga0055536_1012982 3300003781 Bacteria 3041
62 Ga0055528_1000146 3300003790 Bacteria 57915
63 Ga0055528_1000636 3300003790 Bacteria 25725
64 Ga0055528_1002006 3300003790 Bacteria 11423
65 Ga0055528_1006732 3300003790 Bacteria 5175
66 Ga0055528_1011522 3300003790 Bacteria 3502
67 Ga0055528_1017754 3300003790 Bacteria 2449
68 Ga0055530_10037531 3300003791 Bacteria 1211
69 Ga0055540_1000111 3300003792 Bacteria 88263
70 Ga0055540_1008488 3300003792 Bacteria 3693
71 Ga0055540_1008672 3300003792 Bacteria 3627
72 Ga0055540_1017841 3300003792 Bacteria 1966
73 Ga0055540_1021187 3300003792 Bacteria 1696
74 Ga0055540_1024277 3300003792 Bacteria 1507
75 Ga0055531_10009694 3300003794 Bacteria 4895
76 Ga0055531_10012435 3300003794 Bacteria 4005
77 Ga0055531_10014881 3300003794 Bacteria 3474
78 Ga0055543_1000208 3300004625 Bacteria 47499
79 Ga0055543_1000402 3300004625 Bacteria 27634
80 Ga0055543_1000637 3300004625 Bacteria 18741
81 Ga0055543_1003374 3300004625 Bacteria 4751
82 Ga0055543_1006055 3300004625 Bacteria 2987
83 Ga0065165_1000389 3300005262 Bacteria 71369
84 Ga0065165_1000468 3300005262 Bacteria 63190
85 Ga0065165_1000693 3300005262 Bacteria 48076
86 Ga0065165_1003090 3300005262 Bacteria 12404
87 Ga0065165_1008980 3300005262 Bacteria 4569
88 Ga0065165_1010930 3300005262 Bacteria 3856
89 Ga0065165_1028682 3300005262 Bacteria 1794
90 Ga0070670_100000173 3300005331 Bacteria 58127
91 Ga0070666_10107996 3300005335 Bacteria 1923
92 Ga0070682_100181413 3300005337 Bacteria 1471
93 Ga0070668_100093172 3300005347 Bacteria 2377
94 Ga0070669_100624789 3300005353 Bacteria 904
95 Ga0070671_100012822 3300005355 Bacteria 6758
96 Ga0070671_100357284 3300005355 Bacteria 1247
97 Ga0070667_100146697 3300005367 Bacteria 2070
98 Ga0070663_100067648 3300005455 Bacteria 2592
99 Ga0068853_100255608 3300005539 Bacteria 1609
100 Ga0070665_100018373 3300005548 Bacteria 7008
101 Ga0070665_100060832 3300005548 Bacteria 3786
102 Ga0068855_100345760 3300005563 Bacteria 1639
103 Ga0068856_100083561 3300005614 Bacteria 3171
104 Ga0068856_100135663 3300005614 Bacteria 2466
105 Ga0068852_100080225 3300005616 Bacteria 2892
106 Ga0068863_100510787 3300005841 Bacteria 1184
107 Ga0075365_10009533 3300006038 Bacteria 5590
108 Ga0075365_10012660 3300006038 Bacteria 5019
109 Ga0075365_10033219 3300006038 Bacteria 3323
110 Ga0075365_10273664 3300006038 Bacteria 1188
111 Ga0075363_100286759 3300006048 Bacteria 954
112 Ga0075364_10000875 3300006051 Bacteria 15886
113 Ga0075362_10068711 3300006177 Bacteria 1614
114 Ga0075369_10002530 3300006186 Bacteria 6541
115 Ga0075369_10009993 3300006186 Bacteria 3705
116 Ga0075366_10011977 3300006195 Bacteria 4911
117 Ga0075366_10432235 3300006195 Bacteria 812
118 Ga0075370_10021085 3300006353 Bacteria 3569
119 Ga0075370_10023191 3300006353 Bacteria 3416
120 Ga0079104_1000069 3300006946 Bacteria 153993
121 Ga0105251_10010923 3300009011 Bacteria 5225
122 Ga0105250_10030703 3300009092 Bacteria 2160
123 Ga0105240_10006772 3300009093 Bacteria 16763
124 Ga0105247_10206393 3300009101 Bacteria 1323
125 Ga0105243_10044233 3300009148 Bacteria 3493
126 Ga0105243_10162016 3300009148 Bacteria 1930
127 Ga0105248_10005517 3300009177 Bacteria 13892
128 Ga0105237_10010394 3300009545 Bacteria 9906
129 Ga0105237_10283757 3300009545 Bacteria 1658
130 Ga0123340_1057202 3300009763 Bacteria 1224
131 Ga0123341_1000452 3300009765 Bacteria 24837
132 Ga0123341_1082950 3300009765 Bacteria 1233
133 Ga0123341_1083348 3300009765 Bacteria 1226
134 Ga0123342_1014969 3300009766 Bacteria 7225
135 Ga0123342_1029957 3300009766 Bacteria 2778
136 Ga0105239_10012926 3300010375 Bacteria 9287
137 Ga0157322_1003048 3300012490 Bacteria 997
138 Ga0157314_1004303 3300012500 Bacteria 1043
139 Ga0157373_10017343 3300013100 Bacteria 5243
140 Ga0157373_10087897 3300013100 Bacteria 2190
141 Ga0157370_10003911 3300013104 Bacteria 17347
142 Ga0157369_10127636 3300013105 Bacteria 2696
143 Ga0157369_10137547 3300013105 Bacteria 2585
144 Ga0171463_1008 3300013249 Bacteria 299022
145 Ga0163162_10400123 3300013306 Bacteria 1506
146 Ga0163163_10401145 3300014325 Bacteria 1429
147 Ga0157379_10457298 3300014968 Bacteria 1179
148 Ga0182005_1003486 3300015265 Bacteria 5320
149 Ga0183363_1335 3300015690 Bacteria 5852
150 Ga0209435_100011 3300025206 Bacteria 413027
151 Ga0209436_100077 3300025208 Bacteria 49473
152 Ga0209436_100305 3300025208 Bacteria 22585
153 Ga0209437_100036 3300025233 Bacteria 469153
154 Ga0209437_100086 3300025233 Bacteria 254578
155 Ga0207425_1000012 3300025245 Bacteria 528324
156 Ga0207425_1008931 3300025245 Bacteria 2525
157 Ga0207425_1010568 3300025245 Bacteria 2239
158 Ga0207425_1017543 3300025245 Bacteria 1570
159 Ga0209646_1000024 3300025246 Bacteria 413027
160 Ga0209646_1006810 3300025246 Bacteria 1900
161 Ga0209646_1009330 3300025246 Bacteria 1559
162 Ga0209026_1000030 3300025250 Bacteria 329811
163 Ga0209677_100267 3300025253 Bacteria 35499
164 Ga0209759_1000011 3300025256 Bacteria 413027
165 Ga0209759_1025982 3300025256 Bacteria 1236
166 Ga0209129_1000086 3300025258 Bacteria 181543
167 Ga0209129_1000123 3300025258 Bacteria 133661
168 Ga0209129_1000316 3300025258 Bacteria 42919
169 Ga0209129_1000472 3300025258 Bacteria 29524
170 Ga0209129_1000633 3300025258 Bacteria 23502
171 Ga0209129_1000710 3300025258 Bacteria 21515
172 Ga0209129_1006698 3300025258 Bacteria 3643
173 Ga0209233_1000110 3300025261 Bacteria 260825
174 Ga0209233_1000166 3300025261 Bacteria 152270
175 Ga0209233_1000350 3300025261 Bacteria 43454
176 Ga0209565_1031971 3300025263 Bacteria 1020
177 Ga0209455_1008242 3300025272 Bacteria 2850
178 Ga0209673_1000015 3300025273 Bacteria 530618
179 Ga0209673_1000091 3300025273 Bacteria 201875
180 Ga0209673_1000919 3300025273 Bacteria 37355
181 Ga0209673_1002462 3300025273 Bacteria 12800
182 Ga0209673_1002974 3300025273 Bacteria 10578
183 Ga0209673_1004455 3300025273 Bacteria 7495
184 Ga0209130_1000015 3300025284 Bacteria 409631
185 Ga0209130_1000182 3300025284 Bacteria 89233
186 Ga0209130_1000185 3300025284 Bacteria 87796
187 Ga0209130_1000312 3300025284 Bacteria 57303
188 Ga0209675_1030297 3300025291 Bacteria 1292
189 Ga0209676_1008100 3300025292 Bacteria 4767
190 Ga0209676_1009574 3300025292 Bacteria 4165
191 Ga0209676_1010076 3300025292 Bacteria 3987
192 Ga0209676_1012133 3300025292 Bacteria 3415
193 Ga0209676_1028044 3300025292 Bacteria 1761
194 Ga0209676_1031387 3300025292 Bacteria 1611
195 Ga0209676_1037030 3300025292 Bacteria 1412
196 Ga0209025_1000024 3300025294 Bacteria 528324
197 Ga0209025_1000033 3300025294 Bacteria 414511
198 Ga0209025_1000407 3300025294 Bacteria 87041
199 Ga0209025_1001232 3300025294 Bacteria 35695
200 Ga0209025_1002342 3300025294 Bacteria 20420
201 Ga0209025_1010470 3300025294 Bacteria 6279
202 Ga0209025_1014042 3300025294 Bacteria 4973
203 Ga0209025_1015556 3300025294 Bacteria 4575
204 Ga0209025_1018388 3300025294 Bacteria 3964
205 Ga0209025_1035721 3300025294 Bacteria 2239
206 Ga0209025_1050259 3300025294 Bacteria 1669
207 Ga0209564_1000152 3300025295 Bacteria 167572
208 Ga0209564_1000845 3300025295 Bacteria 41202
209 Ga0209564_1001802 3300025295 Bacteria 19770
210 Ga0209564_1002399 3300025295 Bacteria 14953
211 Ga0209564_1009840 3300025295 Bacteria 4486
212 Ga0209564_1013227 3300025295 Bacteria 3525
213 Ga0209564_1030461 3300025295 Bacteria 1671
214 Ga0209758_1000046 3300025297 Bacteria 364931
215 Ga0209758_1000336 3300025297 Bacteria 87439
216 Ga0209758_1000602 3300025297 Bacteria 55848
217 Ga0209758_1000877 3300025297 Bacteria 41329
218 Ga0209758_1004509 3300025297 Bacteria 11543
219 Ga0209758_1013040 3300025297 Bacteria 4575
220 Ga0209758_1019376 3300025297 Bacteria 3282
221 Ga0209758_1023591 3300025297 Bacteria 2776
222 Ga0209758_1060159 3300025297 Bacteria 1259
223 Ga0209050_1004756 3300025298 Bacteria 8971
224 Ga0209050_1009663 3300025298 Bacteria 4893
225 Ga0209050_1016427 3300025298 Bacteria 3029
226 Ga0209256_1000188 3300025299 Bacteria 117988
227 Ga0209256_1000218 3300025299 Bacteria 106228
228 Ga0209256_1000531 3300025299 Bacteria 55283
229 Ga0209256_1000759 3300025299 Bacteria 41913
230 Ga0209256_1002589 3300025299 Bacteria 14402
231 Ga0209256_1004329 3300025299 Bacteria 9015
232 Ga0209256_1006233 3300025299 Bacteria 6422
233 Ga0209256_1016158 3300025299 Bacteria 2562
234 Ga0207426_1000012 3300025302 Bacteria 730942
235 Ga0207426_1000063 3300025302 Bacteria 358920
236 Ga0207426_1000144 3300025302 Bacteria 191590
237 Ga0207426_1000340 3300025302 Bacteria 87796
238 Ga0207426_1004140 3300025302 Bacteria 7272
239 Ga0207426_1023549 3300025302 Bacteria 2099
240 Ga0209051_1000084 3300025303 Bacteria 190324
241 Ga0209051_1001336 3300025303 Bacteria 21465
242 Ga0209051_1004188 3300025303 Bacteria 9003
243 Ga0209051_1005881 3300025303 Bacteria 7046
244 Ga0209051_1009489 3300025303 Bacteria 5011
245 Ga0209051_1016530 3300025303 Bacteria 3331
246 Ga0209051_1055965 3300025303 Bacteria 1276
247 Ga0209257_1009030 3300025304 Bacteria 5463
