F483161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 842 | 439 | 744 | 217 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2997600082|2997606603 |
| Length | 261 |
| Sequence | TSPSGSTSAASSAGSSAGLSAGLSARSVREKLADARLYLCTDARKRQGDLPEFLDAVLTSGVDIVQLRDKGMEAAEELDHLAVFIEACRRHGKLLAVNDRADVAHAIGSDVLHLGQGDLPVPAARAILGQDVLIGRSTHAEAEVDAAVAQPGVDYFCTGPCWPTPTKPGRPAPGLSLVRYTAALRPSRPWFAIGGIDASNLDEVLEAGARRIVVVRAITAADDPAEAAASLAKRVRSAQGPSNHRQSAGGIRTAGHDTDKR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 5 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 6 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 7 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 8 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 9 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 10 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 11 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 12 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 13 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 14 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 15 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 16 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 17 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 18 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 19 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 20 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 21 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 22 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 23 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 24 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 25 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 26 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 27 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 28 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 29 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 30 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 31 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 32 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 33 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 34 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 35 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 36 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 37 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 38 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 39 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 40 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 41 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 42 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 43 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 44 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 45 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 46 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 47 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 48 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 49 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 50 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 51 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 52 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 53 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 54 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 55 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 56 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 57 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 58 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 59 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 60 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 61 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 62 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 63 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 64 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 65 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 66 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 67 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 68 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 69 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 70 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 71 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 72 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 73 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 74 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 75 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 76 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 77 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 78 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 79 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 80 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 81 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 82 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 83 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 84 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 87 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 114 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 115 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 117 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 122 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 124 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 125 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 127 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 128 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 129 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 130 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 131 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 132 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 133 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 136 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 137 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 139 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 140 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 151 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 152 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 153 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 164 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 165 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 210 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 211 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 212 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 213 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 220 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 221 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 226 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 232 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 247 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 248 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 249 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 253 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 254 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 257 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 258 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 261 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 262 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 263 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 264 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 265 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 266 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 371 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 372 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 399 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 409 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 410 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 411 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 412 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 413 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 414 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 415 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 416 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 417 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 419 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 422 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 423 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 424 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 425 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 426 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 427 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 428 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 429 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 430 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 431 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 432 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 433 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 434 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 435 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 436 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 437 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 438 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 439 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88 |
| Metatranscriptomes | 0.24 |
| Isolates | 11.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.38 |
| Nodule | 0.24 |
| Rhizoplane | 2.85 |
| Rhizosphere | 82.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10018911 | 3300003316 | Bacteria | 2270 |
| 2 | rootH1_10018911 | 3300003323 | Bacteria | 5599 |
| 3 | rootH2_10046870 | 3300003320 | Bacteria | 1213 |
| 4 | rootH2_10131917 | 3300003320 | Bacteria | 3824 |
| 5 | rootH1_10049521 | 3300003323 | Bacteria | 3166 |
| 6 | Ga0070658_10032082 | 3300005327 | Bacteria | 4223 |
| 7 | Ga0070658_10143423 | 3300005327 | Bacteria | 1996 |
| 8 | Ga0070690_100166820 | 3300005330 | Bacteria | 1513 |
| 9 | Ga0070677_10105815 | 3300005333 | Bacteria | 1248 |
| 10 | Ga0070660_100009722 | 3300005339 | Bacteria | 6778 |
| 11 | Ga0070691_10121144 | 3300005341 | Bacteria | 1317 |
| 12 | Ga0070687_100014648 | 3300005343 | Bacteria | 3526 |
| 13 | Ga0070661_100049902 | 3300005344 | Bacteria | 3063 |
| 14 | Ga0070668_100466255 | 3300005347 | Bacteria | 1088 |
| 15 | Ga0070675_100105883 | 3300005354 | Bacteria | 2373 |
| 16 | Ga0070671_100001069 | 3300005355 | Bacteria | 20212 |
| 17 | Ga0070671_100186242 | 3300005355 | Bacteria | 1759 |
| 18 | Ga0070673_100382182 | 3300005364 | Bacteria | 1255 |
| 19 | Ga0070667_100258653 | 3300005367 | Bacteria | 1558 |
| 20 | Ga0070709_10021433 | 3300005434 | Bacteria | 3763 |
| 21 | Ga0070709_10048179 | 3300005434 | Bacteria | 2658 |
| 22 | Ga0070714_100111539 | 3300005435 | Bacteria | 2422 |
| 23 | Ga0070714_100133749 | 3300005435 | Bacteria | 2218 |
| 24 | Ga0070714_100293934 | 3300005435 | Bacteria | 1512 |
| 25 | Ga0070714_100466905 | 3300005435 | Bacteria | 1200 |
| 26 | Ga0070714_100594467 | 3300005435 | Bacteria | 1062 |
| 27 | Ga0070714_101042375 | 3300005435 | Bacteria | 796 |
| 28 | Ga0070714_101165846 | 3300005435 | Bacteria | 751 |
| 29 | Ga0070713_100028588 | 3300005436 | Bacteria | 4403 |
| 30 | Ga0070713_100366054 | 3300005436 | Bacteria | 1340 |
| 31 | Ga0070713_100508447 | 3300005436 | Bacteria | 1137 |
| 32 | Ga0070713_100536307 | 3300005436 | Bacteria | 1107 |
| 33 | Ga0070710_10090980 | 3300005437 | Bacteria | 1799 |
| 34 | Ga0070711_100164630 | 3300005439 | Bacteria | 1684 |
| 35 | Ga0070711_100269290 | 3300005439 | Bacteria | 1343 |
| 36 | Ga0070711_100468666 | 3300005439 | Bacteria | 1033 |
| 37 | Ga0070705_100043008 | 3300005440 | Bacteria | 2586 |
| 38 | Ga0070700_100000046 | 3300005441 | Bacteria | 91380 |
| 39 | Ga0070708_100014738 | 3300005445 | Bacteria | 6440 |
| 40 | Ga0070708_100144239 | 3300005445 | Bacteria | 2210 |
| 41 | Ga0070708_100685516 | 3300005445 | Unclassified | 965 |
| 42 | Ga0070663_100008380 | 3300005455 | Bacteria | 6354 |
| 43 | Ga0070678_100070844 | 3300005456 | Bacteria | 2608 |
| 44 | Ga0070662_100058592 | 3300005457 | Bacteria | 2803 |
| 45 | Ga0070681_10263183 | 3300005458 | Bacteria | 1636 |
| 46 | Ga0070706_100022411 | 3300005467 | Bacteria | 5814 |
| 47 | Ga0070706_100061305 | 3300005467 | Bacteria | 3473 |
| 48 | Ga0070706_100061882 | 3300005467 | Bacteria | 3457 |
| 49 | Ga0070706_100112598 | 3300005467 | Bacteria | 2533 |
| 50 | Ga0070707_100011319 | 3300005468 | Bacteria | 8316 |
| 51 | Ga0070707_100030611 | 3300005468 | Bacteria | 5125 |
| 52 | Ga0070707_100033248 | 3300005468 | Bacteria | 4917 |
| 53 | Ga0070707_100058044 | 3300005468 | Bacteria | 3712 |
| 54 | Ga0070707_100077848 | 3300005468 | Bacteria | 3199 |
| 55 | Ga0070707_100188039 | 3300005468 | Bacteria | 2013 |
| 56 | Ga0070698_100006962 | 3300005471 | Bacteria | 12243 |
| 57 | Ga0070698_100017421 | 3300005471 | Bacteria | 7572 |
| 58 | Ga0070698_100025287 | 3300005471 | Bacteria | 6187 |
| 59 | Ga0070698_100232996 | 3300005471 | Bacteria | 1775 |
| 60 | Ga0070698_100432145 | 3300005471 | Bacteria | 1251 |
| 61 | Ga0070698_100700195 | 3300005471 | Bacteria | 955 |
| 62 | Ga0070699_100004942 | 3300005518 | Bacteria | 11759 |
| 63 | Ga0070699_100224520 | 3300005518 | Bacteria | 1674 |
| 64 | Ga0070679_100257671 | 3300005530 | Bacteria | 1700 |
| 65 | Ga0070684_100036331 | 3300005535 | Bacteria | 4221 |
| 66 | Ga0070684_100198413 | 3300005535 | Bacteria | 1827 |
| 67 | Ga0070697_100203822 | 3300005536 | Bacteria | 1682 |
| 68 | Ga0068853_100209148 | 3300005539 | Bacteria | 1778 |
| 69 | Ga0068853_100415085 | 3300005539 | Bacteria | 1261 |
| 70 | Ga0070696_100115308 | 3300005546 | Bacteria | 1938 |
| 71 | Ga0070693_100109567 | 3300005547 | Bacteria | 1696 |
| 72 | Ga0070665_100006798 | 3300005548 | Bacteria | 11628 |
| 73 | Ga0070665_100163185 | 3300005548 | Bacteria | 2230 |
| 74 | Ga0070704_100097907 | 3300005549 | Bacteria | 2203 |
| 75 | Ga0068855_100028602 | 3300005563 | Bacteria | 6668 |
| 76 | Ga0068855_100032082 | 3300005563 | Bacteria | 6271 |
| 77 | Ga0068855_100189698 | 3300005563 | Bacteria | 2319 |
| 78 | Ga0068855_100845652 | 3300005563 | Bacteria | 970 |
| 79 | Ga0070664_100216629 | 3300005564 | Bacteria | 1712 |
| 80 | Ga0068857_100021276 | 3300005577 | Bacteria | 5709 |
| 81 | Ga0068854_100529855 | 3300005578 | Bacteria | 996 |
| 82 | Ga0070702_100554650 | 3300005615 | Bacteria | 854 |
| 83 | Ga0068852_100135991 | 3300005616 | Bacteria | 2269 |