248 Ga0209257_1009036 3300025304 Bacteria 5459
249 Ga0209257_1009123 3300025304 Bacteria 5411
250 Ga0209257_1015380 3300025304 Bacteria 3189
251 Ga0209257_1036948 3300025304 Bacteria 1495
252 Ga0209257_1044544 3300025304 Bacteria 1294
253 Ga0207713_1032483 3300025735 Bacteria 2291
254 Ga0207695_10005499 3300025913 Bacteria 16771
255 Ga0207671_10000176 3300025914 Bacteria 98289
256 Ga0207681_10196225 3300025923 Bacteria 1547
257 Ga0207681_10358434 3300025923 Bacteria 1169
258 Ga0207650_10016150 3300025925 Bacteria 5213
259 Ga0207709_10173314 3300025935 Bacteria 1516
260 Ga0207711_10199320 3300025941 Bacteria 1826
261 Ga0207667_10278046 3300025949 Bacteria 1711
262 Ga0207668_10086867 3300025972 Bacteria 2286
263 Ga0207640_10083001 3300025981 Bacteria 2196
264 Ga0207639_10267885 3300026041 Bacteria 1497
265 Ga0207678_10045153 3300026067 Bacteria 3810
266 Ga0207702_10331923 3300026078 Bacteria 1451
267 Ga0207702_10869565 3300026078 Bacteria 893
268 Ga0207698_10067092 3300026142 Bacteria 2828
269 Ga0207698_10689472 3300026142 Bacteria 1015
270 Ga0209281_1000192 3300027111 Bacteria 140252
271 Ga0209371_1002637 3300027312 Bacteria 9803
272 Ga0268266_10059328 3300028379 Bacteria 3297
273 Ga0268266_10081975 3300028379 Bacteria 2813
274 Ga0307515_10077394 3300028794 Bacteria 4394
275 Ga0268256_1002270 3300030500 Bacteria 10014
276 Ga0307513_10106022 3300031456 Bacteria 2818
277 Ga0307513_10167532 3300031456 Bacteria 2079
278 Ga0307405_10002585 3300031731 Bacteria 8026
279 Ga0307413_10482056 3300031824 Bacteria 992
280 Ga0307406_10001781 3300031901 Bacteria 11773
281 Ga0307406_10207269 3300031901 Bacteria 1448
282 Ga0307412_10001828 3300031911 Bacteria 11789
283 Ga0237816_01952 3300039145 Bacteria 1632
284 Ga0436360_1375654 3300039438 Bacteria 2090
285 Ga0436361_0616510 3300039447 Bacteria 1013
286 Ga0436363_0887411 3300039450 Bacteria 1624
287 Ga0439436_0039178 3300041404 Bacteria 1362
288 Ga0439438_042655 3300041405 Bacteria 1173
289 Ga0439465_0034291 3300041413 Bacteria 1625
290 Ga0439465_0039202 3300041413 Bacteria 1529
291 Ga0451787_682831 3300041441 Bacteria 2052
292 Ga0451833_1012096 3300041491 Bacteria 2187
293 Ga0451837_0259953 3300041494 Bacteria 2028
294 Ga0451841_1019185 3300041498 Bacteria 1542
295 Ga0451845_0396315 3300041501 Bacteria 1568
296 Ga0451847_0124849 3300041503 Bacteria 3817
297 Ga0451849_0241149 3300041505 Bacteria 1363
298 Ga0451855_0112266 3300041511 Bacteria 3124
299 Ga0451855_1309579 3300041511 Bacteria 1578
300 Ga0439449_0015161 3300042007 Bacteria 2896
301 Ga0466965_0082582 3300044683 Bacteria 1626
302 Ga0466966_0021690 3300044684 Bacteria 4216
303 Ga0466966_0082022 3300044684 Bacteria 2007
304 Ga0466970_0003121 3300044765 Bacteria 8047
305 Ga0466957_0064581 3300044842 Bacteria 2252
306 Ga0466958_0020796 3300045836 Bacteria 3830
307 Ga0495617_014356 3300046452 Bacteria 2693
308 Ga0495592_0050931 3300046454 Bacteria 3076
309 Ga0495629_0391167 3300046459 Bacteria 945
310 Ga0495638_0000299 3300046460 Bacteria 63971
311 Ga0495638_0127301 3300046460 Bacteria 1500
312 Ga0495605_0003759 3300046474 Bacteria 9007
313 Ga0495605_0050626 3300046474 Bacteria 2026
314 Ga0495605_0109147 3300046474 Bacteria 1264
315 Ga0495662_0027480 3300046476 Bacteria 2748
316 Ga0495584_0125661 3300046491 Bacteria 1300
317 Ga0495585_0023818 3300046492 Bacteria 3513
318 Ga0495585_0095321 3300046492 Bacteria 1598
319 Ga0495607_0027801 3300046501 Bacteria 3494
320 Ga0495607_0103965 3300046501 Bacteria 1516
321 Ga0495583_0001834 3300046506 Bacteria 19816
322 Ga0495583_0028985 3300046506 Bacteria 2714
323 Ga0495606_0004205 3300046507 Bacteria 14567
324 Ga0495606_0061334 3300046507 Bacteria 2405
325 Ga0495606_0070080 3300046507 Bacteria 2213
326 Ga0495606_0133784 3300046507 Bacteria 1471
327 Ga0495610_0003518 3300046512 Bacteria 12149
328 Ga0495610_0108342 3300046512 Bacteria 1234
329 Ga0495610_0137584 3300046512 Bacteria 1054
330 Ga0495616_0014369 3300046513 Bacteria 4434
331 Ga0495616_0082853 3300046513 Bacteria 1531
332 Ga0495620_0026849 3300046515 Bacteria 2702
333 Ga0495620_0041911 3300046515 Bacteria 2004
334 Ga0495620_0052126 3300046515 Bacteria 1739
335 Ga0495628_0225948 3300046516 Bacteria 1404
336 Ga0495631_0003621 3300046518 Bacteria 8427
337 Ga0495631_0090134 3300046518 Bacteria 1320
338 Ga0495631_0138793 3300046518 Bacteria 1044
339 Ga0495632_0001582 3300046519 Bacteria 18768
340 Ga0495632_0035888 3300046519 Bacteria 2525
341 Ga0495637_0098017 3300046520 Bacteria 1149
342 Ga0495637_0180455 3300046520 Bacteria 783
343 Ga0495643_0036604 3300046522 Bacteria 2695
344 Ga0495643_0075030 3300046522 Bacteria 1770
345 Ga0495643_0081163 3300046522 Bacteria 1687
346 Ga0495648_0204325 3300046524 Bacteria 986
347 Ga0495654_0002878 3300046530 Bacteria 10802
348 Ga0495609_0010561 3300046538 Bacteria 4425
349 Ga0495609_0022699 3300046538 Bacteria 2891
350 Ga0495597_0024726 3300046542 Bacteria 2770
351 Ga0495633_0045729 3300046558 Bacteria 2072
352 Ga0495633_0214659 3300046558 Bacteria 881
353 Ga0495656_0019612 3300046615 Bacteria 2612
354 Ga0495668_0007244 3300046616 Bacteria 7117
355 Ga0495634_0077167 3300046642 Bacteria 2186
356 Ga0495611_0015546 3300046648 Bacteria 3253
357 Ga0495625_0004364 3300046660 Bacteria 13428
358 Ga0495625_0044036 3300046660 Bacteria 3233
359 Ga0495625_0205281 3300046660 Bacteria 1298
360 Ga0495625_0409653 3300046660 Bacteria 845
361 Ga0495661_0142024 3300046665 Bacteria 1305
362 Ga0495588_0100587 3300046674 Bacteria 1519
363 Ga0495624_0081841 3300046690 Bacteria 1999
364 Ga0495671_0139155 3300046692 Bacteria 1183
365 Ga0495649_0025304 3300046694 Bacteria 3306
366 Ga0495649_0157157 3300046694 Bacteria 1193
367 Ga0495600_0070820 3300046809 Bacteria 2278
368 Ga0495660_0028650 3300046810 Bacteria 3144
369 Ga0495604_0020147 3300047317 Bacteria 5329
370 Ga0495636_0010645 3300047318 Bacteria 3635
371 Ga0495672_0015932 3300047320 Bacteria 5089
372 Ga0495683_0017508 3300047323 Bacteria 3714
373 Ga0495687_057508 3300047443 Bacteria 1617
374 Ga0495687_125710 3300047443 Bacteria 917
375 Ga0495685_052846 3300047447 Bacteria 1376
376 Ga0495681_0092572 3300047470 Bacteria 1332
377 Ga0495686_0000688 3300047472 Bacteria 45757
378 Ga0495686_0007326 3300047472 Bacteria 8281
379 Ga0495686_0019662 3300047472 Bacteria 4510
380 Ga0495686_0066988 3300047472 Bacteria 2217
381 Ga0495686_0231443 3300047472 Bacteria 1046
382 Ga0495686_0289687 3300047472 Bacteria 907
383 Ga0495686_0341145 3300047472 Bacteria 817
384 Ga0495615_0006719 3300048090 Bacteria 2149
385 Ga0496101_0166779 3300048904 Bacteria 1691
386 Ga0496102_0006951 3300048905 Bacteria 9655
387 Ga0496103_0006250 3300048906 Bacteria 7119
388 Ga0496106_0007956 3300048909 Bacteria 7835
389 Ga0496106_0073382 3300048909 Bacteria 2618
390 Ga0496110_0170901 3300048913 Bacteria 1972
391 Ga0496111_0003317 3300048914 Bacteria 9952
392 Ga0496113_0047872 3300048916 Bacteria 3179
393 Ga0496113_0379103 3300048916 Bacteria 1135
394 Ga0496116_0019214 3300048919 Bacteria 5238
395 Ga0496116_0026581 3300048919 Bacteria 4229
396 Ga0496116_0042281 3300048919 Bacteria 3117
397 Ga0496116_0074978 3300048919 Bacteria 2125
398 Ga0496116_0081922 3300048919 Bacteria 1998
399 Ga0496116_0176274 3300048919 Bacteria 1151
400 Ga0496117_0004211 3300048920 Bacteria 16063
401 Ga0496117_0007443 3300048920 Bacteria 10695
402 Ga0496117_0019788 3300048920 Bacteria 5516
403 Ga0496117_0039979 3300048920 Bacteria 3456
404 Ga0496117_0101682 3300048920 Bacteria 1816
405 Ga0496117_0160544 3300048920 Bacteria 1317
406 Ga0496118_0008854 3300048921 Bacteria 10298
407 Ga0496118_0009023 3300048921 Bacteria 10169
408 Ga0496118_0016254 3300048921 Bacteria 6835
409 Ga0496118_0022988 3300048921 Bacteria 5429
410 Ga0496119_0011852 3300048922 Bacteria 7158
411 Ga0496119_0016635 3300048922 Bacteria 5582
412 Ga0496120_0003587 3300048923 Bacteria 13945
413 Ga0496120_0108845 3300048923 Bacteria 1451
414 Ga0496121_0000581 3300048924 Bacteria 68614
415 Ga0496121_0005515 3300048924 Bacteria 16164
416 Ga0496121_0006088 3300048924 Bacteria 15178
417 Ga0496121_0009856 3300048924 Bacteria 10901
418 Ga0496121_0035493 3300048924 Bacteria 4468
419 Ga0496121_0048431 3300048924 Bacteria 3615
420 Ga0496121_0053577 3300048924 Bacteria 3378
421 Ga0496121_0072341 3300048924 Bacteria 2768
422 Ga0496121_0126312 3300048924 Bacteria 1922
423 Ga0496121_0213114 3300048924 Bacteria 1367
424 Ga0496121_0300078 3300048924 Bacteria 1090
425 Ga0496122_0000009 3300048925 Bacteria 584024
426 Ga0496122_0010110 3300048925 Bacteria 9790
427 Ga0496122_0018408 3300048925 Bacteria 6456
428 Ga0496122_0021974 3300048925 Bacteria 5687
429 Ga0496122_0026276 3300048925 Bacteria 5023
430 Ga0496122_0033043 3300048925 Bacteria 4263
431 Ga0496122_0039858 3300048925 Bacteria 3740
432 Ga0496122_0041423 3300048925 Bacteria 3641
433 Ga0496122_0049563 3300048925 Bacteria 3213
434 Ga0496122_0073942 3300048925 Bacteria 2413
435 Ga0496123_0000020 3300048926 Bacteria 388748
436 Ga0496123_0005995 3300048926 Bacteria 11950
437 Ga0496123_0007612 3300048926 Bacteria 10141
438 Ga0496123_0013530 3300048926 Bacteria 6834
439 Ga0496123_0025599 3300048926 Bacteria 4444
440 Ga0496123_0026213 3300048926 Bacteria 4374
441 Ga0496123_0042850 3300048926 Bacteria 3117
442 Ga0496123_0081438 3300048926 Bacteria 1967
443 Ga0496123_0164043 3300048926 Bacteria 1181
444 Ga0496123_0182720 3300048926 Bacteria 1093
445 Ga0496124_0004941 3300048927 Bacteria 15282
446 Ga0496124_0015396 3300048927 Bacteria 7331
447 Ga0496124_0035902 3300048927 Bacteria 4331
448 Ga0496124_0038092 3300048927 Bacteria 4177
449 Ga0496124_0047300 3300048927 Bacteria 3681
450 Ga0496124_0050244 3300048927 Bacteria 3554
451 Ga0496124_0062089 3300048927 Bacteria 3128
452 Ga0496124_0068333 3300048927 Bacteria 2953
453 Ga0496124_0174779 3300048927 Bacteria 1659
454 Ga0496124_0257429 3300048927 Bacteria 1287
455 Ga0496125_0002192 3300048928 Bacteria 26081
456 Ga0496125_0009453 3300048928 Bacteria 10011
457 Ga0496126_0017025 3300048929 Bacteria 7252
458 Ga0496126_0104013 3300048929 Bacteria 2481
459 Ga0496126_0176292 3300048929 Bacteria 1818
460 Ga0496126_0222981 3300048929 Bacteria 1582
461 Ga0495678_008193 3300049459 Bacteria 5305
462 Ga0495678_008483 3300049459 Bacteria 5178
463 Ga0495678_070657 3300049459 Bacteria 1281
464 Ga0495682_0051415 3300049460 Bacteria 1499
465 Ga0501031_0029846 3300049568 Bacteria 3557
466 Ga0501032_0082367 3300049569 Bacteria 2141
467 Ga0501032_0098084 3300049569 Bacteria 1942
468 Ga0501033_0000986 3300049570 Bacteria 25898
469 Ga0501034_0009938 3300049571 Bacteria 9945
470 Ga0501034_0033123 3300049571 Bacteria 5245
471 Ga0501034_0108890 3300049571 Bacteria 2762
472 Ga0501034_0365055 3300049571 Bacteria 1370
473 Ga0501036_0086253 3300049572 Bacteria 2654
474 Ga0501038_0311247 3300049574 Bacteria 1234
475 Ga0501039_0102104 3300049575 Bacteria 2238
476 Ga0501043_0295347 3300049579 Bacteria 1239
477 Ga0501046_0206111 3300049580 Bacteria 1461
478 Ga0501047_0204311 3300049581 Bacteria 1835
479 Ga0501048_0194381 3300049582 Bacteria 1438
480 Ga0501067_0000688 3300049583 Bacteria 18195
481 Ga0501067_0056919 3300049583 Bacteria 2166
482 Ga0501068_0079644 3300049584 Bacteria 2009
483 Ga0501073_0012900 3300049589 Bacteria 6092
484 Ga0501073_0028289 3300049589 Bacteria 4006
485 Ga0501073_0228449 3300049589 Bacteria 1286
486 Ga0501073_0279246 3300049589 Bacteria 1152
487 Ga0501080_0013741 3300049742 Bacteria 7454
488 Ga0501080_0098860 3300049742 Bacteria 2708
489 Ga0501083_0004419 3300049744 Bacteria 9919
490 Ga0501083_0007506 3300049744 Bacteria 7725
491 Ga0501280_001569 3300049776 Bacteria 4123
492 Ga0501035_0001767 3300049822 Bacteria 21812
493 Ga0501035_0203277 3300049822 Bacteria 1698
494 Ga0501044_0074123 3300049823 Bacteria 3459
495 nmdc:mga03683_59285_c1 3300050489 Bacteria 1614
496 nmdc:mga00v17_133_c2 3300050491 Bacteria 35968
497 nmdc:mga00v17_227463_c1 3300050491 Bacteria 1208
498 nmdc:mga0yw44_12807_c1 3300050492 Bacteria 4387
499 nmdc:mga0yw44_38792_c1 3300050492 Bacteria 2821
500 nmdc:mga0k408_54169_c1 3300050493 Bacteria 2325
501 nmdc:mga06z11_64413_c1 3300050494 Bacteria 1921
502 nmdc:mga07m45_131759_c1 3300050496 Bacteria 1446
503 nmdc:mga0sz30_68451_c1 3300050516 Bacteria 1525
504 Ga0500610_0051524 3300053079 Bacteria 2144
505 Ga0500578_0108565 3300053086 Bacteria 1750
506 Ga0500646_0060954 3300053090 Bacteria 1111
507 Ga0500650_0049985 3300053098 Bacteria 1941
508 Ga0500556_0051888 3300053104 Bacteria 1487
509 Ga0500557_019144 3300053105 Bacteria 1923
510 Ga0500569_003997 3300053109 Bacteria 3064
511 Ga0500594_0001496 3300053118 Bacteria 5082
512 Ga0500594_0016853 3300053118 Bacteria 1781
513 Ga0500607_163219 3300053121 Bacteria 1015
514 Ga0500618_000046 3300053125 Bacteria 109891
515 Ga0500618_007646 3300053125 Bacteria 3066
516 Ga0500618_013097 3300053125 Bacteria 2153
517 Ga0500618_013268 3300053125 Bacteria 2134
518 Ga0500618_017561 3300053125 Bacteria 1778
519 Ga0500658_0000767 3300053134 Bacteria 13217
520 Ga0500658_0038470 3300053134 Bacteria 1907
521 Ga0500568_0000108 3300053139 Bacteria 77013
522 Ga0500568_0002150 3300053139 Bacteria 11883
523 Ga0500568_0014071 3300053139 Bacteria 3625
524 Ga0500573_0001555 3300053140 Bacteria 11071
525 Ga0500577_0066311 3300053142 Bacteria 1404
526 Ga0500577_0166121 3300053142 Bacteria 942
527 Ga0500590_000222 3300053148 Bacteria 17111
528 Ga0500616_0001019 3300053153 Bacteria 29833
529 Ga0500616_0009546 3300053153 Bacteria 5896
530 Ga0500616_0155131 3300053153 Bacteria 1055
531 Ga0500622_0000653 3300053156 Bacteria 30881
532 Ga0500622_0066099 3300053156 Bacteria 1836
533 Ga0500633_0018749 3300053160 Bacteria 2056
534 Ga0500633_0054053 3300053160 Bacteria 1395
535 Ga0501084_0010280 3300054114 Bacteria 7742
536 Ga0501082_0004072 3300060353 Bacteria 12754
537 Ga0501082_0040155 3300060353 Bacteria 4037
538 Ga0466962_0161745 3300061719 Bacteria 1088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002738 JGI25154J39366_1013091 JGI25154J39366_10130912 226
2 iso_pu_bacteria 2889790730 2889794269 227
3 iso_pu_bacteria 2889914905 2889916772 227
4 iso_pu_bacteria 2894817345 2894821591 227
5 iso_pu_bacteria 2510917026 2511175364 228
6 iso_pu_bacteria 2585427633 2585994506 228
7 iso_pu_bacteria 2585427634 2585998953 228
8 iso_pu_bacteria 2599185236 2599719492 228
9 iso_pu_bacteria 2600254933 2600374781 228
10 iso_pu_bacteria 2643221653 2644297495 228
11 iso_pu_bacteria 2643221719 2644655748 228
12 iso_pu_bacteria 2643221734 2644733656 228
13 iso_pu_bacteria 2643221736 2644742118 228
14 iso_pu_bacteria 2818991461 2819684636 228
15 iso_pu_bacteria 2818991467 2819717078 228
16 iso_pu_bacteria 2821123053 2821123703 228
17 iso_pu_bacteria 2838736955 2838739266 228
18 iso_pu_bacteria 2841840854 2841843164 228
19 iso_pu_bacteria 2842140634 2842142946 228
20 iso_pu_bacteria 2851182111 2851182780 228
21 iso_pu_bacteria 2854896431 2854898356 228
22 iso_pu_bacteria 2854916844 2854919069 228
23 iso_pu_bacteria 2857531043 2857531265 228
24 iso_pu_bacteria 2917554339 2917554680 228
25 iso_pu_bacteria 2917699015 2917701427 228
26 iso_pu_bacteria 2919171160 2919171998 228
27 iso_pu_bacteria 8045864390 8045867261 228
28 iso_pu_bacteria 8056875544 8056879205 228
29 iso_pu_bacteria 2511231027 2511390098 229
30 iso_pu_bacteria 2558860983 2561467365 229
31 iso_pu_bacteria 2599185352 2600192490 229
32 iso_pu_bacteria 2643221557 2643808651 229
33 iso_pu_bacteria 2643221610 2644066327 229
34 iso_pu_bacteria 2643221618 2644109354 229
35 iso_pu_bacteria 2643221626 2644149957 229
36 iso_pu_bacteria 2643221655 2644307619 229
37 iso_pu_bacteria 2643221659 2644332394 229
38 iso_pu_bacteria 2643221668 2644377879 229
39 iso_pu_bacteria 2643221675 2644415460 229
40 iso_pu_bacteria 2643221680 2644450138 229
41 iso_pu_bacteria 2643221698 2644544128 229
42 iso_pu_bacteria 2643221712 2644613708 229
43 iso_pu_bacteria 2643221723 2644678067 229
44 iso_pu_bacteria 2643221726 2644687695 229
45 iso_pu_bacteria 2738541317 2738945652 229
46 iso_pu_bacteria 2775506902 2776270476 229
47 iso_pu_bacteria 2775506904 2776281605 229
48 iso_pu_bacteria 2837651117 2837653283 229
49 iso_pu_bacteria 2839993093 2839997451 229
50 iso_pu_bacteria 2840764183 2840768923 229
51 iso_pu_bacteria 2842871566 2842872088 229
52 iso_pu_bacteria 2844163670 2844167239 229
53 iso_pu_bacteria 2913308742 2913310669 229
54 iso_pu_bacteria 2920822456 2920824404 229
55 iso_pu_bacteria 2928521798 2928524026 229
56 iso_pu_bacteria 2941499720 2941505088 229
57 iso_pu_bacteria 2954011201 2954012971 229
58 iso_pu_bacteria 8005658619 8005661833 229
59 iso_pu_bacteria 8024486573 8024491360 229
60 iso_pu_bacteria 2509276021 2509388340 230
61 iso_pu_bacteria 2509276033 2509443904 230
62 iso_pu_bacteria 2510065019 2510131549 230
63 iso_pu_bacteria 2510461069 2510843118 230
64 iso_pu_bacteria 2510461076 2510897855 230
65 iso_pu_bacteria 2510917022 2511136218 230
66 iso_pu_bacteria 2510917028 2511185619 230
67 iso_pu_bacteria 2510917030 2511194414 230
68 iso_pu_bacteria 2513237084 2513571139 230
69 iso_pu_bacteria 2513237085 2513579316 230
70 iso_pu_bacteria 2513237088 2513596791 230
71 iso_pu_bacteria 2513237093 2513632232 230
72 iso_pu_bacteria 2513237103 2513713282 230
73 iso_pu_bacteria 2513237138 2513870285 230
74 iso_pu_bacteria 2513237144 2513910431 230
75 iso_pu_bacteria 2513237146 2513928383 230
76 iso_pu_bacteria 2513237162 2514020939 230
77 iso_pu_bacteria 2515075009 2515110482 230
78 iso_pu_bacteria 2515154113 2515636916 230
79 iso_pu_bacteria 2515154114 2515647121 230
80 iso_pu_bacteria 2515154116 2515659533 230
81 iso_pu_bacteria 2515154134 2515743006 230
82 iso_pu_bacteria 2516653077 2517039183 230
83 iso_pu_bacteria 2516653085 2517079429 230
84 iso_pu_bacteria 2517093000 2517093373 230
85 iso_pu_bacteria 2517287029 2517409599 230
86 iso_pu_bacteria 2519899620 2520380020 230
87 iso_pu_bacteria 2529292951 2530647724 230
88 iso_pu_bacteria 2534681796 2535515163 230