| 84 | Ga0068852_100230554 | 3300005616 | Bacteria | 1765 |
| 85 | Ga0068859_100214382 | 3300005617 | Bacteria | 2012 |
| 86 | Ga0068864_100069457 | 3300005618 | Bacteria | 3063 |
| 87 | Ga0068863_100127901 | 3300005841 | Bacteria | 2424 |
| 88 | Ga0068863_100403030 | 3300005841 | Bacteria | 1338 |
| 89 | Ga0068860_100156092 | 3300005843 | Bacteria | 2199 |
| 90 | Ga0081455_10037754 | 3300005937 | Bacteria | 4284 |
| 91 | Ga0081540_1001003 | 3300005983 | Bacteria | 25342 |
| 92 | Ga0070717_10056517 | 3300006028 | Bacteria | 3242 |
| 93 | Ga0070717_10347505 | 3300006028 | Bacteria | 1325 |
| 94 | Ga0070717_10451466 | 3300006028 | Bacteria | 1158 |
| 95 | Ga0070717_10690351 | 3300006028 | Bacteria | 927 |
| 96 | Ga0070715_10009652 | 3300006163 | Bacteria | 3410 |
| 97 | Ga0070715_10029481 | 3300006163 | Bacteria | 2210 |
| 98 | Ga0070716_100056492 | 3300006173 | Bacteria | 2251 |
| 99 | Ga0070712_100068471 | 3300006175 | Bacteria | 2529 |
| 100 | Ga0070712_100071771 | 3300006175 | Bacteria | 2478 |
| 101 | Ga0070712_100083205 | 3300006175 | Bacteria | 2323 |
| 102 | Ga0070712_100098410 | 3300006175 | Bacteria | 2158 |
| 103 | Ga0097621_100024958 | 3300006237 | Bacteria | 4673 |
| 104 | Ga0068871_100103140 | 3300006358 | Bacteria | 2391 |
| 105 | Ga0075434_100317411 | 3300006871 | Bacteria | 1579 |
| 106 | Ga0068865_100671682 | 3300006881 | Bacteria | 882 |
| 107 | Ga0097620_100214382 | 3300006931 | Bacteria | 2012 |
| 108 | Ga0105251_10046387 | 3300009011 | Bacteria | 2091 |
| 109 | Ga0105241_10042041 | 3300009174 | Bacteria | 3456 |
| 110 | Ga0105242_10479412 | 3300009176 | Bacteria | 1179 |
| 111 | Ga0105248_10046817 | 3300009177 | Bacteria | 4849 |
| 112 | Ga0105237_10023191 | 3300009545 | Bacteria | 6362 |
| 113 | Ga0105249_10106568 | 3300009553 | Bacteria | 2644 |
| 114 | Ga0105239_10189981 | 3300010375 | Bacteria | 2299 |
| 115 | Ga0105246_10018005 | 3300011119 | Bacteria | 4499 |
| 116 | Ga0157344_1003718 | 3300012476 | Bacteria | 875 |
| 117 | Ga0157342_1005584 | 3300012507 | Bacteria | 1162 |
| 118 | Ga0157338_1003999 | 3300012515 | Bacteria | 1253 |
| 119 | Ga0157371_10223820 | 3300013102 | Bacteria | 1351 |
| 120 | Ga0157369_10001097 | 3300013105 | Bacteria | 33863 |
| 121 | Ga0157374_10165189 | 3300013296 | Bacteria | 2157 |
| 122 | Ga0157375_10140650 | 3300013308 | Bacteria | 2541 |
| 123 | Ga0163163_10877880 | 3300014325 | Bacteria | 960 |
| 124 | Ga0157380_10090063 | 3300014326 | Bacteria | 2529 |
| 125 | Ga0182008_10002405 | 3300014497 | Bacteria | 11763 |
| 126 | Ga0157377_10066603 | 3300014745 | Bacteria | 2071 |
| 127 | Ga0182007_10000417 | 3300015262 | Bacteria | 26024 |
| 128 | Ga0206356_10014746 | 3300020070 | Bacteria | 1629 |
| 129 | Ga0213876_10009157 | 3300021384 | Bacteria | 5331 |
| 130 | Ga0213875_10000331 | 3300021388 | Bacteria | 44957 |
| 131 | Ga0213875_10011586 | 3300021388 | Bacteria | 4383 |
| 132 | Ga0209758_1018862 | 3300025297 | Bacteria | 3358 |
| 133 | Ga0207426_1001695 | 3300025302 | Bacteria | 17002 |
| 134 | Ga0207426_1006964 | 3300025302 | Bacteria | 4802 |
| 135 | Ga0207653_10045165 | 3300025885 | Bacteria | 1455 |
| 136 | Ga0207692_10026902 | 3300025898 | Bacteria | 2703 |
| 137 | Ga0207692_10052092 | 3300025898 | Bacteria | 2078 |
| 138 | Ga0207692_10151822 | 3300025898 | Bacteria | 1327 |
| 139 | Ga0207688_10003920 | 3300025901 | Bacteria | 8114 |
| 140 | Ga0207647_10012829 | 3300025904 | Bacteria | 5822 |
| 141 | Ga0207699_10005049 | 3300025906 | Bacteria | 6312 |
| 142 | Ga0207699_10032148 | 3300025906 | Bacteria | 2954 |
| 143 | Ga0207699_10056834 | 3300025906 | Bacteria | 2334 |
| 144 | Ga0207699_10061155 | 3300025906 | Bacteria | 2265 |
| 145 | Ga0207645_10020916 | 3300025907 | Bacteria | 4274 |
| 146 | Ga0207643_10010462 | 3300025908 | Bacteria | 4997 |
| 147 | Ga0207705_10009924 | 3300025909 | Bacteria | 6932 |
| 148 | Ga0207705_10279423 | 3300025909 | Bacteria | 1278 |
| 149 | Ga0207684_10035694 | 3300025910 | Bacteria | 4221 |
| 150 | Ga0207684_10036572 | 3300025910 | Bacteria | 4167 |
| 151 | Ga0207654_10036955 | 3300025911 | Bacteria | 2732 |
| 152 | Ga0207707_10247138 | 3300025912 | Bacteria | 1550 |
| 153 | Ga0207707_10375231 | 3300025912 | Bacteria | 1223 |
| 154 | Ga0207695_10084491 | 3300025913 | Bacteria | 3205 |
| 155 | Ga0207693_10044829 | 3300025915 | Bacteria | 3475 |
| 156 | Ga0207693_10048524 | 3300025915 | Bacteria | 3334 |
| 157 | Ga0207693_10055008 | 3300025915 | Bacteria | 3122 |
| 158 | Ga0207663_10102646 | 3300025916 | Bacteria | 1924 |
| 159 | Ga0207657_10010424 | 3300025919 | Bacteria | 9277 |
| 160 | Ga0207652_10035870 | 3300025921 | Bacteria | 4189 |
| 161 | Ga0207646_10010187 | 3300025922 | Bacteria | 9206 |
| 162 | Ga0207646_10012121 | 3300025922 | Bacteria | 8298 |
| 163 | Ga0207646_10040561 | 3300025922 | Bacteria | 4186 |
| 164 | Ga0207646_10051833 | 3300025922 | Bacteria | 3671 |
| 165 | Ga0207646_10206437 | 3300025922 | Bacteria | 1774 |
| 166 | Ga0207694_10255328 | 3300025924 | Bacteria | 1435 |
| 167 | Ga0207650_10181194 | 3300025925 | Bacteria | 1679 |
| 168 | Ga0207700_10059527 | 3300025928 | Bacteria | 2889 |
| 169 | Ga0207700_10064776 | 3300025928 | Bacteria | 2785 |
| 170 | Ga0207700_10148750 | 3300025928 | Bacteria | 1933 |
| 171 | Ga0207700_10482663 | 3300025928 | Bacteria | 1095 |
| 172 | Ga0207700_10862652 | 3300025928 | Bacteria | 810 |
| 173 | Ga0207664_10000001 | 3300025929 | Bacteria | 724213 |
| 174 | Ga0207664_10020356 | 3300025929 | Bacteria | 4916 |
| 175 | Ga0207664_10158406 | 3300025929 | Bacteria | 1929 |
| 176 | Ga0207664_10487935 | 3300025929 | Bacteria | 1102 |
| 177 | Ga0207664_10554068 | 3300025929 | Bacteria | 1032 |
| 178 | Ga0207644_10001360 | 3300025931 | Bacteria | 15731 |
| 179 | Ga0207644_10406452 | 3300025931 | Bacteria | 1114 |
| 180 | Ga0207706_10026322 | 3300025933 | Bacteria | 5206 |
| 181 | Ga0207686_10024265 | 3300025934 | Bacteria | 3512 |
| 182 | Ga0207670_10136158 | 3300025936 | Bacteria | 1806 |
| 183 | Ga0207665_10006674 | 3300025939 | Bacteria | 7658 |
| 184 | Ga0207665_10471257 | 3300025939 | Bacteria | 966 |
| 185 | Ga0207689_10106006 | 3300025942 | Bacteria | 2309 |
| 186 | Ga0207661_10159922 | 3300025944 | Bacteria | 1954 |
| 187 | Ga0207667_10057556 | 3300025949 | Bacteria | 4080 |
| 188 | Ga0207667_10119316 | 3300025949 | Bacteria | 2718 |
| 189 | Ga0207667_10770070 | 3300025949 | Bacteria | 961 |
| 190 | Ga0207640_10276448 | 3300025981 | Bacteria | 1317 |
| 191 | Ga0207658_10135834 | 3300025986 | Bacteria | 1983 |
| 192 | Ga0207639_10172234 | 3300026041 | Bacteria | 1834 |
| 193 | Ga0207678_10717393 | 3300026067 | Bacteria | 880 |
| 194 | Ga0207708_10000002 | 3300026075 | Bacteria | 411071 |
| 195 | Ga0207702_10016152 | 3300026078 | Bacteria | 6180 |
| 196 | Ga0207641_10024402 | 3300026088 | Bacteria | 4984 |
| 197 | Ga0207641_10927815 | 3300026088 | Bacteria | 865 |
| 198 | Ga0207675_100402395 | 3300026118 | Bacteria | 1349 |
| 199 | Ga0207683_10008335 | 3300026121 | Bacteria | 8866 |
| 200 | Ga0207698_10010090 | 3300026142 | Bacteria | 6049 |
| 201 | Ga0209813_10006896 | 3300027866 | Bacteria | 2817 |
| 202 | Ga0268266_10044101 | 3300028379 | Bacteria | 3811 |
| 203 | Ga0268266_10114600 | 3300028379 | Bacteria | 2392 |
| 204 | Ga0268264_10131684 | 3300028381 | Bacteria | 2218 |
| 205 | Ga0307517_10003383 | 3300028786 | Bacteria | 24818 |
| 206 | Ga0307517_10009169 | 3300028786 | Bacteria | 14079 |
| 207 | Ga0307517_10258779 | 3300028786 | Bacteria | 1013 |
| 208 | Ga0307515_10005348 | 3300028794 | Bacteria | 26076 |
| 209 | Ga0307511_10001143 | 3300030521 | Bacteria | 28236 |
| 210 | Ga0307511_10004831 | 3300030521 | Bacteria | 13778 |
| 211 | Ga0307512_10005460 | 3300030522 | Bacteria | 13266 |
| 212 | Ga0307512_10042832 | 3300030522 | Bacteria | 3743 |
| 213 | Ga0316176_1058730 | 3300030732 | Bacteria | 1102 |
| 214 | Ga0307513_10003780 | 3300031456 | Bacteria | 20423 |
| 215 | Ga0307509_10007629 | 3300031507 | Bacteria | 14065 |
| 216 | Ga0307509_10034109 | 3300031507 | Bacteria | 5595 |
| 217 | Ga0307509_10043365 | 3300031507 | Bacteria | 4868 |
| 218 | Ga0307509_10219510 | 3300031507 | Bacteria | 1716 |
| 219 | Ga0307509_10415778 | 3300031507 | Bacteria | 1047 |
| 220 | Ga0307508_10001228 | 3300031616 | Bacteria | 29284 |
| 221 | Ga0307508_10008698 | 3300031616 | Bacteria | 9371 |
| 222 | Ga0307508_10010547 | 3300031616 | Bacteria | 8454 |
| 223 | Ga0307508_10101115 | 3300031616 | Bacteria | 2478 |
| 224 | Ga0307508_10150836 | 3300031616 | Bacteria | 1929 |
| 225 | Ga0307514_10009106 | 3300031649 | Bacteria | 8379 |
| 226 | Ga0307514_10048682 | 3300031649 | Bacteria | 3299 |
| 227 | Ga0307514_10206757 | 3300031649 | Bacteria | 1225 |
| 228 | Ga0307514_10256189 | 3300031649 | Bacteria | 1030 |
| 229 | Ga0307516_10010490 | 3300031730 | Bacteria | 10174 |
| 230 | Ga0307516_10028336 | 3300031730 | Bacteria | 5668 |
| 231 | Ga0307516_10202274 | 3300031730 | Bacteria | 1705 |
| 232 | Ga0307518_10106213 | 3300031838 | Bacteria | 2005 |
| 233 | Ga0307507_10014880 | 3300033179 | Bacteria | 9223 |
| 234 | Ga0307510_10028481 | 3300033180 | Bacteria | 6379 |
| 235 | Ga0307510_10044963 | 3300033180 | Bacteria | 4774 |
| 236 | Ga0307510_10169961 | 3300033180 | Bacteria | 1761 |
| 237 | Ga0373926_0000431 | 3300035083 | Bacteria | 10840 |
| 238 | Ga0373934_0060672 | 3300035086 | Bacteria | 1506 |
| 239 | Ga0373944_0001774 | 3300035089 | Bacteria | 5448 |
| 240 | Ga0373923_0004370 | 3300035111 | Bacteria | 4685 |
| 241 | Ga0373923_0005743 | 3300035111 | Bacteria | 4233 |
| 242 | Ga0373923_0092196 | 3300035111 | Bacteria | 1326 |
| 243 | Ga0373936_0000300 | 3300035113 | Bacteria | 16641 |
| 244 | Ga0373936_0003136 | 3300035113 | Bacteria | 6190 |
| 245 | Ga0373936_0028740 | 3300035113 | Bacteria | 2186 |
| 246 | Ga0373936_0121546 | 3300035113 | Bacteria | 1116 |
| 247 | Ga0373945_0000621 | 3300035116 | Bacteria | 10201 |
| 248 | Ga0373945_0000765 | 3300035116 | Bacteria | 9383 |
| 249 | Ga0373953_0010773 | 3300035117 | Bacteria | 3191 |
| 250 | Ga0373953_0017014 | 3300035117 | Bacteria | 2665 |
| 251 | Ga0373953_0046444 | 3300035117 | Bacteria | 1743 |
| 252 | Ga0373954_0012718 | 3300035118 | Bacteria | 3746 |
| 253 | Ga0373954_0060510 | 3300035118 | Bacteria | 1786 |
| 254 | Ga0373956_0032315 | 3300035119 | Bacteria | 2296 |
| 255 | Ga0373956_0066949 | 3300035119 | Bacteria | 1634 |
| 256 | Ga0373957_0004859 | 3300035120 | Bacteria | 4122 |
| 257 | Ga0373957_0013131 | 3300035120 | Bacteria | 2804 |
| 258 | Ga0373957_0035114 | 3300035120 | Bacteria | 1861 |
| 259 | Ga0373960_0036014 | 3300035121 | Bacteria | 1407 |
| 260 | Ga0373943_0000210 | 3300035170 | Bacteria | 23878 |
| 261 | Ga0373943_0000853 | 3300035170 | Bacteria | 13451 |
| 262 | Ga0373943_0049300 | 3300035170 | Bacteria | 2066 |
| 263 | Ga0373946_0000853 | 3300035171 | Bacteria | 10469 |
| 264 | Ga0373946_0000901 | 3300035171 | Bacteria | 10211 |
| 265 | Ga0373955_0007658 | 3300035172 | Bacteria | 4973 |
| 266 | Ga0373955_0053068 | 3300035172 | Bacteria | 2212 |
| 267 | Ga0373955_0096188 | 3300035172 | Bacteria | 1694 |
| 268 | Ga0373942_0148961 | 3300035207 | Bacteria | 750 |
| 269 | Ga0373961_0087311 | 3300035241 | Bacteria | 991 |
| 270 | Ga0373924_0003757 | 3300035410 | Bacteria | 5246 |
| 271 | Ga0373931_0237587 | 3300035691 | Bacteria | 1103 |
| 272 | Ga0373935_0015120 | 3300035692 | Bacteria | 4660 |
| 273 | Ga0373935_0021479 | 3300035692 | Bacteria | 3953 |
| 274 | Ga0373935_0159123 | 3300035692 | Bacteria | 1538 |
| 275 | Ga0373935_0216968 | 3300035692 | Bacteria | 1327 |
| 276 | Ga0373927_0001724 | 3300035695 | Bacteria | 16345 |
| 277 | Ga0373927_0003506 | 3300035695 | Bacteria | 11230 |
| 278 | Ga0373927_0139879 | 3300035695 | Bacteria | 1583 |
| 279 | Ga0373927_0261318 | 3300035695 | Bacteria | 1139 |
| 280 | Ga0373933_0007376 | 3300035724 | Bacteria | 5997 |
| 281 | Ga0373933_0010418 | 3300035724 | Bacteria | 5096 |
| 282 | Ga0373933_0010620 | 3300035724 | Bacteria | 5049 |
| 283 | Ga0373933_0180163 | 3300035724 | Bacteria | 1347 |
| 284 | Ga0373947_0000745 | 3300035725 | Bacteria | 19507 |
| 285 | Ga0373947_0012919 | 3300035725 | Bacteria | 4787 |
| 286 | Ga0373937_0047927 | 3300036401 | Bacteria | 3909 |
| 287 | Ga0373937_0196205 | 3300036401 | Bacteria | 1897 |
| 288 | Ga0373937_0196588 | 3300036401 | Bacteria | 1895 |
| 289 | Ga0373937_0512640 | 3300036401 | Bacteria | 1139 |
| 290 | Ga0373925_0000989 | 3300037068 | Bacteria | 25847 |
| 291 | Ga0373925_0001802 | 3300037068 | Bacteria | 17862 |
| 292 | Ga0373925_0010631 | 3300037068 | Bacteria | 6674 |
| 293 | Ga0373925_0053289 | 3300037068 | Bacteria | 3023 |
| 294 | Ga0373925_0152526 | 3300037068 | Bacteria | 1815 |
| 295 | Ga0373925_0153026 | 3300037068 | Bacteria | 1812 |
| 296 | Ga0395900_0162181 | 3300037418 | Bacteria | 2280 |
| 297 | Ga0395898_0015773 | 3300037466 | Bacteria | 7743 |
| 298 | Ga0436364_0226463 | 3300037853 | Bacteria | 27340 |
| 299 | Ga0436364_0397039 | 3300037853 | Bacteria | 5442 |
| 300 | Ga0436364_0644841 | 3300037853 | Bacteria | 2837 |
| 301 | Ga0436364_0728232 | 3300037853 | Bacteria | 1227 |
| 302 | Ga0436364_0773303 | 3300037853 | Bacteria | 13655 |
| 303 | Ga0436364_1419474 | 3300037853 | Bacteria | 2456 |
| 304 | Ga0436365_0192020 | 3300039437 | Bacteria | 2176 |
| 305 | Ga0436365_1767487 | 3300039437 | Bacteria | 27437 |
| 306 | Ga0436361_0451808 | 3300039447 | Bacteria | 786 |
| 307 | Ga0436363_0358206 | 3300039450 | Bacteria | 1420 |
| 308 | Ga0436363_0381476 | 3300039450 | Bacteria | 2125 |
| 309 | Ga0436363_1261317 | 3300039450 | Bacteria | 836 |
| 310 | Ga0439436_0000995 | 3300041404 | Bacteria | 7883 |
| 311 | Ga0439439_0001201 | 3300041406 | Bacteria | 5012 |
| 312 | Ga0451837_0619170 | 3300041494 | Bacteria | 4000 |
| 313 | Ga0451853_1087724 | 3300041512 | Bacteria | 4677 |
| 314 | Ga0451853_1223385 | 3300041512 | Bacteria | 2647 |
| 315 | Ga0439433_0001185 | 3300041999 | Bacteria | 5355 |
| 316 | Ga0439442_024467 | 3300042002 | Bacteria | 1256 |
| 317 | Ga0439449_0000937 | 3300042007 | Bacteria | 11406 |
| 318 | Ga0439449_0040989 | 3300042007 | Bacteria | 1721 |
| 319 | Ga0439449_0185097 | 3300042007 | Bacteria | 779 |
| 320 | Ga0439455_0009626 | 3300042012 | Bacteria | 2104 |
| 321 | Ga0439457_026017 | 3300042014 | Bacteria | 1295 |
| 322 | Ga0439457_052461 | 3300042014 | Bacteria | 916 |
| 323 | Ga0439462_0009705 | 3300042015 | Bacteria | 2434 |
| 324 | Ga0450894_000226 | 3300042131 | Bacteria | 10039 |
| 325 | Ga0450896_005131 | 3300042133 | Bacteria | 1783 |
| 326 | Ga0450898_000074 | 3300042134 | Bacteria | 8910 |