89 iso_pu_bacteria 2582581294 2585203741 230
90 iso_pu_bacteria 2582581298 2585227530 230
91 iso_pu_bacteria 2582581299 2585229055 230
92 iso_pu_bacteria 2582581304 2585259509 230
93 iso_pu_bacteria 2582581307 2585275381 230
94 iso_pu_bacteria 2582581308 2585283442 230
95 iso_pu_bacteria 2582581315 2585325913 230
96 iso_pu_bacteria 2582581316 2585330084 230
97 iso_pu_bacteria 2582581867 2585398482 230
98 iso_pu_bacteria 2585427526 2585528386 230
99 iso_pu_bacteria 2585427527 2585536382 230
100 iso_pu_bacteria 2585427528 2585539777 230
101 iso_pu_bacteria 2585427529 2585550963 230
102 iso_pu_bacteria 2585427530 2585556947 230
103 iso_pu_bacteria 2585427531 2585560176 230
104 iso_pu_bacteria 2585427590 2585819371 230
105 iso_pu_bacteria 2585427593 2585837760 230
106 iso_pu_bacteria 2585427594 2585844586 230
107 iso_pu_bacteria 2585427608 2585901554 230
108 iso_pu_bacteria 2585427609 2585905642 230
109 iso_pu_bacteria 2585428125 2587979242 230
110 iso_pu_bacteria 2599185170 2599419103 230
111 iso_pu_bacteria 2615840624 2616295748 230
112 iso_pu_bacteria 2615840626 2616306257 230
113 iso_pu_bacteria 2615840698 2616553479 230
114 iso_pu_bacteria 2617270742 2617386652 230
115 iso_pu_bacteria 2643221558 2643810481 230
116 iso_pu_bacteria 2643221599 2644007417 230
117 iso_pu_bacteria 2643221634 2644190668 230
118 iso_pu_bacteria 2643221643 2644241476 230
119 iso_pu_bacteria 2667528174 2671112433 230
120 iso_pu_bacteria 2718217882 2719179647 230
121 iso_pu_bacteria 2718217927 2719384259 230
122 iso_pu_bacteria 2718217997 2719663993 230
123 iso_pu_bacteria 2718218009 2719730317 230
124 iso_pu_bacteria 2718218199 2720490412 230
125 iso_pu_bacteria 2718218232 2720611790 230
126 iso_pu_bacteria 2718218233 2720618647 230
127 iso_pu_bacteria 2718218235 2720630046 230
128 iso_pu_bacteria 2718218269 2720773741 230
129 iso_pu_bacteria 2718218363 2721145740 230
130 iso_pu_bacteria 2718218365 2721157272 230
131 iso_pu_bacteria 2718218366 2721162619 230
132 iso_pu_bacteria 2718218423 2721397973 230
133 iso_pu_bacteria 2721755514 2722838789 230
134 iso_pu_bacteria 2721755556 2723025411 230
135 iso_pu_bacteria 2721755684 2723558994 230
136 iso_pu_bacteria 2721755685 2723565601 230
137 iso_pu_bacteria 2721755809 2724036783 230
138 iso_pu_bacteria 2721755810 2724043073 230
139 iso_pu_bacteria 2721755819 2724088348 230
140 iso_pu_bacteria 2721755822 2724102866 230
141 iso_pu_bacteria 2721755823 2724108733 230
142 iso_pu_bacteria 2724679232 2725950167 230
143 iso_pu_bacteria 2728369352 2730106347 230
144 iso_pu_bacteria 2728369365 2730162884 230
145 iso_pu_bacteria 2728369397 2730296904 230
146 iso_pu_bacteria 2738541293 2738803768 230
147 iso_pu_bacteria 2738541333 2739034636 230
148 iso_pu_bacteria 2757320392 2757570762 230
149 iso_pu_bacteria 2765235942 2766065619 230
150 iso_pu_bacteria 2775507049 2776912216 230
151 iso_pu_bacteria 2775507266 2778174238 230
152 iso_pu_bacteria 2791355256 2793295137 230
153 iso_pu_bacteria 2791355259 2793315346 230
154 iso_pu_bacteria 2791355260 2793320207 230
155 iso_pu_bacteria 2791355261 2793326073 230
156 iso_pu_bacteria 2791355262 2793332509 230
157 iso_pu_bacteria 2791355263 2793343253 230
158 iso_pu_bacteria 2791355264 2793351046 230
159 iso_pu_bacteria 2791355265 2793353302 230
160 iso_pu_bacteria 2791355266 2793362685 230
161 iso_pu_bacteria 2791355267 2793364756 230
162 iso_pu_bacteria 2802429605 2805927507 230
163 iso_pu_bacteria 2802429606 2805932291 230
164 iso_pu_bacteria 2802429633 2806043933 230
165 iso_pu_bacteria 2802429634 2806052249 230
166 iso_pu_bacteria 2802429635 2806058550 230
167 iso_pu_bacteria 2802429636 2806067046 230
168 iso_pu_bacteria 2802429637 2806074791 230
169 iso_pu_bacteria 2818991272 2819243155 230
170 iso_pu_bacteria 2818991448 2819608340 230
171 iso_pu_bacteria 2818991453 2819643396 230
172 iso_pu_bacteria 2838016132 2838022154 230
173 iso_pu_bacteria 2838022645 2838024567 230
174 iso_pu_bacteria 2838029111 2838029229 230
175 iso_pu_bacteria 2838035591 2838037210 230
176 iso_pu_bacteria 2838042994 2838044338 230
177 iso_pu_bacteria 2838048938 2838051397 230
178 iso_pu_bacteria 2838061910 2838066658 230
179 iso_pu_bacteria 2838068647 2838073711 230
180 iso_pu_bacteria 2838661181 2838663602 230
181 iso_pu_bacteria 2838668709 2838673140 230
182 iso_pu_bacteria 2838680041 2838680673 230
183 iso_pu_bacteria 2838686498 2838692667 230
184 iso_pu_bacteria 2838694306 2838695294 230
185 iso_pu_bacteria 2838701080 2838703942 230
186 iso_pu_bacteria 2838707686 2838708670 230
187 iso_pu_bacteria 2838729681 2838732739 230
188 iso_pu_bacteria 2838742623 2838745634 230
189 iso_pu_bacteria 2841760612 2841763533 230
190 iso_pu_bacteria 2841851746 2841855278 230
191 iso_pu_bacteria 2841864319 2841866730 230
192 iso_pu_bacteria 2842077413 2842080095 230
193 iso_pu_bacteria 2842110456 2842112288 230
194 iso_pu_bacteria 2842118031 2842120715 230
195 iso_pu_bacteria 2842146304 2842148266 230
196 iso_pu_bacteria 2842156927 2842161692 230
197 iso_pu_bacteria 2842163707 2842170095 230
198 iso_pu_bacteria 2842180545 2842185309 230
199 iso_pu_bacteria 2842192696 2842192980 230
200 iso_pu_bacteria 2842198810 2842200328 230
201 iso_pu_bacteria 2842205361 2842206851 230
202 iso_pu_bacteria 2842217011 2842218711 230
203 iso_pu_bacteria 2842229732 2842233247 230
204 iso_pu_bacteria 2842237096 2842238082 230
205 iso_pu_bacteria 2842243621 2842248749 230
206 iso_pu_bacteria 2842250916 2842253331 230
207 iso_pu_bacteria 2842257432 2842261892 230
208 iso_pu_bacteria 2842264693 2842267363 230
209 iso_pu_bacteria 2842271015 2842277044 230
210 iso_pu_bacteria 2842278818 2842280456 230
211 iso_pu_bacteria 2842285085 2842289403 230
212 iso_pu_bacteria 2842291075 2842293755 230
213 iso_pu_bacteria 2842304105 2842306401 230
214 iso_pu_bacteria 2842311132 2842312545 230
215 iso_pu_bacteria 2842317721 2842322577 230
216 iso_pu_bacteria 2842341865 2842342993 230
217 iso_pu_bacteria 2842357229 2842358078 230
218 iso_pu_bacteria 2842363717 2842367283 230
219 iso_pu_bacteria 2842370503 2842371136 230
220 iso_pu_bacteria 2842377471 2842380152 230
221 iso_pu_bacteria 2842384541 2842387223 230
222 iso_pu_bacteria 2842395702 2842401247 230
223 iso_pu_bacteria 2842402390 2842406751 230
224 iso_pu_bacteria 2842409023 2842413753 230
225 iso_pu_bacteria 2842415677 2842420285 230
226 iso_pu_bacteria 2842422224 2842427159 230
227 iso_pu_bacteria 2842428310 2842431385 230
228 iso_pu_bacteria 2842434925 2842437720 230
229 iso_pu_bacteria 2842441272 2842444535 230
230 iso_pu_bacteria 2842447887 2842450282 230
231 iso_pu_bacteria 2842462802 2842465637 230
232 iso_pu_bacteria 2842469257 2842472447 230
233 iso_pu_bacteria 2842475841 2842476341 230
234 iso_pu_bacteria 2842482326 2842482417 230
235 iso_pu_bacteria 2842489311 2842492381 230
236 iso_pu_bacteria 2842495871 2842501940 230
237 iso_pu_bacteria 2842502639 2842502757 230
238 iso_pu_bacteria 2842509118 2842509275 230
239 iso_pu_bacteria 2844104063 2844109563 230
240 iso_pu_bacteria 2844454524 2844455893 230
241 iso_pu_bacteria 2851246043 2851251670 230
242 iso_pu_bacteria 2852387548 2852388561 230
243 iso_pu_bacteria 2857516855 2857522171 230
244 iso_pu_bacteria 2919100787 2919101268 230
245 iso_pu_bacteria 2919408235 2919408867 230
246 iso_pu_bacteria 2923556063 2923557265 230
247 iso_pu_bacteria 2933016740 2933019475 230
248 iso_pu_bacteria 2933570622 2933573470 230
249 iso_pu_bacteria 2933586486 2933587617 230
250 iso_pu_bacteria 2933599457 2933604139 230
251 iso_pu_bacteria 2935894831 2935895817 230
252 iso_pu_bacteria 2935901341 2935907734 230
253 iso_pu_bacteria 2936367885 2936368835 230
254 iso_pu_bacteria 2936375103 2936377085 230
255 iso_pu_bacteria 2936381700 2936388338 230
256 iso_pu_bacteria 2989776772 2989777586 230
257 iso_pu_bacteria 2996887358 2996892112 230
258 iso_pu_bacteria 2996893221 2996893535 230
259 iso_pu_bacteria 3002141150 3002144913 230
260 iso_pu_bacteria 3005409236 3005411297 230
261 iso_pu_bacteria 3005416602 3005422745 230
262 iso_pu_bacteria 3005445848 3005446251 230
263 iso_pu_bacteria 3005452660 3005452904 230
264 iso_pu_bacteria 639633055 639646754 230
265 iso_pu_bacteria 8005246636 8005247249 230
266 iso_pu_bacteria 8005258706 8005263561 230
267 iso_pu_bacteria 8005275841 8005278973 230
268 iso_pu_bacteria 8005282627 8005283659 230
269 iso_pu_bacteria 8005289223 8005291003 230
270 iso_pu_bacteria 8005301065 8005303927 230
271 iso_pu_bacteria 8005307578 8005308747 230
272 iso_pu_bacteria 8005314921 8005321719 230
273 iso_pu_bacteria 8005321885 8005326639 230
274 iso_pu_bacteria 8005376324 8005377341 230
275 iso_pu_bacteria 8005382845 8005387212 230
276 iso_pu_bacteria 8005395548 8005401971 230
277 iso_pu_bacteria 8005430974 8005433011 230
278 iso_pu_bacteria 8005460587 8005461121 230
279 iso_pu_bacteria 8005484373 8005486075 230
280 iso_pu_bacteria 8005497431 8005498735 230
281 iso_pu_bacteria 8005542996 8005543839 230
282 iso_pu_bacteria 8005556819 8005560721 230
283 iso_pu_bacteria 8005563573 8005569703 230
284 iso_pu_bacteria 8005570704 8005577012 230
285 iso_pu_bacteria 8005619151 8005619930 230
286 iso_pu_bacteria 8005626139 8005628527 230
287 iso_pu_bacteria 8005645114 8005650213 230
288 iso_pu_bacteria 8005668836 8005670146 230
289 iso_pu_bacteria 8005682033 8005685051 230
290 iso_pu_bacteria 8005688590 8005690354 230
291 iso_pu_bacteria 8005695170 8005700295 230
292 iso_pu_bacteria 8018127388 8018133210 230
293 iso_pu_bacteria 8018150411 8018151980 230
294 iso_pu_bacteria 8018163183 8018167809 230
295 iso_pu_bacteria 8018176218 8018180234 230
296 iso_pu_bacteria 8023680758 8023684131 230
297 iso_pu_bacteria 8024479707 8024480378 230
298 iso_pu_bacteria 8024501048 8024503599 230
299 iso_pu_bacteria 8046767195 8046771101 230
300 iso_pu_bacteria 8056375014 8056375713 230
301 iso_pu_bacteria 8056382006 8056386034 230
302 iso_pu_bacteria 8057529695 8057534542 230
303 iso_pu_bacteria 8057575449 8057579869 230
304 iso_pu_bacteria 8057874678 8057881009 230
305 3300049568 Ga0501031_0029846 Ga0501031_0029846_260_976 231
306 3300049571 Ga0501034_0033123 Ga0501034_0033123_2967_3668 231
307 3300049583 Ga0501067_0056919 Ga0501067_0056919_28_729 231
308 3300049742 Ga0501080_0013741 Ga0501080_0013741_4998_5699 231
309 iso_pu_bacteria 2899803654 2899804420 231
310 3300002739 JGI25158J39367_1001611 JGI25158J39367_10016117 232
311 3300002987 JGI25159J45721_1000034 JGI25159J45721_100003421 232
312 3300003354 JGI25160J50197_1000096 JGI25160J50197_100009621 232
313 3300003374 JGI25161J50226_1000735 JGI25161J50226_100073513 232
314 3300003771 Ga0055526_1004323 Ga0055526_10043239 232
315 3300003775 Ga0055524_1001011 Ga0055524_100101112 232
316 3300003781 Ga0055536_1012982 Ga0055536_10129823 232
317 3300003791 Ga0055530_10037531 Ga0055530_100375311 232
318 3300003792 Ga0055540_1008488 Ga0055540_10084882 232
319 3300003792 Ga0055540_1008672 Ga0055540_10086723 232
320 3300003794 Ga0055531_10009694 Ga0055531_100096947 232
321 3300003794 Ga0055531_10012435 Ga0055531_100124351 232
322 3300003794 Ga0055531_10014881 Ga0055531_100148811 232
323 3300004625 Ga0055543_1000402 Ga0055543_100040221 232
324 3300005262 Ga0065165_1000389 Ga0065165_100038986 232
325 3300005262 Ga0065165_1003090 Ga0065165_10030903 232
326 3300005548 Ga0070665_100060832 Ga0070665_1000608323 232
327 3300006038 Ga0075365_10033219 Ga0075365_100332197 232
328 3300006038 Ga0075365_10273664 Ga0075365_102736642 232
329 3300006946 Ga0079104_1000069 Ga0079104_100006994 232
330 3300013100 Ga0157373_10017343 Ga0157373_100173435 232
331 3300013105 Ga0157369_10137547 Ga0157369_101375473 232
332 3300013249 Ga0171463_1008 Ga0171463_100843 232
333 3300015690 Ga0183363_1335 Ga0183363_13358 232
334 3300025208 Ga0209436_100305 Ga0209436_1003059 232
335 3300025263 Ga0209565_1031971 Ga0209565_10319712 232
336 3300025284 Ga0209130_1000185 Ga0209130_100018521 232
337 3300025292 Ga0209676_1009574 Ga0209676_10095743 232
338 3300025292 Ga0209676_1010076 Ga0209676_10100762 232
339 3300025292 Ga0209676_1012133 Ga0209676_10121334 232
340 3300025292 Ga0209676_1028044 Ga0209676_10280441 232
341 3300025294 Ga0209025_1000033 Ga0209025_1000033235 232
342 3300025294 Ga0209025_1002342 Ga0209025_10023424 232
343 3300025294 Ga0209025_1050259 Ga0209025_10502593 232
344 3300025295 Ga0209564_1000152 Ga0209564_100015248 232
345 3300025295 Ga0209564_1030461 Ga0209564_10304612 232
346 3300025297 Ga0209758_1000602 Ga0209758_100060213 232
347 3300025298 Ga0209050_1009663 Ga0209050_10096635 232
348 3300025298 Ga0209050_1016427 Ga0209050_10164273 232
349 3300025299 Ga0209256_1000218 Ga0209256_100021859 232
350 3300025299 Ga0209256_1000759 Ga0209256_100075946 232
351 3300025302 Ga0207426_1000340 Ga0207426_100034021 232
352 3300025303 Ga0209051_1001336 Ga0209051_10013368 232
353 3300025303 Ga0209051_1009489 Ga0209051_10094894 232
354 3300025304 Ga0209257_1009030 Ga0209257_10090304 232
355 3300025304 Ga0209257_1009123 Ga0209257_10091232 232
356 3300025304 Ga0209257_1015380 Ga0209257_10153804 232
357 3300025304 Ga0209257_1044544 Ga0209257_10445442 232
358 3300026142 Ga0207698_10689472 Ga0207698_106894722 232
359 3300027111 Ga0209281_1000192 Ga0209281_100019222 232
360 3300028379 Ga0268266_10081975 Ga0268266_100819754 232
361 3300031901 Ga0307406_10207269 Ga0307406_102072692 232
362 3300041413 Ga0439465_0039202 Ga0439465_0039202_336_1034 232
363 3300044683 Ga0466965_0082582 Ga0466965_0082582_672_1376 232
364 3300046501 Ga0495607_0027801 Ga0495607_0027801_1030_1734 232
365 3300048913 Ga0496110_0170901 Ga0496110_0170901_116_820 232
366 3300048914 Ga0496111_0003317 Ga0496111_0003317_5559_6263 232
367 3300048920 Ga0496117_0019788 Ga0496117_0019788_3039_3740 232
368 3300048925 Ga0496122_0000009 Ga0496122_0000009_450566_451270 232
369 3300048925 Ga0496122_0010110 Ga0496122_0010110_2266_2970 232
370 3300048926 Ga0496123_0000020 Ga0496123_0000020_255124_255828 232
371 3300048926 Ga0496123_0013530 Ga0496123_0013530_4040_4741 232
372 3300048927 Ga0496124_0015396 Ga0496124_0015396_1446_2150 232
373 3300048927 Ga0496124_0047300 Ga0496124_0047300_735_1439 232
374 3300048927 Ga0496124_0174779 Ga0496124_0174779_10_720 232
375 3300048929 Ga0496126_0176292 Ga0496126_0176292_443_1144 232
376 3300049571 Ga0501034_0009938 Ga0501034_0009938_2911_3609 232
377 3300049571 Ga0501034_0108890 Ga0501034_0108890_339_1043 232
378 3300049574 Ga0501038_0311247 Ga0501038_0311247_484_1182 232
379 3300049583 Ga0501067_0000688 Ga0501067_0000688_1451_2152 232
380 3300049589 Ga0501073_0012900 Ga0501073_0012900_1336_2037 232
381 3300049589 Ga0501073_0228449 Ga0501073_0228449_175_873 232
382 3300049589 Ga0501073_0279246 Ga0501073_0279246_377_1075 232
383 3300049744 Ga0501083_0004419 Ga0501083_0004419_1767_2465 232
384 3300049744 Ga0501083_0007506 Ga0501083_0007506_3058_3759 232
385 3300050491 nmdc:mga00v17_227463_c1 nmdc:mga00v17_227463_c1_155_859 232
386 3300050492 nmdc:mga0yw44_12807_c1 nmdc:mga0yw44_12807_c1_2443_3147 232
387 3300053125 Ga0500618_007646 Ga0500618_007646_2279_2983 232
388 3300053125 Ga0500618_013097 Ga0500618_013097_79_783 232
389 3300053139 Ga0500568_0000108 Ga0500568_0000108_67365_68075 232
390 3300053153 Ga0500616_0001019 Ga0500616_0001019_18070_18774 232
391 3300054114 Ga0501084_0010280 Ga0501084_0010280_3010_3711 232
392 3300060353 Ga0501082_0004072 Ga0501082_0004072_1390_2091 232
393 iso_pu_bacteria 2524023209 2524457583 232
394 iso_pu_bacteria 2842298080 2842300803 232
395 3300003775 Ga0055524_1018423 Ga0055524_10184233 233
396 3300025292 Ga0209676_1037030 Ga0209676_10370302 233
397 3300025299 Ga0209256_1000188 Ga0209256_100018847 233
398 3300031456 Ga0307513_10167532 Ga0307513_101675322 233
399 3300046507 Ga0495606_0070080 Ga0495606_0070080_141_866 233
400 3300047472 Ga0495686_0341145 Ga0495686_0341145_60_776 233
401 3300053156 Ga0500622_0066099 Ga0500622_0066099_1029_1745 233
402 3300001979 JGI24740J21852_10000263 JGI24740J21852_100002637 234
403 3300002704 JGI25155J39150_1000023 JGI25155J39150_1000023116 234
404 3300002705 JGI25156J39149_1000094 JGI25156J39149_100009459 234
405 3300002737 JGI25162J39368_1000177 JGI25162J39368_100017732 234
406 3300002737 JGI25162J39368_1000788 JGI25162J39368_10007889 234
407 3300002738 JGI25154J39366_1000213 JGI25154J39366_100021330 234
408 3300002738 JGI25154J39366_1013929 JGI25154J39366_10139291 234
409 3300002739 JGI25158J39367_1000158 JGI25158J39367_10001586 234
410 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004311 234
411 3300002773 JGI25152J39213_1001662 JGI25152J39213_10016625 234
412 3300002773 JGI25152J39213_1003959 JGI25152J39213_10039593 234
413 3300002773 JGI25152J39213_1004756 JGI25152J39213_10047564 234
414 3300002773 JGI25152J39213_1012579 JGI25152J39213_10125792 234
415 3300002773 JGI25152J39213_1014458 JGI25152J39213_10144582 234
416 3300002773 JGI25152J39213_1015644 JGI25152J39213_10156442 234
417 3300002774 JGI25150J39212_1000378 JGI25150J39212_10003784 234
418 3300002774 JGI25150J39212_1004689 JGI25150J39212_10046892 234
419 3300002774 JGI25150J39212_1006376 JGI25150J39212_10063763 234
420 3300002774 JGI25150J39212_1010896 JGI25150J39212_10108963 234
421 3300002774 JGI25150J39212_1023141 JGI25150J39212_10231411 234
422 3300002987 JGI25159J45721_1000489 JGI25159J45721_100048918 234
423 3300002987 JGI25159J45721_1009426 JGI25159J45721_10094263 234
424 3300003187 JGI25151J46595_10000565 JGI25151J46595_1000056520 234
425 3300003187 JGI25151J46595_10001463 JGI25151J46595_100014632 234
426 3300003187 JGI25151J46595_10002461 JGI25151J46595_100024612 234
427 3300003187 JGI25151J46595_10006390 JGI25151J46595_100063903 234
428 3300003187 JGI25151J46595_10022314 JGI25151J46595_100223143 234
429 3300003187 JGI25151J46595_10048823 JGI25151J46595_100488232 234
430 3300003187 JGI25151J46595_10062025 JGI25151J46595_100620251 234
431 3300003214 JGI25165J46597_1000415 JGI25165J46597_100041530 234
432 3300003214 JGI25165J46597_1000555 JGI25165J46597_100055514 234