| 327 | Ga0450903_000479 | 3300042138 | Bacteria | 8405 |
| 328 | Ga0450906_000163 | 3300042145 | Bacteria | 12452 |
| 329 | Ga0466969_0000457 | 3300044656 | Bacteria | 22464 |
| 330 | Ga0466969_0007599 | 3300044656 | Bacteria | 5762 |
| 331 | Ga0466969_0007733 | 3300044656 | Bacteria | 5714 |
| 332 | Ga0466969_0015982 | 3300044656 | Bacteria | 3933 |
| 333 | Ga0466972_0051678 | 3300044658 | Bacteria | 1982 |
| 334 | Ga0466965_0053650 | 3300044683 | Bacteria | 2004 |
| 335 | Ga0466965_0109447 | 3300044683 | Bacteria | 1419 |
| 336 | Ga0466965_0135122 | 3300044683 | Bacteria | 1281 |
| 337 | Ga0466966_0025078 | 3300044684 | Bacteria | 3897 |
| 338 | Ga0466966_0032287 | 3300044684 | Bacteria | 3394 |
| 339 | Ga0466966_0123527 | 3300044684 | Bacteria | 1589 |
| 340 | Ga0466961_0000804 | 3300044693 | Bacteria | 19562 |
| 341 | Ga0466961_0002459 | 3300044693 | Bacteria | 11491 |
| 342 | Ga0466961_0003433 | 3300044693 | Bacteria | 9887 |
| 343 | Ga0466961_0013690 | 3300044693 | Bacteria | 5198 |
| 344 | Ga0466961_0133384 | 3300044693 | Bacteria | 1556 |
| 345 | Ga0466963_0002973 | 3300044694 | Bacteria | 9576 |
| 346 | Ga0466971_0002384 | 3300044719 | Bacteria | 7938 |
| 347 | Ga0466971_0029345 | 3300044719 | Bacteria | 2460 |
| 348 | Ga0466968_0062563 | 3300044735 | Bacteria | 1607 |
| 349 | Ga0466970_0002761 | 3300044765 | Bacteria | 8475 |
| 350 | Ga0466970_0002932 | 3300044765 | Bacteria | 8269 |
| 351 | Ga0466970_0005496 | 3300044765 | Bacteria | 6290 |
| 352 | Ga0466960_0007064 | 3300044901 | Bacteria | 4539 |
| 353 | Ga0466959_0002676 | 3300045049 | Bacteria | 11432 |
| 354 | Ga0466959_0366594 | 3300045049 | Bacteria | 981 |
| 355 | Ga0466967_0087393 | 3300045976 | Bacteria | 2826 |
| 356 | Ga0466967_0219988 | 3300045976 | Bacteria | 1804 |
| 357 | Ga0466967_0864979 | 3300045976 | Bacteria | 898 |
| 358 | Ga0495617_018522 | 3300046452 | Bacteria | 2354 |
| 359 | Ga0495627_096635 | 3300046453 | Bacteria | 846 |
| 360 | Ga0495592_0003362 | 3300046454 | Bacteria | 11453 |
| 361 | Ga0495592_0007389 | 3300046454 | Bacteria | 8222 |
| 362 | Ga0495592_0012304 | 3300046454 | Bacteria | 6496 |
| 363 | Ga0495592_0305794 | 3300046454 | Bacteria | 1032 |
| 364 | Ga0495603_0000581 | 3300046455 | Bacteria | 20555 |
| 365 | Ga0495603_0002290 | 3300046455 | Bacteria | 11246 |
| 366 | Ga0495603_0010349 | 3300046455 | Bacteria | 5647 |
| 367 | Ga0495603_0014926 | 3300046455 | Bacteria | 4698 |
| 368 | Ga0495603_0185681 | 3300046455 | Bacteria | 1202 |
| 369 | Ga0495629_0001519 | 3300046459 | Bacteria | 18262 |
| 370 | Ga0495629_0005219 | 3300046459 | Bacteria | 9728 |
| 371 | Ga0495629_0007561 | 3300046459 | Bacteria | 8007 |
| 372 | Ga0495629_0008473 | 3300046459 | Bacteria | 7569 |
| 373 | Ga0495629_0020033 | 3300046459 | Bacteria | 4775 |
| 374 | Ga0495629_0025351 | 3300046459 | Bacteria | 4215 |
| 375 | Ga0495629_0034729 | 3300046459 | Bacteria | 3564 |
| 376 | Ga0495629_0059311 | 3300046459 | Bacteria | 2675 |
| 377 | Ga0495629_0076614 | 3300046459 | Bacteria | 2335 |
| 378 | Ga0495638_0019298 | 3300046460 | Bacteria | 4510 |
| 379 | Ga0495638_0318647 | 3300046460 | Bacteria | 832 |
| 380 | Ga0495641_0002279 | 3300046461 | Bacteria | 15262 |
| 381 | Ga0495641_0035142 | 3300046461 | Bacteria | 2365 |
| 382 | Ga0495651_0001048 | 3300046462 | Bacteria | 21410 |
| 383 | Ga0495651_0003279 | 3300046462 | Bacteria | 12422 |
| 384 | Ga0495651_0047653 | 3300046462 | Bacteria | 3312 |
| 385 | Ga0495651_0068380 | 3300046462 | Bacteria | 2708 |
| 386 | Ga0495651_0104129 | 3300046462 | Bacteria | 2107 |
| 387 | Ga0495651_0112862 | 3300046462 | Bacteria | 2007 |
| 388 | Ga0495651_0124443 | 3300046462 | Bacteria | 1889 |
| 389 | Ga0495651_0181068 | 3300046462 | Bacteria | 1491 |
| 390 | Ga0495653_0007471 | 3300046463 | Bacteria | 8938 |
| 391 | Ga0495653_0018529 | 3300046463 | Bacteria | 5651 |
| 392 | Ga0495653_0030171 | 3300046463 | Bacteria | 4321 |
| 393 | Ga0495653_0044209 | 3300046463 | Bacteria | 3457 |
| 394 | Ga0495653_0099009 | 3300046463 | Bacteria | 2116 |
| 395 | Ga0495653_0153327 | 3300046463 | Bacteria | 1607 |
| 396 | Ga0495653_0287368 | 3300046463 | Bacteria | 1077 |
| 397 | Ga0495580_0001275 | 3300046472 | Bacteria | 22209 |
| 398 | Ga0495580_0184671 | 3300046472 | Bacteria | 1439 |
| 399 | Ga0495580_0318087 | 3300046472 | Bacteria | 1058 |
| 400 | Ga0495582_0061116 | 3300046473 | Bacteria | 2080 |
| 401 | Ga0495605_0197204 | 3300046474 | Bacteria | 879 |
| 402 | Ga0495639_0000919 | 3300046475 | Bacteria | 13290 |
| 403 | Ga0495662_0000196 | 3300046476 | Bacteria | 24887 |
| 404 | Ga0495662_0001981 | 3300046476 | Bacteria | 10272 |
| 405 | Ga0495662_0003816 | 3300046476 | Bacteria | 7598 |
| 406 | Ga0495662_0222887 | 3300046476 | Bacteria | 929 |
| 407 | Ga0495664_0003354 | 3300046477 | Bacteria | 8705 |
| 408 | Ga0495664_0005259 | 3300046477 | Bacteria | 7102 |
| 409 | Ga0495664_0069801 | 3300046477 | Bacteria | 2097 |
| 410 | Ga0495664_0119135 | 3300046477 | Bacteria | 1596 |
| 411 | Ga0495664_0390921 | 3300046477 | Bacteria | 836 |
| 412 | Ga0495594_0002455 | 3300046499 | Bacteria | 9644 |
| 413 | Ga0495594_0069558 | 3300046499 | Bacteria | 1955 |
| 414 | Ga0495594_0180531 | 3300046499 | Bacteria | 1201 |
| 415 | Ga0495594_0236458 | 3300046499 | Bacteria | 1041 |
| 416 | Ga0495596_0016515 | 3300046500 | Bacteria | 3065 |
| 417 | Ga0495583_0110431 | 3300046506 | Bacteria | 1166 |
| 418 | Ga0495608_0000625 | 3300046511 | Bacteria | 24370 |
| 419 | Ga0495608_0014214 | 3300046511 | Bacteria | 5523 |
| 420 | Ga0495608_0023923 | 3300046511 | Bacteria | 4179 |
| 421 | Ga0495608_0035569 | 3300046511 | Bacteria | 3358 |
| 422 | Ga0495610_0180754 | 3300046512 | Bacteria | 877 |
| 423 | Ga0495616_0014854 | 3300046513 | Bacteria | 4344 |
| 424 | Ga0495618_0001193 | 3300046514 | Bacteria | 17637 |
| 425 | Ga0495618_0026198 | 3300046514 | Bacteria | 3623 |
| 426 | Ga0495618_0045219 | 3300046514 | Bacteria | 2777 |
| 427 | Ga0495618_0072888 | 3300046514 | Bacteria | 2185 |
| 428 | Ga0495618_0082226 | 3300046514 | Bacteria | 2057 |
| 429 | Ga0495620_0011287 | 3300046515 | Bacteria | 4663 |
| 430 | Ga0495620_0197085 | 3300046515 | Bacteria | 775 |
| 431 | Ga0495628_0004700 | 3300046516 | Bacteria | 12042 |
| 432 | Ga0495628_0016836 | 3300046516 | Bacteria | 6091 |
| 433 | Ga0495628_0058091 | 3300046516 | Bacteria | 3041 |
| 434 | Ga0495628_0090534 | 3300046516 | Bacteria | 2368 |
| 435 | Ga0495628_0158565 | 3300046516 | Bacteria | 1720 |
| 436 | Ga0495628_0199834 | 3300046516 | Bacteria | 1506 |
| 437 | Ga0495628_0249908 | 3300046516 | Bacteria | 1324 |
| 438 | Ga0495628_0344491 | 3300046516 | Bacteria | 1096 |
| 439 | Ga0495630_0003270 | 3300046517 | Bacteria | 11304 |
| 440 | Ga0495630_0015818 | 3300046517 | Bacteria | 5512 |
| 441 | Ga0495630_0033272 | 3300046517 | Bacteria | 3843 |
| 442 | Ga0495630_0137908 | 3300046517 | Bacteria | 1854 |
| 443 | Ga0495630_0173082 | 3300046517 | Bacteria | 1645 |
| 444 | Ga0495631_0003384 | 3300046518 | Bacteria | 8739 |
| 445 | Ga0495632_0046066 | 3300046519 | Bacteria | 2169 |
| 446 | Ga0495643_0015751 | 3300046522 | Bacteria | 4459 |
| 447 | Ga0495648_0099254 | 3300046524 | Bacteria | 1611 |
| 448 | Ga0495666_0002728 | 3300046526 | Bacteria | 8817 |
| 449 | Ga0495666_0002824 | 3300046526 | Bacteria | 8696 |
| 450 | Ga0495666_0009995 | 3300046526 | Bacteria | 4739 |
| 451 | Ga0495666_0294888 | 3300046526 | Bacteria | 734 |
| 452 | Ga0495652_0006871 | 3300046529 | Bacteria | 10532 |
| 453 | Ga0495652_0008008 | 3300046529 | Bacteria | 9690 |
| 454 | Ga0495652_0038041 | 3300046529 | Bacteria | 4171 |
| 455 | Ga0495652_0075703 | 3300046529 | Bacteria | 2794 |
| 456 | Ga0495652_0281190 | 3300046529 | Bacteria | 1218 |
| 457 | Ga0495654_0077346 | 3300046530 | Bacteria | 1566 |
| 458 | Ga0495665_0002201 | 3300046531 | Bacteria | 10553 |
| 459 | Ga0495665_0005244 | 3300046531 | Bacteria | 6985 |
| 460 | Ga0495665_0032653 | 3300046531 | Bacteria | 2785 |
| 461 | Ga0495640_0006759 | 3300046533 | Bacteria | 9049 |
| 462 | Ga0495640_0020436 | 3300046533 | Bacteria | 4872 |
| 463 | Ga0495640_0038683 | 3300046533 | Bacteria | 3354 |
| 464 | Ga0495640_0042835 | 3300046533 | Bacteria | 3155 |
| 465 | Ga0495640_0064323 | 3300046533 | Bacteria | 2480 |
| 466 | Ga0495640_0085431 | 3300046533 | Bacteria | 2091 |
| 467 | Ga0495586_0021800 | 3300046535 | Bacteria | 3418 |
| 468 | Ga0495586_0120600 | 3300046535 | Bacteria | 1465 |
| 469 | Ga0495587_0002510 | 3300046536 | Bacteria | 12259 |
| 470 | Ga0495587_0010861 | 3300046536 | Bacteria | 5780 |
| 471 | Ga0495587_0066521 | 3300046536 | Bacteria | 2102 |
| 472 | Ga0495587_0295055 | 3300046536 | Bacteria | 907 |
| 473 | Ga0495609_0010581 | 3300046538 | Bacteria | 4420 |
| 474 | Ga0495597_0010605 | 3300046542 | Bacteria | 4496 |
| 475 | Ga0495645_0011084 | 3300046543 | Bacteria | 6337 |
| 476 | Ga0495645_0050801 | 3300046543 | Bacteria | 3017 |
| 477 | Ga0495645_0060170 | 3300046543 | Bacteria | 2753 |
| 478 | Ga0495645_0070401 | 3300046543 | Bacteria | 2524 |
| 479 | Ga0495645_0091998 | 3300046543 | Bacteria | 2166 |
| 480 | Ga0495622_0020933 | 3300046557 | Bacteria | 3045 |
| 481 | Ga0495622_0043034 | 3300046557 | Bacteria | 2099 |
| 482 | Ga0495622_0154432 | 3300046557 | Bacteria | 1037 |
| 483 | Ga0495633_0007334 | 3300046558 | Bacteria | 6358 |
| 484 | Ga0495667_0005551 | 3300046559 | Bacteria | 8526 |
| 485 | Ga0495667_0006827 | 3300046559 | Bacteria | 7749 |
| 486 | Ga0495667_0010332 | 3300046559 | Bacteria | 6314 |
| 487 | Ga0495667_0016663 | 3300046559 | Bacteria | 4961 |
| 488 | Ga0495667_0098645 | 3300046559 | Bacteria | 1891 |
| 489 | Ga0495667_0448651 | 3300046559 | Bacteria | 810 |
| 490 | Ga0495668_0206862 | 3300046616 | Bacteria | 1074 |
| 491 | Ga0495634_0003734 | 3300046642 | Bacteria | 12128 |
| 492 | Ga0495634_0004035 | 3300046642 | Bacteria | 11647 |
| 493 | Ga0495634_0023005 | 3300046642 | Bacteria | 4387 |
| 494 | Ga0495634_0064823 | 3300046642 | Bacteria | 2421 |
| 495 | Ga0495634_0085342 | 3300046642 | Bacteria | 2057 |
| 496 | Ga0495634_0086784 | 3300046642 | Bacteria | 2037 |
| 497 | Ga0495634_0144048 | 3300046642 | Bacteria | 1511 |
| 498 | Ga0495611_0021326 | 3300046648 | Bacteria | 2797 |
| 499 | Ga0495611_0060824 | 3300046648 | Bacteria | 1716 |
| 500 | Ga0495611_0150539 | 3300046648 | Bacteria | 1086 |
| 501 | Ga0495611_0193356 | 3300046648 | Bacteria | 950 |
| 502 | Ga0495635_0001020 | 3300046663 | Bacteria | 18505 |
| 503 | Ga0495635_0005268 | 3300046663 | Bacteria | 8995 |
| 504 | Ga0495635_0040955 | 3300046663 | Bacteria | 3200 |
| 505 | Ga0495635_0062768 | 3300046663 | Bacteria | 2551 |
| 506 | Ga0495635_0286528 | 3300046663 | Bacteria | 1106 |
| 507 | Ga0495635_0298400 | 3300046663 | Bacteria | 1080 |
| 508 | Ga0495588_0037055 | 3300046674 | Bacteria | 2477 |
| 509 | Ga0495588_0055324 | 3300046674 | Bacteria | 2047 |
| 510 | Ga0495657_0002061 | 3300046675 | Bacteria | 17090 |
| 511 | Ga0495657_0007027 | 3300046675 | Bacteria | 8734 |
| 512 | Ga0495657_0013113 | 3300046675 | Bacteria | 6126 |
| 513 | Ga0495657_0026424 | 3300046675 | Bacteria | 4110 |
| 514 | Ga0495657_0026932 | 3300046675 | Bacteria | 4065 |
| 515 | Ga0495657_0032482 | 3300046675 | Bacteria | 3641 |
| 516 | Ga0495657_0128888 | 3300046675 | Bacteria | 1586 |
| 517 | Ga0495657_0144372 | 3300046675 | Bacteria | 1481 |
| 518 | Ga0495657_0237227 | 3300046675 | Bacteria | 1101 |
| 519 | Ga0495657_0358045 | 3300046675 | Bacteria | 863 |
| 520 | Ga0495657_0366990 | 3300046675 | Bacteria | 850 |
| 521 | Ga0495599_0003474 | 3300046678 | Bacteria | 9222 |
| 522 | Ga0495599_0165891 | 3300046678 | Bacteria | 1364 |
| 523 | Ga0495599_0187761 | 3300046678 | Bacteria | 1272 |
| 524 | Ga0495599_0197164 | 3300046678 | Bacteria | 1237 |
| 525 | Ga0495623_0027238 | 3300046679 | Bacteria | 3675 |
| 526 | Ga0495623_0100159 | 3300046679 | Bacteria | 1766 |
| 527 | Ga0495623_0121458 | 3300046679 | Bacteria | 1572 |
| 528 | Ga0495623_0222323 | 3300046679 | Bacteria | 1075 |
| 529 | Ga0495646_0008959 | 3300046680 | Bacteria | 6352 |
| 530 | Ga0495646_0026449 | 3300046680 | Bacteria | 3644 |
| 531 | Ga0495646_0046051 | 3300046680 | Bacteria | 2661 |
| 532 | Ga0495646_0144775 | 3300046680 | Bacteria | 1326 |
| 533 | Ga0495647_0036628 | 3300046681 | Bacteria | 1847 |
| 534 | Ga0495658_0000668 | 3300046683 | Bacteria | 18633 |
| 535 | Ga0495658_0017509 | 3300046683 | Bacteria | 3703 |
| 536 | Ga0495613_0001017 | 3300046689 | Bacteria | 21317 |
| 537 | Ga0495613_0004228 | 3300046689 | Bacteria | 10755 |
| 538 | Ga0495613_0006091 | 3300046689 | Bacteria | 9022 |
| 539 | Ga0495613_0006111 | 3300046689 | Bacteria | 9009 |
| 540 | Ga0495613_0045156 | 3300046689 | Bacteria | 3259 |
| 541 | Ga0495613_0097186 | 3300046689 | Bacteria | 2129 |
| 542 | Ga0495613_0206111 | 3300046689 | Bacteria | 1384 |
| 543 | Ga0495613_0301722 | 3300046689 | Bacteria | 1108 |
| 544 | Ga0495613_0303607 | 3300046689 | Bacteria | 1104 |
| 545 | Ga0495624_0003117 | 3300046690 | Bacteria | 12395 |
| 546 | Ga0495624_0177528 | 3300046690 | Bacteria | 1298 |
| 547 | Ga0495670_0028561 | 3300046691 | Bacteria | 2765 |
| 548 | Ga0495671_0016204 | 3300046692 | Bacteria | 3984 |
| 549 | Ga0495649_0027568 | 3300046694 | Bacteria | 3151 |
| 550 | Ga0495649_0145680 | 3300046694 | Bacteria | 1245 |
| 551 | Ga0495589_0012578 | 3300046794 | Bacteria | 4379 |
| 552 | Ga0495589_0087324 | 3300046794 | Bacteria | 1514 |
| 553 | Ga0495600_0028042 | 3300046809 | Bacteria | 3641 |
| 554 | Ga0495600_0033937 | 3300046809 | Bacteria | 3313 |
| 555 | Ga0495600_0094741 | 3300046809 | Bacteria | 1947 |
| 556 | Ga0495600_0131715 | 3300046809 | Bacteria | 1625 |
| 557 | Ga0495660_0107029 | 3300046810 | Bacteria | 1431 |
| 558 | Ga0495581_0000732 | 3300047315 | Bacteria | 17377 |
| 559 | Ga0495581_0029604 | 3300047315 | Bacteria | 3173 |
| 560 | Ga0495581_0058776 | 3300047315 | Bacteria | 2221 |
| 561 | Ga0495581_0131963 | 3300047315 | Bacteria | 1455 |
| 562 | Ga0495581_0260869 | 3300047315 | Bacteria | 1013 |
| 563 | Ga0495604_0001177 | 3300047317 | Bacteria | 21636 |
| 564 | Ga0495604_0003563 | 3300047317 | Bacteria | 12422 |
| 565 | Ga0495604_0007586 | 3300047317 | Bacteria | 8586 |
| 566 | Ga0495604_0031810 | 3300047317 | Bacteria | 4184 |
| 567 | Ga0495604_0037390 | 3300047317 | Bacteria | 3824 |
| 568 | Ga0495604_0075680 | 3300047317 | Bacteria | 2534 |
| 569 | Ga0495604_0164304 | 3300047317 | Bacteria | 1566 |
| 570 | Ga0495636_0039985 | 3300047318 | Bacteria | 1943 |
| 571 | Ga0495636_0108364 | 3300047318 | Bacteria | 1220 |
| 572 | Ga0495636_0211322 | 3300047318 | Bacteria | 888 |
| 573 | Ga0495674_0001674 | 3300047319 | Bacteria | 21807 |