433 3300003214 JGI25165J46597_1003155 JGI25165J46597_10031553 234
434 3300003215 JGI25153J46596_10000833 JGI25153J46596_1000083319 234
435 3300003215 JGI25153J46596_10007280 JGI25153J46596_100072802 234
436 3300003215 JGI25153J46596_10010202 JGI25153J46596_100102023 234
437 3300003215 JGI25153J46596_10026027 JGI25153J46596_100260272 234
438 3300003215 JGI25153J46596_10037224 JGI25153J46596_100372242 234
439 3300003215 JGI25153J46596_10037406 JGI25153J46596_100374062 234
440 3300003323 rootH1_10012486 rootH1_100124861 234
441 3300003323 rootH1_10156603 rootH1_101566032 234
442 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004638 234
443 3300003354 JGI25160J50197_1000703 JGI25160J50197_100070318 234
444 3300003354 JGI25160J50197_1008324 JGI25160J50197_10083246 234
445 3300003354 JGI25160J50197_1029684 JGI25160J50197_10296842 234
446 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003138 234
447 3300003374 JGI25161J50226_1001481 JGI25161J50226_10014816 234
448 3300003771 Ga0055526_1002004 Ga0055526_100200413 234
449 3300003771 Ga0055526_1004833 Ga0055526_10048337 234
450 3300003771 Ga0055526_1016842 Ga0055526_10168422 234
451 3300003775 Ga0055524_1003205 Ga0055524_10032058 234
452 3300003775 Ga0055524_1006519 Ga0055524_10065196 234
453 3300003775 Ga0055524_1007117 Ga0055524_10071172 234
454 3300003790 Ga0055528_1000146 Ga0055528_100014648 234
455 3300003790 Ga0055528_1000636 Ga0055528_100063613 234
456 3300003790 Ga0055528_1002006 Ga0055528_100200610 234
457 3300003790 Ga0055528_1006732 Ga0055528_10067323 234
458 3300003790 Ga0055528_1011522 Ga0055528_10115222 234
459 3300003790 Ga0055528_1017754 Ga0055528_10177543 234
460 3300003792 Ga0055540_1000111 Ga0055540_100011181 234
461 3300003792 Ga0055540_1017841 Ga0055540_10178411 234
462 3300003792 Ga0055540_1021187 Ga0055540_10211873 234
463 3300003792 Ga0055540_1024277 Ga0055540_10242772 234
464 3300004625 Ga0055543_1000208 Ga0055543_10002086 234
465 3300004625 Ga0055543_1000637 Ga0055543_10006375 234
466 3300004625 Ga0055543_1003374 Ga0055543_10033745 234
467 3300004625 Ga0055543_1006055 Ga0055543_10060553 234
468 3300005262 Ga0065165_1000468 Ga0065165_100046831 234
469 3300005262 Ga0065165_1000693 Ga0065165_100069339 234
470 3300005262 Ga0065165_1008980 Ga0065165_10089806 234
471 3300005262 Ga0065165_1010930 Ga0065165_10109305 234
472 3300005262 Ga0065165_1028682 Ga0065165_10286823 234
473 3300005331 Ga0070670_100000173 Ga0070670_10000017313 234
474 3300005335 Ga0070666_10107996 Ga0070666_101079962 234
475 3300005337 Ga0070682_100181413 Ga0070682_1001814132 234
476 3300005347 Ga0070668_100093172 Ga0070668_1000931722 234
477 3300005353 Ga0070669_100624789 Ga0070669_1006247892 234
478 3300005355 Ga0070671_100012822 Ga0070671_1000128222 234
479 3300005355 Ga0070671_100357284 Ga0070671_1003572842 234
480 3300005367 Ga0070667_100146697 Ga0070667_1001466973 234
481 3300005455 Ga0070663_100067648 Ga0070663_1000676482 234
482 3300005539 Ga0068853_100255608 Ga0068853_1002556082 234
483 3300005548 Ga0070665_100018373 Ga0070665_1000183736 234
484 3300005563 Ga0068855_100345760 Ga0068855_1003457602 234
485 3300005614 Ga0068856_100083561 Ga0068856_1000835611 234
486 3300005614 Ga0068856_100135663 Ga0068856_1001356632 234
487 3300005616 Ga0068852_100080225 Ga0068852_1000802253 234
488 3300005841 Ga0068863_100510787 Ga0068863_1005107872 234
489 3300006038 Ga0075365_10009533 Ga0075365_100095337 234
490 3300006038 Ga0075365_10012660 Ga0075365_100126602 234
491 3300006048 Ga0075363_100286759 Ga0075363_1002867592 234
492 3300006051 Ga0075364_10000875 Ga0075364_1000087516 234
493 3300006177 Ga0075362_10068711 Ga0075362_100687112 234
494 3300006186 Ga0075369_10002530 Ga0075369_100025303 234
495 3300006186 Ga0075369_10009993 Ga0075369_100099933 234
496 3300006195 Ga0075366_10011977 Ga0075366_100119771 234
497 3300006195 Ga0075366_10432235 Ga0075366_104322351 234
498 3300006353 Ga0075370_10021085 Ga0075370_100210853 234
499 3300006353 Ga0075370_10023191 Ga0075370_100231912 234
500 3300009011 Ga0105251_10010923 Ga0105251_100109236 234
501 3300009092 Ga0105250_10030703 Ga0105250_100307032 234
502 3300009093 Ga0105240_10006772 Ga0105240_100067728 234
503 3300009101 Ga0105247_10206393 Ga0105247_102063932 234
504 3300009148 Ga0105243_10044233 Ga0105243_100442332 234
505 3300009148 Ga0105243_10162016 Ga0105243_101620162 234
506 3300009177 Ga0105248_10005517 Ga0105248_100055178 234
507 3300009545 Ga0105237_10010394 Ga0105237_100103947 234
508 3300009545 Ga0105237_10283757 Ga0105237_102837572 234
509 3300009763 Ga0123340_1057202 Ga0123340_10572021 234
510 3300009765 Ga0123341_1000452 Ga0123341_100045220 234
511 3300009765 Ga0123341_1082950 Ga0123341_10829502 234
512 3300009765 Ga0123341_1083348 Ga0123341_10833482 234
513 3300009766 Ga0123342_1014969 Ga0123342_10149696 234
514 3300009766 Ga0123342_1029957 Ga0123342_10299572 234
515 3300010375 Ga0105239_10012926 Ga0105239_100129268 234
516 3300012490 Ga0157322_1003048 Ga0157322_10030481 234
517 3300012500 Ga0157314_1004303 Ga0157314_10043031 234
518 3300013100 Ga0157373_10087897 Ga0157373_100878973 234
519 3300013104 Ga0157370_10003911 Ga0157370_1000391115 234
520 3300013105 Ga0157369_10127636 Ga0157369_101276362 234
521 3300013306 Ga0163162_10400123 Ga0163162_104001232 234
522 3300014325 Ga0163163_10401145 Ga0163163_104011452 234
523 3300014968 Ga0157379_10457298 Ga0157379_104572981 234
524 3300015265 Ga0182005_1003486 Ga0182005_10034863 234
525 3300025206 Ga0209435_100011 Ga0209435_100011258 234
526 3300025208 Ga0209436_100077 Ga0209436_1000776 234
527 3300025233 Ga0209437_100036 Ga0209437_10003695 234
528 3300025233 Ga0209437_100086 Ga0209437_100086153 234
529 3300025245 Ga0207425_1000012 Ga0207425_1000012404 234
530 3300025245 Ga0207425_1008931 Ga0207425_10089312 234
531 3300025245 Ga0207425_1010568 Ga0207425_10105682 234
532 3300025245 Ga0207425_1017543 Ga0207425_10175432 234
533 3300025246 Ga0209646_1000024 Ga0209646_1000024153 234
534 3300025246 Ga0209646_1006810 Ga0209646_10068103 234
535 3300025246 Ga0209646_1009330 Ga0209646_10093302 234
536 3300025250 Ga0209026_1000030 Ga0209026_1000030153 234
537 3300025253 Ga0209677_100267 Ga0209677_10026713 234
538 3300025256 Ga0209759_1000011 Ga0209759_1000011258 234
539 3300025256 Ga0209759_1025982 Ga0209759_10259822 234
540 3300025258 Ga0209129_1000086 Ga0209129_1000086137 234
541 3300025258 Ga0209129_1000123 Ga0209129_1000123117 234
542 3300025258 Ga0209129_1000316 Ga0209129_100031612 234
543 3300025258 Ga0209129_1000472 Ga0209129_10004726 234
544 3300025258 Ga0209129_1000633 Ga0209129_100063317 234
545 3300025258 Ga0209129_1000710 Ga0209129_10007106 234
546 3300025258 Ga0209129_1006698 Ga0209129_10066983 234
547 3300025261 Ga0209233_1000110 Ga0209233_100011093 234
548 3300025261 Ga0209233_1000166 Ga0209233_100016695 234
549 3300025261 Ga0209233_1000350 Ga0209233_100035014 234
550 3300025272 Ga0209455_1008242 Ga0209455_10082422 234
551 3300025273 Ga0209673_1000015 Ga0209673_1000015297 234
552 3300025273 Ga0209673_1000091 Ga0209673_1000091163 234
553 3300025273 Ga0209673_1000919 Ga0209673_100091933 234
554 3300025273 Ga0209673_1002462 Ga0209673_10024622 234
555 3300025273 Ga0209673_1002974 Ga0209673_10029749 234
556 3300025273 Ga0209673_1004455 Ga0209673_10044557 234
557 3300025284 Ga0209130_1000015 Ga0209130_1000015415 234
558 3300025284 Ga0209130_1000182 Ga0209130_100018213 234
559 3300025284 Ga0209130_1000312 Ga0209130_100031239 234
560 3300025291 Ga0209675_1030297 Ga0209675_10302972 234
561 3300025292 Ga0209676_1008100 Ga0209676_10081003 234
562 3300025292 Ga0209676_1031387 Ga0209676_10313872 234
563 3300025294 Ga0209025_1000024 Ga0209025_1000024404 234
564 3300025294 Ga0209025_1000407 Ga0209025_100040713 234
565 3300025294 Ga0209025_1001232 Ga0209025_100123222 234
566 3300025294 Ga0209025_1010470 Ga0209025_10104702 234
567 3300025294 Ga0209025_1014042 Ga0209025_10140423 234
568 3300025294 Ga0209025_1015556 Ga0209025_10155561 234
569 3300025294 Ga0209025_1018388 Ga0209025_10183883 234
570 3300025294 Ga0209025_1035721 Ga0209025_10357212 234
571 3300025295 Ga0209564_1000845 Ga0209564_100084535 234
572 3300025295 Ga0209564_1001802 Ga0209564_10018026 234
573 3300025295 Ga0209564_1002399 Ga0209564_10023998 234
574 3300025295 Ga0209564_1009840 Ga0209564_10098402 234
575 3300025295 Ga0209564_1013227 Ga0209564_10132275 234
576 3300025297 Ga0209758_1000046 Ga0209758_1000046137 234
577 3300025297 Ga0209758_1000336 Ga0209758_100033675 234
578 3300025297 Ga0209758_1000877 Ga0209758_100087712 234
579 3300025297 Ga0209758_1004509 Ga0209758_10045092 234
580 3300025297 Ga0209758_1013040 Ga0209758_10130401 234
581 3300025297 Ga0209758_1019376 Ga0209758_10193762 234
582 3300025297 Ga0209758_1023591 Ga0209758_10235912 234
583 3300025297 Ga0209758_1060159 Ga0209758_10601591 234
584 3300025298 Ga0209050_1004756 Ga0209050_10047565 234
585 3300025299 Ga0209256_1000531 Ga0209256_100053135 234
586 3300025299 Ga0209256_1002589 Ga0209256_10025892 234
587 3300025299 Ga0209256_1004329 Ga0209256_10043292 234
588 3300025299 Ga0209256_1006233 Ga0209256_10062336 234
589 3300025299 Ga0209256_1016158 Ga0209256_10161583 234
590 3300025302 Ga0207426_1000012 Ga0207426_100001239 234
591 3300025302 Ga0207426_1000063 Ga0207426_1000063132 234
592 3300025302 Ga0207426_1000144 Ga0207426_1000144185 234
593 3300025302 Ga0207426_1004140 Ga0207426_10041405 234
594 3300025302 Ga0207426_1023549 Ga0207426_10235492 234
595 3300025303 Ga0209051_1000084 Ga0209051_100008455 234
596 3300025303 Ga0209051_1004188 Ga0209051_10041888 234
597 3300025303 Ga0209051_1005881 Ga0209051_10058816 234
598 3300025303 Ga0209051_1016530 Ga0209051_10165303 234
599 3300025303 Ga0209051_1055965 Ga0209051_10559652 234
600 3300025304 Ga0209257_1009036 Ga0209257_10090363 234
601 3300025304 Ga0209257_1036948 Ga0209257_10369481 234
602 3300025735 Ga0207713_1032483 Ga0207713_10324832 234
603 3300025913 Ga0207695_10005499 Ga0207695_100054998 234
604 3300025914 Ga0207671_10000176 Ga0207671_100001768 234
605 3300025923 Ga0207681_10196225 Ga0207681_101962253 234
606 3300025923 Ga0207681_10358434 Ga0207681_103584341 234
607 3300025925 Ga0207650_10016150 Ga0207650_100161506 234
608 3300025935 Ga0207709_10173314 Ga0207709_101733142 234
609 3300025941 Ga0207711_10199320 Ga0207711_101993202 234
610 3300025949 Ga0207667_10278046 Ga0207667_102780462 234
611 3300025972 Ga0207668_10086867 Ga0207668_100868672 234
612 3300025981 Ga0207640_10083001 Ga0207640_100830012 234
613 3300026041 Ga0207639_10267885 Ga0207639_102678852 234
614 3300026067 Ga0207678_10045153 Ga0207678_100451534 234
615 3300026078 Ga0207702_10331923 Ga0207702_103319233 234
616 3300026078 Ga0207702_10869565 Ga0207702_108695651 234
617 3300026142 Ga0207698_10067092 Ga0207698_100670923 234
618 3300027312 Ga0209371_1002637 Ga0209371_10026373 234
619 3300028379 Ga0268266_10059328 Ga0268266_100593284 234
620 3300028794 Ga0307515_10077394 Ga0307515_100773944 234
621 3300030500 Ga0268256_1002270 Ga0268256_10022703 234
622 3300031456 Ga0307513_10106022 Ga0307513_101060222 234
623 3300031731 Ga0307405_10002585 Ga0307405_100025855 234
624 3300031824 Ga0307413_10482056 Ga0307413_104820561 234
625 3300031901 Ga0307406_10001781 Ga0307406_100017812 234
626 3300031911 Ga0307412_10001828 Ga0307412_100018287 234
627 3300039145 Ga0237816_01952 Ga0237816_01952_486_1196 234
628 3300039438 Ga0436360_1375654 Ga0436360_1375654_1117_1845 234
629 3300039447 Ga0436361_0616510 Ga0436361_0616510_68_796 234
630 3300039450 Ga0436363_0887411 Ga0436363_0887411_765_1493 234
631 3300041404 Ga0439436_0039178 Ga0439436_0039178_402_1106 234
632 3300041405 Ga0439438_042655 Ga0439438_042655_431_1135 234
633 3300041413 Ga0439465_0034291 Ga0439465_0034291_459_1163 234
634 3300041441 Ga0451787_682831 Ga0451787_682831_71_775 234
635 3300041491 Ga0451833_1012096 Ga0451833_1012096_382_1086 234
636 3300041494 Ga0451837_0259953 Ga0451837_0259953_48_752 234
637 3300041498 Ga0451841_1019185 Ga0451841_1019185_131_835 234
638 3300041501 Ga0451845_0396315 Ga0451845_0396315_192_896 234
639 3300041503 Ga0451847_0124849 Ga0451847_0124849_142_846 234
640 3300041505 Ga0451849_0241149 Ga0451849_0241149_407_1111 234
641 3300041511 Ga0451855_0112266 Ga0451855_0112266_682_1386 234
642 3300041511 Ga0451855_1309579 Ga0451855_1309579_652_1356 234
643 3300042007 Ga0439449_0015161 Ga0439449_0015161_1738_2442 234
644 3300044684 Ga0466966_0021690 Ga0466966_0021690_603_1331 234
645 3300044684 Ga0466966_0082022 Ga0466966_0082022_626_1351 234
646 3300044765 Ga0466970_0003121 Ga0466970_0003121_905_1630 234
647 3300044842 Ga0466957_0064581 Ga0466957_0064581_916_1641 234
648 3300045836 Ga0466958_0020796 Ga0466958_0020796_2081_2809 234
649 3300046452 Ga0495617_014356 Ga0495617_014356_141_845 234
650 3300046454 Ga0495592_0050931 Ga0495592_0050931_1793_2497 234
651 3300046459 Ga0495629_0391167 Ga0495629_0391167_24_728 234
652 3300046460 Ga0495638_0000299 Ga0495638_0000299_44234_44938 234
653 3300046460 Ga0495638_0127301 Ga0495638_0127301_696_1400 234
654 3300046474 Ga0495605_0003759 Ga0495605_0003759_7766_8470 234
655 3300046474 Ga0495605_0050626 Ga0495605_0050626_1207_1911 234
656 3300046474 Ga0495605_0109147 Ga0495605_0109147_75_779 234
657 3300046476 Ga0495662_0027480 Ga0495662_0027480_466_1170 234
658 3300046491 Ga0495584_0125661 Ga0495584_0125661_573_1277 234
659 3300046492 Ga0495585_0023818 Ga0495585_0023818_662_1366 234
660 3300046492 Ga0495585_0095321 Ga0495585_0095321_421_1125 234
661 3300046501 Ga0495607_0103965 Ga0495607_0103965_687_1391 234
662 3300046506 Ga0495583_0001834 Ga0495583_0001834_3313_4017 234
663 3300046506 Ga0495583_0028985 Ga0495583_0028985_1395_2099 234
664 3300046507 Ga0495606_0004205 Ga0495606_0004205_2772_3476 234
665 3300046507 Ga0495606_0061334 Ga0495606_0061334_946_1650 234
666 3300046507 Ga0495606_0133784 Ga0495606_0133784_747_1451 234
667 3300046512 Ga0495610_0003518 Ga0495610_0003518_8957_9661 234
668 3300046512 Ga0495610_0108342 Ga0495610_0108342_138_842 234
669 3300046512 Ga0495610_0137584 Ga0495610_0137584_256_960 234
670 3300046513 Ga0495616_0014369 Ga0495616_0014369_42_746 234
671 3300046513 Ga0495616_0082853 Ga0495616_0082853_517_1221 234
672 3300046515 Ga0495620_0026849 Ga0495620_0026849_1030_1734 234
673 3300046515 Ga0495620_0041911 Ga0495620_0041911_935_1639 234
674 3300046515 Ga0495620_0052126 Ga0495620_0052126_333_1037 234
675 3300046516 Ga0495628_0225948 Ga0495628_0225948_540_1244 234
676 3300046518 Ga0495631_0003621 Ga0495631_0003621_1247_1951 234
677 3300046518 Ga0495631_0090134 Ga0495631_0090134_337_1041 234
678 3300046518 Ga0495631_0138793 Ga0495631_0138793_12_716 234
679 3300046519 Ga0495632_0001582 Ga0495632_0001582_6244_6948 234
680 3300046519 Ga0495632_0035888 Ga0495632_0035888_1312_2016 234
681 3300046520 Ga0495637_0098017 Ga0495637_0098017_346_1050 234
682 3300046520 Ga0495637_0180455 Ga0495637_0180455_30_764 234
683 3300046522 Ga0495643_0036604 Ga0495643_0036604_1867_2571 234
684 3300046522 Ga0495643_0075030 Ga0495643_0075030_479_1183 234
685 3300046522 Ga0495643_0081163 Ga0495643_0081163_722_1426 234
686 3300046524 Ga0495648_0204325 Ga0495648_0204325_31_735 234
687 3300046530 Ga0495654_0002878 Ga0495654_0002878_6531_7265 234
688 3300046538 Ga0495609_0010561 Ga0495609_0010561_904_1608 234
689 3300046538 Ga0495609_0022699 Ga0495609_0022699_392_1096 234
690 3300046542 Ga0495597_0024726 Ga0495597_0024726_139_843 234
691 3300046558 Ga0495633_0045729 Ga0495633_0045729_1058_1762 234
692 3300046558 Ga0495633_0214659 Ga0495633_0214659_76_780 234
693 3300046615 Ga0495656_0019612 Ga0495656_0019612_1090_1794 234
694 3300046616 Ga0495668_0007244 Ga0495668_0007244_1510_2214 234
695 3300046642 Ga0495634_0077167 Ga0495634_0077167_147_851 234
696 3300046648 Ga0495611_0015546 Ga0495611_0015546_505_1209 234
697 3300046660 Ga0495625_0004364 Ga0495625_0004364_799_1503 234
698 3300046660 Ga0495625_0044036 Ga0495625_0044036_1870_2574 234
699 3300046660 Ga0495625_0205281 Ga0495625_0205281_418_1146 234
700 3300046660 Ga0495625_0409653 Ga0495625_0409653_60_764 234
701 3300046665 Ga0495661_0142024 Ga0495661_0142024_314_1018 234
702 3300046674 Ga0495588_0100587 Ga0495588_0100587_529_1233 234
703 3300046690 Ga0495624_0081841 Ga0495624_0081841_271_975 234
704 3300046692 Ga0495671_0139155 Ga0495671_0139155_81_815 234
705 3300046694 Ga0495649_0025304 Ga0495649_0025304_104_808 234
706 3300046694 Ga0495649_0157157 Ga0495649_0157157_357_1061 234
707 3300046809 Ga0495600_0070820 Ga0495600_0070820_1160_1864 234
708 3300046810 Ga0495660_0028650 Ga0495660_0028650_1352_2056 234
709 3300047317 Ga0495604_0020147 Ga0495604_0020147_825_1529 234
710 3300047318 Ga0495636_0010645 Ga0495636_0010645_596_1300 234
711 3300047320 Ga0495672_0015932 Ga0495672_0015932_4026_4730 234
712 3300047323 Ga0495683_0017508 Ga0495683_0017508_1490_2194 234
713 3300047443 Ga0495687_057508 Ga0495687_057508_59_763 234
714 3300047443 Ga0495687_125710 Ga0495687_125710_199_903 234
715 3300047447 Ga0495685_052846 Ga0495685_052846_352_1056 234
716 3300047470 Ga0495681_0092572 Ga0495681_0092572_89_793 234
717 3300047472 Ga0495686_0000688 Ga0495686_0000688_33108_33812 234
718 3300047472 Ga0495686_0007326 Ga0495686_0007326_470_1201 234
719 3300047472 Ga0495686_0019662 Ga0495686_0019662_1414_2118 234
720 3300047472 Ga0495686_0066988 Ga0495686_0066988_1333_2037 234
721 3300047472 Ga0495686_0231443 Ga0495686_0231443_18_746 234
722 3300047472 Ga0495686_0289687 Ga0495686_0289687_37_741 234
723 3300048090 Ga0495615_0006719 Ga0495615_0006719_348_1052 234
724 3300048904 Ga0496101_0166779 Ga0496101_0166779_440_1144 234
725 3300048905 Ga0496102_0006951 Ga0496102_0006951_4163_4867 234
726 3300048906 Ga0496103_0006250 Ga0496103_0006250_3047_3751 234
727 3300048909 Ga0496106_0007956 Ga0496106_0007956_3598_4302 234
728 3300048909 Ga0496106_0073382 Ga0496106_0073382_1865_2569 234
729 3300048916 Ga0496113_0047872 Ga0496113_0047872_595_1299 234