| 574 | Ga0495674_0018733 | 3300047319 | Bacteria | 6442 |
| 575 | Ga0495674_0166927 | 3300047319 | Bacteria | 1839 |
| 576 | Ga0495674_0234848 | 3300047319 | Bacteria | 1512 |
| 577 | Ga0495674_0796852 | 3300047319 | Bacteria | 735 |
| 578 | Ga0495676_0002474 | 3300047321 | Bacteria | 16429 |
| 579 | Ga0495676_0008328 | 3300047321 | Bacteria | 9509 |
| 580 | Ga0495676_0008832 | 3300047321 | Bacteria | 9214 |
| 581 | Ga0495676_0012595 | 3300047321 | Bacteria | 7615 |
| 582 | Ga0495676_0023093 | 3300047321 | Bacteria | 5403 |
| 583 | Ga0495676_0172450 | 3300047321 | Bacteria | 1521 |
| 584 | Ga0495680_0006577 | 3300047322 | Bacteria | 10782 |
| 585 | Ga0495680_0026944 | 3300047322 | Bacteria | 4730 |
| 586 | Ga0495680_0028924 | 3300047322 | Bacteria | 4541 |
| 587 | Ga0495680_0036621 | 3300047322 | Bacteria | 3938 |
| 588 | Ga0495680_0106162 | 3300047322 | Bacteria | 2087 |
| 589 | Ga0495683_0043444 | 3300047323 | Bacteria | 2263 |
| 590 | Ga0495683_0098775 | 3300047323 | Bacteria | 1406 |
| 591 | Ga0495687_001803 | 3300047443 | Bacteria | 18868 |
| 592 | Ga0495687_026958 | 3300047443 | Bacteria | 2695 |
| 593 | Ga0495687_129842 | 3300047443 | Bacteria | 894 |
| 594 | Ga0495687_145491 | 3300047443 | Bacteria | 818 |
| 595 | Ga0495675_0004281 | 3300047444 | Bacteria | 8636 |
| 596 | Ga0495675_0007900 | 3300047444 | Bacteria | 6572 |
| 597 | Ga0495675_0018761 | 3300047444 | Bacteria | 4393 |
| 598 | Ga0495675_0030126 | 3300047444 | Bacteria | 3463 |
| 599 | Ga0495675_0032379 | 3300047444 | Bacteria | 3336 |
| 600 | Ga0495675_0385450 | 3300047444 | Bacteria | 819 |
| 601 | Ga0495677_0138177 | 3300047445 | Bacteria | 935 |
| 602 | Ga0495685_002002 | 3300047447 | Bacteria | 6320 |
| 603 | Ga0495685_004607 | 3300047447 | Bacteria | 4466 |
| 604 | Ga0495685_037134 | 3300047447 | Bacteria | 1671 |
| 605 | Ga0495685_106267 | 3300047447 | Bacteria | 925 |
| 606 | Ga0495681_0001329 | 3300047470 | Bacteria | 18701 |
| 607 | Ga0495681_0003668 | 3300047470 | Bacteria | 10663 |
| 608 | Ga0495681_0017652 | 3300047470 | Bacteria | 3954 |
| 609 | Ga0495684_0003513 | 3300047471 | Bacteria | 12258 |
| 610 | Ga0495684_0043083 | 3300047471 | Bacteria | 3455 |
| 611 | Ga0495684_0054852 | 3300047471 | Bacteria | 3039 |
| 612 | Ga0495684_0057084 | 3300047471 | Bacteria | 2975 |
| 613 | Ga0495684_0262418 | 3300047471 | Bacteria | 1252 |
| 614 | Ga0495686_0021426 | 3300047472 | Bacteria | 4292 |
| 615 | Ga0495686_0359710 | 3300047472 | Bacteria | 789 |
| 616 | Ga0495593_0006644 | 3300047673 | Bacteria | 6769 |
| 617 | Ga0495593_0056023 | 3300047673 | Bacteria | 2073 |
| 618 | Ga0495602_0033616 | 3300048088 | Bacteria | 4808 |
| 619 | Ga0495602_0042207 | 3300048088 | Bacteria | 4158 |
| 620 | Ga0495602_0134116 | 3300048088 | Bacteria | 1970 |
| 621 | Ga0495614_0001624 | 3300048089 | Bacteria | 9790 |
| 622 | Ga0495614_0006077 | 3300048089 | Bacteria | 5428 |
| 623 | Ga0495614_0008394 | 3300048089 | Bacteria | 4594 |
| 624 | Ga0495614_0056364 | 3300048089 | Bacteria | 1686 |
| 625 | Ga0495614_0142670 | 3300048089 | Bacteria | 1065 |
| 626 | Ga0496100_0028814 | 3300048903 | Bacteria | 3428 |
| 627 | Ga0496101_0224162 | 3300048904 | Bacteria | 1459 |
| 628 | Ga0496102_0109191 | 3300048905 | Bacteria | 2577 |
| 629 | Ga0496103_0015293 | 3300048906 | Bacteria | 4563 |
| 630 | Ga0496104_0047016 | 3300048907 | Bacteria | 4066 |
| 631 | Ga0496105_0044148 | 3300048908 | Bacteria | 3675 |
| 632 | Ga0496105_0167738 | 3300048908 | Bacteria | 1801 |
| 633 | Ga0496106_0039817 | 3300048909 | Bacteria | 3519 |
| 634 | Ga0496106_0485553 | 3300048909 | Bacteria | 992 |
| 635 | Ga0496107_0071585 | 3300048910 | Bacteria | 2519 |
| 636 | Ga0496108_0177728 | 3300048911 | Bacteria | 1843 |
| 637 | Ga0496108_0964335 | 3300048911 | Bacteria | 729 |
| 638 | Ga0496109_0096805 | 3300048912 | Bacteria | 2734 |
| 639 | Ga0496109_0211288 | 3300048912 | Bacteria | 1825 |
| 640 | Ga0496109_0575401 | 3300048912 | Bacteria | 1062 |
| 641 | Ga0496110_0044145 | 3300048913 | Bacteria | 3892 |
| 642 | Ga0496111_0181938 | 3300048914 | Bacteria | 1562 |
| 643 | Ga0496112_0069182 | 3300048915 | Bacteria | 3487 |
| 644 | Ga0496112_0825898 | 3300048915 | Bacteria | 851 |
| 645 | Ga0496113_0059780 | 3300048916 | Bacteria | 2871 |
| 646 | Ga0496114_0147762 | 3300048917 | Bacteria | 2038 |
| 647 | Ga0496115_0166387 | 3300048918 | Bacteria | 1823 |
| 648 | Ga0496115_0557778 | 3300048918 | Bacteria | 915 |
| 649 | Ga0496126_0531483 | 3300048929 | Bacteria | 936 |
| 650 | Ga0495678_021898 | 3300049459 | Bacteria | 2805 |
| 651 | Ga0495682_0052774 | 3300049460 | Bacteria | 1477 |
| 652 | Ga0501323_007016 | 3300049539 | Bacteria | 1275 |
| 653 | Ga0501031_0006424 | 3300049568 | Bacteria | 7667 |
| 654 | Ga0501031_0067105 | 3300049568 | Bacteria | 2337 |
| 655 | Ga0501032_0146868 | 3300049569 | Bacteria | 1552 |
| 656 | Ga0501033_0001301 | 3300049570 | Bacteria | 22178 |
| 657 | Ga0501033_0076368 | 3300049570 | Bacteria | 2459 |
| 658 | Ga0501034_0001622 | 3300049571 | Bacteria | 29187 |
| 659 | Ga0501034_0055492 | 3300049571 | Bacteria | 3986 |
| 660 | Ga0501034_0085655 | 3300049571 | Bacteria | 3152 |
| 661 | Ga0501036_0003801 | 3300049572 | Bacteria | 12106 |
| 662 | Ga0501036_0018744 | 3300049572 | Bacteria | 5804 |
| 663 | Ga0501036_0019176 | 3300049572 | Bacteria | 5738 |
| 664 | Ga0501037_0002340 | 3300049573 | Bacteria | 13694 |
| 665 | Ga0501037_0013307 | 3300049573 | Bacteria | 6063 |
| 666 | Ga0501037_0593406 | 3300049573 | Bacteria | 744 |
| 667 | Ga0501038_0007735 | 3300049574 | Bacteria | 9909 |
| 668 | Ga0501038_0008418 | 3300049574 | Bacteria | 9487 |
| 669 | Ga0501038_0021101 | 3300049574 | Bacteria | 5851 |
| 670 | Ga0501039_0013778 | 3300049575 | Bacteria | 6186 |
| 671 | Ga0501039_0065064 | 3300049575 | Bacteria | 2828 |
| 672 | Ga0501042_0048952 | 3300049578 | Bacteria | 3014 |
| 673 | Ga0501043_0001089 | 3300049579 | Bacteria | 23889 |
| 674 | Ga0501043_0031502 | 3300049579 | Bacteria | 4168 |
| 675 | Ga0501043_0052024 | 3300049579 | Bacteria | 3218 |
| 676 | Ga0501046_0015796 | 3300049580 | Bacteria | 6334 |
| 677 | Ga0501046_0177986 | 3300049580 | Bacteria | 1592 |
| 678 | Ga0501047_0000309 | 3300049581 | Bacteria | 56264 |
| 679 | Ga0501047_0015678 | 3300049581 | Bacteria | 7221 |
| 680 | Ga0501047_0018162 | 3300049581 | Bacteria | 6740 |
| 681 | Ga0501047_0111742 | 3300049581 | Bacteria | 2615 |
| 682 | Ga0501047_0148312 | 3300049581 | Bacteria | 2222 |
| 683 | Ga0501047_0173390 | 3300049581 | Bacteria | 2025 |
| 684 | Ga0501047_0291203 | 3300049581 | Bacteria | 1476 |
| 685 | Ga0501048_0016728 | 3300049582 | Bacteria | 5406 |
| 686 | Ga0501069_0196515 | 3300049585 | Bacteria | 1168 |
| 687 | Ga0501070_0000441 | 3300049586 | Bacteria | 37765 |
| 688 | Ga0501071_0024174 | 3300049587 | Bacteria | 4247 |
| 689 | Ga0501073_0066827 | 3300049589 | Bacteria | 2506 |
| 690 | Ga0501073_0192030 | 3300049589 | Bacteria | 1413 |
| 691 | Ga0501074_0026677 | 3300049590 | Bacteria | 4188 |
| 692 | Ga0501080_0084922 | 3300049742 | Bacteria | 2941 |
| 693 | Ga0501080_0298932 | 3300049742 | Bacteria | 1460 |
| 694 | Ga0501035_0002876 | 3300049822 | Bacteria | 16604 |
| 695 | Ga0501035_0012498 | 3300049822 | Bacteria | 7844 |
| 696 | Ga0501035_0034183 | 3300049822 | Bacteria | 4620 |
| 697 | Ga0501035_0064529 | 3300049822 | Bacteria | 3255 |
| 698 | Ga0501035_0225285 | 3300049822 | Bacteria | 1599 |
| 699 | Ga0501044_0013506 | 3300049823 | Bacteria | 8830 |
| 700 | Ga0501044_0022495 | 3300049823 | Bacteria | 6716 |
| 701 | Ga0501044_0025390 | 3300049823 | Bacteria | 6280 |
| 702 | Ga0501044_0067407 | 3300049823 | Bacteria | 3646 |
| 703 | Ga0501044_0088729 | 3300049823 | Bacteria | 3121 |
| 704 | Ga0501044_0139858 | 3300049823 | Bacteria | 2410 |
| 705 | Ga0501044_0181461 | 3300049823 | Bacteria | 2071 |
| 706 | Ga0501044_0196420 | 3300049823 | Bacteria | 1977 |
| 707 | Ga0501044_0373078 | 3300049823 | Bacteria | 1343 |
| 708 | Ga0501044_0396491 | 3300049823 | Bacteria | 1293 |
| 709 | Ga0501044_0467508 | 3300049823 | Bacteria | 1166 |
| 710 | nmdc:mga03n38_107831_c1 | 3300050490 | Bacteria | 1352 |
| 711 | nmdc:mga04h51_8038_c1 | 3300050495 | Bacteria | 2810 |
| 712 | nmdc:mga0rr50_240546_c1 | 3300050513 | Bacteria | 1500 |
| 713 | nmdc:mga0a205_527864_c1 | 3300050515 | Bacteria | 1036 |
| 714 | Ga0495601_0006351 | 3300053077 | Bacteria | 6908 |
| 715 | Ga0495601_0012738 | 3300053077 | Bacteria | 5046 |
| 716 | Ga0495601_0091853 | 3300053077 | Bacteria | 1955 |
| 717 | Ga0495601_0210752 | 3300053077 | Bacteria | 1269 |
| 718 | Ga0495601_0267920 | 3300053077 | Bacteria | 1114 |
| 719 | Ga0495612_0001269 | 3300053078 | Bacteria | 10415 |
| 720 | Ga0495612_0002887 | 3300053078 | Bacteria | 7124 |
| 721 | Ga0495612_0050001 | 3300053078 | Bacteria | 1716 |
| 722 | Ga0495612_0120044 | 3300053078 | Bacteria | 1130 |
| 723 | Ga0495595_0004208 | 3300053084 | Bacteria | 5787 |
| 724 | Ga0495619_0004841 | 3300053085 | Bacteria | 8546 |
| 725 | Ga0495619_0071628 | 3300053085 | Bacteria | 2320 |
| 726 | Ga0495619_0082560 | 3300053085 | Bacteria | 2166 |
| 727 | Ga0500578_0036380 | 3300053086 | Bacteria | 3162 |
| 728 | Ga0500644_0014080 | 3300053088 | Bacteria | 2249 |
| 729 | Ga0500660_139741 | 3300053100 | Bacteria | 965 |
| 730 | Ga0500553_037842 | 3300053101 | Bacteria | 2380 |
| 731 | Ga0500560_000508 | 3300053107 | Bacteria | 5467 |
| 732 | Ga0500569_003461 | 3300053109 | Bacteria | 3231 |
| 733 | Ga0500652_000184 | 3300053131 | Bacteria | 24098 |
| 734 | Ga0500561_0016007 | 3300053137 | Bacteria | 1675 |
| 735 | Ga0500573_0061052 | 3300053140 | Bacteria | 2159 |
| 736 | Ga0500579_054867 | 3300053143 | Bacteria | 2410 |
| 737 | Ga0500600_0019200 | 3300053149 | Bacteria | 4117 |
| 738 | Ga0500600_0042669 | 3300053149 | Bacteria | 2612 |
| 739 | Ga0500616_0022984 | 3300053153 | Bacteria | 3477 |
| 740 | Ga0500634_0019418 | 3300053161 | Bacteria | 3661 |
| 741 | Ga0501084_0885665 | 3300054114 | Bacteria | 751 |
| 742 | Ga0501082_0018213 | 3300060353 | Bacteria | 6047 |
| 743 | Ga0466962_0000123 | 3300061719 | Bacteria | 31639 |
| 744 | Ga0466962_0128867 | 3300061719 | Bacteria | 1222 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100001069 | Ga0070671_10000106912 | 192 |
| 2 | 3300005367 | Ga0070667_100258653 | Ga0070667_1002586532 | 192 |
| 3 | 3300005548 | Ga0070665_100006798 | Ga0070665_1000067982 | 192 |
| 4 | 3300005843 | Ga0068860_100156092 | Ga0068860_1001560922 | 192 |
| 5 | 3300025931 | Ga0207644_10001360 | Ga0207644_100013607 | 192 |
| 6 | 3300025986 | Ga0207658_10135834 | Ga0207658_101358342 | 192 |
| 7 | 3300028379 | Ga0268266_10044101 | Ga0268266_100441014 | 192 |
| 8 | 3300028381 | Ga0268264_10131684 | Ga0268264_101316843 | 192 |
| 9 | 3300045976 | Ga0466967_0219988 | Ga0466967_0219988_285_947 | 197 |
| 10 | 3300044901 | Ga0466960_0007064 | Ga0466960_0007064_3625_4257 | 203 |
| 11 | iso_pu_bacteria | 2862705112 | 2862705624 | 204 |
| 12 | iso_pu_bacteria | 2990044586 | 2990049406 | 204 |
| 13 | iso_pu_bacteria | 8008485437 | 8008489528 | 204 |
| 14 | iso_pu_bacteria | 8025524527 | 8025528896 | 204 |
| 15 | 3300053140 | Ga0500573_0061052 | Ga0500573_0061052_1268_1930 | 205 |
| 16 | iso_pu_bacteria | 2867346516 | 2867351269 | 205 |
| 17 | 3300039437 | Ga0436365_0192020 | Ga0436365_0192020_1371_2024 | 207 |
| 18 | 3300044656 | Ga0466969_0007733 | Ga0466969_0007733_1084_1725 | 207 |
| 19 | 3300044684 | Ga0466966_0025078 | Ga0466966_0025078_624_1265 | 207 |
| 20 | 3300044693 | Ga0466961_0000804 | Ga0466961_0000804_17136_17777 | 207 |
| 21 | 3300044719 | Ga0466971_0029345 | Ga0466971_0029345_28_669 | 207 |
| 22 | 3300044765 | Ga0466970_0002932 | Ga0466970_0002932_3067_3708 | 207 |
| 23 | 3300044765 | Ga0466970_0005496 | Ga0466970_0005496_4753_5409 | 207 |
| 24 | 3300044693 | Ga0466961_0002459 | Ga0466961_0002459_10714_11355 | 208 |
| 25 | 3300048912 | Ga0496109_0211288 | Ga0496109_0211288_582_1214 | 208 |
| 26 | iso_pu_bacteria | 2558860280 | 2559427446 | 208 |
| 27 | iso_pu_bacteria | 2758568621 | 2760622860 | 208 |
| 28 | iso_pu_bacteria | 8056579771 | 8056581689 | 208 |
| 29 | 3300005327 | Ga0070658_10143423 | Ga0070658_101434232 | 209 |
| 30 | 3300005539 | Ga0068853_100209148 | Ga0068853_1002091482 | 209 |
| 31 | 3300005564 | Ga0070664_100216629 | Ga0070664_1002166292 | 209 |
| 32 | 3300005616 | Ga0068852_100230554 | Ga0068852_1002305542 | 209 |
| 33 | 3300005937 | Ga0081455_10037754 | Ga0081455_100377541 | 209 |
| 34 | 3300009545 | Ga0105237_10023191 | Ga0105237_100231915 | 209 |
| 35 | 3300010375 | Ga0105239_10189981 | Ga0105239_101899811 | 209 |
| 36 | 3300025929 | Ga0207664_10000001 | Ga0207664_10000001431 | 209 |
| 37 | 3300026041 | Ga0207639_10172234 | Ga0207639_101722341 | 209 |
| 38 | 3300030521 | Ga0307511_10004831 | Ga0307511_1000483117 | 209 |
| 39 | 3300030522 | Ga0307512_10005460 | Ga0307512_100054603 | 209 |
| 40 | 3300031616 | Ga0307508_10008698 | Ga0307508_100086983 | 209 |
| 41 | 3300037068 | Ga0373925_0152526 | Ga0373925_0152526_888_1535 | 209 |
| 42 | 3300046459 | Ga0495629_0007561 | Ga0495629_0007561_3572_4231 | 209 |
| 43 | 3300046476 | Ga0495662_0001981 | Ga0495662_0001981_7592_8251 | 209 |
| 44 | 3300046476 | Ga0495662_0222887 | Ga0495662_0222887_105_764 | 209 |
| 45 | 3300046477 | Ga0495664_0390921 | Ga0495664_0390921_155_808 | 209 |
| 46 | 3300046517 | Ga0495630_0137908 | Ga0495630_0137908_858_1517 | 209 |
| 47 | 3300046543 | Ga0495645_0091998 | Ga0495645_0091998_868_1527 | 209 |
| 48 | 3300046675 | Ga0495657_0002061 | Ga0495657_0002061_9438_10097 | 209 |
| 49 | 3300046675 | Ga0495657_0366990 | Ga0495657_0366990_71_730 | 209 |
| 50 | 3300046689 | Ga0495613_0206111 | Ga0495613_0206111_578_1237 | 209 |
| 51 | 3300047444 | Ga0495675_0007900 | Ga0495675_0007900_1238_1897 | 209 |
| 52 | 3300048908 | Ga0496105_0167738 | Ga0496105_0167738_649_1308 | 209 |
| 53 | 3300048912 | Ga0496109_0575401 | Ga0496109_0575401_270_917 | 209 |
| 54 | 3300049575 | Ga0501039_0065064 | Ga0501039_0065064_2130_2780 | 209 |
| 55 | iso_pu_bacteria | 2643221601 | 2644015014 | 209 |
| 56 | iso_pu_bacteria | 2643221631 | 2644176901 | 209 |
| 57 | iso_pu_bacteria | 2915768154 | 2915769476 | 209 |
| 58 | 3300044656 | Ga0466969_0007599 | Ga0466969_0007599_3986_4645 | 210 |
| 59 | 3300044656 | Ga0466969_0015982 | Ga0466969_0015982_482_1141 | 210 |
| 60 | 3300044693 | Ga0466961_0133384 | Ga0466961_0133384_209_868 | 210 |
| 61 | 3300044765 | Ga0466970_0002761 | Ga0466970_0002761_3406_4065 | 210 |
| 62 | 3300049823 | Ga0501044_0181461 | Ga0501044_0181461_940_1668 | 210 |
| 63 | iso_pu_bacteria | 2582581312 | 2585301094 | 210 |