730 3300048916 Ga0496113_0379103 Ga0496113_0379103_50_754 234
731 3300048919 Ga0496116_0019214 Ga0496116_0019214_1379_2083 234
732 3300048919 Ga0496116_0026581 Ga0496116_0026581_1389_2093 234
733 3300048919 Ga0496116_0042281 Ga0496116_0042281_1197_1901 234
734 3300048919 Ga0496116_0074978 Ga0496116_0074978_1361_2065 234
735 3300048919 Ga0496116_0081922 Ga0496116_0081922_751_1455 234
736 3300048919 Ga0496116_0176274 Ga0496116_0176274_242_949 234
737 3300048920 Ga0496117_0004211 Ga0496117_0004211_10571_11275 234
738 3300048920 Ga0496117_0007443 Ga0496117_0007443_2834_3538 234
739 3300048920 Ga0496117_0039979 Ga0496117_0039979_53_757 234
740 3300048920 Ga0496117_0101682 Ga0496117_0101682_237_941 234
741 3300048920 Ga0496117_0160544 Ga0496117_0160544_425_1129 234
742 3300048921 Ga0496118_0008854 Ga0496118_0008854_4923_5627 234
743 3300048921 Ga0496118_0009023 Ga0496118_0009023_1098_1802 234
744 3300048921 Ga0496118_0016254 Ga0496118_0016254_2528_3232 234
745 3300048921 Ga0496118_0022988 Ga0496118_0022988_3638_4342 234
746 3300048922 Ga0496119_0011852 Ga0496119_0011852_4680_5384 234
747 3300048922 Ga0496119_0016635 Ga0496119_0016635_207_911 234
748 3300048923 Ga0496120_0003587 Ga0496120_0003587_2565_3269 234
749 3300048923 Ga0496120_0108845 Ga0496120_0108845_330_1034 234
750 3300048924 Ga0496121_0000581 Ga0496121_0000581_55380_56090 234
751 3300048924 Ga0496121_0005515 Ga0496121_0005515_10677_11381 234
752 3300048924 Ga0496121_0006088 Ga0496121_0006088_8023_8727 234
753 3300048924 Ga0496121_0009856 Ga0496121_0009856_3953_4687 234
754 3300048924 Ga0496121_0035493 Ga0496121_0035493_20_724 234
755 3300048924 Ga0496121_0048431 Ga0496121_0048431_652_1356 234
756 3300048924 Ga0496121_0053577 Ga0496121_0053577_534_1238 234
757 3300048924 Ga0496121_0072341 Ga0496121_0072341_584_1288 234
758 3300048924 Ga0496121_0126312 Ga0496121_0126312_70_774 234
759 3300048924 Ga0496121_0213114 Ga0496121_0213114_555_1283 234
760 3300048924 Ga0496121_0300078 Ga0496121_0300078_106_810 234
761 3300048925 Ga0496122_0018408 Ga0496122_0018408_1940_2644 234
762 3300048925 Ga0496122_0021974 Ga0496122_0021974_1226_1930 234
763 3300048925 Ga0496122_0026276 Ga0496122_0026276_33_737 234
764 3300048925 Ga0496122_0033043 Ga0496122_0033043_705_1409 234
765 3300048925 Ga0496122_0039858 Ga0496122_0039858_2845_3549 234
766 3300048925 Ga0496122_0041423 Ga0496122_0041423_1292_1996 234
767 3300048925 Ga0496122_0049563 Ga0496122_0049563_1166_1870 234
768 3300048925 Ga0496122_0073942 Ga0496122_0073942_63_767 234
769 3300048926 Ga0496123_0005995 Ga0496123_0005995_6324_7028 234
770 3300048926 Ga0496123_0007612 Ga0496123_0007612_4649_5353 234
771 3300048926 Ga0496123_0025599 Ga0496123_0025599_2811_3515 234
772 3300048926 Ga0496123_0026213 Ga0496123_0026213_2485_3189 234
773 3300048926 Ga0496123_0042850 Ga0496123_0042850_667_1371 234
774 3300048926 Ga0496123_0081438 Ga0496123_0081438_1113_1817 234
775 3300048926 Ga0496123_0164043 Ga0496123_0164043_190_894 234
776 3300048926 Ga0496123_0182720 Ga0496123_0182720_219_923 234
777 3300048927 Ga0496124_0004941 Ga0496124_0004941_1389_2093 234
778 3300048927 Ga0496124_0035902 Ga0496124_0035902_207_911 234
779 3300048927 Ga0496124_0038092 Ga0496124_0038092_477_1181 234
780 3300048927 Ga0496124_0050244 Ga0496124_0050244_1205_1909 234
781 3300048927 Ga0496124_0062089 Ga0496124_0062089_1205_1909 234
782 3300048927 Ga0496124_0068333 Ga0496124_0068333_1614_2348 234
783 3300048927 Ga0496124_0257429 Ga0496124_0257429_142_846 234
784 3300048928 Ga0496125_0002192 Ga0496125_0002192_1298_2002 234
785 3300048928 Ga0496125_0009453 Ga0496125_0009453_4798_5502 234
786 3300048929 Ga0496126_0017025 Ga0496126_0017025_1827_2531 234
787 3300048929 Ga0496126_0104013 Ga0496126_0104013_1348_2052 234
788 3300048929 Ga0496126_0222981 Ga0496126_0222981_466_1170 234
789 3300049459 Ga0495678_008193 Ga0495678_008193_1968_2672 234
790 3300049459 Ga0495678_008483 Ga0495678_008483_3641_4345 234
791 3300049459 Ga0495678_070657 Ga0495678_070657_379_1113 234
792 3300049460 Ga0495682_0051415 Ga0495682_0051415_566_1270 234
793 3300049569 Ga0501032_0082367 Ga0501032_0082367_448_1281 234
794 3300049569 Ga0501032_0098084 Ga0501032_0098084_274_978 234
795 3300049570 Ga0501033_0000986 Ga0501033_0000986_16643_17347 234
796 3300049571 Ga0501034_0365055 Ga0501034_0365055_600_1304 234
797 3300049572 Ga0501036_0086253 Ga0501036_0086253_525_1358 234
798 3300049575 Ga0501039_0102104 Ga0501039_0102104_1087_1920 234
799 3300049579 Ga0501043_0295347 Ga0501043_0295347_525_1229 234
800 3300049580 Ga0501046_0206111 Ga0501046_0206111_631_1335 234
801 3300049581 Ga0501047_0204311 Ga0501047_0204311_565_1269 234
802 3300049582 Ga0501048_0194381 Ga0501048_0194381_539_1372 234
803 3300049584 Ga0501068_0079644 Ga0501068_0079644_493_1197 234
804 3300049589 Ga0501073_0028289 Ga0501073_0028289_1444_2148 234
805 3300049742 Ga0501080_0098860 Ga0501080_0098860_46_750 234
806 3300049776 Ga0501280_001569 Ga0501280_001569_2911_3618 234
807 3300049822 Ga0501035_0001767 Ga0501035_0001767_19541_20245 234
808 3300049822 Ga0501035_0203277 Ga0501035_0203277_492_1325 234
809 3300049823 Ga0501044_0074123 Ga0501044_0074123_827_1660 234
810 3300050489 nmdc:mga03683_59285_c1 nmdc:mga03683_59285_c1_377_1090 234
811 3300050491 nmdc:mga00v17_133_c2 nmdc:mga00v17_133_c2_11962_12672 234
812 3300050492 nmdc:mga0yw44_38792_c1 nmdc:mga0yw44_38792_c1_12_1040 234
813 3300050493 nmdc:mga0k408_54169_c1 nmdc:mga0k408_54169_c1_773_1477 234
814 3300050494 nmdc:mga06z11_64413_c1 nmdc:mga06z11_64413_c1_111_815 234
815 3300050496 nmdc:mga07m45_131759_c1 nmdc:mga07m45_131759_c1_201_923 234
816 3300050516 nmdc:mga0sz30_68451_c1 nmdc:mga0sz30_68451_c1_640_1344 234
817 3300053079 Ga0500610_0051524 Ga0500610_0051524_604_1308 234
818 3300053086 Ga0500578_0108565 Ga0500578_0108565_922_1626 234
819 3300053090 Ga0500646_0060954 Ga0500646_0060954_331_1035 234
820 3300053098 Ga0500650_0049985 Ga0500650_0049985_792_1496 234
821 3300053104 Ga0500556_0051888 Ga0500556_0051888_417_1121 234
822 3300053105 Ga0500557_019144 Ga0500557_019144_285_989 234
823 3300053109 Ga0500569_003997 Ga0500569_003997_481_1185 234
824 3300053118 Ga0500594_0001496 Ga0500594_0001496_1954_2658 234
825 3300053118 Ga0500594_0016853 Ga0500594_0016853_15_719 234
826 3300053121 Ga0500607_163219 Ga0500607_163219_125_829 234
827 3300053125 Ga0500618_000046 Ga0500618_000046_89466_90194 234
828 3300053125 Ga0500618_013268 Ga0500618_013268_556_1260 234
829 3300053125 Ga0500618_017561 Ga0500618_017561_834_1538 234
830 3300053134 Ga0500658_0000767 Ga0500658_0000767_3042_3746 234
831 3300053134 Ga0500658_0038470 Ga0500658_0038470_654_1358 234
832 3300053139 Ga0500568_0002150 Ga0500568_0002150_7174_7878 234
833 3300053139 Ga0500568_0014071 Ga0500568_0014071_2776_3480 234
834 3300053140 Ga0500573_0001555 Ga0500573_0001555_3545_4282 234
835 3300053142 Ga0500577_0066311 Ga0500577_0066311_134_838 234
836 3300053142 Ga0500577_0166121 Ga0500577_0166121_171_875 234
837 3300053148 Ga0500590_000222 Ga0500590_000222_15501_16205 234
838 3300053153 Ga0500616_0009546 Ga0500616_0009546_4157_4861 234
839 3300053153 Ga0500616_0155131 Ga0500616_0155131_125_829 234
840 3300053156 Ga0500622_0000653 Ga0500622_0000653_4427_5131 234
841 3300053160 Ga0500633_0018749 Ga0500633_0018749_1239_1943 234
842 3300053160 Ga0500633_0054053 Ga0500633_0054053_253_957 234
843 3300060353 Ga0501082_0040155 Ga0501082_0040155_761_1465 234
844 3300061719 Ga0466962_0161745 Ga0466962_0161745_63_791 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

6

183

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pke-assembly1.cif.gz_A crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9449 1 233
3ddh-assembly1.cif.gz_A the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9201 5 230
2pke-assembly1.cif.gz_B crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9145 4 233
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9121 1 234
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9082 1 234
ID Description Score Start End Superfamily
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9597 22 100 1.10.150.240
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9363 22 100 1.10.150.240
2pkeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8908 98 233 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8599 105 199 3.40.50.1000
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8592 3 234 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A527HAS5-F1-model_v4 HAD family hydrolase 0.9925 145 233 GO:0016787
AF-A0A2N2XIM3-F1-model_v4 deleted 0.9913 6 149
AF-A0A1I0C3C8-F1-model_v4 Putative hydrolase of the HAD superfamily 0.9909 11 97 GO:0016787
AF-A0A259DCA7-F1-model_v4 HAD family hydrolase 0.9883 6 129 GO:0016787
AF-A0A3M2DJN1-F1-model_v4 HAD family hydrolase 0.9864 3 192 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.9 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map