| 64 | iso_pu_bacteria | 2616644941 | 2616899423 | 210 |
| 65 | iso_pu_bacteria | 2643221548 | 2643759300 | 210 |
| 66 | iso_pu_bacteria | 2643221578 | 2643897369 | 210 |
| 67 | iso_pu_bacteria | 2643221587 | 2643945164 | 210 |
| 68 | iso_pu_bacteria | 2643221670 | 2644387395 | 210 |
| 69 | iso_pu_bacteria | 2643221673 | 2644408514 | 210 |
| 70 | iso_pu_bacteria | 2643221677 | 2644432063 | 210 |
| 71 | iso_pu_bacteria | 2643221682 | 2644463282 | 210 |
| 72 | iso_pu_bacteria | 2808606982 | 2811847596 | 210 |
| 73 | iso_pu_bacteria | 2818991463 | 2819694123 | 210 |
| 74 | iso_pu_bacteria | 2862178590 | 2862182958 | 210 |
| 75 | iso_pu_bacteria | 2863404153 | 2863406219 | 210 |
| 76 | iso_pu_bacteria | 2867475112 | 2867477002 | 210 |
| 77 | iso_pu_bacteria | 2875391855 | 2875393311 | 210 |
| 78 | iso_pu_bacteria | 2891326441 | 2891331060 | 210 |
| 79 | iso_pu_bacteria | 2918501144 | 2918503182 | 210 |
| 80 | iso_pu_bacteria | 2946045630 | 2946051379 | 210 |
| 81 | iso_pu_bacteria | 2966598605 | 2966603750 | 210 |
| 82 | iso_pu_bacteria | 2990059506 | 2990060786 | 210 |
| 83 | iso_pu_bacteria | 2997451912 | 2997458555 | 210 |
| 84 | iso_pu_bacteria | 8008558824 | 8008562090 | 210 |
| 85 | iso_pu_bacteria | 8023623736 | 8023627517 | 210 |
| 86 | iso_pu_bacteria | 8048406513 | 8048409060 | 210 |
| 87 | iso_pu_bacteria | 8054160619 | 8054163656 | 210 |
| 88 | 3300005330 | Ga0070690_100166820 | Ga0070690_1001668202 | 211 |
| 89 | 3300005333 | Ga0070677_10105815 | Ga0070677_101058152 | 211 |
| 90 | 3300005339 | Ga0070660_100009722 | Ga0070660_1000097224 | 211 |
| 91 | 3300005341 | Ga0070691_10121144 | Ga0070691_101211442 | 211 |
| 92 | 3300005343 | Ga0070687_100014648 | Ga0070687_1000146484 | 211 |
| 93 | 3300005344 | Ga0070661_100049902 | Ga0070661_1000499023 | 211 |
| 94 | 3300005347 | Ga0070668_100466255 | Ga0070668_1004662552 | 211 |
| 95 | 3300005354 | Ga0070675_100105883 | Ga0070675_1001058832 | 211 |
| 96 | 3300005355 | Ga0070671_100186242 | Ga0070671_1001862421 | 211 |
| 97 | 3300005364 | Ga0070673_100382182 | Ga0070673_1003821821 | 211 |
| 98 | 3300005435 | Ga0070714_100111539 | Ga0070714_1001115392 | 211 |
| 99 | 3300005435 | Ga0070714_100594467 | Ga0070714_1005944672 | 211 |
| 100 | 3300005435 | Ga0070714_101042375 | Ga0070714_1010423751 | 211 |
| 101 | 3300005435 | Ga0070714_101165846 | Ga0070714_1011658461 | 211 |
| 102 | 3300005436 | Ga0070713_100366054 | Ga0070713_1003660542 | 211 |
| 103 | 3300005436 | Ga0070713_100536307 | Ga0070713_1005363072 | 211 |
| 104 | 3300005439 | Ga0070711_100164630 | Ga0070711_1001646302 | 211 |
| 105 | 3300005439 | Ga0070711_100269290 | Ga0070711_1002692901 | 211 |
| 106 | 3300005439 | Ga0070711_100468666 | Ga0070711_1004686661 | 211 |
| 107 | 3300005440 | Ga0070705_100043008 | Ga0070705_1000430083 | 211 |
| 108 | 3300005445 | Ga0070708_100144239 | Ga0070708_1001442392 | 211 |
| 109 | 3300005455 | Ga0070663_100008380 | Ga0070663_1000083802 | 211 |
| 110 | 3300005456 | Ga0070678_100070844 | Ga0070678_1000708441 | 211 |
| 111 | 3300005457 | Ga0070662_100058592 | Ga0070662_1000585922 | 211 |
| 112 | 3300005458 | Ga0070681_10263183 | Ga0070681_102631832 | 211 |
| 113 | 3300005530 | Ga0070679_100257671 | Ga0070679_1002576713 | 211 |
| 114 | 3300005535 | Ga0070684_100036331 | Ga0070684_1000363314 | 211 |
| 115 | 3300005535 | Ga0070684_100198413 | Ga0070684_1001984132 | 211 |
| 116 | 3300005539 | Ga0068853_100415085 | Ga0068853_1004150852 | 211 |
| 117 | 3300005546 | Ga0070696_100115308 | Ga0070696_1001153082 | 211 |
| 118 | 3300005547 | Ga0070693_100109567 | Ga0070693_1001095672 | 211 |
| 119 | 3300005548 | Ga0070665_100163185 | Ga0070665_1001631852 | 211 |
| 120 | 3300005549 | Ga0070704_100097907 | Ga0070704_1000979072 | 211 |
| 121 | 3300005563 | Ga0068855_100032082 | Ga0068855_1000320826 | 211 |
| 122 | 3300005563 | Ga0068855_100189698 | Ga0068855_1001896983 | 211 |
| 123 | 3300005577 | Ga0068857_100021276 | Ga0068857_1000212762 | 211 |
| 124 | 3300005615 | Ga0070702_100554650 | Ga0070702_1005546501 | 211 |
| 125 | 3300005616 | Ga0068852_100135991 | Ga0068852_1001359913 | 211 |
| 126 | 3300005617 | Ga0068859_100214382 | Ga0068859_1002143822 | 211 |
| 127 | 3300005618 | Ga0068864_100069457 | Ga0068864_1000694572 | 211 |
| 128 | 3300005841 | Ga0068863_100127901 | Ga0068863_1001279012 | 211 |
| 129 | 3300005841 | Ga0068863_100403030 | Ga0068863_1004030302 | 211 |
| 130 | 3300005983 | Ga0081540_1001003 | Ga0081540_10010033 | 211 |
| 131 | 3300006028 | Ga0070717_10690351 | Ga0070717_106903511 | 211 |
| 132 | 3300006163 | Ga0070715_10009652 | Ga0070715_100096522 | 211 |
| 133 | 3300006163 | Ga0070715_10029481 | Ga0070715_100294811 | 211 |
| 134 | 3300006175 | Ga0070712_100083205 | Ga0070712_1000832053 | 211 |
| 135 | 3300006237 | Ga0097621_100024958 | Ga0097621_1000249584 | 211 |
| 136 | 3300006358 | Ga0068871_100103140 | Ga0068871_1001031402 | 211 |
| 137 | 3300006871 | Ga0075434_100317411 | Ga0075434_1003174112 | 211 |
| 138 | 3300006881 | Ga0068865_100671682 | Ga0068865_1006716821 | 211 |
| 139 | 3300006931 | Ga0097620_100214382 | Ga0097620_1002143822 | 211 |
| 140 | 3300009011 | Ga0105251_10046387 | Ga0105251_100463872 | 211 |
| 141 | 3300009174 | Ga0105241_10042041 | Ga0105241_100420412 | 211 |
| 142 | 3300009176 | Ga0105242_10479412 | Ga0105242_104794122 | 211 |
| 143 | 3300009177 | Ga0105248_10046817 | Ga0105248_100468172 | 211 |
| 144 | 3300009553 | Ga0105249_10106568 | Ga0105249_101065682 | 211 |
| 145 | 3300012476 | Ga0157344_1003718 | Ga0157344_10037181 | 211 |
| 146 | 3300012507 | Ga0157342_1005584 | Ga0157342_10055842 | 211 |
| 147 | 3300012515 | Ga0157338_1003999 | Ga0157338_10039992 | 211 |
| 148 | 3300013102 | Ga0157371_10223820 | Ga0157371_102238202 | 211 |
| 149 | 3300013296 | Ga0157374_10165189 | Ga0157374_101651892 | 211 |
| 150 | 3300013308 | Ga0157375_10140650 | Ga0157375_101406502 | 211 |
| 151 | 3300014325 | Ga0163163_10877880 | Ga0163163_108778802 | 211 |
| 152 | 3300014326 | Ga0157380_10090063 | Ga0157380_100900631 | 211 |
| 153 | 3300014745 | Ga0157377_10066603 | Ga0157377_100666031 | 211 |
| 154 | 3300020070 | Ga0206356_10014746 | Ga0206356_100147462 | 211 |
| 155 | 3300025302 | Ga0207426_1001695 | Ga0207426_10016956 | 211 |
| 156 | 3300025302 | Ga0207426_1006964 | Ga0207426_10069641 | 211 |
| 157 | 3300025885 | Ga0207653_10045165 | Ga0207653_100451652 | 211 |
| 158 | 3300025898 | Ga0207692_10052092 | Ga0207692_100520922 | 211 |
| 159 | 3300025898 | Ga0207692_10151822 | Ga0207692_101518222 | 211 |
| 160 | 3300025901 | Ga0207688_10003920 | Ga0207688_100039202 | 211 |
| 161 | 3300025906 | Ga0207699_10032148 | Ga0207699_100321482 | 211 |
| 162 | 3300025906 | Ga0207699_10056834 | Ga0207699_100568342 | 211 |
| 163 | 3300025907 | Ga0207645_10020916 | Ga0207645_100209165 | 211 |
| 164 | 3300025908 | Ga0207643_10010462 | Ga0207643_100104626 | 211 |
| 165 | 3300025909 | Ga0207705_10279423 | Ga0207705_102794232 | 211 |
| 166 | 3300025911 | Ga0207654_10036955 | Ga0207654_100369552 | 211 |
| 167 | 3300025912 | Ga0207707_10247138 | Ga0207707_102471382 | 211 |
| 168 | 3300025912 | Ga0207707_10375231 | Ga0207707_103752312 | 211 |
| 169 | 3300025913 | Ga0207695_10084491 | Ga0207695_100844913 | 211 |
| 170 | 3300025916 | Ga0207663_10102646 | Ga0207663_101026463 | 211 |
| 171 | 3300025919 | Ga0207657_10010424 | Ga0207657_1001042410 | 211 |
| 172 | 3300025921 | Ga0207652_10035870 | Ga0207652_100358705 | 211 |
| 173 | 3300025924 | Ga0207694_10255328 | Ga0207694_102553282 | 211 |
| 174 | 3300025925 | Ga0207650_10181194 | Ga0207650_101811942 | 211 |
| 175 | 3300025928 | Ga0207700_10064776 | Ga0207700_100647762 | 211 |
| 176 | 3300025928 | Ga0207700_10482663 | Ga0207700_104826631 | 211 |
| 177 | 3300025928 | Ga0207700_10862652 | Ga0207700_108626521 | 211 |
| 178 | 3300025929 | Ga0207664_10020356 | Ga0207664_100203562 | 211 |
| 179 | 3300025929 | Ga0207664_10158406 | Ga0207664_101584062 | 211 |
| 180 | 3300025929 | Ga0207664_10554068 | Ga0207664_105540682 | 211 |
| 181 | 3300025931 | Ga0207644_10406452 | Ga0207644_104064521 | 211 |
| 182 | 3300025933 | Ga0207706_10026322 | Ga0207706_100263223 | 211 |
| 183 | 3300025934 | Ga0207686_10024265 | Ga0207686_100242651 | 211 |
| 184 | 3300025936 | Ga0207670_10136158 | Ga0207670_101361582 | 211 |
| 185 | 3300025939 | Ga0207665_10006674 | Ga0207665_100066743 | 211 |
| 186 | 3300025942 | Ga0207689_10106006 | Ga0207689_101060062 | 211 |
| 187 | 3300025944 | Ga0207661_10159922 | Ga0207661_101599222 | 211 |
| 188 | 3300025949 | Ga0207667_10119316 | Ga0207667_101193162 | 211 |
| 189 | 3300026067 | Ga0207678_10717393 | Ga0207678_107173932 | 211 |
| 190 | 3300026078 | Ga0207702_10016152 | Ga0207702_100161526 | 211 |
| 191 | 3300026088 | Ga0207641_10024402 | Ga0207641_100244023 | 211 |
| 192 | 3300026088 | Ga0207641_10927815 | Ga0207641_109278151 | 211 |
| 193 | 3300026118 | Ga0207675_100402395 | Ga0207675_1004023952 | 211 |
| 194 | 3300026121 | Ga0207683_10008335 | Ga0207683_1000833510 | 211 |
| 195 | 3300026142 | Ga0207698_10010090 | Ga0207698_100100906 | 211 |
| 196 | 3300031456 | Ga0307513_10003780 | Ga0307513_100037807 | 211 |
| 197 | 3300031616 | Ga0307508_10001228 | Ga0307508_1000122813 | 211 |
| 198 | 3300035083 | Ga0373926_0000431 | Ga0373926_0000431_1601_2242 | 211 |
| 199 | 3300035086 | Ga0373934_0060672 | Ga0373934_0060672_251_895 | 211 |
| 200 | 3300035089 | Ga0373944_0001774 | Ga0373944_0001774_470_1111 | 211 |
| 201 | 3300035111 | Ga0373923_0004370 | Ga0373923_0004370_3724_4365 | 211 |
| 202 | 3300035111 | Ga0373923_0005743 | Ga0373923_0005743_154_798 | 211 |
| 203 | 3300035113 | Ga0373936_0000300 | Ga0373936_0000300_4803_5444 | 211 |
| 204 | 3300035113 | Ga0373936_0003136 | Ga0373936_0003136_2717_3361 | 211 |
| 205 | 3300035116 | Ga0373945_0000621 | Ga0373945_0000621_8666_9310 | 211 |
| 206 | 3300035116 | Ga0373945_0000765 | Ga0373945_0000765_2893_3534 | 211 |
| 207 | 3300035117 | Ga0373953_0010773 | Ga0373953_0010773_105_749 | 211 |
| 208 | 3300035119 | Ga0373956_0066949 | Ga0373956_0066949_837_1481 | 211 |
| 209 | 3300035120 | Ga0373957_0013131 | Ga0373957_0013131_1992_2636 | 211 |
| 210 | 3300035121 | Ga0373960_0036014 | Ga0373960_0036014_443_1096 | 211 |
| 211 | 3300035170 | Ga0373943_0000210 | Ga0373943_0000210_11137_11778 | 211 |
| 212 | 3300035170 | Ga0373943_0000853 | Ga0373943_0000853_3038_3682 | 211 |
| 213 | 3300035171 | Ga0373946_0000853 | Ga0373946_0000853_1528_2169 | 211 |
| 214 | 3300035171 | Ga0373946_0000901 | Ga0373946_0000901_8384_9028 | 211 |
| 215 | 3300035172 | Ga0373955_0007658 | Ga0373955_0007658_962_1606 | 211 |
| 216 | 3300035207 | Ga0373942_0148961 | Ga0373942_0148961_29_682 | 211 |
| 217 | 3300035241 | Ga0373961_0087311 | Ga0373961_0087311_143_796 | 211 |
| 218 | 3300035410 | Ga0373924_0003757 | Ga0373924_0003757_2765_3409 | 211 |
| 219 | 3300035691 | Ga0373931_0237587 | Ga0373931_0237587_105_758 | 211 |
| 220 | 3300035692 | Ga0373935_0015120 | Ga0373935_0015120_3723_4364 | 211 |
| 221 | 3300035692 | Ga0373935_0216968 | Ga0373935_0216968_56_700 | 211 |
| 222 | 3300035695 | Ga0373927_0001724 | Ga0373927_0001724_10927_11568 | 211 |
| 223 | 3300035695 | Ga0373927_0003506 | Ga0373927_0003506_805_1449 | 211 |
| 224 | 3300035724 | Ga0373933_0010418 | Ga0373933_0010418_4121_4765 | 211 |
| 225 | 3300035724 | Ga0373933_0180163 | Ga0373933_0180163_121_765 | 211 |
| 226 | 3300035725 | Ga0373947_0000745 | Ga0373947_0000745_1343_1987 | 211 |
| 227 | 3300035725 | Ga0373947_0012919 | Ga0373947_0012919_3897_4538 | 211 |
| 228 | 3300036401 | Ga0373937_0196588 | Ga0373937_0196588_1184_1828 | 211 |
| 229 | 3300036401 | Ga0373937_0512640 | Ga0373937_0512640_363_1007 | 211 |
| 230 | 3300037068 | Ga0373925_0000989 | Ga0373925_0000989_25024_25665 | 211 |
| 231 | 3300037068 | Ga0373925_0010631 | Ga0373925_0010631_3632_4276 | 211 |
| 232 | 3300037418 | Ga0395900_0162181 | Ga0395900_0162181_1188_1856 | 211 |
| 233 | 3300037853 | Ga0436364_1419474 | Ga0436364_1419474_1746_2399 | 211 |
| 234 | 3300039450 | Ga0436363_0381476 | Ga0436363_0381476_148_801 | 211 |
| 235 | 3300039450 | Ga0436363_1261317 | Ga0436363_1261317_72_725 | 211 |
| 236 | 3300045976 | Ga0466967_0087393 | Ga0466967_0087393_845_1486 | 211 |
| 237 | 3300046453 | Ga0495627_096635 | Ga0495627_096635_88_738 | 211 |
| 238 | 3300046454 | Ga0495592_0012304 | Ga0495592_0012304_4137_4781 | 211 |
| 239 | 3300046454 | Ga0495592_0305794 | Ga0495592_0305794_104_757 | 211 |
| 240 | 3300046455 | Ga0495603_0000581 | Ga0495603_0000581_3690_4343 | 211 |
| 241 | 3300046455 | Ga0495603_0002290 | Ga0495603_0002290_113_766 | 211 |
| 242 | 3300046455 | Ga0495603_0014926 | Ga0495603_0014926_1665_2309 | 211 |
| 243 | 3300046459 | Ga0495629_0001519 | Ga0495629_0001519_6444_7097 | 211 |
| 244 | 3300046459 | Ga0495629_0008473 | Ga0495629_0008473_2247_2900 | 211 |
| 245 | 3300046459 | Ga0495629_0034729 | Ga0495629_0034729_200_844 | 211 |
| 246 | 3300046459 | Ga0495629_0076614 | Ga0495629_0076614_777_1418 | 211 |
| 247 | 3300046461 | Ga0495641_0002279 | Ga0495641_0002279_11394_12038 | 211 |
| 248 | 3300046461 | Ga0495641_0035142 | Ga0495641_0035142_717_1358 | 211 |
| 249 | 3300046462 | Ga0495651_0124443 | Ga0495651_0124443_912_1556 | 211 |
| 250 | 3300046462 | Ga0495651_0181068 | Ga0495651_0181068_120_764 | 211 |
| 251 | 3300046463 | Ga0495653_0007471 | Ga0495653_0007471_6635_7276 | 211 |
| 252 | 3300046463 | Ga0495653_0044209 | Ga0495653_0044209_1175_1819 | 211 |
| 253 | 3300046463 | Ga0495653_0153327 | Ga0495653_0153327_708_1352 | 211 |
| 254 | 3300046463 | Ga0495653_0287368 | Ga0495653_0287368_278_919 | 211 |
| 255 | 3300046472 | Ga0495580_0001275 | Ga0495580_0001275_8186_8830 | 211 |
| 256 | 3300046473 | Ga0495582_0061116 | Ga0495582_0061116_921_1562 | 211 |
| 257 | 3300046475 | Ga0495639_0000919 | Ga0495639_0000919_2752_3396 | 211 |
| 258 | 3300046476 | Ga0495662_0003816 | Ga0495662_0003816_1949_2593 | 211 |
| 259 | 3300046477 | Ga0495664_0005259 | Ga0495664_0005259_3106_3750 | 211 |
| 260 | 3300046477 | Ga0495664_0069801 | Ga0495664_0069801_424_1065 | 211 |
| 261 | 3300046477 | Ga0495664_0119135 | Ga0495664_0119135_242_886 | 211 |
| 262 | 3300046499 | Ga0495594_0002455 | Ga0495594_0002455_3478_4131 | 211 |
| 263 | 3300046499 | Ga0495594_0236458 | Ga0495594_0236458_306_950 | 211 |
| 264 | 3300046511 | Ga0495608_0014214 | Ga0495608_0014214_1527_2171 | 211 |
| 265 | 3300046514 | Ga0495618_0001193 | Ga0495618_0001193_3402_4046 | 211 |
| 266 | 3300046514 | Ga0495618_0045219 | Ga0495618_0045219_1251_1892 | 211 |
| 267 | 3300046515 | Ga0495620_0197085 | Ga0495620_0197085_77_730 | 211 |
| 268 | 3300046516 | Ga0495628_0004700 | Ga0495628_0004700_5324_5968 | 211 |
| 269 | 3300046516 | Ga0495628_0249908 | Ga0495628_0249908_194_835 | 211 |
| 270 | 3300046516 | Ga0495628_0344491 | Ga0495628_0344491_353_1006 | 211 |
| 271 | 3300046517 | Ga0495630_0003270 | Ga0495630_0003270_827_1468 | 211 |
| 272 | 3300046517 | Ga0495630_0015818 | Ga0495630_0015818_628_1272 | 211 |
| 273 | 3300046526 | Ga0495666_0002824 | Ga0495666_0002824_1045_1689 | 211 |
| 274 | 3300046526 | Ga0495666_0294888 | Ga0495666_0294888_68_721 | 211 |
| 275 | 3300046529 | Ga0495652_0008008 | Ga0495652_0008008_8375_9019 | 211 |
| 276 | 3300046529 | Ga0495652_0038041 | Ga0495652_0038041_3107_3748 | 211 |
| 277 | 3300046531 | Ga0495665_0002201 | Ga0495665_0002201_9742_10386 | 211 |
| 278 | 3300046533 | Ga0495640_0064323 | Ga0495640_0064323_1347_1991 | 211 |
| 279 | 3300046533 | Ga0495640_0085431 | Ga0495640_0085431_612_1253 | 211 |
| 280 | 3300046535 | Ga0495586_0021800 | Ga0495586_0021800_2621_3265 | 211 |
| 281 | 3300046536 | Ga0495587_0002510 | Ga0495587_0002510_8846_9490 | 211 |
| 282 | 3300046536 | Ga0495587_0066521 | Ga0495587_0066521_327_980 | 211 |
| 283 | 3300046536 | Ga0495587_0295055 | Ga0495587_0295055_44_685 | 211 |
| 284 | 3300046543 | Ga0495645_0060170 | Ga0495645_0060170_2083_2727 | 211 |
| 285 | 3300046557 | Ga0495622_0020933 | Ga0495622_0020933_894_1547 | 211 |
| 286 | 3300046557 | Ga0495622_0154432 | Ga0495622_0154432_146_799 | 211 |
| 287 | 3300046559 | Ga0495667_0005551 | Ga0495667_0005551_7462_8103 | 211 |
| 288 | 3300046559 | Ga0495667_0010332 | Ga0495667_0010332_1430_2074 | 211 |
| 289 | 3300046559 | Ga0495667_0448651 | Ga0495667_0448651_69_713 | 211 |
| 290 | 3300046642 | Ga0495634_0004035 | Ga0495634_0004035_5196_5840 | 211 |
| 291 | 3300046642 | Ga0495634_0023005 | Ga0495634_0023005_2662_3303 | 211 |
| 292 | 3300046648 | Ga0495611_0060824 | Ga0495611_0060824_26_679 | 211 |
| 293 | 3300046663 | Ga0495635_0001020 | Ga0495635_0001020_6727_7368 | 211 |
| 294 | 3300046663 | Ga0495635_0040955 | Ga0495635_0040955_918_1562 | 211 |
| 295 | 3300046674 | Ga0495588_0037055 | Ga0495588_0037055_610_1254 | 211 |
| 296 | 3300046675 | Ga0495657_0128888 | Ga0495657_0128888_887_1531 | 211 |
| 297 | 3300046675 | Ga0495657_0144372 | Ga0495657_0144372_597_1238 | 211 |
| 298 | 3300046678 | Ga0495599_0003474 | Ga0495599_0003474_7951_8595 | 211 |
| 299 | 3300046678 | Ga0495599_0187761 | Ga0495599_0187761_165_818 | 211 |
| 300 | 3300046678 | Ga0495599_0197164 | Ga0495599_0197164_145_789 | 211 |
| 301 | 3300046679 | Ga0495623_0100159 | Ga0495623_0100159_1065_1709 | 211 |
| 302 | 3300046679 | Ga0495623_0121458 | Ga0495623_0121458_130_774 | 211 |
| 303 | 3300046680 | Ga0495646_0026449 | Ga0495646_0026449_918_1562 | 211 |
| 304 | 3300046681 | Ga0495647_0036628 | Ga0495647_0036628_693_1337 | 211 |
| 305 | 3300046683 | Ga0495658_0000668 | Ga0495658_0000668_6427_7071 | 211 |
| 306 | 3300046689 | Ga0495613_0001017 | Ga0495613_0001017_8414_9058 | 211 |
| 307 | 3300046689 | Ga0495613_0004228 | Ga0495613_0004228_5476_6129 | 211 |
| 308 | 3300046690 | Ga0495624_0003117 | Ga0495624_0003117_6916_7557 | 211 |
| 309 | 3300046809 | Ga0495600_0033937 | Ga0495600_0033937_155_799 | 211 |
| 310 | 3300047315 | Ga0495581_0000732 | Ga0495581_0000732_7701_8345 | 211 |
| 311 | 3300047315 | Ga0495581_0029604 | Ga0495581_0029604_1504_2145 | 211 |
| 312 | 3300047317 | Ga0495604_0001177 | Ga0495604_0001177_18023_18667 | 211 |
| 313 | 3300047317 | Ga0495604_0164304 | Ga0495604_0164304_251_895 | 211 |
| 314 | 3300047319 | Ga0495674_0001674 | Ga0495674_0001674_10024_10665 | 211 |
| 315 | 3300047319 | Ga0495674_0018733 | Ga0495674_0018733_5743_6387 | 211 |
| 316 | 3300047319 | Ga0495674_0234848 | Ga0495674_0234848_65_718 | 211 |
| 317 | 3300047321 | Ga0495676_0008328 | Ga0495676_0008328_8827_9468 | 211 |
| 318 | 3300047321 | Ga0495676_0008832 | Ga0495676_0008832_194_838 | 211 |
| 319 | 3300047321 | Ga0495676_0023093 | Ga0495676_0023093_76_729 | 211 |
| 320 | 3300047322 | Ga0495680_0026944 | Ga0495680_0026944_3301_3942 | 211 |
| 321 | 3300047322 | Ga0495680_0106162 | Ga0495680_0106162_1417_2061 | 211 |
| 322 | 3300047323 | Ga0495683_0098775 | Ga0495683_0098775_730_1383 | 211 |
| 323 | 3300047444 | Ga0495675_0030126 | Ga0495675_0030126_1966_2610 | 211 |
| 324 | 3300047444 | Ga0495675_0032379 | Ga0495675_0032379_21_665 | 211 |
| 325 | 3300047471 | Ga0495684_0003513 | Ga0495684_0003513_11460_12104 | 211 |
| 326 | 3300047471 | Ga0495684_0054852 | Ga0495684_0054852_736_1377 | 211 |
| 327 | 3300047673 | Ga0495593_0006644 | Ga0495593_0006644_2958_3602 | 211 |
| 328 | 3300047673 | Ga0495593_0056023 | Ga0495593_0056023_777_1418 | 211 |
| 329 | 3300048088 | Ga0495602_0042207 | Ga0495602_0042207_3041_3685 | 211 |
| 330 | 3300048088 | Ga0495602_0134116 | Ga0495602_0134116_802_1443 | 211 |
| 331 | 3300048089 | Ga0495614_0006077 | Ga0495614_0006077_4665_5318 | 211 |
| 332 | 3300048089 | Ga0495614_0008394 | Ga0495614_0008394_3291_3935 | 211 |
| 333 | 3300048089 | Ga0495614_0142670 | Ga0495614_0142670_42_695 | 211 |
| 334 | 3300048903 | Ga0496100_0028814 | Ga0496100_0028814_955_1599 | 211 |
| 335 | 3300048904 | Ga0496101_0224162 | Ga0496101_0224162_560_1204 | 211 |
| 336 | 3300048905 | Ga0496102_0109191 | Ga0496102_0109191_1483_2127 | 211 |
| 337 | 3300048906 | Ga0496103_0015293 | Ga0496103_0015293_1539_2183 | 211 |
| 338 | 3300048907 | Ga0496104_0047016 | Ga0496104_0047016_2949_3593 | 211 |
| 339 | 3300048908 | Ga0496105_0044148 | Ga0496105_0044148_2620_3264 | 211 |
| 340 | 3300048909 | Ga0496106_0039817 | Ga0496106_0039817_2842_3486 | 211 |
| 341 | 3300048909 | Ga0496106_0485553 | Ga0496106_0485553_22_675 | 211 |
| 342 | 3300048910 | Ga0496107_0071585 | Ga0496107_0071585_1295_1939 | 211 |
| 343 | 3300048911 | Ga0496108_0177728 | Ga0496108_0177728_706_1347 | 211 |
| 344 | 3300048911 | Ga0496108_0964335 | Ga0496108_0964335_24_668 | 211 |
| 345 | 3300048912 | Ga0496109_0096805 | Ga0496109_0096805_1256_1900 | 211 |
| 346 | 3300048913 | Ga0496110_0044145 | Ga0496110_0044145_2368_3012 | 211 |
| 347 | 3300048914 | Ga0496111_0181938 | Ga0496111_0181938_450_1094 | 211 |
| 348 | 3300048915 | Ga0496112_0069182 | Ga0496112_0069182_2685_3329 | 211 |
| 349 | 3300048915 | Ga0496112_0825898 | Ga0496112_0825898_152_793 | 211 |
| 350 | 3300048916 | Ga0496113_0059780 | Ga0496113_0059780_828_1472 | 211 |
| 351 | 3300048917 | Ga0496114_0147762 | Ga0496114_0147762_546_1190 | 211 |
| 352 | 3300048918 | Ga0496115_0166387 | Ga0496115_0166387_258_902 | 211 |
| 353 | 3300048929 | Ga0496126_0531483 | Ga0496126_0531483_50_712 | 211 |
| 354 | 3300049539 | Ga0501323_007016 | Ga0501323_007016_274_921 | 211 |
| 355 | 3300049823 | Ga0501044_0396491 | Ga0501044_0396491_280_942 | 211 |
| 356 | 3300049823 | Ga0501044_0467508 | Ga0501044_0467508_367_1032 | 211 |
| 357 | 3300050513 | nmdc:mga0rr50_240546_c1 | nmdc:mga0rr50_240546_c1_721_1362 | 211 |
| 358 | 3300050515 | nmdc:mga0a205_527864_c1 | nmdc:mga0a205_527864_c1_362_1015 | 211 |
| 359 | 3300053077 | Ga0495601_0012738 | Ga0495601_0012738_3516_4160 | 211 |
| 360 | 3300053077 | Ga0495601_0091853 | Ga0495601_0091853_885_1568 | 211 |
| 361 | 3300053078 | Ga0495612_0001269 | Ga0495612_0001269_1948_2592 | 211 |
| 362 | 3300053078 | Ga0495612_0050001 | Ga0495612_0050001_370_1053 | 211 |
| 363 | 3300053078 | Ga0495612_0120044 | Ga0495612_0120044_356_1000 | 211 |
| 364 | 3300053084 | Ga0495595_0004208 | Ga0495595_0004208_574_1218 | 211 |
| 365 | 3300053085 | Ga0495619_0004841 | Ga0495619_0004841_4707_5351 | 211 |
| 366 | iso_pu_bacteria | 2547132111 | 2547409602 | 211 |
| 367 | iso_pu_bacteria | 2554235005 | 2554258985 | 211 |
| 368 | iso_pu_bacteria | 2582581313 | 2585306790 | 211 |
| 369 | iso_pu_bacteria | 2582581314 | 2585314086 | 211 |
| 370 | iso_pu_bacteria | 2616644814 | 2616694276 | 211 |
| 371 | iso_pu_bacteria | 2643221647 | 2644271108 | 211 |
| 372 | iso_pu_bacteria | 2643221678 | 2644435775 | 211 |
| 373 | iso_pu_bacteria | 2643221679 | 2644444684 | 211 |
| 374 | iso_pu_bacteria | 2758568522 | 2760307933 | 211 |
| 375 | iso_pu_bacteria | 2784132148 | 2784587365 | 211 |
| 376 | iso_pu_bacteria | 2784746768 | 2785367920 | 211 |
| 377 | iso_pu_bacteria | 2786546132 | 2786668974 | 211 |
| 378 | iso_pu_bacteria | 2802429296 | 2804844390 | 211 |
| 379 | iso_pu_bacteria | 2808606359 | 2808840584 | 211 |
| 380 | iso_pu_bacteria | 2808606375 | 2808919163 | 211 |
| 381 | iso_pu_bacteria | 2808606448 | 2809230938 | 211 |
| 382 | iso_pu_bacteria | 2811994879 | 2812359599 | 211 |
| 383 | iso_pu_bacteria | 2811994917 | 2812481722 | 211 |
| 384 | iso_pu_bacteria | 2818991472 | 2819743257 | 211 |
| 385 | iso_pu_bacteria | 2852635781 | 2852638418 | 211 |
| 386 | iso_pu_bacteria | 2862281513 | 2862288699 | 211 |
| 387 | iso_pu_bacteria | 2862574272 | 2862582950 | 211 |
| 388 | iso_pu_bacteria | 2867369537 | 2867370622 | 211 |
| 389 | iso_pu_bacteria | 2873151551 | 2873157033 | 211 |
| 390 | iso_pu_bacteria | 2877676314 | 2877682624 | 211 |
| 391 | iso_pu_bacteria | 2912723979 | 2912725493 | 211 |
| 392 | iso_pu_bacteria | 2912757875 | 2912759502 | 211 |
| 393 | iso_pu_bacteria | 2946064051 | 2946066311 | 211 |
| 394 | iso_pu_bacteria | 2946072368 | 2946074580 | 211 |
| 395 | iso_pu_bacteria | 2954380949 | 2954387822 | 211 |
| 396 | iso_pu_bacteria | 2954673503 | 2954675255 | 211 |
| 397 | iso_pu_bacteria | 2954682443 | 2954688880 | 211 |
| 398 | iso_pu_bacteria | 2954691527 | 2954698635 | 211 |
| 399 | iso_pu_bacteria | 2954701450 | 2954703590 | 211 |
| 400 | iso_pu_bacteria | 2954711539 | 2954717606 | 211 |
| 401 | iso_pu_bacteria | 2954721474 | 2954727571 | 211 |
| 402 | iso_pu_bacteria | 2954731030 | 2954734230 | 211 |
| 403 | iso_pu_bacteria | 2954740390 | 2954746466 | 211 |
| 404 | iso_pu_bacteria | 2954749733 | 2954753114 | 211 |
| 405 | iso_pu_bacteria | 2954759201 | 2954765582 | 211 |
| 406 | iso_pu_bacteria | 2990088156 | 2990093063 | 211 |
| 407 | iso_pu_bacteria | 2995463766 | 2995464657 | 211 |
| 408 | iso_pu_bacteria | 3006321560 | 3006322428 | 211 |
| 409 | iso_pu_bacteria | 3006393351 | 3006398639 | 211 |
| 410 | iso_pu_bacteria | 3006425503 | 3006426632 | 211 |
| 411 | iso_pu_bacteria | 3006493962 | 3006495534 | 211 |
| 412 | iso_pu_bacteria | 8008574985 | 8008580090 | 211 |
| 413 | iso_pu_bacteria | 8025413630 | 8025414030 | 211 |
| 414 | iso_pu_bacteria | 8025478263 | 8025485847 | 211 |
| 415 | iso_pu_bacteria | 8025530807 | 8025534742 | 211 |
| 416 | iso_pu_bacteria | 8047893842 | 8047899626 | 211 |
| 417 | iso_pu_bacteria | 8048356638 | 8048359304 | 211 |
| 418 | iso_pu_bacteria | 8048369669 | 8048376575 | 211 |
| 419 | iso_pu_bacteria | 8048379754 | 8048385628 | 211 |
| 420 | iso_pu_bacteria | 8056667051 | 8056668551 | 211 |
| 421 | iso_pu_bacteria | 8056829672 | 8056831216 | 211 |
| 422 | 3300005327 | Ga0070658_10032082 | Ga0070658_100320823 | 212 |
| 423 | 3300005434 | Ga0070709_10021433 | Ga0070709_100214333 | 212 |
| 424 | 3300005434 | Ga0070709_10048179 | Ga0070709_100481793 | 212 |
| 425 | 3300005435 | Ga0070714_100133749 | Ga0070714_1001337492 | 212 |
| 426 | 3300005435 | Ga0070714_100293934 | Ga0070714_1002939341 | 212 |
| 427 | 3300005435 | Ga0070714_100466905 | Ga0070714_1004669051 | 212 |
| 428 | 3300005436 | Ga0070713_100028588 | Ga0070713_1000285885 | 212 |
| 429 | 3300005436 | Ga0070713_100508447 | Ga0070713_1005084472 | 212 |
| 430 | 3300005437 | Ga0070710_10090980 | Ga0070710_100909801 | 212 |
| 431 | 3300005468 | Ga0070707_100058044 | Ga0070707_1000580443 | 212 |
| 432 | 3300005471 | Ga0070698_100006962 | Ga0070698_1000069628 | 212 |
| 433 | 3300005563 | Ga0068855_100028602 | Ga0068855_1000286026 | 212 |
| 434 | 3300006028 | Ga0070717_10056517 | Ga0070717_100565173 | 212 |
| 435 | 3300006028 | Ga0070717_10347505 | Ga0070717_103475052 | 212 |
| 436 | 3300006173 | Ga0070716_100056492 | Ga0070716_1000564922 | 212 |
| 437 | 3300006175 | Ga0070712_100068471 | Ga0070712_1000684711 | 212 |
| 438 | 3300006175 | Ga0070712_100071771 | Ga0070712_1000717712 | 212 |
| 439 | 3300006175 | Ga0070712_100098410 | Ga0070712_1000984102 | 212 |
| 440 | 3300013105 | Ga0157369_10001097 | Ga0157369_100010979 | 212 |
| 441 | 3300021384 | Ga0213876_10009157 | Ga0213876_100091577 | 212 |
| 442 | 3300021388 | Ga0213875_10000331 | Ga0213875_100003318 | 212 |
| 443 | 3300025898 | Ga0207692_10026902 | Ga0207692_100269021 | 212 |
| 444 | 3300025906 | Ga0207699_10005049 | Ga0207699_100050496 | 212 |
| 445 | 3300025906 | Ga0207699_10061155 | Ga0207699_100611552 | 212 |
| 446 | 3300025909 | Ga0207705_10009924 | Ga0207705_100099245 | 212 |
| 447 | 3300025915 | Ga0207693_10044829 | Ga0207693_100448293 | 212 |
| 448 | 3300025915 | Ga0207693_10048524 | Ga0207693_100485243 | 212 |
| 449 | 3300025915 | Ga0207693_10055008 | Ga0207693_100550082 | 212 |
| 450 | 3300025922 | Ga0207646_10206437 | Ga0207646_102064373 | 212 |
| 451 | 3300025928 | Ga0207700_10059527 | Ga0207700_100595271 | 212 |
| 452 | 3300025928 | Ga0207700_10148750 | Ga0207700_101487502 | 212 |
| 453 | 3300025929 | Ga0207664_10487935 | Ga0207664_104879352 | 212 |
| 454 | 3300025939 | Ga0207665_10471257 | Ga0207665_104712571 | 212 |
| 455 | 3300025949 | Ga0207667_10057556 | Ga0207667_100575563 | 212 |
| 456 | 3300031507 | Ga0307509_10034109 | Ga0307509_100341094 | 212 |
| 457 | 3300031616 | Ga0307508_10150836 | Ga0307508_101508362 | 212 |
| 458 | 3300035111 | Ga0373923_0092196 | Ga0373923_0092196_142_813 | 212 |
| 459 | 3300035113 | Ga0373936_0028740 | Ga0373936_0028740_527_1198 | 212 |
| 460 | 3300035113 | Ga0373936_0121546 | Ga0373936_0121546_206_877 | 212 |
| 461 | 3300035117 | Ga0373953_0017014 | Ga0373953_0017014_526_1197 | 212 |
| 462 | 3300035117 | Ga0373953_0046444 | Ga0373953_0046444_622_1293 | 212 |
| 463 | 3300035118 | Ga0373954_0012718 | Ga0373954_0012718_924_1595 | 212 |
| 464 | 3300035118 | Ga0373954_0060510 | Ga0373954_0060510_749_1420 | 212 |
| 465 | 3300035119 | Ga0373956_0032315 | Ga0373956_0032315_208_879 | 212 |
| 466 | 3300035120 | Ga0373957_0004859 | Ga0373957_0004859_455_1126 | 212 |
| 467 | 3300035120 | Ga0373957_0035114 | Ga0373957_0035114_1045_1716 | 212 |
| 468 | 3300035172 | Ga0373955_0053068 | Ga0373955_0053068_525_1196 | 212 |
| 469 | 3300035172 | Ga0373955_0096188 | Ga0373955_0096188_613_1284 | 212 |
| 470 | 3300035692 | Ga0373935_0021479 | Ga0373935_0021479_2730_3401 | 212 |
| 471 | 3300035692 | Ga0373935_0159123 | Ga0373935_0159123_128_799 | 212 |
| 472 | 3300035695 | Ga0373927_0261318 | Ga0373927_0261318_412_1068 | 212 |
| 473 | 3300035724 | Ga0373933_0007376 | Ga0373933_0007376_2841_3512 | 212 |
| 474 | 3300035724 | Ga0373933_0010620 | Ga0373933_0010620_2887_3558 | 212 |
| 475 | 3300036401 | Ga0373937_0047927 | Ga0373937_0047927_920_1591 | 212 |
| 476 | 3300036401 | Ga0373937_0196205 | Ga0373937_0196205_152_823 | 212 |
| 477 | 3300039437 | Ga0436365_1767487 | Ga0436365_1767487_15498_16145 | 212 |
| 478 | 3300044719 | Ga0466971_0002384 | Ga0466971_0002384_4393_5073 | 212 |
| 479 | 3300045049 | Ga0466959_0002676 | Ga0466959_0002676_10706_11386 | 212 |
| 480 | 3300046454 | Ga0495592_0003362 | Ga0495592_0003362_6580_7248 | 212 |
| 481 | 3300046459 | Ga0495629_0005219 | Ga0495629_0005219_5356_6024 | 212 |
| 482 | 3300046462 | Ga0495651_0001048 | Ga0495651_0001048_4132_4812 | 212 |
| 483 | 3300046462 | Ga0495651_0104129 | Ga0495651_0104129_773_1444 | 212 |
| 484 | 3300046462 | Ga0495651_0112862 | Ga0495651_0112862_1184_1852 | 212 |
| 485 | 3300046463 | Ga0495653_0018529 | Ga0495653_0018529_4568_5239 | 212 |
| 486 | 3300046463 | Ga0495653_0099009 | Ga0495653_0099009_673_1344 | 212 |
| 487 | 3300046511 | Ga0495608_0023923 | Ga0495608_0023923_655_1326 | 212 |
| 488 | 3300046511 | Ga0495608_0035569 | Ga0495608_0035569_1569_2240 | 212 |
| 489 | 3300046514 | Ga0495618_0026198 | Ga0495618_0026198_855_1535 | 212 |
| 490 | 3300046514 | Ga0495618_0082226 | Ga0495618_0082226_197_868 | 212 |
| 491 | 3300046516 | Ga0495628_0058091 | Ga0495628_0058091_122_802 | 212 |
| 492 | 3300046516 | Ga0495628_0199834 | Ga0495628_0199834_724_1395 | 212 |
| 493 | 3300046517 | Ga0495630_0173082 | Ga0495630_0173082_231_902 | 212 |
| 494 | 3300046529 | Ga0495652_0006871 | Ga0495652_0006871_3350_4030 | 212 |
| 495 | 3300046529 | Ga0495652_0075703 | Ga0495652_0075703_1324_1995 | 212 |
| 496 | 3300046533 | Ga0495640_0006759 | Ga0495640_0006759_6577_7245 | 212 |
| 497 | 3300046535 | Ga0495586_0120600 | Ga0495586_0120600_67_738 | 212 |
| 498 | 3300046543 | Ga0495645_0050801 | Ga0495645_0050801_1907_2578 | 212 |
| 499 | 3300046559 | Ga0495667_0006827 | Ga0495667_0006827_5748_6419 | 212 |
| 500 | 3300046559 | Ga0495667_0098645 | Ga0495667_0098645_658_1329 | 212 |
| 501 | 3300046642 | Ga0495634_0003734 | Ga0495634_0003734_6301_6969 | 212 |
| 502 | 3300046642 | Ga0495634_0086784 | Ga0495634_0086784_313_984 | 212 |
| 503 | 3300046642 | Ga0495634_0144048 | Ga0495634_0144048_449_1120 | 212 |
| 504 | 3300046663 | Ga0495635_0005268 | Ga0495635_0005268_1616_2287 | 212 |
| 505 | 3300046663 | Ga0495635_0062768 | Ga0495635_0062768_665_1336 | 212 |
| 506 | 3300046675 | Ga0495657_0007027 | Ga0495657_0007027_1669_2340 | 212 |
| 507 | 3300046675 | Ga0495657_0013113 | Ga0495657_0013113_2922_3590 | 212 |
| 508 | 3300046675 | Ga0495657_0026932 | Ga0495657_0026932_509_1180 | 212 |
| 509 | 3300046675 | Ga0495657_0358045 | Ga0495657_0358045_28_684 | 212 |
| 510 | 3300046678 | Ga0495599_0165891 | Ga0495599_0165891_134_805 | 212 |
| 511 | 3300046679 | Ga0495623_0222323 | Ga0495623_0222323_23_694 | 212 |
| 512 | 3300046680 | Ga0495646_0008959 | Ga0495646_0008959_1604_2275 | 212 |
| 513 | 3300046689 | Ga0495613_0006091 | Ga0495613_0006091_5675_6343 | 212 |
| 514 | 3300046689 | Ga0495613_0097186 | Ga0495613_0097186_1094_1765 | 212 |
| 515 | 3300046809 | Ga0495600_0094741 | Ga0495600_0094741_172_843 | 212 |
| 516 | 3300046809 | Ga0495600_0131715 | Ga0495600_0131715_931_1602 | 212 |
| 517 | 3300047317 | Ga0495604_0007586 | Ga0495604_0007586_6550_7218 | 212 |
| 518 | 3300047317 | Ga0495604_0037390 | Ga0495604_0037390_431_1102 | 212 |
| 519 | 3300047319 | Ga0495674_0166927 | Ga0495674_0166927_455_1126 | 212 |
| 520 | 3300047321 | Ga0495676_0002474 | Ga0495676_0002474_9172_9840 | 212 |
| 521 | 3300047322 | Ga0495680_0006577 | Ga0495680_0006577_5473_6144 | 212 |
| 522 | 3300047471 | Ga0495684_0043083 | Ga0495684_0043083_839_1510 | 212 |
| 523 | 3300047471 | Ga0495684_0057084 | Ga0495684_0057084_977_1648 | 212 |
| 524 | 3300048088 | Ga0495602_0033616 | Ga0495602_0033616_508_1179 | 212 |
| 525 | 3300049568 | Ga0501031_0006424 | Ga0501031_0006424_1963_2697 | 212 |
| 526 | 3300049570 | Ga0501033_0076368 | Ga0501033_0076368_1586_2251 | 212 |
| 527 | 3300049571 | Ga0501034_0085655 | Ga0501034_0085655_1072_1806 | 212 |
| 528 | 3300049572 | Ga0501036_0019176 | Ga0501036_0019176_4710_5444 | 212 |
| 529 | 3300049574 | Ga0501038_0007735 | Ga0501038_0007735_5256_5990 | 212 |
| 530 | 3300049581 | Ga0501047_0111742 | Ga0501047_0111742_1541_2188 | 212 |
| 531 | 3300049822 | Ga0501035_0225285 | Ga0501035_0225285_43_708 | 212 |
| 532 | 3300049823 | Ga0501044_0067407 | Ga0501044_0067407_843_1508 | 212 |
| 533 | 3300053077 | Ga0495601_0006351 | Ga0495601_0006351_881_1561 | 212 |
| 534 | 3300053078 | Ga0495612_0002887 | Ga0495612_0002887_4173_4853 | 212 |
| 535 | 3300053085 | Ga0495619_0071628 | Ga0495619_0071628_845_1516 | 212 |
| 536 | 3300053085 | Ga0495619_0082560 | Ga0495619_0082560_752_1432 | 212 |
| 537 | 3300061719 | Ga0466962_0000123 | Ga0466962_0000123_23960_24640 | 212 |
| 538 | iso_pu_bacteria | 2816332119 | 2816425211 | 212 |
| 539 | iso_pu_bacteria | 8056447290 | 8056449735 | 212 |
| 540 | 3300003320 | rootH2_10131917 | rootH2_101319172 | 213 |
| 541 | 3300005441 | Ga0070700_100000046 | Ga0070700_10000004627 | 213 |
| 542 | 3300005445 | Ga0070708_100014738 | Ga0070708_1000147383 | 213 |
| 543 | 3300005445 | Ga0070708_100685516 | Ga0070708_1006855161 | 213 |
| 544 | 3300005467 | Ga0070706_100022411 | Ga0070706_1000224115 | 213 |
| 545 | 3300005467 | Ga0070706_100061305 | Ga0070706_1000613053 | 213 |
| 546 | 3300005467 | Ga0070706_100061882 | Ga0070706_1000618822 | 213 |
| 547 | 3300005467 | Ga0070706_100112598 | Ga0070706_1001125983 | 213 |
| 548 | 3300005468 | Ga0070707_100011319 | Ga0070707_1000113192 | 213 |
| 549 | 3300005468 | Ga0070707_100030611 | Ga0070707_1000306113 | 213 |
| 550 | 3300005468 | Ga0070707_100033248 | Ga0070707_1000332483 | 213 |
| 551 | 3300005468 | Ga0070707_100077848 | Ga0070707_1000778482 | 213 |
| 552 | 3300005468 | Ga0070707_100188039 | Ga0070707_1001880392 | 213 |
| 553 | 3300005471 | Ga0070698_100017421 | Ga0070698_10001742110 | 213 |
| 554 | 3300005471 | Ga0070698_100025287 | Ga0070698_1000252877 | 213 |
| 555 | 3300005471 | Ga0070698_100232996 | Ga0070698_1002329962 | 213 |
| 556 | 3300005471 | Ga0070698_100432145 | Ga0070698_1004321452 | 213 |
| 557 | 3300005471 | Ga0070698_100700195 | Ga0070698_1007001952 | 213 |
| 558 | 3300005518 | Ga0070699_100004942 | Ga0070699_10000494213 | 213 |
| 559 | 3300005518 | Ga0070699_100224520 | Ga0070699_1002245201 | 213 |
| 560 | 3300005536 | Ga0070697_100203822 | Ga0070697_1002038222 | 213 |
| 561 | 3300006028 | Ga0070717_10451466 | Ga0070717_104514662 | 213 |
| 562 | 3300025910 | Ga0207684_10035694 | Ga0207684_100356943 | 213 |
| 563 | 3300025910 | Ga0207684_10036572 | Ga0207684_100365725 | 213 |
| 564 | 3300025922 | Ga0207646_10010187 | Ga0207646_100101879 | 213 |
| 565 | 3300025922 | Ga0207646_10012121 | Ga0207646_100121212 | 213 |
| 566 | 3300025922 | Ga0207646_10040561 | Ga0207646_100405611 | 213 |
| 567 | 3300025922 | Ga0207646_10051833 | Ga0207646_100518334 | 213 |
| 568 | 3300026075 | Ga0207708_10000002 | Ga0207708_1000000269 | 213 |
| 569 | 3300028786 | Ga0307517_10009169 | Ga0307517_100091694 | 213 |
| 570 | 3300030732 | Ga0316176_1058730 | Ga0316176_10587302 | 213 |
| 571 | 3300031507 | Ga0307509_10415778 | Ga0307509_104157782 | 213 |
| 572 | 3300031616 | Ga0307508_10101115 | Ga0307508_101011153 | 213 |
| 573 | 3300031649 | Ga0307514_10206757 | Ga0307514_102067572 | 213 |
| 574 | 3300031730 | Ga0307516_10202274 | Ga0307516_102022742 | 213 |
| 575 | 3300033180 | Ga0307510_10169961 | Ga0307510_101699613 | 213 |
| 576 | 3300035170 | Ga0373943_0049300 | Ga0373943_0049300_155_877 | 213 |
| 577 | 3300035695 | Ga0373927_0139879 | Ga0373927_0139879_411_1133 | 213 |
| 578 | 3300037068 | Ga0373925_0053289 | Ga0373925_0053289_1786_2454 | 213 |
| 579 | 3300037068 | Ga0373925_0153026 | Ga0373925_0153026_412_1134 | 213 |
| 580 | 3300037466 | Ga0395898_0015773 | Ga0395898_0015773_6031_6684 | 213 |
| 581 | 3300037853 | Ga0436364_0226463 | Ga0436364_0226463_16358_17029 | 213 |
| 582 | 3300037853 | Ga0436364_0397039 | Ga0436364_0397039_1986_2648 | 213 |
| 583 | 3300037853 | Ga0436364_0644841 | Ga0436364_0644841_76_762 | 213 |
| 584 | 3300037853 | Ga0436364_0728232 | Ga0436364_0728232_183_839 | 213 |
| 585 | 3300039447 | Ga0436361_0451808 | Ga0436361_0451808_116_775 | 213 |
| 586 | 3300039450 | Ga0436363_0358206 | Ga0436363_0358206_242_889 | 213 |
| 587 | 3300042007 | Ga0439449_0000937 | Ga0439449_0000937_856_1500 | 213 |
| 588 | 3300046455 | Ga0495603_0185681 | Ga0495603_0185681_45_698 | 213 |
| 589 | 3300046459 | Ga0495629_0059311 | Ga0495629_0059311_1325_1975 | 213 |
| 590 | 3300046460 | Ga0495638_0318647 | Ga0495638_0318647_146_799 | 213 |
| 591 | 3300046462 | Ga0495651_0068380 | Ga0495651_0068380_309_977 | 213 |
| 592 | 3300046474 | Ga0495605_0197204 | Ga0495605_0197204_154_807 | 213 |
| 593 | 3300046499 | Ga0495594_0069558 | Ga0495594_0069558_1278_1931 | 213 |
| 594 | 3300046499 | Ga0495594_0180531 | Ga0495594_0180531_525_1169 | 213 |
| 595 | 3300046506 | Ga0495583_0110431 | Ga0495583_0110431_32_688 | 213 |
| 596 | 3300046519 | Ga0495632_0046066 | Ga0495632_0046066_1033_1677 | 213 |
| 597 | 3300046522 | Ga0495643_0015751 | Ga0495643_0015751_2772_3416 | 213 |
| 598 | 3300046533 | Ga0495640_0038683 | Ga0495640_0038683_1977_2633 | 213 |
| 599 | 3300046648 | Ga0495611_0150539 | Ga0495611_0150539_272_925 | 213 |
| 600 | 3300046648 | Ga0495611_0193356 | Ga0495611_0193356_91_735 | 213 |
| 601 | 3300046683 | Ga0495658_0017509 | Ga0495658_0017509_2339_2983 | 213 |
| 602 | 3300046691 | Ga0495670_0028561 | Ga0495670_0028561_27_680 | 213 |
| 603 | 3300047315 | Ga0495581_0058776 | Ga0495581_0058776_885_1535 | 213 |
| 604 | 3300047317 | Ga0495604_0075680 | Ga0495604_0075680_622_1278 | 213 |
| 605 | 3300047321 | Ga0495676_0172450 | Ga0495676_0172450_429_1082 | 213 |
| 606 | 3300047322 | Ga0495680_0036621 | Ga0495680_0036621_309_977 | 213 |
| 607 | 3300047323 | Ga0495683_0043444 | Ga0495683_0043444_1459_2112 | 213 |
| 608 | 3300047447 | Ga0495685_002002 | Ga0495685_002002_1814_2467 | 213 |
| 609 | 3300047447 | Ga0495685_004607 | Ga0495685_004607_895_1539 | 213 |
| 610 | 3300047470 | Ga0495681_0003668 | Ga0495681_0003668_352_996 | 213 |
| 611 | 3300047472 | Ga0495686_0021426 | Ga0495686_0021426_813_1457 | 213 |
| 612 | 3300048918 | Ga0496115_0557778 | Ga0496115_0557778_35_685 | 213 |
| 613 | 3300049580 | Ga0501046_0177986 | Ga0501046_0177986_438_1094 | 213 |
| 614 | 3300049589 | Ga0501073_0192030 | Ga0501073_0192030_654_1316 | 213 |
| 615 | 3300049742 | Ga0501080_0298932 | Ga0501080_0298932_263_925 | 213 |
| 616 | 3300049822 | Ga0501035_0012498 | Ga0501035_0012498_6318_6968 | 213 |
| 617 | 3300049823 | Ga0501044_0025390 | Ga0501044_0025390_1278_1976 | 213 |
| 618 | 3300049823 | Ga0501044_0139858 | Ga0501044_0139858_1124_1780 | 213 |
| 619 | 3300053077 | Ga0495601_0267920 | Ga0495601_0267920_152_814 | 213 |
| 620 | 3300053086 | Ga0500578_0036380 | Ga0500578_0036380_2102_2746 | 213 |
| 621 | 3300053100 | Ga0500660_139741 | Ga0500660_139741_110_754 | 213 |
| 622 | 3300053101 | Ga0500553_037842 | Ga0500553_037842_374_1018 | 213 |
| 623 | 3300053109 | Ga0500569_003461 | Ga0500569_003461_1068_1712 | 213 |
| 624 | 3300053131 | Ga0500652_000184 | Ga0500652_000184_20764_21408 | 213 |
| 625 | 3300053137 | Ga0500561_0016007 | Ga0500561_0016007_88_732 | 213 |
| 626 | 3300053143 | Ga0500579_054867 | Ga0500579_054867_493_1137 | 213 |
| 627 | 3300053149 | Ga0500600_0019200 | Ga0500600_0019200_674_1318 | 213 |
| 628 | 3300053153 | Ga0500616_0022984 | Ga0500616_0022984_1116_1760 | 213 |
| 629 | 3300053161 | Ga0500634_0019418 | Ga0500634_0019418_820_1464 | 213 |
| 630 | iso_pu_bacteria | 2947224130 | 2947231067 | 213 |
| 631 | 3300003316 | rootH1_10018911 | rootH1_100189113 | 214 |
| 632 | 3300003320 | rootH2_10046870 | rootH2_100468702 | 214 |
| 633 | 3300003323 | rootH1_10049521 | rootH1_100495213 | 214 |
| 634 | 3300005563 | Ga0068855_100845652 | Ga0068855_1008456521 | 214 |
| 635 | 3300005578 | Ga0068854_100529855 | Ga0068854_1005298551 | 214 |
| 636 | 3300011119 | Ga0105246_10018005 | Ga0105246_100180054 | 214 |
| 637 | 3300014497 | Ga0182008_10002405 | Ga0182008_100024053 | 214 |
| 638 | 3300015262 | Ga0182007_10000417 | Ga0182007_1000041727 | 214 |
| 639 | 3300021388 | Ga0213875_10011586 | Ga0213875_100115861 | 214 |
| 640 | 3300025297 | Ga0209758_1018862 | Ga0209758_10188623 | 214 |
| 641 | 3300025904 | Ga0207647_10012829 | Ga0207647_100128292 | 214 |
| 642 | 3300025949 | Ga0207667_10770070 | Ga0207667_107700702 | 214 |
| 643 | 3300025981 | Ga0207640_10276448 | Ga0207640_102764482 | 214 |
| 644 | 3300027866 | Ga0209813_10006896 | Ga0209813_100068963 | 214 |
| 645 | 3300028379 | Ga0268266_10114600 | Ga0268266_101146002 | 214 |
| 646 | 3300028786 | Ga0307517_10003383 | Ga0307517_1000338314 | 214 |
| 647 | 3300028786 | Ga0307517_10258779 | Ga0307517_102587792 | 214 |
| 648 | 3300028794 | Ga0307515_10005348 | Ga0307515_100053484 | 214 |
| 649 | 3300030521 | Ga0307511_10001143 | Ga0307511_1000114311 | 214 |
| 650 | 3300030522 | Ga0307512_10042832 | Ga0307512_100428324 | 214 |
| 651 | 3300031507 | Ga0307509_10007629 | Ga0307509_100076296 | 214 |
| 652 | 3300031507 | Ga0307509_10043365 | Ga0307509_100433652 | 214 |
| 653 | 3300031507 | Ga0307509_10219510 | Ga0307509_102195102 | 214 |
| 654 | 3300031616 | Ga0307508_10010547 | Ga0307508_100105473 | 214 |
| 655 | 3300031649 | Ga0307514_10009106 | Ga0307514_100091068 | 214 |
| 656 | 3300031649 | Ga0307514_10048682 | Ga0307514_100486821 | 214 |
| 657 | 3300031649 | Ga0307514_10256189 | Ga0307514_102561891 | 214 |
| 658 | 3300031730 | Ga0307516_10010490 | Ga0307516_100104908 | 214 |
| 659 | 3300031730 | Ga0307516_10028336 | Ga0307516_100283362 | 214 |
| 660 | 3300031838 | Ga0307518_10106213 | Ga0307518_101062133 | 214 |
| 661 | 3300033179 | Ga0307507_10014880 | Ga0307507_100148808 | 214 |
| 662 | 3300033180 | Ga0307510_10028481 | Ga0307510_100284813 | 214 |
| 663 | 3300033180 | Ga0307510_10044963 | Ga0307510_100449632 | 214 |
| 664 | 3300037068 | Ga0373925_0001802 | Ga0373925_0001802_2234_2944 | 214 |
| 665 | 3300037853 | Ga0436364_0773303 | Ga0436364_0773303_9787_10476 | 214 |
| 666 | 3300041404 | Ga0439436_0000995 | Ga0439436_0000995_4193_4852 | 214 |
| 667 | 3300041406 | Ga0439439_0001201 | Ga0439439_0001201_337_996 | 214 |
| 668 | 3300041494 | Ga0451837_0619170 | Ga0451837_0619170_2281_2931 | 214 |
| 669 | 3300041512 | Ga0451853_1087724 | Ga0451853_1087724_1166_1810 | 214 |
| 670 | 3300041512 | Ga0451853_1223385 | Ga0451853_1223385_1023_1670 | 214 |
| 671 | 3300041999 | Ga0439433_0001185 | Ga0439433_0001185_3988_4647 | 214 |
| 672 | 3300042002 | Ga0439442_024467 | Ga0439442_024467_420_1067 | 214 |
| 673 | 3300042007 | Ga0439449_0040989 | Ga0439449_0040989_298_957 | 214 |
| 674 | 3300042007 | Ga0439449_0185097 | Ga0439449_0185097_61_723 | 214 |
| 675 | 3300042012 | Ga0439455_0009626 | Ga0439455_0009626_856_1506 | 214 |
| 676 | 3300042014 | Ga0439457_026017 | Ga0439457_026017_145_789 | 214 |
| 677 | 3300042014 | Ga0439457_052461 | Ga0439457_052461_132_791 | 214 |
| 678 | 3300042015 | Ga0439462_0009705 | Ga0439462_0009705_1569_2228 | 214 |
| 679 | 3300042131 | Ga0450894_000226 | Ga0450894_000226_2421_3065 | 214 |
| 680 | 3300042133 | Ga0450896_005131 | Ga0450896_005131_961_1605 | 214 |
| 681 | 3300042134 | Ga0450898_000074 | Ga0450898_000074_2126_2770 | 214 |
| 682 | 3300042138 | Ga0450903_000479 | Ga0450903_000479_3173_3823 | 214 |
| 683 | 3300042145 | Ga0450906_000163 | Ga0450906_000163_7125_7769 | 214 |
| 684 | 3300044656 | Ga0466969_0000457 | Ga0466969_0000457_13822_14484 | 214 |
| 685 | 3300044658 | Ga0466972_0051678 | Ga0466972_0051678_686_1336 | 214 |
| 686 | 3300044683 | Ga0466965_0053650 | Ga0466965_0053650_1299_1946 | 214 |
| 687 | 3300044683 | Ga0466965_0109447 | Ga0466965_0109447_529_1179 | 214 |
| 688 | 3300044683 | Ga0466965_0135122 | Ga0466965_0135122_561_1217 | 214 |
| 689 | 3300044684 | Ga0466966_0032287 | Ga0466966_0032287_691_1341 | 214 |
| 690 | 3300044684 | Ga0466966_0123527 | Ga0466966_0123527_594_1292 | 214 |
| 691 | 3300044693 | Ga0466961_0003433 | Ga0466961_0003433_3671_4321 | 214 |
| 692 | 3300044693 | Ga0466961_0013690 | Ga0466961_0013690_1181_1843 | 214 |
| 693 | 3300044694 | Ga0466963_0002973 | Ga0466963_0002973_7207_7857 | 214 |
| 694 | 3300044735 | Ga0466968_0062563 | Ga0466968_0062563_279_929 | 214 |
| 695 | 3300045049 | Ga0466959_0366594 | Ga0466959_0366594_45_695 | 214 |
| 696 | 3300045976 | Ga0466967_0864979 | Ga0466967_0864979_55_711 | 214 |
| 697 | 3300046452 | Ga0495617_018522 | Ga0495617_018522_1212_1862 | 214 |
| 698 | 3300046454 | Ga0495592_0007389 | Ga0495592_0007389_6002_6652 | 214 |
| 699 | 3300046455 | Ga0495603_0010349 | Ga0495603_0010349_2727_3377 | 214 |
| 700 | 3300046459 | Ga0495629_0020033 | Ga0495629_0020033_809_1459 | 214 |
| 701 | 3300046459 | Ga0495629_0025351 | Ga0495629_0025351_80_739 | 214 |
| 702 | 3300046460 | Ga0495638_0019298 | Ga0495638_0019298_3549_4199 | 214 |
| 703 | 3300046462 | Ga0495651_0003279 | Ga0495651_0003279_4793_5446 | 214 |
| 704 | 3300046462 | Ga0495651_0047653 | Ga0495651_0047653_1043_1693 | 214 |
| 705 | 3300046463 | Ga0495653_0030171 | Ga0495653_0030171_3525_4178 | 214 |
| 706 | 3300046472 | Ga0495580_0184671 | Ga0495580_0184671_44_697 | 214 |
| 707 | 3300046472 | Ga0495580_0318087 | Ga0495580_0318087_379_1029 | 214 |
| 708 | 3300046476 | Ga0495662_0000196 | Ga0495662_0000196_1573_2226 | 214 |
| 709 | 3300046477 | Ga0495664_0003354 | Ga0495664_0003354_2343_2996 | 214 |
| 710 | 3300046500 | Ga0495596_0016515 | Ga0495596_0016515_497_1147 | 214 |
| 711 | 3300046511 | Ga0495608_0000625 | Ga0495608_0000625_18734_19387 | 214 |
| 712 | 3300046512 | Ga0495610_0180754 | Ga0495610_0180754_20_670 | 214 |
| 713 | 3300046513 | Ga0495616_0014854 | Ga0495616_0014854_1138_1788 | 214 |
| 714 | 3300046514 | Ga0495618_0072888 | Ga0495618_0072888_1464_2114 | 214 |
| 715 | 3300046515 | Ga0495620_0011287 | Ga0495620_0011287_1946_2596 | 214 |
| 716 | 3300046516 | Ga0495628_0016836 | Ga0495628_0016836_1863_2516 | 214 |
| 717 | 3300046516 | Ga0495628_0090534 | Ga0495628_0090534_115_765 | 214 |
| 718 | 3300046516 | Ga0495628_0158565 | Ga0495628_0158565_108_758 | 214 |
| 719 | 3300046517 | Ga0495630_0033272 | Ga0495630_0033272_513_1166 | 214 |
| 720 | 3300046518 | Ga0495631_0003384 | Ga0495631_0003384_5559_6209 | 214 |
| 721 | 3300046524 | Ga0495648_0099254 | Ga0495648_0099254_544_1194 | 214 |
| 722 | 3300046526 | Ga0495666_0002728 | Ga0495666_0002728_7770_8423 | 214 |
| 723 | 3300046526 | Ga0495666_0009995 | Ga0495666_0009995_1676_2326 | 214 |
| 724 | 3300046529 | Ga0495652_0281190 | Ga0495652_0281190_40_690 | 214 |
| 725 | 3300046530 | Ga0495654_0077346 | Ga0495654_0077346_19_669 | 214 |
| 726 | 3300046531 | Ga0495665_0005244 | Ga0495665_0005244_1448_2101 | 214 |
| 727 | 3300046531 | Ga0495665_0032653 | Ga0495665_0032653_559_1209 | 214 |
| 728 | 3300046533 | Ga0495640_0020436 | Ga0495640_0020436_289_939 | 214 |
| 729 | 3300046533 | Ga0495640_0042835 | Ga0495640_0042835_67_720 | 214 |
| 730 | 3300046536 | Ga0495587_0010861 | Ga0495587_0010861_2155_2808 | 214 |
| 731 | 3300046538 | Ga0495609_0010581 | Ga0495609_0010581_1641_2291 | 214 |
| 732 | 3300046542 | Ga0495597_0010605 | Ga0495597_0010605_3699_4349 | 214 |
| 733 | 3300046543 | Ga0495645_0011084 | Ga0495645_0011084_3342_3995 | 214 |
| 734 | 3300046543 | Ga0495645_0070401 | Ga0495645_0070401_886_1551 | 214 |
| 735 | 3300046557 | Ga0495622_0043034 | Ga0495622_0043034_889_1539 | 214 |
| 736 | 3300046558 | Ga0495633_0007334 | Ga0495633_0007334_3101_3751 | 214 |
| 737 | 3300046559 | Ga0495667_0016663 | Ga0495667_0016663_144_797 | 214 |
| 738 | 3300046616 | Ga0495668_0206862 | Ga0495668_0206862_144_794 | 214 |
| 739 | 3300046642 | Ga0495634_0064823 | Ga0495634_0064823_529_1179 | 214 |
| 740 | 3300046642 | Ga0495634_0085342 | Ga0495634_0085342_553_1206 | 214 |
| 741 | 3300046648 | Ga0495611_0021326 | Ga0495611_0021326_629_1279 | 214 |
| 742 | 3300046663 | Ga0495635_0286528 | Ga0495635_0286528_164_814 | 214 |
| 743 | 3300046663 | Ga0495635_0298400 | Ga0495635_0298400_385_1038 | 214 |
| 744 | 3300046674 | Ga0495588_0055324 | Ga0495588_0055324_46_705 | 214 |
| 745 | 3300046675 | Ga0495657_0026424 | Ga0495657_0026424_188_838 | 214 |
| 746 | 3300046675 | Ga0495657_0032482 | Ga0495657_0032482_2845_3498 | 214 |
| 747 | 3300046675 | Ga0495657_0237227 | Ga0495657_0237227_201_851 | 214 |
| 748 | 3300046679 | Ga0495623_0027238 | Ga0495623_0027238_553_1206 | 214 |
| 749 | 3300046680 | Ga0495646_0046051 | Ga0495646_0046051_1584_2237 | 214 |
| 750 | 3300046680 | Ga0495646_0144775 | Ga0495646_0144775_622_1272 | 214 |
| 751 | 3300046689 | Ga0495613_0006111 | Ga0495613_0006111_4832_5485 | 214 |
| 752 | 3300046689 | Ga0495613_0045156 | Ga0495613_0045156_1003_1662 | 214 |
| 753 | 3300046689 | Ga0495613_0301722 | Ga0495613_0301722_204_854 | 214 |
| 754 | 3300046689 | Ga0495613_0303607 | Ga0495613_0303607_200_850 | 214 |
| 755 | 3300046690 | Ga0495624_0177528 | Ga0495624_0177528_414_1064 | 214 |
| 756 | 3300046692 | Ga0495671_0016204 | Ga0495671_0016204_693_1355 | 214 |
| 757 | 3300046694 | Ga0495649_0027568 | Ga0495649_0027568_1409_2056 | 214 |
| 758 | 3300046694 | Ga0495649_0145680 | Ga0495649_0145680_21_671 | 214 |
| 759 | 3300046794 | Ga0495589_0012578 | Ga0495589_0012578_22_681 | 214 |
| 760 | 3300046794 | Ga0495589_0087324 | Ga0495589_0087324_403_1053 | 214 |
| 761 | 3300046809 | Ga0495600_0028042 | Ga0495600_0028042_2845_3498 | 214 |
| 762 | 3300046810 | Ga0495660_0107029 | Ga0495660_0107029_365_1015 | 214 |
| 763 | 3300047315 | Ga0495581_0131963 | Ga0495581_0131963_345_998 | 214 |
| 764 | 3300047315 | Ga0495581_0260869 | Ga0495581_0260869_152_802 | 214 |
| 765 | 3300047317 | Ga0495604_0003563 | Ga0495604_0003563_4793_5446 | 214 |
| 766 | 3300047317 | Ga0495604_0031810 | Ga0495604_0031810_3381_4031 | 214 |
| 767 | 3300047318 | Ga0495636_0039985 | Ga0495636_0039985_1033_1692 | 214 |
| 768 | 3300047318 | Ga0495636_0108364 | Ga0495636_0108364_477_1136 | 214 |
| 769 | 3300047318 | Ga0495636_0211322 | Ga0495636_0211322_174_833 | 214 |
| 770 | 3300047319 | Ga0495674_0796852 | Ga0495674_0796852_45_695 | 214 |
| 771 | 3300047321 | Ga0495676_0012595 | Ga0495676_0012595_4061_4711 | 214 |
| 772 | 3300047322 | Ga0495680_0028924 | Ga0495680_0028924_1234_1884 | 214 |
| 773 | 3300047443 | Ga0495687_001803 | Ga0495687_001803_8014_8673 | 214 |
| 774 | 3300047443 | Ga0495687_026958 | Ga0495687_026958_575_1237 | 214 |
| 775 | 3300047443 | Ga0495687_129842 | Ga0495687_129842_38_685 | 214 |
| 776 | 3300047443 | Ga0495687_145491 | Ga0495687_145491_54_710 | 214 |
| 777 | 3300047444 | Ga0495675_0004281 | Ga0495675_0004281_5104_5769 | 214 |
| 778 | 3300047444 | Ga0495675_0018761 | Ga0495675_0018761_72_725 | 214 |
| 779 | 3300047444 | Ga0495675_0385450 | Ga0495675_0385450_103_753 | 214 |
| 780 | 3300047445 | Ga0495677_0138177 | Ga0495677_0138177_46_699 | 214 |
| 781 | 3300047447 | Ga0495685_037134 | Ga0495685_037134_909_1568 | 214 |
| 782 | 3300047447 | Ga0495685_106267 | Ga0495685_106267_255_905 | 214 |
| 783 | 3300047470 | Ga0495681_0001329 | Ga0495681_0001329_17982_18641 | 214 |
| 784 | 3300047470 | Ga0495681_0017652 | Ga0495681_0017652_3227_3877 | 214 |
| 785 | 3300047471 | Ga0495684_0262418 | Ga0495684_0262418_215_868 | 214 |
| 786 | 3300047472 | Ga0495686_0359710 | Ga0495686_0359710_78_725 | 214 |
| 787 | 3300048089 | Ga0495614_0001624 | Ga0495614_0001624_3959_4618 | 214 |
| 788 | 3300048089 | Ga0495614_0056364 | Ga0495614_0056364_235_885 | 214 |
| 789 | 3300049459 | Ga0495678_021898 | Ga0495678_021898_1612_2262 | 214 |
| 790 | 3300049460 | Ga0495682_0052774 | Ga0495682_0052774_205_855 | 214 |
| 791 | 3300049568 | Ga0501031_0067105 | Ga0501031_0067105_1432_2082 | 214 |
| 792 | 3300049569 | Ga0501032_0146868 | Ga0501032_0146868_744_1403 | 214 |
| 793 | 3300049570 | Ga0501033_0001301 | Ga0501033_0001301_19052_19711 | 214 |
| 794 | 3300049571 | Ga0501034_0001622 | Ga0501034_0001622_24488_25147 | 214 |
| 795 | 3300049571 | Ga0501034_0055492 | Ga0501034_0055492_2331_2987 | 214 |
| 796 | 3300049572 | Ga0501036_0003801 | Ga0501036_0003801_5520_6179 | 214 |
| 797 | 3300049572 | Ga0501036_0018744 | Ga0501036_0018744_1583_2242 | 214 |
| 798 | 3300049573 | Ga0501037_0002340 | Ga0501037_0002340_9202_9852 | 214 |
| 799 | 3300049573 | Ga0501037_0013307 | Ga0501037_0013307_2129_2923 | 214 |
| 800 | 3300049573 | Ga0501037_0593406 | Ga0501037_0593406_74_724 | 214 |
| 801 | 3300049574 | Ga0501038_0008418 | Ga0501038_0008418_5213_5869 | 214 |
| 802 | 3300049574 | Ga0501038_0021101 | Ga0501038_0021101_1429_2088 | 214 |
| 803 | 3300049575 | Ga0501039_0013778 | Ga0501039_0013778_1472_2131 | 214 |
| 804 | 3300049578 | Ga0501042_0048952 | Ga0501042_0048952_2040_2690 | 214 |
| 805 | 3300049579 | Ga0501043_0001089 | Ga0501043_0001089_22883_23542 | 214 |
| 806 | 3300049579 | Ga0501043_0031502 | Ga0501043_0031502_2337_2987 | 214 |
| 807 | 3300049579 | Ga0501043_0052024 | Ga0501043_0052024_1119_1775 | 214 |
| 808 | 3300049580 | Ga0501046_0015796 | Ga0501046_0015796_1908_2558 | 214 |
| 809 | 3300049581 | Ga0501047_0000309 | Ga0501047_0000309_10942_11736 | 214 |
| 810 | 3300049581 | Ga0501047_0015678 | Ga0501047_0015678_4304_4960 | 214 |
| 811 | 3300049581 | Ga0501047_0018162 | Ga0501047_0018162_1489_2163 | 214 |
| 812 | 3300049581 | Ga0501047_0148312 | Ga0501047_0148312_879_1538 | 214 |
| 813 | 3300049581 | Ga0501047_0173390 | Ga0501047_0173390_829_1479 | 214 |
| 814 | 3300049581 | Ga0501047_0291203 | Ga0501047_0291203_375_1025 | 214 |
| 815 | 3300049582 | Ga0501048_0016728 | Ga0501048_0016728_2360_3010 | 214 |
| 816 | 3300049585 | Ga0501069_0196515 | Ga0501069_0196515_262_921 | 214 |
| 817 | 3300049586 | Ga0501070_0000441 | Ga0501070_0000441_22486_23145 | 214 |
| 818 | 3300049587 | Ga0501071_0024174 | Ga0501071_0024174_316_990 | 214 |
| 819 | 3300049589 | Ga0501073_0066827 | Ga0501073_0066827_781_1440 | 214 |
| 820 | 3300049590 | Ga0501074_0026677 | Ga0501074_0026677_1499_2158 | 214 |
| 821 | 3300049742 | Ga0501080_0084922 | Ga0501080_0084922_46_720 | 214 |
| 822 | 3300049822 | Ga0501035_0002876 | Ga0501035_0002876_14041_14715 | 214 |
| 823 | 3300049822 | Ga0501035_0034183 | Ga0501035_0034183_2304_2954 | 214 |
| 824 | 3300049822 | Ga0501035_0064529 | Ga0501035_0064529_2112_2768 | 214 |
| 825 | 3300049823 | Ga0501044_0013506 | Ga0501044_0013506_4784_5458 | 214 |
| 826 | 3300049823 | Ga0501044_0022495 | Ga0501044_0022495_4559_5209 | 214 |
| 827 | 3300049823 | Ga0501044_0088729 | Ga0501044_0088729_864_1523 | 214 |
| 828 | 3300049823 | Ga0501044_0196420 | Ga0501044_0196420_1246_1896 | 214 |
| 829 | 3300049823 | Ga0501044_0373078 | Ga0501044_0373078_175_834 | 214 |
| 830 | 3300050490 | nmdc:mga03n38_107831_c1 | nmdc:mga03n38_107831_c1_632_1282 | 214 |
| 831 | 3300050495 | nmdc:mga04h51_8038_c1 | nmdc:mga04h51_8038_c1_712_1371 | 214 |
| 832 | 3300053077 | Ga0495601_0210752 | Ga0495601_0210752_56_709 | 214 |
| 833 | 3300053088 | Ga0500644_0014080 | Ga0500644_0014080_413_1075 | 214 |
| 834 | 3300053107 | Ga0500560_000508 | Ga0500560_000508_1290_1949 | 214 |
| 835 | 3300053149 | Ga0500600_0042669 | Ga0500600_0042669_583_1233 | 214 |
| 836 | 3300054114 | Ga0501084_0885665 | Ga0501084_0885665_45_695 | 214 |
| 837 | 3300060353 | Ga0501082_0018213 | Ga0501082_0018213_675_1349 | 214 |
| 838 | 3300061719 | Ga0466962_0128867 | Ga0466962_0128867_423_1070 | 214 |
| 839 | iso_pu_bacteria | 2862507626 | 2862512527 | 214 |
| 840 | iso_pu_bacteria | 2867428634 | 2867432926 | 214 |
| 841 | iso_pu_bacteria | 2954002825 | 2954004373 | 214 |
| 842 | iso_pu_bacteria | 2997600082 | 2997606603 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o63-assembly1.cif.gz_A-2 | crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis | 0.9429 | 5 | 214 |
| 3o63-assembly2.cif.gz_B-3 | crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis | 0.9428 | 5 | 214 |
| 3o63-assembly2.cif.gz_B-3 | crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis | 0.9295 | 5 | 214 |
| 1xi3-assembly1.cif.gz_B | thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 | 0.9176 | 6 | 213 |
| 1g4p-assembly2.cif.gz_B | thiamin phosphate synthase | 0.9088 | 8 | 213 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3o63B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9428 | 5 | 214 | 3.20.20.70 |
| 3o63B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9295 | 5 | 214 | 3.20.20.70 |
| 1xi3B00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9176 | 6 | 213 | 3.20.20.70 |
| af_P40386_1_220_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9138 | 10 | 211 | 3.20.20.70 |
| af_Q5AEJ1_1_231_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9122 | 12 | 211 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W7BUZ3-F1-model_v4 | deleted | 0.9982 | 2 | 213 |
|
| AF-A0A6B1JU72-F1-model_v4 | deleted | 0.9981 | 2 | 193 |
|
| AF-A0A1D8FZ67-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9977 | 4 | 213 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-A0A2W2EZA4-F1-model_v4 | Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) | 0.9952 | 8 | 214 |
GO:0000287
GO:0004789 GO:0005737 GO:0009228 GO:0009229 |
| AF-A0A429ULY0-F1-model_v4 | deleted | 0.9951 | 4 | 136 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar