F483161

General Info

Members Datasets Scaffolds Average Seq Length
842 439 744 217

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997600082|2997606603
Length 261
Sequence TSPSGSTSAASSAGSSAGLSAGLSARSVREKLADARLYLCTDARKRQGDLPEFLDAVLTSGVDIVQLRDKGMEAAEELDHLAVFIEACRRHGKLLAVNDRADVAHAIGSDVLHLGQGDLPVPAARAILGQDVLIGRSTHAEAEVDAAVAQPGVDYFCTGPCWPTPTKPGRPAPGLSLVRYTAALRPSRPWFAIGGIDASNLDEVLEAGARRIVVVRAITAADDPAEAAASLAKRVRSAQGPSNHRQSAGGIRTAGHDTDKR

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
7 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
8 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
9 2643221548 Streptomyces sp. Root55 Isolate Unclassified
10 2643221578 Streptomyces sp. Root63 Isolate Unclassified
11 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
12 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
13 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
14 2643221647 Streptomyces sp. Root369 Isolate Unclassified
15 2643221670 Streptomyces sp. Root431 Isolate Unclassified
16 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
17 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
18 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
19 2643221679 Angustibacter sp. Root456 Isolate Unclassified
20 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
21 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
22 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
23 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
26 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
27 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
28 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
29 2808606448 Streptomyces sp. 193411 Isolate Unclassified
30 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
31 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
32 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
33 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
34 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
35 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
36 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
37 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
38 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
39 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
40 2862574272 Streptomyces sp. AcE210 Isolate Nodule
41 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
42 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
43 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
44 2867369537 Streptomyces sp. Z26 Isolate Unclassified
45 2867428634 Streptomyces sp. RP5T Isolate Unclassified
46 2867475112 Streptomyces sp. TM32 Isolate Unclassified
47 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
48 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
49 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
50 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
51 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
52 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
53 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
54 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
55 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
56 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
57 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
58 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
59 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
60 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
61 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
62 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
63 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
64 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
65 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
66 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
67 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
68 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
69 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
70 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
71 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
72 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
73 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
74 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
75 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
76 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
77 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
78 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
79 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
80 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
81 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
82 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
83 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
84 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
87 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
90 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
91 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
92 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
95 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
98 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
99 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
100 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
101 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
102 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
103 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
104 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
109 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
110 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
111 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
112 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
113 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
114 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
115 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
116 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
117 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
118 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
123 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
124 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
125 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
126 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
127 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
128 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
132 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
133 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
134 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
135 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
136 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
137 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
140 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
146 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
151 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
152 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
153 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
164 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
165 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
210 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
211 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
212 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
213 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
220 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
221 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
224 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
228 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
229 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
230 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
231 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
232 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
233 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
249 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
253 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
254 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
257 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
258 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
259 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
260 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
261 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
262 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
263 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
264 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
265 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
266 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
270 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
271 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
284 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
293 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
327 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
328 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
329 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
330 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
331 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
332 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
333 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
334 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
335 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
336 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
337 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
344 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
345 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
346 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
347 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
348 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
349 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
350 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
353 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
354 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
355 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
356 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
371 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
372 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
375 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
376 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
391 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
392 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
393 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
394 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
395 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
399 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
400 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
407 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
408 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
409 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
410 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
411 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
412 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
413 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
414 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
415 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
416 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
417 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
418 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
419 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
420 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
421 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
422 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
423 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
424 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
425 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
426 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
427 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
428 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
429 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
430 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
431 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
432 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
433 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
434 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
435 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
436 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
437 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
438 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
439 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88
Metatranscriptomes 0.24
Isolates 11.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.38
Nodule 0.24
Rhizoplane 2.85
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 11.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10018911 3300003316 Bacteria 2270
2 rootH1_10018911 3300003323 Bacteria 5599
3 rootH2_10046870 3300003320 Bacteria 1213
4 rootH2_10131917 3300003320 Bacteria 3824
5 rootH1_10049521 3300003323 Bacteria 3166
6 Ga0070658_10032082 3300005327 Bacteria 4223
7 Ga0070658_10143423 3300005327 Bacteria 1996
8 Ga0070690_100166820 3300005330 Bacteria 1513
9 Ga0070677_10105815 3300005333 Bacteria 1248
10 Ga0070660_100009722 3300005339 Bacteria 6778
11 Ga0070691_10121144 3300005341 Bacteria 1317
12 Ga0070687_100014648 3300005343 Bacteria 3526
13 Ga0070661_100049902 3300005344 Bacteria 3063
14 Ga0070668_100466255 3300005347 Bacteria 1088
15 Ga0070675_100105883 3300005354 Bacteria 2373
16 Ga0070671_100001069 3300005355 Bacteria 20212
17 Ga0070671_100186242 3300005355 Bacteria 1759
18 Ga0070673_100382182 3300005364 Bacteria 1255
19 Ga0070667_100258653 3300005367 Bacteria 1558
20 Ga0070709_10021433 3300005434 Bacteria 3763
21 Ga0070709_10048179 3300005434 Bacteria 2658
22 Ga0070714_100111539 3300005435 Bacteria 2422
23 Ga0070714_100133749 3300005435 Bacteria 2218
24 Ga0070714_100293934 3300005435 Bacteria 1512
25 Ga0070714_100466905 3300005435 Bacteria 1200
26 Ga0070714_100594467 3300005435 Bacteria 1062
27 Ga0070714_101042375 3300005435 Bacteria 796
28 Ga0070714_101165846 3300005435 Bacteria 751
29 Ga0070713_100028588 3300005436 Bacteria 4403
30 Ga0070713_100366054 3300005436 Bacteria 1340
31 Ga0070713_100508447 3300005436 Bacteria 1137
32 Ga0070713_100536307 3300005436 Bacteria 1107
33 Ga0070710_10090980 3300005437 Bacteria 1799
34 Ga0070711_100164630 3300005439 Bacteria 1684
35 Ga0070711_100269290 3300005439 Bacteria 1343
36 Ga0070711_100468666 3300005439 Bacteria 1033
37 Ga0070705_100043008 3300005440 Bacteria 2586
38 Ga0070700_100000046 3300005441 Bacteria 91380
39 Ga0070708_100014738 3300005445 Bacteria 6440
40 Ga0070708_100144239 3300005445 Bacteria 2210
41 Ga0070708_100685516 3300005445 Unclassified 965
42 Ga0070663_100008380 3300005455 Bacteria 6354
43 Ga0070678_100070844 3300005456 Bacteria 2608
44 Ga0070662_100058592 3300005457 Bacteria 2803
45 Ga0070681_10263183 3300005458 Bacteria 1636
46 Ga0070706_100022411 3300005467 Bacteria 5814
47 Ga0070706_100061305 3300005467 Bacteria 3473
48 Ga0070706_100061882 3300005467 Bacteria 3457
49 Ga0070706_100112598 3300005467 Bacteria 2533
50 Ga0070707_100011319 3300005468 Bacteria 8316
51 Ga0070707_100030611 3300005468 Bacteria 5125
52 Ga0070707_100033248 3300005468 Bacteria 4917
53 Ga0070707_100058044 3300005468 Bacteria 3712
54 Ga0070707_100077848 3300005468 Bacteria 3199
55 Ga0070707_100188039 3300005468 Bacteria 2013
56 Ga0070698_100006962 3300005471 Bacteria 12243
57 Ga0070698_100017421 3300005471 Bacteria 7572
58 Ga0070698_100025287 3300005471 Bacteria 6187
59 Ga0070698_100232996 3300005471 Bacteria 1775
60 Ga0070698_100432145 3300005471 Bacteria 1251
61 Ga0070698_100700195 3300005471 Bacteria 955
62 Ga0070699_100004942 3300005518 Bacteria 11759
63 Ga0070699_100224520 3300005518 Bacteria 1674
64 Ga0070679_100257671 3300005530 Bacteria 1700
65 Ga0070684_100036331 3300005535 Bacteria 4221
66 Ga0070684_100198413 3300005535 Bacteria 1827
67 Ga0070697_100203822 3300005536 Bacteria 1682
68 Ga0068853_100209148 3300005539 Bacteria 1778
69 Ga0068853_100415085 3300005539 Bacteria 1261
70 Ga0070696_100115308 3300005546 Bacteria 1938
71 Ga0070693_100109567 3300005547 Bacteria 1696
72 Ga0070665_100006798 3300005548 Bacteria 11628
73 Ga0070665_100163185 3300005548 Bacteria 2230
74 Ga0070704_100097907 3300005549 Bacteria 2203
75 Ga0068855_100028602 3300005563 Bacteria 6668
76 Ga0068855_100032082 3300005563 Bacteria 6271
77 Ga0068855_100189698 3300005563 Bacteria 2319
78 Ga0068855_100845652 3300005563 Bacteria 970
79 Ga0070664_100216629 3300005564 Bacteria 1712
80 Ga0068857_100021276 3300005577 Bacteria 5709
81 Ga0068854_100529855 3300005578 Bacteria 996
82 Ga0070702_100554650 3300005615 Bacteria 854
83 Ga0068852_100135991 3300005616 Bacteria 2269
84 Ga0068852_100230554 3300005616 Bacteria 1765
85 Ga0068859_100214382 3300005617 Bacteria 2012
86 Ga0068864_100069457 3300005618 Bacteria 3063
87 Ga0068863_100127901 3300005841 Bacteria 2424
88 Ga0068863_100403030 3300005841 Bacteria 1338
89 Ga0068860_100156092 3300005843 Bacteria 2199
90 Ga0081455_10037754 3300005937 Bacteria 4284
91 Ga0081540_1001003 3300005983 Bacteria 25342
92 Ga0070717_10056517 3300006028 Bacteria 3242
93 Ga0070717_10347505 3300006028 Bacteria 1325
94 Ga0070717_10451466 3300006028 Bacteria 1158
95 Ga0070717_10690351 3300006028 Bacteria 927
96 Ga0070715_10009652 3300006163 Bacteria 3410
97 Ga0070715_10029481 3300006163 Bacteria 2210
98 Ga0070716_100056492 3300006173 Bacteria 2251
99 Ga0070712_100068471 3300006175 Bacteria 2529
100 Ga0070712_100071771 3300006175 Bacteria 2478
101 Ga0070712_100083205 3300006175 Bacteria 2323
102 Ga0070712_100098410 3300006175 Bacteria 2158
103 Ga0097621_100024958 3300006237 Bacteria 4673
104 Ga0068871_100103140 3300006358 Bacteria 2391
105 Ga0075434_100317411 3300006871 Bacteria 1579
106 Ga0068865_100671682 3300006881 Bacteria 882
107 Ga0097620_100214382 3300006931 Bacteria 2012
108 Ga0105251_10046387 3300009011 Bacteria 2091
109 Ga0105241_10042041 3300009174 Bacteria 3456
110 Ga0105242_10479412 3300009176 Bacteria 1179
111 Ga0105248_10046817 3300009177 Bacteria 4849
112 Ga0105237_10023191 3300009545 Bacteria 6362
113 Ga0105249_10106568 3300009553 Bacteria 2644
114 Ga0105239_10189981 3300010375 Bacteria 2299
115 Ga0105246_10018005 3300011119 Bacteria 4499
116 Ga0157344_1003718 3300012476 Bacteria 875
117 Ga0157342_1005584 3300012507 Bacteria 1162
118 Ga0157338_1003999 3300012515 Bacteria 1253
119 Ga0157371_10223820 3300013102 Bacteria 1351
120 Ga0157369_10001097 3300013105 Bacteria 33863
121 Ga0157374_10165189 3300013296 Bacteria 2157
122 Ga0157375_10140650 3300013308 Bacteria 2541
123 Ga0163163_10877880 3300014325 Bacteria 960
124 Ga0157380_10090063 3300014326 Bacteria 2529
125 Ga0182008_10002405 3300014497 Bacteria 11763
126 Ga0157377_10066603 3300014745 Bacteria 2071
127 Ga0182007_10000417 3300015262 Bacteria 26024
128 Ga0206356_10014746 3300020070 Bacteria 1629
129 Ga0213876_10009157 3300021384 Bacteria 5331
130 Ga0213875_10000331 3300021388 Bacteria 44957
131 Ga0213875_10011586 3300021388 Bacteria 4383
132 Ga0209758_1018862 3300025297 Bacteria 3358
133 Ga0207426_1001695 3300025302 Bacteria 17002
134 Ga0207426_1006964 3300025302 Bacteria 4802
135 Ga0207653_10045165 3300025885 Bacteria 1455
136 Ga0207692_10026902 3300025898 Bacteria 2703
137 Ga0207692_10052092 3300025898 Bacteria 2078
138 Ga0207692_10151822 3300025898 Bacteria 1327
139 Ga0207688_10003920 3300025901 Bacteria 8114
140 Ga0207647_10012829 3300025904 Bacteria 5822
141 Ga0207699_10005049 3300025906 Bacteria 6312
142 Ga0207699_10032148 3300025906 Bacteria 2954
143 Ga0207699_10056834 3300025906 Bacteria 2334
144 Ga0207699_10061155 3300025906 Bacteria 2265
145 Ga0207645_10020916 3300025907 Bacteria 4274
146 Ga0207643_10010462 3300025908 Bacteria 4997
147 Ga0207705_10009924 3300025909 Bacteria 6932
148 Ga0207705_10279423 3300025909 Bacteria 1278
149 Ga0207684_10035694 3300025910 Bacteria 4221
150 Ga0207684_10036572 3300025910 Bacteria 4167
151 Ga0207654_10036955 3300025911 Bacteria 2732
152 Ga0207707_10247138 3300025912 Bacteria 1550
153 Ga0207707_10375231 3300025912 Bacteria 1223
154 Ga0207695_10084491 3300025913 Bacteria 3205
155 Ga0207693_10044829 3300025915 Bacteria 3475
156 Ga0207693_10048524 3300025915 Bacteria 3334
157 Ga0207693_10055008 3300025915 Bacteria 3122
158 Ga0207663_10102646 3300025916 Bacteria 1924
159 Ga0207657_10010424 3300025919 Bacteria 9277
160 Ga0207652_10035870 3300025921 Bacteria 4189
161 Ga0207646_10010187 3300025922 Bacteria 9206
162 Ga0207646_10012121 3300025922 Bacteria 8298
163 Ga0207646_10040561 3300025922 Bacteria 4186
164 Ga0207646_10051833 3300025922 Bacteria 3671
165 Ga0207646_10206437 3300025922 Bacteria 1774
166 Ga0207694_10255328 3300025924 Bacteria 1435
167 Ga0207650_10181194 3300025925 Bacteria 1679
168 Ga0207700_10059527 3300025928 Bacteria 2889
169 Ga0207700_10064776 3300025928 Bacteria 2785
170 Ga0207700_10148750 3300025928 Bacteria 1933
171 Ga0207700_10482663 3300025928 Bacteria 1095
172 Ga0207700_10862652 3300025928 Bacteria 810
173 Ga0207664_10000001 3300025929 Bacteria 724213
174 Ga0207664_10020356 3300025929 Bacteria 4916
175 Ga0207664_10158406 3300025929 Bacteria 1929
176 Ga0207664_10487935 3300025929 Bacteria 1102
177 Ga0207664_10554068 3300025929 Bacteria 1032
178 Ga0207644_10001360 3300025931 Bacteria 15731
179 Ga0207644_10406452 3300025931 Bacteria 1114
180 Ga0207706_10026322 3300025933 Bacteria 5206
181 Ga0207686_10024265 3300025934 Bacteria 3512
182 Ga0207670_10136158 3300025936 Bacteria 1806
183 Ga0207665_10006674 3300025939 Bacteria 7658
184 Ga0207665_10471257 3300025939 Bacteria 966
185 Ga0207689_10106006 3300025942 Bacteria 2309
186 Ga0207661_10159922 3300025944 Bacteria 1954
187 Ga0207667_10057556 3300025949 Bacteria 4080
188 Ga0207667_10119316 3300025949 Bacteria 2718
189 Ga0207667_10770070 3300025949 Bacteria 961
190 Ga0207640_10276448 3300025981 Bacteria 1317
191 Ga0207658_10135834 3300025986 Bacteria 1983
192 Ga0207639_10172234 3300026041 Bacteria 1834
193 Ga0207678_10717393 3300026067 Bacteria 880
194 Ga0207708_10000002 3300026075 Bacteria 411071
195 Ga0207702_10016152 3300026078 Bacteria 6180
196 Ga0207641_10024402 3300026088 Bacteria 4984
197 Ga0207641_10927815 3300026088 Bacteria 865
198 Ga0207675_100402395 3300026118 Bacteria 1349
199 Ga0207683_10008335 3300026121 Bacteria 8866
200 Ga0207698_10010090 3300026142 Bacteria 6049
201 Ga0209813_10006896 3300027866 Bacteria 2817
202 Ga0268266_10044101 3300028379 Bacteria 3811
203 Ga0268266_10114600 3300028379 Bacteria 2392
204 Ga0268264_10131684 3300028381 Bacteria 2218
205 Ga0307517_10003383 3300028786 Bacteria 24818
206 Ga0307517_10009169 3300028786 Bacteria 14079
207 Ga0307517_10258779 3300028786 Bacteria 1013
208 Ga0307515_10005348 3300028794 Bacteria 26076
209 Ga0307511_10001143 3300030521 Bacteria 28236
210 Ga0307511_10004831 3300030521 Bacteria 13778
211 Ga0307512_10005460 3300030522 Bacteria 13266
212 Ga0307512_10042832 3300030522 Bacteria 3743
213 Ga0316176_1058730 3300030732 Bacteria 1102
214 Ga0307513_10003780 3300031456 Bacteria 20423
215 Ga0307509_10007629 3300031507 Bacteria 14065
216 Ga0307509_10034109 3300031507 Bacteria 5595
217 Ga0307509_10043365 3300031507 Bacteria 4868
218 Ga0307509_10219510 3300031507 Bacteria 1716
219 Ga0307509_10415778 3300031507 Bacteria 1047
220 Ga0307508_10001228 3300031616 Bacteria 29284
221 Ga0307508_10008698 3300031616 Bacteria 9371
222 Ga0307508_10010547 3300031616 Bacteria 8454
223 Ga0307508_10101115 3300031616 Bacteria 2478
224 Ga0307508_10150836 3300031616 Bacteria 1929
225 Ga0307514_10009106 3300031649 Bacteria 8379
226 Ga0307514_10048682 3300031649 Bacteria 3299
227 Ga0307514_10206757 3300031649 Bacteria 1225
228 Ga0307514_10256189 3300031649 Bacteria 1030
229 Ga0307516_10010490 3300031730 Bacteria 10174
230 Ga0307516_10028336 3300031730 Bacteria 5668
231 Ga0307516_10202274 3300031730 Bacteria 1705
232 Ga0307518_10106213 3300031838 Bacteria 2005
233 Ga0307507_10014880 3300033179 Bacteria 9223
234 Ga0307510_10028481 3300033180 Bacteria 6379
235 Ga0307510_10044963 3300033180 Bacteria 4774
236 Ga0307510_10169961 3300033180 Bacteria 1761
237 Ga0373926_0000431 3300035083 Bacteria 10840
238 Ga0373934_0060672 3300035086 Bacteria 1506
239 Ga0373944_0001774 3300035089 Bacteria 5448
240 Ga0373923_0004370 3300035111 Bacteria 4685
241 Ga0373923_0005743 3300035111 Bacteria 4233
242 Ga0373923_0092196 3300035111 Bacteria 1326
243 Ga0373936_0000300 3300035113 Bacteria 16641
244 Ga0373936_0003136 3300035113 Bacteria 6190
245 Ga0373936_0028740 3300035113 Bacteria 2186
246 Ga0373936_0121546 3300035113 Bacteria 1116
247 Ga0373945_0000621 3300035116 Bacteria 10201
248 Ga0373945_0000765 3300035116 Bacteria 9383
249 Ga0373953_0010773 3300035117 Bacteria 3191
250 Ga0373953_0017014 3300035117 Bacteria 2665
251 Ga0373953_0046444 3300035117 Bacteria 1743
252 Ga0373954_0012718 3300035118 Bacteria 3746
253 Ga0373954_0060510 3300035118 Bacteria 1786
254 Ga0373956_0032315 3300035119 Bacteria 2296
255 Ga0373956_0066949 3300035119 Bacteria 1634
256 Ga0373957_0004859 3300035120 Bacteria 4122
257 Ga0373957_0013131 3300035120 Bacteria 2804
258 Ga0373957_0035114 3300035120 Bacteria 1861
259 Ga0373960_0036014 3300035121 Bacteria 1407
260 Ga0373943_0000210 3300035170 Bacteria 23878
261 Ga0373943_0000853 3300035170 Bacteria 13451
262 Ga0373943_0049300 3300035170 Bacteria 2066
263 Ga0373946_0000853 3300035171 Bacteria 10469
264 Ga0373946_0000901 3300035171 Bacteria 10211
265 Ga0373955_0007658 3300035172 Bacteria 4973
266 Ga0373955_0053068 3300035172 Bacteria 2212
267 Ga0373955_0096188 3300035172 Bacteria 1694
268 Ga0373942_0148961 3300035207 Bacteria 750
269 Ga0373961_0087311 3300035241 Bacteria 991
270 Ga0373924_0003757 3300035410 Bacteria 5246
271 Ga0373931_0237587 3300035691 Bacteria 1103
272 Ga0373935_0015120 3300035692 Bacteria 4660
273 Ga0373935_0021479 3300035692 Bacteria 3953
274 Ga0373935_0159123 3300035692 Bacteria 1538
275 Ga0373935_0216968 3300035692 Bacteria 1327
276 Ga0373927_0001724 3300035695 Bacteria 16345
277 Ga0373927_0003506 3300035695 Bacteria 11230
278 Ga0373927_0139879 3300035695 Bacteria 1583
279 Ga0373927_0261318 3300035695 Bacteria 1139
280 Ga0373933_0007376 3300035724 Bacteria 5997
281 Ga0373933_0010418 3300035724 Bacteria 5096
282 Ga0373933_0010620 3300035724 Bacteria 5049
283 Ga0373933_0180163 3300035724 Bacteria 1347
284 Ga0373947_0000745 3300035725 Bacteria 19507
285 Ga0373947_0012919 3300035725 Bacteria 4787
286 Ga0373937_0047927 3300036401 Bacteria 3909
287 Ga0373937_0196205 3300036401 Bacteria 1897
288 Ga0373937_0196588 3300036401 Bacteria 1895
289 Ga0373937_0512640 3300036401 Bacteria 1139
290 Ga0373925_0000989 3300037068 Bacteria 25847
291 Ga0373925_0001802 3300037068 Bacteria 17862
292 Ga0373925_0010631 3300037068 Bacteria 6674
293 Ga0373925_0053289 3300037068 Bacteria 3023
294 Ga0373925_0152526 3300037068 Bacteria 1815
295 Ga0373925_0153026 3300037068 Bacteria 1812
296 Ga0395900_0162181 3300037418 Bacteria 2280
297 Ga0395898_0015773 3300037466 Bacteria 7743
298 Ga0436364_0226463 3300037853 Bacteria 27340
299 Ga0436364_0397039 3300037853 Bacteria 5442
300 Ga0436364_0644841 3300037853 Bacteria 2837
301 Ga0436364_0728232 3300037853 Bacteria 1227
302 Ga0436364_0773303 3300037853 Bacteria 13655
303 Ga0436364_1419474 3300037853 Bacteria 2456
304 Ga0436365_0192020 3300039437 Bacteria 2176
305 Ga0436365_1767487 3300039437 Bacteria 27437
306 Ga0436361_0451808 3300039447 Bacteria 786
307 Ga0436363_0358206 3300039450 Bacteria 1420
308 Ga0436363_0381476 3300039450 Bacteria 2125
309 Ga0436363_1261317 3300039450 Bacteria 836
310 Ga0439436_0000995 3300041404 Bacteria 7883
311 Ga0439439_0001201 3300041406 Bacteria 5012
312 Ga0451837_0619170 3300041494 Bacteria 4000
313 Ga0451853_1087724 3300041512 Bacteria 4677
314 Ga0451853_1223385 3300041512 Bacteria 2647
315 Ga0439433_0001185 3300041999 Bacteria 5355
316 Ga0439442_024467 3300042002 Bacteria 1256
317 Ga0439449_0000937 3300042007 Bacteria 11406
318 Ga0439449_0040989 3300042007 Bacteria 1721
319 Ga0439449_0185097 3300042007 Bacteria 779
320 Ga0439455_0009626 3300042012 Bacteria 2104
321 Ga0439457_026017 3300042014 Bacteria 1295
322 Ga0439457_052461 3300042014 Bacteria 916
323 Ga0439462_0009705 3300042015 Bacteria 2434
324 Ga0450894_000226 3300042131 Bacteria 10039
325 Ga0450896_005131 3300042133 Bacteria 1783
326 Ga0450898_000074 3300042134 Bacteria 8910
327 Ga0450903_000479 3300042138 Bacteria 8405
328 Ga0450906_000163 3300042145 Bacteria 12452
329 Ga0466969_0000457 3300044656 Bacteria 22464
330 Ga0466969_0007599 3300044656 Bacteria 5762
331 Ga0466969_0007733 3300044656 Bacteria 5714
332 Ga0466969_0015982 3300044656 Bacteria 3933
333 Ga0466972_0051678 3300044658 Bacteria 1982
334 Ga0466965_0053650 3300044683 Bacteria 2004
335 Ga0466965_0109447 3300044683 Bacteria 1419
336 Ga0466965_0135122 3300044683 Bacteria 1281
337 Ga0466966_0025078 3300044684 Bacteria 3897
338 Ga0466966_0032287 3300044684 Bacteria 3394
339 Ga0466966_0123527 3300044684 Bacteria 1589
340 Ga0466961_0000804 3300044693 Bacteria 19562
341 Ga0466961_0002459 3300044693 Bacteria 11491
342 Ga0466961_0003433 3300044693 Bacteria 9887
343 Ga0466961_0013690 3300044693 Bacteria 5198
344 Ga0466961_0133384 3300044693 Bacteria 1556
345 Ga0466963_0002973 3300044694 Bacteria 9576
346 Ga0466971_0002384 3300044719 Bacteria 7938
347 Ga0466971_0029345 3300044719 Bacteria 2460
348 Ga0466968_0062563 3300044735 Bacteria 1607
349 Ga0466970_0002761 3300044765 Bacteria 8475
350 Ga0466970_0002932 3300044765 Bacteria 8269
351 Ga0466970_0005496 3300044765 Bacteria 6290
352 Ga0466960_0007064 3300044901 Bacteria 4539
353 Ga0466959_0002676 3300045049 Bacteria 11432
354 Ga0466959_0366594 3300045049 Bacteria 981
355 Ga0466967_0087393 3300045976 Bacteria 2826
356 Ga0466967_0219988 3300045976 Bacteria 1804
357 Ga0466967_0864979 3300045976 Bacteria 898
358 Ga0495617_018522 3300046452 Bacteria 2354
359 Ga0495627_096635 3300046453 Bacteria 846
360 Ga0495592_0003362 3300046454 Bacteria 11453
361 Ga0495592_0007389 3300046454 Bacteria 8222
362 Ga0495592_0012304 3300046454 Bacteria 6496
363 Ga0495592_0305794 3300046454 Bacteria 1032
364 Ga0495603_0000581 3300046455 Bacteria 20555
365 Ga0495603_0002290 3300046455 Bacteria 11246
366 Ga0495603_0010349 3300046455 Bacteria 5647
367 Ga0495603_0014926 3300046455 Bacteria 4698
368 Ga0495603_0185681 3300046455 Bacteria 1202
369 Ga0495629_0001519 3300046459 Bacteria 18262
370 Ga0495629_0005219 3300046459 Bacteria 9728
371 Ga0495629_0007561 3300046459 Bacteria 8007
372 Ga0495629_0008473 3300046459 Bacteria 7569
373 Ga0495629_0020033 3300046459 Bacteria 4775
374 Ga0495629_0025351 3300046459 Bacteria 4215
375 Ga0495629_0034729 3300046459 Bacteria 3564
376 Ga0495629_0059311 3300046459 Bacteria 2675
377 Ga0495629_0076614 3300046459 Bacteria 2335
378 Ga0495638_0019298 3300046460 Bacteria 4510
379 Ga0495638_0318647 3300046460 Bacteria 832
380 Ga0495641_0002279 3300046461 Bacteria 15262
381 Ga0495641_0035142 3300046461 Bacteria 2365
382 Ga0495651_0001048 3300046462 Bacteria 21410
383 Ga0495651_0003279 3300046462 Bacteria 12422
384 Ga0495651_0047653 3300046462 Bacteria 3312
385 Ga0495651_0068380 3300046462 Bacteria 2708
386 Ga0495651_0104129 3300046462 Bacteria 2107
387 Ga0495651_0112862 3300046462 Bacteria 2007
388 Ga0495651_0124443 3300046462 Bacteria 1889
389 Ga0495651_0181068 3300046462 Bacteria 1491
390 Ga0495653_0007471 3300046463 Bacteria 8938
391 Ga0495653_0018529 3300046463 Bacteria 5651
392 Ga0495653_0030171 3300046463 Bacteria 4321
393 Ga0495653_0044209 3300046463 Bacteria 3457
394 Ga0495653_0099009 3300046463 Bacteria 2116
395 Ga0495653_0153327 3300046463 Bacteria 1607
396 Ga0495653_0287368 3300046463 Bacteria 1077
397 Ga0495580_0001275 3300046472 Bacteria 22209
398 Ga0495580_0184671 3300046472 Bacteria 1439
399 Ga0495580_0318087 3300046472 Bacteria 1058
400 Ga0495582_0061116 3300046473 Bacteria 2080
401 Ga0495605_0197204 3300046474 Bacteria 879
402 Ga0495639_0000919 3300046475 Bacteria 13290
403 Ga0495662_0000196 3300046476 Bacteria 24887
404 Ga0495662_0001981 3300046476 Bacteria 10272
405 Ga0495662_0003816 3300046476 Bacteria 7598
406 Ga0495662_0222887 3300046476 Bacteria 929
407 Ga0495664_0003354 3300046477 Bacteria 8705
408 Ga0495664_0005259 3300046477 Bacteria 7102
409 Ga0495664_0069801 3300046477 Bacteria 2097
410 Ga0495664_0119135 3300046477 Bacteria 1596
411 Ga0495664_0390921 3300046477 Bacteria 836
412 Ga0495594_0002455 3300046499 Bacteria 9644
413 Ga0495594_0069558 3300046499 Bacteria 1955
414 Ga0495594_0180531 3300046499 Bacteria 1201
415 Ga0495594_0236458 3300046499 Bacteria 1041
416 Ga0495596_0016515 3300046500 Bacteria 3065
417 Ga0495583_0110431 3300046506 Bacteria 1166
418 Ga0495608_0000625 3300046511 Bacteria 24370
419 Ga0495608_0014214 3300046511 Bacteria 5523
420 Ga0495608_0023923 3300046511 Bacteria 4179
421 Ga0495608_0035569 3300046511 Bacteria 3358
422 Ga0495610_0180754 3300046512 Bacteria 877
423 Ga0495616_0014854 3300046513 Bacteria 4344
424 Ga0495618_0001193 3300046514 Bacteria 17637
425 Ga0495618_0026198 3300046514 Bacteria 3623
426 Ga0495618_0045219 3300046514 Bacteria 2777
427 Ga0495618_0072888 3300046514 Bacteria 2185
428 Ga0495618_0082226 3300046514 Bacteria 2057
429 Ga0495620_0011287 3300046515 Bacteria 4663
430 Ga0495620_0197085 3300046515 Bacteria 775
431 Ga0495628_0004700 3300046516 Bacteria 12042
432 Ga0495628_0016836 3300046516 Bacteria 6091
433 Ga0495628_0058091 3300046516 Bacteria 3041
434 Ga0495628_0090534 3300046516 Bacteria 2368
435 Ga0495628_0158565 3300046516 Bacteria 1720
436 Ga0495628_0199834 3300046516 Bacteria 1506
437 Ga0495628_0249908 3300046516 Bacteria 1324
438 Ga0495628_0344491 3300046516 Bacteria 1096
439 Ga0495630_0003270 3300046517 Bacteria 11304
440 Ga0495630_0015818 3300046517 Bacteria 5512
441 Ga0495630_0033272 3300046517 Bacteria 3843
442 Ga0495630_0137908 3300046517 Bacteria 1854
443 Ga0495630_0173082 3300046517 Bacteria 1645
444 Ga0495631_0003384 3300046518 Bacteria 8739
445 Ga0495632_0046066 3300046519 Bacteria 2169
446 Ga0495643_0015751 3300046522 Bacteria 4459
447 Ga0495648_0099254 3300046524 Bacteria 1611
448 Ga0495666_0002728 3300046526 Bacteria 8817
449 Ga0495666_0002824 3300046526 Bacteria 8696
450 Ga0495666_0009995 3300046526 Bacteria 4739
451 Ga0495666_0294888 3300046526 Bacteria 734
452 Ga0495652_0006871 3300046529 Bacteria 10532
453 Ga0495652_0008008 3300046529 Bacteria 9690
454 Ga0495652_0038041 3300046529 Bacteria 4171
455 Ga0495652_0075703 3300046529 Bacteria 2794
456 Ga0495652_0281190 3300046529 Bacteria 1218
457 Ga0495654_0077346 3300046530 Bacteria 1566
458 Ga0495665_0002201 3300046531 Bacteria 10553
459 Ga0495665_0005244 3300046531 Bacteria 6985
460 Ga0495665_0032653 3300046531 Bacteria 2785
461 Ga0495640_0006759 3300046533 Bacteria 9049
462 Ga0495640_0020436 3300046533 Bacteria 4872
463 Ga0495640_0038683 3300046533 Bacteria 3354
464 Ga0495640_0042835 3300046533 Bacteria 3155
465 Ga0495640_0064323 3300046533 Bacteria 2480
466 Ga0495640_0085431 3300046533 Bacteria 2091
467 Ga0495586_0021800 3300046535 Bacteria 3418
468 Ga0495586_0120600 3300046535 Bacteria 1465
469 Ga0495587_0002510 3300046536 Bacteria 12259
470 Ga0495587_0010861 3300046536 Bacteria 5780
471 Ga0495587_0066521 3300046536 Bacteria 2102
472 Ga0495587_0295055 3300046536 Bacteria 907
473 Ga0495609_0010581 3300046538 Bacteria 4420
474 Ga0495597_0010605 3300046542 Bacteria 4496
475 Ga0495645_0011084 3300046543 Bacteria 6337
476 Ga0495645_0050801 3300046543 Bacteria 3017
477 Ga0495645_0060170 3300046543 Bacteria 2753
478 Ga0495645_0070401 3300046543 Bacteria 2524
479 Ga0495645_0091998 3300046543 Bacteria 2166
480 Ga0495622_0020933 3300046557 Bacteria 3045
481 Ga0495622_0043034 3300046557 Bacteria 2099
482 Ga0495622_0154432 3300046557 Bacteria 1037
483 Ga0495633_0007334 3300046558 Bacteria 6358
484 Ga0495667_0005551 3300046559 Bacteria 8526
485 Ga0495667_0006827 3300046559 Bacteria 7749
486 Ga0495667_0010332 3300046559 Bacteria 6314
487 Ga0495667_0016663 3300046559 Bacteria 4961
488 Ga0495667_0098645 3300046559 Bacteria 1891
489 Ga0495667_0448651 3300046559 Bacteria 810
490 Ga0495668_0206862 3300046616 Bacteria 1074
491 Ga0495634_0003734 3300046642 Bacteria 12128
492 Ga0495634_0004035 3300046642 Bacteria 11647
493 Ga0495634_0023005 3300046642 Bacteria 4387
494 Ga0495634_0064823 3300046642 Bacteria 2421
495 Ga0495634_0085342 3300046642 Bacteria 2057
496 Ga0495634_0086784 3300046642 Bacteria 2037
497 Ga0495634_0144048 3300046642 Bacteria 1511
498 Ga0495611_0021326 3300046648 Bacteria 2797
499 Ga0495611_0060824 3300046648 Bacteria 1716
500 Ga0495611_0150539 3300046648 Bacteria 1086
501 Ga0495611_0193356 3300046648 Bacteria 950
502 Ga0495635_0001020 3300046663 Bacteria 18505
503 Ga0495635_0005268 3300046663 Bacteria 8995
504 Ga0495635_0040955 3300046663 Bacteria 3200
505 Ga0495635_0062768 3300046663 Bacteria 2551
506 Ga0495635_0286528 3300046663 Bacteria 1106
507 Ga0495635_0298400 3300046663 Bacteria 1080
508 Ga0495588_0037055 3300046674 Bacteria 2477
509 Ga0495588_0055324 3300046674 Bacteria 2047
510 Ga0495657_0002061 3300046675 Bacteria 17090
511 Ga0495657_0007027 3300046675 Bacteria 8734
512 Ga0495657_0013113 3300046675 Bacteria 6126
513 Ga0495657_0026424 3300046675 Bacteria 4110
514 Ga0495657_0026932 3300046675 Bacteria 4065
515 Ga0495657_0032482 3300046675 Bacteria 3641
516 Ga0495657_0128888 3300046675 Bacteria 1586
517 Ga0495657_0144372 3300046675 Bacteria 1481
518 Ga0495657_0237227 3300046675 Bacteria 1101
519 Ga0495657_0358045 3300046675 Bacteria 863
520 Ga0495657_0366990 3300046675 Bacteria 850
521 Ga0495599_0003474 3300046678 Bacteria 9222
522 Ga0495599_0165891 3300046678 Bacteria 1364
523 Ga0495599_0187761 3300046678 Bacteria 1272
524 Ga0495599_0197164 3300046678 Bacteria 1237
525 Ga0495623_0027238 3300046679 Bacteria 3675
526 Ga0495623_0100159 3300046679 Bacteria 1766
527 Ga0495623_0121458 3300046679 Bacteria 1572
528 Ga0495623_0222323 3300046679 Bacteria 1075
529 Ga0495646_0008959 3300046680 Bacteria 6352
530 Ga0495646_0026449 3300046680 Bacteria 3644
531 Ga0495646_0046051 3300046680 Bacteria 2661
532 Ga0495646_0144775 3300046680 Bacteria 1326
533 Ga0495647_0036628 3300046681 Bacteria 1847
534 Ga0495658_0000668 3300046683 Bacteria 18633
535 Ga0495658_0017509 3300046683 Bacteria 3703
536 Ga0495613_0001017 3300046689 Bacteria 21317
537 Ga0495613_0004228 3300046689 Bacteria 10755
538 Ga0495613_0006091 3300046689 Bacteria 9022
539 Ga0495613_0006111 3300046689 Bacteria 9009
540 Ga0495613_0045156 3300046689 Bacteria 3259
541 Ga0495613_0097186 3300046689 Bacteria 2129
542 Ga0495613_0206111 3300046689 Bacteria 1384
543 Ga0495613_0301722 3300046689 Bacteria 1108
544 Ga0495613_0303607 3300046689 Bacteria 1104
545 Ga0495624_0003117 3300046690 Bacteria 12395
546 Ga0495624_0177528 3300046690 Bacteria 1298
547 Ga0495670_0028561 3300046691 Bacteria 2765
548 Ga0495671_0016204 3300046692 Bacteria 3984
549 Ga0495649_0027568 3300046694 Bacteria 3151
550 Ga0495649_0145680 3300046694 Bacteria 1245
551 Ga0495589_0012578 3300046794 Bacteria 4379
552 Ga0495589_0087324 3300046794 Bacteria 1514
553 Ga0495600_0028042 3300046809 Bacteria 3641
554 Ga0495600_0033937 3300046809 Bacteria 3313
555 Ga0495600_0094741 3300046809 Bacteria 1947
556 Ga0495600_0131715 3300046809 Bacteria 1625
557 Ga0495660_0107029 3300046810 Bacteria 1431
558 Ga0495581_0000732 3300047315 Bacteria 17377
559 Ga0495581_0029604 3300047315 Bacteria 3173
560 Ga0495581_0058776 3300047315 Bacteria 2221
561 Ga0495581_0131963 3300047315 Bacteria 1455
562 Ga0495581_0260869 3300047315 Bacteria 1013
563 Ga0495604_0001177 3300047317 Bacteria 21636
564 Ga0495604_0003563 3300047317 Bacteria 12422
565 Ga0495604_0007586 3300047317 Bacteria 8586
566 Ga0495604_0031810 3300047317 Bacteria 4184
567 Ga0495604_0037390 3300047317 Bacteria 3824
568 Ga0495604_0075680 3300047317 Bacteria 2534
569 Ga0495604_0164304 3300047317 Bacteria 1566
570 Ga0495636_0039985 3300047318 Bacteria 1943
571 Ga0495636_0108364 3300047318 Bacteria 1220
572 Ga0495636_0211322 3300047318 Bacteria 888
573 Ga0495674_0001674 3300047319 Bacteria 21807
574 Ga0495674_0018733 3300047319 Bacteria 6442
575 Ga0495674_0166927 3300047319 Bacteria 1839
576 Ga0495674_0234848 3300047319 Bacteria 1512
577 Ga0495674_0796852 3300047319 Bacteria 735
578 Ga0495676_0002474 3300047321 Bacteria 16429
579 Ga0495676_0008328 3300047321 Bacteria 9509
580 Ga0495676_0008832 3300047321 Bacteria 9214
581 Ga0495676_0012595 3300047321 Bacteria 7615
582 Ga0495676_0023093 3300047321 Bacteria 5403
583 Ga0495676_0172450 3300047321 Bacteria 1521
584 Ga0495680_0006577 3300047322 Bacteria 10782
585 Ga0495680_0026944 3300047322 Bacteria 4730
586 Ga0495680_0028924 3300047322 Bacteria 4541
587 Ga0495680_0036621 3300047322 Bacteria 3938
588 Ga0495680_0106162 3300047322 Bacteria 2087
589 Ga0495683_0043444 3300047323 Bacteria 2263
590 Ga0495683_0098775 3300047323 Bacteria 1406
591 Ga0495687_001803 3300047443 Bacteria 18868
592 Ga0495687_026958 3300047443 Bacteria 2695
593 Ga0495687_129842 3300047443 Bacteria 894
594 Ga0495687_145491 3300047443 Bacteria 818
595 Ga0495675_0004281 3300047444 Bacteria 8636
596 Ga0495675_0007900 3300047444 Bacteria 6572
597 Ga0495675_0018761 3300047444 Bacteria 4393
598 Ga0495675_0030126 3300047444 Bacteria 3463
599 Ga0495675_0032379 3300047444 Bacteria 3336
600 Ga0495675_0385450 3300047444 Bacteria 819
601 Ga0495677_0138177 3300047445 Bacteria 935
602 Ga0495685_002002 3300047447 Bacteria 6320
603 Ga0495685_004607 3300047447 Bacteria 4466
604 Ga0495685_037134 3300047447 Bacteria 1671
605 Ga0495685_106267 3300047447 Bacteria 925
606 Ga0495681_0001329 3300047470 Bacteria 18701
607 Ga0495681_0003668 3300047470 Bacteria 10663
608 Ga0495681_0017652 3300047470 Bacteria 3954
609 Ga0495684_0003513 3300047471 Bacteria 12258
610 Ga0495684_0043083 3300047471 Bacteria 3455
611 Ga0495684_0054852 3300047471 Bacteria 3039
612 Ga0495684_0057084 3300047471 Bacteria 2975
613 Ga0495684_0262418 3300047471 Bacteria 1252
614 Ga0495686_0021426 3300047472 Bacteria 4292
615 Ga0495686_0359710 3300047472 Bacteria 789
616 Ga0495593_0006644 3300047673 Bacteria 6769
617 Ga0495593_0056023 3300047673 Bacteria 2073
618 Ga0495602_0033616 3300048088 Bacteria 4808
619 Ga0495602_0042207 3300048088 Bacteria 4158
620 Ga0495602_0134116 3300048088 Bacteria 1970
621 Ga0495614_0001624 3300048089 Bacteria 9790
622 Ga0495614_0006077 3300048089 Bacteria 5428
623 Ga0495614_0008394 3300048089 Bacteria 4594
624 Ga0495614_0056364 3300048089 Bacteria 1686
625 Ga0495614_0142670 3300048089 Bacteria 1065
626 Ga0496100_0028814 3300048903 Bacteria 3428
627 Ga0496101_0224162 3300048904 Bacteria 1459
628 Ga0496102_0109191 3300048905 Bacteria 2577
629 Ga0496103_0015293 3300048906 Bacteria 4563
630 Ga0496104_0047016 3300048907 Bacteria 4066
631 Ga0496105_0044148 3300048908 Bacteria 3675
632 Ga0496105_0167738 3300048908 Bacteria 1801
633 Ga0496106_0039817 3300048909 Bacteria 3519
634 Ga0496106_0485553 3300048909 Bacteria 992
635 Ga0496107_0071585 3300048910 Bacteria 2519
636 Ga0496108_0177728 3300048911 Bacteria 1843
637 Ga0496108_0964335 3300048911 Bacteria 729
638 Ga0496109_0096805 3300048912 Bacteria 2734
639 Ga0496109_0211288 3300048912 Bacteria 1825
640 Ga0496109_0575401 3300048912 Bacteria 1062
641 Ga0496110_0044145 3300048913 Bacteria 3892
642 Ga0496111_0181938 3300048914 Bacteria 1562
643 Ga0496112_0069182 3300048915 Bacteria 3487
644 Ga0496112_0825898 3300048915 Bacteria 851
645 Ga0496113_0059780 3300048916 Bacteria 2871
646 Ga0496114_0147762 3300048917 Bacteria 2038
647 Ga0496115_0166387 3300048918 Bacteria 1823
648 Ga0496115_0557778 3300048918 Bacteria 915
649 Ga0496126_0531483 3300048929 Bacteria 936
650 Ga0495678_021898 3300049459 Bacteria 2805
651 Ga0495682_0052774 3300049460 Bacteria 1477
652 Ga0501323_007016 3300049539 Bacteria 1275
653 Ga0501031_0006424 3300049568 Bacteria 7667
654 Ga0501031_0067105 3300049568 Bacteria 2337
655 Ga0501032_0146868 3300049569 Bacteria 1552
656 Ga0501033_0001301 3300049570 Bacteria 22178
657 Ga0501033_0076368 3300049570 Bacteria 2459
658 Ga0501034_0001622 3300049571 Bacteria 29187
659 Ga0501034_0055492 3300049571 Bacteria 3986
660 Ga0501034_0085655 3300049571 Bacteria 3152
661 Ga0501036_0003801 3300049572 Bacteria 12106
662 Ga0501036_0018744 3300049572 Bacteria 5804
663 Ga0501036_0019176 3300049572 Bacteria 5738
664 Ga0501037_0002340 3300049573 Bacteria 13694
665 Ga0501037_0013307 3300049573 Bacteria 6063
666 Ga0501037_0593406 3300049573 Bacteria 744
667 Ga0501038_0007735 3300049574 Bacteria 9909
668 Ga0501038_0008418 3300049574 Bacteria 9487
669 Ga0501038_0021101 3300049574 Bacteria 5851
670 Ga0501039_0013778 3300049575 Bacteria 6186
671 Ga0501039_0065064 3300049575 Bacteria 2828
672 Ga0501042_0048952 3300049578 Bacteria 3014
673 Ga0501043_0001089 3300049579 Bacteria 23889
674 Ga0501043_0031502 3300049579 Bacteria 4168
675 Ga0501043_0052024 3300049579 Bacteria 3218
676 Ga0501046_0015796 3300049580 Bacteria 6334
677 Ga0501046_0177986 3300049580 Bacteria 1592
678 Ga0501047_0000309 3300049581 Bacteria 56264
679 Ga0501047_0015678 3300049581 Bacteria 7221
680 Ga0501047_0018162 3300049581 Bacteria 6740
681 Ga0501047_0111742 3300049581 Bacteria 2615
682 Ga0501047_0148312 3300049581 Bacteria 2222
683 Ga0501047_0173390 3300049581 Bacteria 2025
684 Ga0501047_0291203 3300049581 Bacteria 1476
685 Ga0501048_0016728 3300049582 Bacteria 5406
686 Ga0501069_0196515 3300049585 Bacteria 1168
687 Ga0501070_0000441 3300049586 Bacteria 37765
688 Ga0501071_0024174 3300049587 Bacteria 4247
689 Ga0501073_0066827 3300049589 Bacteria 2506
690 Ga0501073_0192030 3300049589 Bacteria 1413
691 Ga0501074_0026677 3300049590 Bacteria 4188
692 Ga0501080_0084922 3300049742 Bacteria 2941
693 Ga0501080_0298932 3300049742 Bacteria 1460
694 Ga0501035_0002876 3300049822 Bacteria 16604
695 Ga0501035_0012498 3300049822 Bacteria 7844
696 Ga0501035_0034183 3300049822 Bacteria 4620
697 Ga0501035_0064529 3300049822 Bacteria 3255
698 Ga0501035_0225285 3300049822 Bacteria 1599
699 Ga0501044_0013506 3300049823 Bacteria 8830
700 Ga0501044_0022495 3300049823 Bacteria 6716
701 Ga0501044_0025390 3300049823 Bacteria 6280
702 Ga0501044_0067407 3300049823 Bacteria 3646
703 Ga0501044_0088729 3300049823 Bacteria 3121
704 Ga0501044_0139858 3300049823 Bacteria 2410
705 Ga0501044_0181461 3300049823 Bacteria 2071
706 Ga0501044_0196420 3300049823 Bacteria 1977
707 Ga0501044_0373078 3300049823 Bacteria 1343
708 Ga0501044_0396491 3300049823 Bacteria 1293
709 Ga0501044_0467508 3300049823 Bacteria 1166
710 nmdc:mga03n38_107831_c1 3300050490 Bacteria 1352
711 nmdc:mga04h51_8038_c1 3300050495 Bacteria 2810
712 nmdc:mga0rr50_240546_c1 3300050513 Bacteria 1500
713 nmdc:mga0a205_527864_c1 3300050515 Bacteria 1036
714 Ga0495601_0006351 3300053077 Bacteria 6908
715 Ga0495601_0012738 3300053077 Bacteria 5046
716 Ga0495601_0091853 3300053077 Bacteria 1955
717 Ga0495601_0210752 3300053077 Bacteria 1269
718 Ga0495601_0267920 3300053077 Bacteria 1114
719 Ga0495612_0001269 3300053078 Bacteria 10415
720 Ga0495612_0002887 3300053078 Bacteria 7124
721 Ga0495612_0050001 3300053078 Bacteria 1716
722 Ga0495612_0120044 3300053078 Bacteria 1130
723 Ga0495595_0004208 3300053084 Bacteria 5787
724 Ga0495619_0004841 3300053085 Bacteria 8546
725 Ga0495619_0071628 3300053085 Bacteria 2320
726 Ga0495619_0082560 3300053085 Bacteria 2166
727 Ga0500578_0036380 3300053086 Bacteria 3162
728 Ga0500644_0014080 3300053088 Bacteria 2249
729 Ga0500660_139741 3300053100 Bacteria 965
730 Ga0500553_037842 3300053101 Bacteria 2380
731 Ga0500560_000508 3300053107 Bacteria 5467
732 Ga0500569_003461 3300053109 Bacteria 3231
733 Ga0500652_000184 3300053131 Bacteria 24098
734 Ga0500561_0016007 3300053137 Bacteria 1675
735 Ga0500573_0061052 3300053140 Bacteria 2159
736 Ga0500579_054867 3300053143 Bacteria 2410
737 Ga0500600_0019200 3300053149 Bacteria 4117
738 Ga0500600_0042669 3300053149 Bacteria 2612
739 Ga0500616_0022984 3300053153 Bacteria 3477
740 Ga0500634_0019418 3300053161 Bacteria 3661
741 Ga0501084_0885665 3300054114 Bacteria 751
742 Ga0501082_0018213 3300060353 Bacteria 6047
743 Ga0466962_0000123 3300061719 Bacteria 31639
744 Ga0466962_0128867 3300061719 Bacteria 1222

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100001069 Ga0070671_10000106912 192
2 3300005367 Ga0070667_100258653 Ga0070667_1002586532 192
3 3300005548 Ga0070665_100006798 Ga0070665_1000067982 192
4 3300005843 Ga0068860_100156092 Ga0068860_1001560922 192
5 3300025931 Ga0207644_10001360 Ga0207644_100013607 192
6 3300025986 Ga0207658_10135834 Ga0207658_101358342 192
7 3300028379 Ga0268266_10044101 Ga0268266_100441014 192
8 3300028381 Ga0268264_10131684 Ga0268264_101316843 192
9 3300045976 Ga0466967_0219988 Ga0466967_0219988_285_947 197
10 3300044901 Ga0466960_0007064 Ga0466960_0007064_3625_4257 203
11 iso_pu_bacteria 2862705112 2862705624 204
12 iso_pu_bacteria 2990044586 2990049406 204
13 iso_pu_bacteria 8008485437 8008489528 204
14 iso_pu_bacteria 8025524527 8025528896 204
15 3300053140 Ga0500573_0061052 Ga0500573_0061052_1268_1930 205
16 iso_pu_bacteria 2867346516 2867351269 205
17 3300039437 Ga0436365_0192020 Ga0436365_0192020_1371_2024 207
18 3300044656 Ga0466969_0007733 Ga0466969_0007733_1084_1725 207
19 3300044684 Ga0466966_0025078 Ga0466966_0025078_624_1265 207
20 3300044693 Ga0466961_0000804 Ga0466961_0000804_17136_17777 207
21 3300044719 Ga0466971_0029345 Ga0466971_0029345_28_669 207
22 3300044765 Ga0466970_0002932 Ga0466970_0002932_3067_3708 207
23 3300044765 Ga0466970_0005496 Ga0466970_0005496_4753_5409 207
24 3300044693 Ga0466961_0002459 Ga0466961_0002459_10714_11355 208
25 3300048912 Ga0496109_0211288 Ga0496109_0211288_582_1214 208
26 iso_pu_bacteria 2558860280 2559427446 208
27 iso_pu_bacteria 2758568621 2760622860 208
28 iso_pu_bacteria 8056579771 8056581689 208
29 3300005327 Ga0070658_10143423 Ga0070658_101434232 209
30 3300005539 Ga0068853_100209148 Ga0068853_1002091482 209
31 3300005564 Ga0070664_100216629 Ga0070664_1002166292 209
32 3300005616 Ga0068852_100230554 Ga0068852_1002305542 209
33 3300005937 Ga0081455_10037754 Ga0081455_100377541 209
34 3300009545 Ga0105237_10023191 Ga0105237_100231915 209
35 3300010375 Ga0105239_10189981 Ga0105239_101899811 209
36 3300025929 Ga0207664_10000001 Ga0207664_10000001431 209
37 3300026041 Ga0207639_10172234 Ga0207639_101722341 209
38 3300030521 Ga0307511_10004831 Ga0307511_1000483117 209
39 3300030522 Ga0307512_10005460 Ga0307512_100054603 209
40 3300031616 Ga0307508_10008698 Ga0307508_100086983 209
41 3300037068 Ga0373925_0152526 Ga0373925_0152526_888_1535 209
42 3300046459 Ga0495629_0007561 Ga0495629_0007561_3572_4231 209
43 3300046476 Ga0495662_0001981 Ga0495662_0001981_7592_8251 209
44 3300046476 Ga0495662_0222887 Ga0495662_0222887_105_764 209
45 3300046477 Ga0495664_0390921 Ga0495664_0390921_155_808 209
46 3300046517 Ga0495630_0137908 Ga0495630_0137908_858_1517 209
47 3300046543 Ga0495645_0091998 Ga0495645_0091998_868_1527 209
48 3300046675 Ga0495657_0002061 Ga0495657_0002061_9438_10097 209
49 3300046675 Ga0495657_0366990 Ga0495657_0366990_71_730 209
50 3300046689 Ga0495613_0206111 Ga0495613_0206111_578_1237 209
51 3300047444 Ga0495675_0007900 Ga0495675_0007900_1238_1897 209
52 3300048908 Ga0496105_0167738 Ga0496105_0167738_649_1308 209
53 3300048912 Ga0496109_0575401 Ga0496109_0575401_270_917 209
54 3300049575 Ga0501039_0065064 Ga0501039_0065064_2130_2780 209
55 iso_pu_bacteria 2643221601 2644015014 209
56 iso_pu_bacteria 2643221631 2644176901 209
57 iso_pu_bacteria 2915768154 2915769476 209
58 3300044656 Ga0466969_0007599 Ga0466969_0007599_3986_4645 210
59 3300044656 Ga0466969_0015982 Ga0466969_0015982_482_1141 210
60 3300044693 Ga0466961_0133384 Ga0466961_0133384_209_868 210
61 3300044765 Ga0466970_0002761 Ga0466970_0002761_3406_4065 210
62 3300049823 Ga0501044_0181461 Ga0501044_0181461_940_1668 210
63 iso_pu_bacteria 2582581312 2585301094 210
64 iso_pu_bacteria 2616644941 2616899423 210
65 iso_pu_bacteria 2643221548 2643759300 210
66 iso_pu_bacteria 2643221578 2643897369 210
67 iso_pu_bacteria 2643221587 2643945164 210
68 iso_pu_bacteria 2643221670 2644387395 210
69 iso_pu_bacteria 2643221673 2644408514 210
70 iso_pu_bacteria 2643221677 2644432063 210
71 iso_pu_bacteria 2643221682 2644463282 210
72 iso_pu_bacteria 2808606982 2811847596 210
73 iso_pu_bacteria 2818991463 2819694123 210
74 iso_pu_bacteria 2862178590 2862182958 210
75 iso_pu_bacteria 2863404153 2863406219 210
76 iso_pu_bacteria 2867475112 2867477002 210
77 iso_pu_bacteria 2875391855 2875393311 210
78 iso_pu_bacteria 2891326441 2891331060 210
79 iso_pu_bacteria 2918501144 2918503182 210
80 iso_pu_bacteria 2946045630 2946051379 210
81 iso_pu_bacteria 2966598605 2966603750 210
82 iso_pu_bacteria 2990059506 2990060786 210
83 iso_pu_bacteria 2997451912 2997458555 210
84 iso_pu_bacteria 8008558824 8008562090 210
85 iso_pu_bacteria 8023623736 8023627517 210
86 iso_pu_bacteria 8048406513 8048409060 210
87 iso_pu_bacteria 8054160619 8054163656 210
88 3300005330 Ga0070690_100166820 Ga0070690_1001668202 211
89 3300005333 Ga0070677_10105815 Ga0070677_101058152 211
90 3300005339 Ga0070660_100009722 Ga0070660_1000097224 211
91 3300005341 Ga0070691_10121144 Ga0070691_101211442 211
92 3300005343 Ga0070687_100014648 Ga0070687_1000146484 211
93 3300005344 Ga0070661_100049902 Ga0070661_1000499023 211
94 3300005347 Ga0070668_100466255 Ga0070668_1004662552 211
95 3300005354 Ga0070675_100105883 Ga0070675_1001058832 211
96 3300005355 Ga0070671_100186242 Ga0070671_1001862421 211
97 3300005364 Ga0070673_100382182 Ga0070673_1003821821 211
98 3300005435 Ga0070714_100111539 Ga0070714_1001115392 211
99 3300005435 Ga0070714_100594467 Ga0070714_1005944672 211
100 3300005435 Ga0070714_101042375 Ga0070714_1010423751 211
101 3300005435 Ga0070714_101165846 Ga0070714_1011658461 211
102 3300005436 Ga0070713_100366054 Ga0070713_1003660542 211
103 3300005436 Ga0070713_100536307 Ga0070713_1005363072 211
104 3300005439 Ga0070711_100164630 Ga0070711_1001646302 211
105 3300005439 Ga0070711_100269290 Ga0070711_1002692901 211
106 3300005439 Ga0070711_100468666 Ga0070711_1004686661 211
107 3300005440 Ga0070705_100043008 Ga0070705_1000430083 211
108 3300005445 Ga0070708_100144239 Ga0070708_1001442392 211
109 3300005455 Ga0070663_100008380 Ga0070663_1000083802 211
110 3300005456 Ga0070678_100070844 Ga0070678_1000708441 211
111 3300005457 Ga0070662_100058592 Ga0070662_1000585922 211
112 3300005458 Ga0070681_10263183 Ga0070681_102631832 211
113 3300005530 Ga0070679_100257671 Ga0070679_1002576713 211
114 3300005535 Ga0070684_100036331 Ga0070684_1000363314 211
115 3300005535 Ga0070684_100198413 Ga0070684_1001984132 211
116 3300005539 Ga0068853_100415085 Ga0068853_1004150852 211
117 3300005546 Ga0070696_100115308 Ga0070696_1001153082 211
118 3300005547 Ga0070693_100109567 Ga0070693_1001095672 211
119 3300005548 Ga0070665_100163185 Ga0070665_1001631852 211
120 3300005549 Ga0070704_100097907 Ga0070704_1000979072 211
121 3300005563 Ga0068855_100032082 Ga0068855_1000320826 211
122 3300005563 Ga0068855_100189698 Ga0068855_1001896983 211
123 3300005577 Ga0068857_100021276 Ga0068857_1000212762 211
124 3300005615 Ga0070702_100554650 Ga0070702_1005546501 211
125 3300005616 Ga0068852_100135991 Ga0068852_1001359913 211
126 3300005617 Ga0068859_100214382 Ga0068859_1002143822 211
127 3300005618 Ga0068864_100069457 Ga0068864_1000694572 211
128 3300005841 Ga0068863_100127901 Ga0068863_1001279012 211
129 3300005841 Ga0068863_100403030 Ga0068863_1004030302 211
130 3300005983 Ga0081540_1001003 Ga0081540_10010033 211
131 3300006028 Ga0070717_10690351 Ga0070717_106903511 211
132 3300006163 Ga0070715_10009652 Ga0070715_100096522 211
133 3300006163 Ga0070715_10029481 Ga0070715_100294811 211
134 3300006175 Ga0070712_100083205 Ga0070712_1000832053 211
135 3300006237 Ga0097621_100024958 Ga0097621_1000249584 211
136 3300006358 Ga0068871_100103140 Ga0068871_1001031402 211
137 3300006871 Ga0075434_100317411 Ga0075434_1003174112 211
138 3300006881 Ga0068865_100671682 Ga0068865_1006716821 211
139 3300006931 Ga0097620_100214382 Ga0097620_1002143822 211
140 3300009011 Ga0105251_10046387 Ga0105251_100463872 211
141 3300009174 Ga0105241_10042041 Ga0105241_100420412 211
142 3300009176 Ga0105242_10479412 Ga0105242_104794122 211
143 3300009177 Ga0105248_10046817 Ga0105248_100468172 211
144 3300009553 Ga0105249_10106568 Ga0105249_101065682 211
145 3300012476 Ga0157344_1003718 Ga0157344_10037181 211
146 3300012507 Ga0157342_1005584 Ga0157342_10055842 211
147 3300012515 Ga0157338_1003999 Ga0157338_10039992 211
148 3300013102 Ga0157371_10223820 Ga0157371_102238202 211
149 3300013296 Ga0157374_10165189 Ga0157374_101651892 211
150 3300013308 Ga0157375_10140650 Ga0157375_101406502 211
151 3300014325 Ga0163163_10877880 Ga0163163_108778802 211
152 3300014326 Ga0157380_10090063 Ga0157380_100900631 211
153 3300014745 Ga0157377_10066603 Ga0157377_100666031 211
154 3300020070 Ga0206356_10014746 Ga0206356_100147462 211
155 3300025302 Ga0207426_1001695 Ga0207426_10016956 211
156 3300025302 Ga0207426_1006964 Ga0207426_10069641 211
157 3300025885 Ga0207653_10045165 Ga0207653_100451652 211
158 3300025898 Ga0207692_10052092 Ga0207692_100520922 211
159 3300025898 Ga0207692_10151822 Ga0207692_101518222 211
160 3300025901 Ga0207688_10003920 Ga0207688_100039202 211
161 3300025906 Ga0207699_10032148 Ga0207699_100321482 211
162 3300025906 Ga0207699_10056834 Ga0207699_100568342 211
163 3300025907 Ga0207645_10020916 Ga0207645_100209165 211
164 3300025908 Ga0207643_10010462 Ga0207643_100104626 211
165 3300025909 Ga0207705_10279423 Ga0207705_102794232 211
166 3300025911 Ga0207654_10036955 Ga0207654_100369552 211
167 3300025912 Ga0207707_10247138 Ga0207707_102471382 211
168 3300025912 Ga0207707_10375231 Ga0207707_103752312 211
169 3300025913 Ga0207695_10084491 Ga0207695_100844913 211
170 3300025916 Ga0207663_10102646 Ga0207663_101026463 211
171 3300025919 Ga0207657_10010424 Ga0207657_1001042410 211
172 3300025921 Ga0207652_10035870 Ga0207652_100358705 211
173 3300025924 Ga0207694_10255328 Ga0207694_102553282 211
174 3300025925 Ga0207650_10181194 Ga0207650_101811942 211
175 3300025928 Ga0207700_10064776 Ga0207700_100647762 211
176 3300025928 Ga0207700_10482663 Ga0207700_104826631 211
177 3300025928 Ga0207700_10862652 Ga0207700_108626521 211
178 3300025929 Ga0207664_10020356 Ga0207664_100203562 211
179 3300025929 Ga0207664_10158406 Ga0207664_101584062 211
180 3300025929 Ga0207664_10554068 Ga0207664_105540682 211
181 3300025931 Ga0207644_10406452 Ga0207644_104064521 211
182 3300025933 Ga0207706_10026322 Ga0207706_100263223 211
183 3300025934 Ga0207686_10024265 Ga0207686_100242651 211
184 3300025936 Ga0207670_10136158 Ga0207670_101361582 211
185 3300025939 Ga0207665_10006674 Ga0207665_100066743 211
186 3300025942 Ga0207689_10106006 Ga0207689_101060062 211
187 3300025944 Ga0207661_10159922 Ga0207661_101599222 211
188 3300025949 Ga0207667_10119316 Ga0207667_101193162 211
189 3300026067 Ga0207678_10717393 Ga0207678_107173932 211
190 3300026078 Ga0207702_10016152 Ga0207702_100161526 211
191 3300026088 Ga0207641_10024402 Ga0207641_100244023 211
192 3300026088 Ga0207641_10927815 Ga0207641_109278151 211
193 3300026118 Ga0207675_100402395 Ga0207675_1004023952 211
194 3300026121 Ga0207683_10008335 Ga0207683_1000833510 211
195 3300026142 Ga0207698_10010090 Ga0207698_100100906 211
196 3300031456 Ga0307513_10003780 Ga0307513_100037807 211
197 3300031616 Ga0307508_10001228 Ga0307508_1000122813 211
198 3300035083 Ga0373926_0000431 Ga0373926_0000431_1601_2242 211
199 3300035086 Ga0373934_0060672 Ga0373934_0060672_251_895 211
200 3300035089 Ga0373944_0001774 Ga0373944_0001774_470_1111 211
201 3300035111 Ga0373923_0004370 Ga0373923_0004370_3724_4365 211
202 3300035111 Ga0373923_0005743 Ga0373923_0005743_154_798 211
203 3300035113 Ga0373936_0000300 Ga0373936_0000300_4803_5444 211
204 3300035113 Ga0373936_0003136 Ga0373936_0003136_2717_3361 211
205 3300035116 Ga0373945_0000621 Ga0373945_0000621_8666_9310 211
206 3300035116 Ga0373945_0000765 Ga0373945_0000765_2893_3534 211
207 3300035117 Ga0373953_0010773 Ga0373953_0010773_105_749 211
208 3300035119 Ga0373956_0066949 Ga0373956_0066949_837_1481 211
209 3300035120 Ga0373957_0013131 Ga0373957_0013131_1992_2636 211
210 3300035121 Ga0373960_0036014 Ga0373960_0036014_443_1096 211
211 3300035170 Ga0373943_0000210 Ga0373943_0000210_11137_11778 211
212 3300035170 Ga0373943_0000853 Ga0373943_0000853_3038_3682 211
213 3300035171 Ga0373946_0000853 Ga0373946_0000853_1528_2169 211
214 3300035171 Ga0373946_0000901 Ga0373946_0000901_8384_9028 211
215 3300035172 Ga0373955_0007658 Ga0373955_0007658_962_1606 211
216 3300035207 Ga0373942_0148961 Ga0373942_0148961_29_682 211
217 3300035241 Ga0373961_0087311 Ga0373961_0087311_143_796 211
218 3300035410 Ga0373924_0003757 Ga0373924_0003757_2765_3409 211
219 3300035691 Ga0373931_0237587 Ga0373931_0237587_105_758 211
220 3300035692 Ga0373935_0015120 Ga0373935_0015120_3723_4364 211
221 3300035692 Ga0373935_0216968 Ga0373935_0216968_56_700 211
222 3300035695 Ga0373927_0001724 Ga0373927_0001724_10927_11568 211
223 3300035695 Ga0373927_0003506 Ga0373927_0003506_805_1449 211
224 3300035724 Ga0373933_0010418 Ga0373933_0010418_4121_4765 211
225 3300035724 Ga0373933_0180163 Ga0373933_0180163_121_765 211
226 3300035725 Ga0373947_0000745 Ga0373947_0000745_1343_1987 211
227 3300035725 Ga0373947_0012919 Ga0373947_0012919_3897_4538 211
228 3300036401 Ga0373937_0196588 Ga0373937_0196588_1184_1828 211
229 3300036401 Ga0373937_0512640 Ga0373937_0512640_363_1007 211
230 3300037068 Ga0373925_0000989 Ga0373925_0000989_25024_25665 211
231 3300037068 Ga0373925_0010631 Ga0373925_0010631_3632_4276 211
232 3300037418 Ga0395900_0162181 Ga0395900_0162181_1188_1856 211
233 3300037853 Ga0436364_1419474 Ga0436364_1419474_1746_2399 211
234 3300039450 Ga0436363_0381476 Ga0436363_0381476_148_801 211
235 3300039450 Ga0436363_1261317 Ga0436363_1261317_72_725 211
236 3300045976 Ga0466967_0087393 Ga0466967_0087393_845_1486 211
237 3300046453 Ga0495627_096635 Ga0495627_096635_88_738 211
238 3300046454 Ga0495592_0012304 Ga0495592_0012304_4137_4781 211
239 3300046454 Ga0495592_0305794 Ga0495592_0305794_104_757 211
240 3300046455 Ga0495603_0000581 Ga0495603_0000581_3690_4343 211
241 3300046455 Ga0495603_0002290 Ga0495603_0002290_113_766 211
242 3300046455 Ga0495603_0014926 Ga0495603_0014926_1665_2309 211
243 3300046459 Ga0495629_0001519 Ga0495629_0001519_6444_7097 211
244 3300046459 Ga0495629_0008473 Ga0495629_0008473_2247_2900 211
245 3300046459 Ga0495629_0034729 Ga0495629_0034729_200_844 211
246 3300046459 Ga0495629_0076614 Ga0495629_0076614_777_1418 211
247 3300046461 Ga0495641_0002279 Ga0495641_0002279_11394_12038 211
248 3300046461 Ga0495641_0035142 Ga0495641_0035142_717_1358 211
249 3300046462 Ga0495651_0124443 Ga0495651_0124443_912_1556 211
250 3300046462 Ga0495651_0181068 Ga0495651_0181068_120_764 211
251 3300046463 Ga0495653_0007471 Ga0495653_0007471_6635_7276 211
252 3300046463 Ga0495653_0044209 Ga0495653_0044209_1175_1819 211
253 3300046463 Ga0495653_0153327 Ga0495653_0153327_708_1352 211
254 3300046463 Ga0495653_0287368 Ga0495653_0287368_278_919 211
255 3300046472 Ga0495580_0001275 Ga0495580_0001275_8186_8830 211
256 3300046473 Ga0495582_0061116 Ga0495582_0061116_921_1562 211
257 3300046475 Ga0495639_0000919 Ga0495639_0000919_2752_3396 211
258 3300046476 Ga0495662_0003816 Ga0495662_0003816_1949_2593 211
259 3300046477 Ga0495664_0005259 Ga0495664_0005259_3106_3750 211
260 3300046477 Ga0495664_0069801 Ga0495664_0069801_424_1065 211
261 3300046477 Ga0495664_0119135 Ga0495664_0119135_242_886 211
262 3300046499 Ga0495594_0002455 Ga0495594_0002455_3478_4131 211
263 3300046499 Ga0495594_0236458 Ga0495594_0236458_306_950 211
264 3300046511 Ga0495608_0014214 Ga0495608_0014214_1527_2171 211
265 3300046514 Ga0495618_0001193 Ga0495618_0001193_3402_4046 211
266 3300046514 Ga0495618_0045219 Ga0495618_0045219_1251_1892 211
267 3300046515 Ga0495620_0197085 Ga0495620_0197085_77_730 211
268 3300046516 Ga0495628_0004700 Ga0495628_0004700_5324_5968 211
269 3300046516 Ga0495628_0249908 Ga0495628_0249908_194_835 211
270 3300046516 Ga0495628_0344491 Ga0495628_0344491_353_1006 211
271 3300046517 Ga0495630_0003270 Ga0495630_0003270_827_1468 211
272 3300046517 Ga0495630_0015818 Ga0495630_0015818_628_1272 211
273 3300046526 Ga0495666_0002824 Ga0495666_0002824_1045_1689 211
274 3300046526 Ga0495666_0294888 Ga0495666_0294888_68_721 211
275 3300046529 Ga0495652_0008008 Ga0495652_0008008_8375_9019 211
276 3300046529 Ga0495652_0038041 Ga0495652_0038041_3107_3748 211
277 3300046531 Ga0495665_0002201 Ga0495665_0002201_9742_10386 211
278 3300046533 Ga0495640_0064323 Ga0495640_0064323_1347_1991 211
279 3300046533 Ga0495640_0085431 Ga0495640_0085431_612_1253 211
280 3300046535 Ga0495586_0021800 Ga0495586_0021800_2621_3265 211
281 3300046536 Ga0495587_0002510 Ga0495587_0002510_8846_9490 211
282 3300046536 Ga0495587_0066521 Ga0495587_0066521_327_980 211
283 3300046536 Ga0495587_0295055 Ga0495587_0295055_44_685 211
284 3300046543 Ga0495645_0060170 Ga0495645_0060170_2083_2727 211
285 3300046557 Ga0495622_0020933 Ga0495622_0020933_894_1547 211
286 3300046557 Ga0495622_0154432 Ga0495622_0154432_146_799 211
287 3300046559 Ga0495667_0005551 Ga0495667_0005551_7462_8103 211
288 3300046559 Ga0495667_0010332 Ga0495667_0010332_1430_2074 211
289 3300046559 Ga0495667_0448651 Ga0495667_0448651_69_713 211
290 3300046642 Ga0495634_0004035 Ga0495634_0004035_5196_5840 211
291 3300046642 Ga0495634_0023005 Ga0495634_0023005_2662_3303 211
292 3300046648 Ga0495611_0060824 Ga0495611_0060824_26_679 211
293 3300046663 Ga0495635_0001020 Ga0495635_0001020_6727_7368 211
294 3300046663 Ga0495635_0040955 Ga0495635_0040955_918_1562 211
295 3300046674 Ga0495588_0037055 Ga0495588_0037055_610_1254 211
296 3300046675 Ga0495657_0128888 Ga0495657_0128888_887_1531 211
297 3300046675 Ga0495657_0144372 Ga0495657_0144372_597_1238 211
298 3300046678 Ga0495599_0003474 Ga0495599_0003474_7951_8595 211
299 3300046678 Ga0495599_0187761 Ga0495599_0187761_165_818 211
300 3300046678 Ga0495599_0197164 Ga0495599_0197164_145_789 211
301 3300046679 Ga0495623_0100159 Ga0495623_0100159_1065_1709 211
302 3300046679 Ga0495623_0121458 Ga0495623_0121458_130_774 211
303 3300046680 Ga0495646_0026449 Ga0495646_0026449_918_1562 211
304 3300046681 Ga0495647_0036628 Ga0495647_0036628_693_1337 211
305 3300046683 Ga0495658_0000668 Ga0495658_0000668_6427_7071 211
306 3300046689 Ga0495613_0001017 Ga0495613_0001017_8414_9058 211
307 3300046689 Ga0495613_0004228 Ga0495613_0004228_5476_6129 211
308 3300046690 Ga0495624_0003117 Ga0495624_0003117_6916_7557 211
309 3300046809 Ga0495600_0033937 Ga0495600_0033937_155_799 211
310 3300047315 Ga0495581_0000732 Ga0495581_0000732_7701_8345 211
311 3300047315 Ga0495581_0029604 Ga0495581_0029604_1504_2145 211
312 3300047317 Ga0495604_0001177 Ga0495604_0001177_18023_18667 211
313 3300047317 Ga0495604_0164304 Ga0495604_0164304_251_895 211
314 3300047319 Ga0495674_0001674 Ga0495674_0001674_10024_10665 211
315 3300047319 Ga0495674_0018733 Ga0495674_0018733_5743_6387 211
316 3300047319 Ga0495674_0234848 Ga0495674_0234848_65_718 211
317 3300047321 Ga0495676_0008328 Ga0495676_0008328_8827_9468 211
318 3300047321 Ga0495676_0008832 Ga0495676_0008832_194_838 211
319 3300047321 Ga0495676_0023093 Ga0495676_0023093_76_729 211
320 3300047322 Ga0495680_0026944 Ga0495680_0026944_3301_3942 211
321 3300047322 Ga0495680_0106162 Ga0495680_0106162_1417_2061 211
322 3300047323 Ga0495683_0098775 Ga0495683_0098775_730_1383 211
323 3300047444 Ga0495675_0030126 Ga0495675_0030126_1966_2610 211
324 3300047444 Ga0495675_0032379 Ga0495675_0032379_21_665 211
325 3300047471 Ga0495684_0003513 Ga0495684_0003513_11460_12104 211
326 3300047471 Ga0495684_0054852 Ga0495684_0054852_736_1377 211
327 3300047673 Ga0495593_0006644 Ga0495593_0006644_2958_3602 211
328 3300047673 Ga0495593_0056023 Ga0495593_0056023_777_1418 211
329 3300048088 Ga0495602_0042207 Ga0495602_0042207_3041_3685 211
330 3300048088 Ga0495602_0134116 Ga0495602_0134116_802_1443 211
331 3300048089 Ga0495614_0006077 Ga0495614_0006077_4665_5318 211
332 3300048089 Ga0495614_0008394 Ga0495614_0008394_3291_3935 211
333 3300048089 Ga0495614_0142670 Ga0495614_0142670_42_695 211
334 3300048903 Ga0496100_0028814 Ga0496100_0028814_955_1599 211
335 3300048904 Ga0496101_0224162 Ga0496101_0224162_560_1204 211
336 3300048905 Ga0496102_0109191 Ga0496102_0109191_1483_2127 211
337 3300048906 Ga0496103_0015293 Ga0496103_0015293_1539_2183 211
338 3300048907 Ga0496104_0047016 Ga0496104_0047016_2949_3593 211
339 3300048908 Ga0496105_0044148 Ga0496105_0044148_2620_3264 211
340 3300048909 Ga0496106_0039817 Ga0496106_0039817_2842_3486 211
341 3300048909 Ga0496106_0485553 Ga0496106_0485553_22_675 211
342 3300048910 Ga0496107_0071585 Ga0496107_0071585_1295_1939 211
343 3300048911 Ga0496108_0177728 Ga0496108_0177728_706_1347 211
344 3300048911 Ga0496108_0964335 Ga0496108_0964335_24_668 211
345 3300048912 Ga0496109_0096805 Ga0496109_0096805_1256_1900 211
346 3300048913 Ga0496110_0044145 Ga0496110_0044145_2368_3012 211
347 3300048914 Ga0496111_0181938 Ga0496111_0181938_450_1094 211
348 3300048915 Ga0496112_0069182 Ga0496112_0069182_2685_3329 211
349 3300048915 Ga0496112_0825898 Ga0496112_0825898_152_793 211
350 3300048916 Ga0496113_0059780 Ga0496113_0059780_828_1472 211
351 3300048917 Ga0496114_0147762 Ga0496114_0147762_546_1190 211
352 3300048918 Ga0496115_0166387 Ga0496115_0166387_258_902 211
353 3300048929 Ga0496126_0531483 Ga0496126_0531483_50_712 211
354 3300049539 Ga0501323_007016 Ga0501323_007016_274_921 211
355 3300049823 Ga0501044_0396491 Ga0501044_0396491_280_942 211
356 3300049823 Ga0501044_0467508 Ga0501044_0467508_367_1032 211
357 3300050513 nmdc:mga0rr50_240546_c1 nmdc:mga0rr50_240546_c1_721_1362 211
358 3300050515 nmdc:mga0a205_527864_c1 nmdc:mga0a205_527864_c1_362_1015 211
359 3300053077 Ga0495601_0012738 Ga0495601_0012738_3516_4160 211
360 3300053077 Ga0495601_0091853 Ga0495601_0091853_885_1568 211
361 3300053078 Ga0495612_0001269 Ga0495612_0001269_1948_2592 211
362 3300053078 Ga0495612_0050001 Ga0495612_0050001_370_1053 211
363 3300053078 Ga0495612_0120044 Ga0495612_0120044_356_1000 211
364 3300053084 Ga0495595_0004208 Ga0495595_0004208_574_1218 211
365 3300053085 Ga0495619_0004841 Ga0495619_0004841_4707_5351 211
366 iso_pu_bacteria 2547132111 2547409602 211
367 iso_pu_bacteria 2554235005 2554258985 211
368 iso_pu_bacteria 2582581313 2585306790 211
369 iso_pu_bacteria 2582581314 2585314086 211
370 iso_pu_bacteria 2616644814 2616694276 211
371 iso_pu_bacteria 2643221647 2644271108 211
372 iso_pu_bacteria 2643221678 2644435775 211
373 iso_pu_bacteria 2643221679 2644444684 211
374 iso_pu_bacteria 2758568522 2760307933 211
375 iso_pu_bacteria 2784132148 2784587365 211
376 iso_pu_bacteria 2784746768 2785367920 211
377 iso_pu_bacteria 2786546132 2786668974 211
378 iso_pu_bacteria 2802429296 2804844390 211
379 iso_pu_bacteria 2808606359 2808840584 211
380 iso_pu_bacteria 2808606375 2808919163 211
381 iso_pu_bacteria 2808606448 2809230938 211
382 iso_pu_bacteria 2811994879 2812359599 211
383 iso_pu_bacteria 2811994917 2812481722 211
384 iso_pu_bacteria 2818991472 2819743257 211
385 iso_pu_bacteria 2852635781 2852638418 211
386 iso_pu_bacteria 2862281513 2862288699 211
387 iso_pu_bacteria 2862574272 2862582950 211
388 iso_pu_bacteria 2867369537 2867370622 211
389 iso_pu_bacteria 2873151551 2873157033 211
390 iso_pu_bacteria 2877676314 2877682624 211
391 iso_pu_bacteria 2912723979 2912725493 211
392 iso_pu_bacteria 2912757875 2912759502 211
393 iso_pu_bacteria 2946064051 2946066311 211
394 iso_pu_bacteria 2946072368 2946074580 211
395 iso_pu_bacteria 2954380949 2954387822 211
396 iso_pu_bacteria 2954673503 2954675255 211
397 iso_pu_bacteria 2954682443 2954688880 211
398 iso_pu_bacteria 2954691527 2954698635 211
399 iso_pu_bacteria 2954701450 2954703590 211
400 iso_pu_bacteria 2954711539 2954717606 211
401 iso_pu_bacteria 2954721474 2954727571 211
402 iso_pu_bacteria 2954731030 2954734230 211
403 iso_pu_bacteria 2954740390 2954746466 211
404 iso_pu_bacteria 2954749733 2954753114 211
405 iso_pu_bacteria 2954759201 2954765582 211
406 iso_pu_bacteria 2990088156 2990093063 211
407 iso_pu_bacteria 2995463766 2995464657 211
408 iso_pu_bacteria 3006321560 3006322428 211
409 iso_pu_bacteria 3006393351 3006398639 211
410 iso_pu_bacteria 3006425503 3006426632 211
411 iso_pu_bacteria 3006493962 3006495534 211
412 iso_pu_bacteria 8008574985 8008580090 211
413 iso_pu_bacteria 8025413630 8025414030 211
414 iso_pu_bacteria 8025478263 8025485847 211
415 iso_pu_bacteria 8025530807 8025534742 211
416 iso_pu_bacteria 8047893842 8047899626 211
417 iso_pu_bacteria 8048356638 8048359304 211
418 iso_pu_bacteria 8048369669 8048376575 211
419 iso_pu_bacteria 8048379754 8048385628 211
420 iso_pu_bacteria 8056667051 8056668551 211
421 iso_pu_bacteria 8056829672 8056831216 211
422 3300005327 Ga0070658_10032082 Ga0070658_100320823 212
423 3300005434 Ga0070709_10021433 Ga0070709_100214333 212
424 3300005434 Ga0070709_10048179 Ga0070709_100481793 212
425 3300005435 Ga0070714_100133749 Ga0070714_1001337492 212
426 3300005435 Ga0070714_100293934 Ga0070714_1002939341 212
427 3300005435 Ga0070714_100466905 Ga0070714_1004669051 212
428 3300005436 Ga0070713_100028588 Ga0070713_1000285885 212
429 3300005436 Ga0070713_100508447 Ga0070713_1005084472 212
430 3300005437 Ga0070710_10090980 Ga0070710_100909801 212
431 3300005468 Ga0070707_100058044 Ga0070707_1000580443 212
432 3300005471 Ga0070698_100006962 Ga0070698_1000069628 212
433 3300005563 Ga0068855_100028602 Ga0068855_1000286026 212
434 3300006028 Ga0070717_10056517 Ga0070717_100565173 212
435 3300006028 Ga0070717_10347505 Ga0070717_103475052 212
436 3300006173 Ga0070716_100056492 Ga0070716_1000564922 212
437 3300006175 Ga0070712_100068471 Ga0070712_1000684711 212
438 3300006175 Ga0070712_100071771 Ga0070712_1000717712 212
439 3300006175 Ga0070712_100098410 Ga0070712_1000984102 212
440 3300013105 Ga0157369_10001097 Ga0157369_100010979 212
441 3300021384 Ga0213876_10009157 Ga0213876_100091577 212
442 3300021388 Ga0213875_10000331 Ga0213875_100003318 212
443 3300025898 Ga0207692_10026902 Ga0207692_100269021 212
444 3300025906 Ga0207699_10005049 Ga0207699_100050496 212
445 3300025906 Ga0207699_10061155 Ga0207699_100611552 212
446 3300025909 Ga0207705_10009924 Ga0207705_100099245 212
447 3300025915 Ga0207693_10044829 Ga0207693_100448293 212
448 3300025915 Ga0207693_10048524 Ga0207693_100485243 212
449 3300025915 Ga0207693_10055008 Ga0207693_100550082 212
450 3300025922 Ga0207646_10206437 Ga0207646_102064373 212
451 3300025928 Ga0207700_10059527 Ga0207700_100595271 212
452 3300025928 Ga0207700_10148750 Ga0207700_101487502 212
453 3300025929 Ga0207664_10487935 Ga0207664_104879352 212
454 3300025939 Ga0207665_10471257 Ga0207665_104712571 212
455 3300025949 Ga0207667_10057556 Ga0207667_100575563 212
456 3300031507 Ga0307509_10034109 Ga0307509_100341094 212
457 3300031616 Ga0307508_10150836 Ga0307508_101508362 212
458 3300035111 Ga0373923_0092196 Ga0373923_0092196_142_813 212
459 3300035113 Ga0373936_0028740 Ga0373936_0028740_527_1198 212
460 3300035113 Ga0373936_0121546 Ga0373936_0121546_206_877 212
461 3300035117 Ga0373953_0017014 Ga0373953_0017014_526_1197 212
462 3300035117 Ga0373953_0046444 Ga0373953_0046444_622_1293 212
463 3300035118 Ga0373954_0012718 Ga0373954_0012718_924_1595 212
464 3300035118 Ga0373954_0060510 Ga0373954_0060510_749_1420 212
465 3300035119 Ga0373956_0032315 Ga0373956_0032315_208_879 212
466 3300035120 Ga0373957_0004859 Ga0373957_0004859_455_1126 212
467 3300035120 Ga0373957_0035114 Ga0373957_0035114_1045_1716 212
468 3300035172 Ga0373955_0053068 Ga0373955_0053068_525_1196 212
469 3300035172 Ga0373955_0096188 Ga0373955_0096188_613_1284 212
470 3300035692 Ga0373935_0021479 Ga0373935_0021479_2730_3401 212
471 3300035692 Ga0373935_0159123 Ga0373935_0159123_128_799 212
472 3300035695 Ga0373927_0261318 Ga0373927_0261318_412_1068 212
473 3300035724 Ga0373933_0007376 Ga0373933_0007376_2841_3512 212
474 3300035724 Ga0373933_0010620 Ga0373933_0010620_2887_3558 212
475 3300036401 Ga0373937_0047927 Ga0373937_0047927_920_1591 212
476 3300036401 Ga0373937_0196205 Ga0373937_0196205_152_823 212
477 3300039437 Ga0436365_1767487 Ga0436365_1767487_15498_16145 212
478 3300044719 Ga0466971_0002384 Ga0466971_0002384_4393_5073 212
479 3300045049 Ga0466959_0002676 Ga0466959_0002676_10706_11386 212
480 3300046454 Ga0495592_0003362 Ga0495592_0003362_6580_7248 212
481 3300046459 Ga0495629_0005219 Ga0495629_0005219_5356_6024 212
482 3300046462 Ga0495651_0001048 Ga0495651_0001048_4132_4812 212
483 3300046462 Ga0495651_0104129 Ga0495651_0104129_773_1444 212
484 3300046462 Ga0495651_0112862 Ga0495651_0112862_1184_1852 212
485 3300046463 Ga0495653_0018529 Ga0495653_0018529_4568_5239 212
486 3300046463 Ga0495653_0099009 Ga0495653_0099009_673_1344 212
487 3300046511 Ga0495608_0023923 Ga0495608_0023923_655_1326 212
488 3300046511 Ga0495608_0035569 Ga0495608_0035569_1569_2240 212
489 3300046514 Ga0495618_0026198 Ga0495618_0026198_855_1535 212
490 3300046514 Ga0495618_0082226 Ga0495618_0082226_197_868 212
491 3300046516 Ga0495628_0058091 Ga0495628_0058091_122_802 212
492 3300046516 Ga0495628_0199834 Ga0495628_0199834_724_1395 212
493 3300046517 Ga0495630_0173082 Ga0495630_0173082_231_902 212
494 3300046529 Ga0495652_0006871 Ga0495652_0006871_3350_4030 212
495 3300046529 Ga0495652_0075703 Ga0495652_0075703_1324_1995 212
496 3300046533 Ga0495640_0006759 Ga0495640_0006759_6577_7245 212
497 3300046535 Ga0495586_0120600 Ga0495586_0120600_67_738 212
498 3300046543 Ga0495645_0050801 Ga0495645_0050801_1907_2578 212
499 3300046559 Ga0495667_0006827 Ga0495667_0006827_5748_6419 212
500 3300046559 Ga0495667_0098645 Ga0495667_0098645_658_1329 212
501 3300046642 Ga0495634_0003734 Ga0495634_0003734_6301_6969 212
502 3300046642 Ga0495634_0086784 Ga0495634_0086784_313_984 212
503 3300046642 Ga0495634_0144048 Ga0495634_0144048_449_1120 212
504 3300046663 Ga0495635_0005268 Ga0495635_0005268_1616_2287 212
505 3300046663 Ga0495635_0062768 Ga0495635_0062768_665_1336 212
506 3300046675 Ga0495657_0007027 Ga0495657_0007027_1669_2340 212
507 3300046675 Ga0495657_0013113 Ga0495657_0013113_2922_3590 212
508 3300046675 Ga0495657_0026932 Ga0495657_0026932_509_1180 212
509 3300046675 Ga0495657_0358045 Ga0495657_0358045_28_684 212
510 3300046678 Ga0495599_0165891 Ga0495599_0165891_134_805 212
511 3300046679 Ga0495623_0222323 Ga0495623_0222323_23_694 212
512 3300046680 Ga0495646_0008959 Ga0495646_0008959_1604_2275 212
513 3300046689 Ga0495613_0006091 Ga0495613_0006091_5675_6343 212
514 3300046689 Ga0495613_0097186 Ga0495613_0097186_1094_1765 212
515 3300046809 Ga0495600_0094741 Ga0495600_0094741_172_843 212
516 3300046809 Ga0495600_0131715 Ga0495600_0131715_931_1602 212
517 3300047317 Ga0495604_0007586 Ga0495604_0007586_6550_7218 212
518 3300047317 Ga0495604_0037390 Ga0495604_0037390_431_1102 212
519 3300047319 Ga0495674_0166927 Ga0495674_0166927_455_1126 212
520 3300047321 Ga0495676_0002474 Ga0495676_0002474_9172_9840 212
521 3300047322 Ga0495680_0006577 Ga0495680_0006577_5473_6144 212
522 3300047471 Ga0495684_0043083 Ga0495684_0043083_839_1510 212
523 3300047471 Ga0495684_0057084 Ga0495684_0057084_977_1648 212
524 3300048088 Ga0495602_0033616 Ga0495602_0033616_508_1179 212
525 3300049568 Ga0501031_0006424 Ga0501031_0006424_1963_2697 212
526 3300049570 Ga0501033_0076368 Ga0501033_0076368_1586_2251 212
527 3300049571 Ga0501034_0085655 Ga0501034_0085655_1072_1806 212
528 3300049572 Ga0501036_0019176 Ga0501036_0019176_4710_5444 212
529 3300049574 Ga0501038_0007735 Ga0501038_0007735_5256_5990 212
530 3300049581 Ga0501047_0111742 Ga0501047_0111742_1541_2188 212
531 3300049822 Ga0501035_0225285 Ga0501035_0225285_43_708 212
532 3300049823 Ga0501044_0067407 Ga0501044_0067407_843_1508 212
533 3300053077 Ga0495601_0006351 Ga0495601_0006351_881_1561 212
534 3300053078 Ga0495612_0002887 Ga0495612_0002887_4173_4853 212
535 3300053085 Ga0495619_0071628 Ga0495619_0071628_845_1516 212
536 3300053085 Ga0495619_0082560 Ga0495619_0082560_752_1432 212
537 3300061719 Ga0466962_0000123 Ga0466962_0000123_23960_24640 212
538 iso_pu_bacteria 2816332119 2816425211 212
539 iso_pu_bacteria 8056447290 8056449735 212
540 3300003320 rootH2_10131917 rootH2_101319172 213
541 3300005441 Ga0070700_100000046 Ga0070700_10000004627 213
542 3300005445 Ga0070708_100014738 Ga0070708_1000147383 213
543 3300005445 Ga0070708_100685516 Ga0070708_1006855161 213
544 3300005467 Ga0070706_100022411 Ga0070706_1000224115 213
545 3300005467 Ga0070706_100061305 Ga0070706_1000613053 213
546 3300005467 Ga0070706_100061882 Ga0070706_1000618822 213
547 3300005467 Ga0070706_100112598 Ga0070706_1001125983 213
548 3300005468 Ga0070707_100011319 Ga0070707_1000113192 213
549 3300005468 Ga0070707_100030611 Ga0070707_1000306113 213
550 3300005468 Ga0070707_100033248 Ga0070707_1000332483 213
551 3300005468 Ga0070707_100077848 Ga0070707_1000778482 213
552 3300005468 Ga0070707_100188039 Ga0070707_1001880392 213
553 3300005471 Ga0070698_100017421 Ga0070698_10001742110 213
554 3300005471 Ga0070698_100025287 Ga0070698_1000252877 213
555 3300005471 Ga0070698_100232996 Ga0070698_1002329962 213
556 3300005471 Ga0070698_100432145 Ga0070698_1004321452 213
557 3300005471 Ga0070698_100700195 Ga0070698_1007001952 213
558 3300005518 Ga0070699_100004942 Ga0070699_10000494213 213
559 3300005518 Ga0070699_100224520 Ga0070699_1002245201 213
560 3300005536 Ga0070697_100203822 Ga0070697_1002038222 213
561 3300006028 Ga0070717_10451466 Ga0070717_104514662 213
562 3300025910 Ga0207684_10035694 Ga0207684_100356943 213
563 3300025910 Ga0207684_10036572 Ga0207684_100365725 213
564 3300025922 Ga0207646_10010187 Ga0207646_100101879 213
565 3300025922 Ga0207646_10012121 Ga0207646_100121212 213
566 3300025922 Ga0207646_10040561 Ga0207646_100405611 213
567 3300025922 Ga0207646_10051833 Ga0207646_100518334 213
568 3300026075 Ga0207708_10000002 Ga0207708_1000000269 213
569 3300028786 Ga0307517_10009169 Ga0307517_100091694 213
570 3300030732 Ga0316176_1058730 Ga0316176_10587302 213
571 3300031507 Ga0307509_10415778 Ga0307509_104157782 213
572 3300031616 Ga0307508_10101115 Ga0307508_101011153 213
573 3300031649 Ga0307514_10206757 Ga0307514_102067572 213
574 3300031730 Ga0307516_10202274 Ga0307516_102022742 213
575 3300033180 Ga0307510_10169961 Ga0307510_101699613 213
576 3300035170 Ga0373943_0049300 Ga0373943_0049300_155_877 213
577 3300035695 Ga0373927_0139879 Ga0373927_0139879_411_1133 213
578 3300037068 Ga0373925_0053289 Ga0373925_0053289_1786_2454 213
579 3300037068 Ga0373925_0153026 Ga0373925_0153026_412_1134 213
580 3300037466 Ga0395898_0015773 Ga0395898_0015773_6031_6684 213
581 3300037853 Ga0436364_0226463 Ga0436364_0226463_16358_17029 213
582 3300037853 Ga0436364_0397039 Ga0436364_0397039_1986_2648 213
583 3300037853 Ga0436364_0644841 Ga0436364_0644841_76_762 213
584 3300037853 Ga0436364_0728232 Ga0436364_0728232_183_839 213
585 3300039447 Ga0436361_0451808 Ga0436361_0451808_116_775 213
586 3300039450 Ga0436363_0358206 Ga0436363_0358206_242_889 213
587 3300042007 Ga0439449_0000937 Ga0439449_0000937_856_1500 213
588 3300046455 Ga0495603_0185681 Ga0495603_0185681_45_698 213
589 3300046459 Ga0495629_0059311 Ga0495629_0059311_1325_1975 213
590 3300046460 Ga0495638_0318647 Ga0495638_0318647_146_799 213
591 3300046462 Ga0495651_0068380 Ga0495651_0068380_309_977 213
592 3300046474 Ga0495605_0197204 Ga0495605_0197204_154_807 213
593 3300046499 Ga0495594_0069558 Ga0495594_0069558_1278_1931 213
594 3300046499 Ga0495594_0180531 Ga0495594_0180531_525_1169 213
595 3300046506 Ga0495583_0110431 Ga0495583_0110431_32_688 213
596 3300046519 Ga0495632_0046066 Ga0495632_0046066_1033_1677 213
597 3300046522 Ga0495643_0015751 Ga0495643_0015751_2772_3416 213
598 3300046533 Ga0495640_0038683 Ga0495640_0038683_1977_2633 213
599 3300046648 Ga0495611_0150539 Ga0495611_0150539_272_925 213
600 3300046648 Ga0495611_0193356 Ga0495611_0193356_91_735 213
601 3300046683 Ga0495658_0017509 Ga0495658_0017509_2339_2983 213
602 3300046691 Ga0495670_0028561 Ga0495670_0028561_27_680 213
603 3300047315 Ga0495581_0058776 Ga0495581_0058776_885_1535 213
604 3300047317 Ga0495604_0075680 Ga0495604_0075680_622_1278 213
605 3300047321 Ga0495676_0172450 Ga0495676_0172450_429_1082 213
606 3300047322 Ga0495680_0036621 Ga0495680_0036621_309_977 213
607 3300047323 Ga0495683_0043444 Ga0495683_0043444_1459_2112 213
608 3300047447 Ga0495685_002002 Ga0495685_002002_1814_2467 213
609 3300047447 Ga0495685_004607 Ga0495685_004607_895_1539 213
610 3300047470 Ga0495681_0003668 Ga0495681_0003668_352_996 213
611 3300047472 Ga0495686_0021426 Ga0495686_0021426_813_1457 213
612 3300048918 Ga0496115_0557778 Ga0496115_0557778_35_685 213
613 3300049580 Ga0501046_0177986 Ga0501046_0177986_438_1094 213
614 3300049589 Ga0501073_0192030 Ga0501073_0192030_654_1316 213
615 3300049742 Ga0501080_0298932 Ga0501080_0298932_263_925 213
616 3300049822 Ga0501035_0012498 Ga0501035_0012498_6318_6968 213
617 3300049823 Ga0501044_0025390 Ga0501044_0025390_1278_1976 213
618 3300049823 Ga0501044_0139858 Ga0501044_0139858_1124_1780 213
619 3300053077 Ga0495601_0267920 Ga0495601_0267920_152_814 213
620 3300053086 Ga0500578_0036380 Ga0500578_0036380_2102_2746 213
621 3300053100 Ga0500660_139741 Ga0500660_139741_110_754 213
622 3300053101 Ga0500553_037842 Ga0500553_037842_374_1018 213
623 3300053109 Ga0500569_003461 Ga0500569_003461_1068_1712 213
624 3300053131 Ga0500652_000184 Ga0500652_000184_20764_21408 213
625 3300053137 Ga0500561_0016007 Ga0500561_0016007_88_732 213
626 3300053143 Ga0500579_054867 Ga0500579_054867_493_1137 213
627 3300053149 Ga0500600_0019200 Ga0500600_0019200_674_1318 213
628 3300053153 Ga0500616_0022984 Ga0500616_0022984_1116_1760 213
629 3300053161 Ga0500634_0019418 Ga0500634_0019418_820_1464 213
630 iso_pu_bacteria 2947224130 2947231067 213
631 3300003316 rootH1_10018911 rootH1_100189113 214
632 3300003320 rootH2_10046870 rootH2_100468702 214
633 3300003323 rootH1_10049521 rootH1_100495213 214
634 3300005563 Ga0068855_100845652 Ga0068855_1008456521 214
635 3300005578 Ga0068854_100529855 Ga0068854_1005298551 214
636 3300011119 Ga0105246_10018005 Ga0105246_100180054 214
637 3300014497 Ga0182008_10002405 Ga0182008_100024053 214
638 3300015262 Ga0182007_10000417 Ga0182007_1000041727 214
639 3300021388 Ga0213875_10011586 Ga0213875_100115861 214
640 3300025297 Ga0209758_1018862 Ga0209758_10188623 214
641 3300025904 Ga0207647_10012829 Ga0207647_100128292 214
642 3300025949 Ga0207667_10770070 Ga0207667_107700702 214
643 3300025981 Ga0207640_10276448 Ga0207640_102764482 214
644 3300027866 Ga0209813_10006896 Ga0209813_100068963 214
645 3300028379 Ga0268266_10114600 Ga0268266_101146002 214
646 3300028786 Ga0307517_10003383 Ga0307517_1000338314 214
647 3300028786 Ga0307517_10258779 Ga0307517_102587792 214
648 3300028794 Ga0307515_10005348 Ga0307515_100053484 214
649 3300030521 Ga0307511_10001143 Ga0307511_1000114311 214
650 3300030522 Ga0307512_10042832 Ga0307512_100428324 214
651 3300031507 Ga0307509_10007629 Ga0307509_100076296 214
652 3300031507 Ga0307509_10043365 Ga0307509_100433652 214
653 3300031507 Ga0307509_10219510 Ga0307509_102195102 214
654 3300031616 Ga0307508_10010547 Ga0307508_100105473 214
655 3300031649 Ga0307514_10009106 Ga0307514_100091068 214
656 3300031649 Ga0307514_10048682 Ga0307514_100486821 214
657 3300031649 Ga0307514_10256189 Ga0307514_102561891 214
658 3300031730 Ga0307516_10010490 Ga0307516_100104908 214
659 3300031730 Ga0307516_10028336 Ga0307516_100283362 214
660 3300031838 Ga0307518_10106213 Ga0307518_101062133 214
661 3300033179 Ga0307507_10014880 Ga0307507_100148808 214
662 3300033180 Ga0307510_10028481 Ga0307510_100284813 214
663 3300033180 Ga0307510_10044963 Ga0307510_100449632 214
664 3300037068 Ga0373925_0001802 Ga0373925_0001802_2234_2944 214
665 3300037853 Ga0436364_0773303 Ga0436364_0773303_9787_10476 214
666 3300041404 Ga0439436_0000995 Ga0439436_0000995_4193_4852 214
667 3300041406 Ga0439439_0001201 Ga0439439_0001201_337_996 214
668 3300041494 Ga0451837_0619170 Ga0451837_0619170_2281_2931 214
669 3300041512 Ga0451853_1087724 Ga0451853_1087724_1166_1810 214
670 3300041512 Ga0451853_1223385 Ga0451853_1223385_1023_1670 214
671 3300041999 Ga0439433_0001185 Ga0439433_0001185_3988_4647 214
672 3300042002 Ga0439442_024467 Ga0439442_024467_420_1067 214
673 3300042007 Ga0439449_0040989 Ga0439449_0040989_298_957 214
674 3300042007 Ga0439449_0185097 Ga0439449_0185097_61_723 214
675 3300042012 Ga0439455_0009626 Ga0439455_0009626_856_1506 214
676 3300042014 Ga0439457_026017 Ga0439457_026017_145_789 214
677 3300042014 Ga0439457_052461 Ga0439457_052461_132_791 214
678 3300042015 Ga0439462_0009705 Ga0439462_0009705_1569_2228 214
679 3300042131 Ga0450894_000226 Ga0450894_000226_2421_3065 214
680 3300042133 Ga0450896_005131 Ga0450896_005131_961_1605 214
681 3300042134 Ga0450898_000074 Ga0450898_000074_2126_2770 214
682 3300042138 Ga0450903_000479 Ga0450903_000479_3173_3823 214
683 3300042145 Ga0450906_000163 Ga0450906_000163_7125_7769 214
684 3300044656 Ga0466969_0000457 Ga0466969_0000457_13822_14484 214
685 3300044658 Ga0466972_0051678 Ga0466972_0051678_686_1336 214
686 3300044683 Ga0466965_0053650 Ga0466965_0053650_1299_1946 214
687 3300044683 Ga0466965_0109447 Ga0466965_0109447_529_1179 214
688 3300044683 Ga0466965_0135122 Ga0466965_0135122_561_1217 214
689 3300044684 Ga0466966_0032287 Ga0466966_0032287_691_1341 214
690 3300044684 Ga0466966_0123527 Ga0466966_0123527_594_1292 214
691 3300044693 Ga0466961_0003433 Ga0466961_0003433_3671_4321 214
692 3300044693 Ga0466961_0013690 Ga0466961_0013690_1181_1843 214
693 3300044694 Ga0466963_0002973 Ga0466963_0002973_7207_7857 214
694 3300044735 Ga0466968_0062563 Ga0466968_0062563_279_929 214
695 3300045049 Ga0466959_0366594 Ga0466959_0366594_45_695 214
696 3300045976 Ga0466967_0864979 Ga0466967_0864979_55_711 214
697 3300046452 Ga0495617_018522 Ga0495617_018522_1212_1862 214
698 3300046454 Ga0495592_0007389 Ga0495592_0007389_6002_6652 214
699 3300046455 Ga0495603_0010349 Ga0495603_0010349_2727_3377 214
700 3300046459 Ga0495629_0020033 Ga0495629_0020033_809_1459 214
701 3300046459 Ga0495629_0025351 Ga0495629_0025351_80_739 214
702 3300046460 Ga0495638_0019298 Ga0495638_0019298_3549_4199 214
703 3300046462 Ga0495651_0003279 Ga0495651_0003279_4793_5446 214
704 3300046462 Ga0495651_0047653 Ga0495651_0047653_1043_1693 214
705 3300046463 Ga0495653_0030171 Ga0495653_0030171_3525_4178 214
706 3300046472 Ga0495580_0184671 Ga0495580_0184671_44_697 214
707 3300046472 Ga0495580_0318087 Ga0495580_0318087_379_1029 214
708 3300046476 Ga0495662_0000196 Ga0495662_0000196_1573_2226 214
709 3300046477 Ga0495664_0003354 Ga0495664_0003354_2343_2996 214
710 3300046500 Ga0495596_0016515 Ga0495596_0016515_497_1147 214
711 3300046511 Ga0495608_0000625 Ga0495608_0000625_18734_19387 214
712 3300046512 Ga0495610_0180754 Ga0495610_0180754_20_670 214
713 3300046513 Ga0495616_0014854 Ga0495616_0014854_1138_1788 214
714 3300046514 Ga0495618_0072888 Ga0495618_0072888_1464_2114 214
715 3300046515 Ga0495620_0011287 Ga0495620_0011287_1946_2596 214
716 3300046516 Ga0495628_0016836 Ga0495628_0016836_1863_2516 214
717 3300046516 Ga0495628_0090534 Ga0495628_0090534_115_765 214
718 3300046516 Ga0495628_0158565 Ga0495628_0158565_108_758 214
719 3300046517 Ga0495630_0033272 Ga0495630_0033272_513_1166 214
720 3300046518 Ga0495631_0003384 Ga0495631_0003384_5559_6209 214
721 3300046524 Ga0495648_0099254 Ga0495648_0099254_544_1194 214
722 3300046526 Ga0495666_0002728 Ga0495666_0002728_7770_8423 214
723 3300046526 Ga0495666_0009995 Ga0495666_0009995_1676_2326 214
724 3300046529 Ga0495652_0281190 Ga0495652_0281190_40_690 214
725 3300046530 Ga0495654_0077346 Ga0495654_0077346_19_669 214
726 3300046531 Ga0495665_0005244 Ga0495665_0005244_1448_2101 214
727 3300046531 Ga0495665_0032653 Ga0495665_0032653_559_1209 214
728 3300046533 Ga0495640_0020436 Ga0495640_0020436_289_939 214
729 3300046533 Ga0495640_0042835 Ga0495640_0042835_67_720 214
730 3300046536 Ga0495587_0010861 Ga0495587_0010861_2155_2808 214
731 3300046538 Ga0495609_0010581 Ga0495609_0010581_1641_2291 214
732 3300046542 Ga0495597_0010605 Ga0495597_0010605_3699_4349 214
733 3300046543 Ga0495645_0011084 Ga0495645_0011084_3342_3995 214
734 3300046543 Ga0495645_0070401 Ga0495645_0070401_886_1551 214
735 3300046557 Ga0495622_0043034 Ga0495622_0043034_889_1539 214
736 3300046558 Ga0495633_0007334 Ga0495633_0007334_3101_3751 214
737 3300046559 Ga0495667_0016663 Ga0495667_0016663_144_797 214
738 3300046616 Ga0495668_0206862 Ga0495668_0206862_144_794 214
739 3300046642 Ga0495634_0064823 Ga0495634_0064823_529_1179 214
740 3300046642 Ga0495634_0085342 Ga0495634_0085342_553_1206 214
741 3300046648 Ga0495611_0021326 Ga0495611_0021326_629_1279 214
742 3300046663 Ga0495635_0286528 Ga0495635_0286528_164_814 214
743 3300046663 Ga0495635_0298400 Ga0495635_0298400_385_1038 214
744 3300046674 Ga0495588_0055324 Ga0495588_0055324_46_705 214
745 3300046675 Ga0495657_0026424 Ga0495657_0026424_188_838 214
746 3300046675 Ga0495657_0032482 Ga0495657_0032482_2845_3498 214
747 3300046675 Ga0495657_0237227 Ga0495657_0237227_201_851 214
748 3300046679 Ga0495623_0027238 Ga0495623_0027238_553_1206 214
749 3300046680 Ga0495646_0046051 Ga0495646_0046051_1584_2237 214
750 3300046680 Ga0495646_0144775 Ga0495646_0144775_622_1272 214
751 3300046689 Ga0495613_0006111 Ga0495613_0006111_4832_5485 214
752 3300046689 Ga0495613_0045156 Ga0495613_0045156_1003_1662 214
753 3300046689 Ga0495613_0301722 Ga0495613_0301722_204_854 214
754 3300046689 Ga0495613_0303607 Ga0495613_0303607_200_850 214
755 3300046690 Ga0495624_0177528 Ga0495624_0177528_414_1064 214
756 3300046692 Ga0495671_0016204 Ga0495671_0016204_693_1355 214
757 3300046694 Ga0495649_0027568 Ga0495649_0027568_1409_2056 214
758 3300046694 Ga0495649_0145680 Ga0495649_0145680_21_671 214
759 3300046794 Ga0495589_0012578 Ga0495589_0012578_22_681 214
760 3300046794 Ga0495589_0087324 Ga0495589_0087324_403_1053 214
761 3300046809 Ga0495600_0028042 Ga0495600_0028042_2845_3498 214
762 3300046810 Ga0495660_0107029 Ga0495660_0107029_365_1015 214
763 3300047315 Ga0495581_0131963 Ga0495581_0131963_345_998 214
764 3300047315 Ga0495581_0260869 Ga0495581_0260869_152_802 214
765 3300047317 Ga0495604_0003563 Ga0495604_0003563_4793_5446 214
766 3300047317 Ga0495604_0031810 Ga0495604_0031810_3381_4031 214
767 3300047318 Ga0495636_0039985 Ga0495636_0039985_1033_1692 214
768 3300047318 Ga0495636_0108364 Ga0495636_0108364_477_1136 214
769 3300047318 Ga0495636_0211322 Ga0495636_0211322_174_833 214
770 3300047319 Ga0495674_0796852 Ga0495674_0796852_45_695 214
771 3300047321 Ga0495676_0012595 Ga0495676_0012595_4061_4711 214
772 3300047322 Ga0495680_0028924 Ga0495680_0028924_1234_1884 214
773 3300047443 Ga0495687_001803 Ga0495687_001803_8014_8673 214
774 3300047443 Ga0495687_026958 Ga0495687_026958_575_1237 214
775 3300047443 Ga0495687_129842 Ga0495687_129842_38_685 214
776 3300047443 Ga0495687_145491 Ga0495687_145491_54_710 214
777 3300047444 Ga0495675_0004281 Ga0495675_0004281_5104_5769 214
778 3300047444 Ga0495675_0018761 Ga0495675_0018761_72_725 214
779 3300047444 Ga0495675_0385450 Ga0495675_0385450_103_753 214
780 3300047445 Ga0495677_0138177 Ga0495677_0138177_46_699 214
781 3300047447 Ga0495685_037134 Ga0495685_037134_909_1568 214
782 3300047447 Ga0495685_106267 Ga0495685_106267_255_905 214
783 3300047470 Ga0495681_0001329 Ga0495681_0001329_17982_18641 214
784 3300047470 Ga0495681_0017652 Ga0495681_0017652_3227_3877 214
785 3300047471 Ga0495684_0262418 Ga0495684_0262418_215_868 214
786 3300047472 Ga0495686_0359710 Ga0495686_0359710_78_725 214
787 3300048089 Ga0495614_0001624 Ga0495614_0001624_3959_4618 214
788 3300048089 Ga0495614_0056364 Ga0495614_0056364_235_885 214
789 3300049459 Ga0495678_021898 Ga0495678_021898_1612_2262 214
790 3300049460 Ga0495682_0052774 Ga0495682_0052774_205_855 214
791 3300049568 Ga0501031_0067105 Ga0501031_0067105_1432_2082 214
792 3300049569 Ga0501032_0146868 Ga0501032_0146868_744_1403 214
793 3300049570 Ga0501033_0001301 Ga0501033_0001301_19052_19711 214
794 3300049571 Ga0501034_0001622 Ga0501034_0001622_24488_25147 214
795 3300049571 Ga0501034_0055492 Ga0501034_0055492_2331_2987 214
796 3300049572 Ga0501036_0003801 Ga0501036_0003801_5520_6179 214
797 3300049572 Ga0501036_0018744 Ga0501036_0018744_1583_2242 214
798 3300049573 Ga0501037_0002340 Ga0501037_0002340_9202_9852 214
799 3300049573 Ga0501037_0013307 Ga0501037_0013307_2129_2923 214
800 3300049573 Ga0501037_0593406 Ga0501037_0593406_74_724 214
801 3300049574 Ga0501038_0008418 Ga0501038_0008418_5213_5869 214
802 3300049574 Ga0501038_0021101 Ga0501038_0021101_1429_2088 214
803 3300049575 Ga0501039_0013778 Ga0501039_0013778_1472_2131 214
804 3300049578 Ga0501042_0048952 Ga0501042_0048952_2040_2690 214
805 3300049579 Ga0501043_0001089 Ga0501043_0001089_22883_23542 214
806 3300049579 Ga0501043_0031502 Ga0501043_0031502_2337_2987 214
807 3300049579 Ga0501043_0052024 Ga0501043_0052024_1119_1775 214
808 3300049580 Ga0501046_0015796 Ga0501046_0015796_1908_2558 214
809 3300049581 Ga0501047_0000309 Ga0501047_0000309_10942_11736 214
810 3300049581 Ga0501047_0015678 Ga0501047_0015678_4304_4960 214
811 3300049581 Ga0501047_0018162 Ga0501047_0018162_1489_2163 214
812 3300049581 Ga0501047_0148312 Ga0501047_0148312_879_1538 214
813 3300049581 Ga0501047_0173390 Ga0501047_0173390_829_1479 214
814 3300049581 Ga0501047_0291203 Ga0501047_0291203_375_1025 214
815 3300049582 Ga0501048_0016728 Ga0501048_0016728_2360_3010 214
816 3300049585 Ga0501069_0196515 Ga0501069_0196515_262_921 214
817 3300049586 Ga0501070_0000441 Ga0501070_0000441_22486_23145 214
818 3300049587 Ga0501071_0024174 Ga0501071_0024174_316_990 214
819 3300049589 Ga0501073_0066827 Ga0501073_0066827_781_1440 214
820 3300049590 Ga0501074_0026677 Ga0501074_0026677_1499_2158 214
821 3300049742 Ga0501080_0084922 Ga0501080_0084922_46_720 214
822 3300049822 Ga0501035_0002876 Ga0501035_0002876_14041_14715 214
823 3300049822 Ga0501035_0034183 Ga0501035_0034183_2304_2954 214
824 3300049822 Ga0501035_0064529 Ga0501035_0064529_2112_2768 214
825 3300049823 Ga0501044_0013506 Ga0501044_0013506_4784_5458 214
826 3300049823 Ga0501044_0022495 Ga0501044_0022495_4559_5209 214
827 3300049823 Ga0501044_0088729 Ga0501044_0088729_864_1523 214
828 3300049823 Ga0501044_0196420 Ga0501044_0196420_1246_1896 214
829 3300049823 Ga0501044_0373078 Ga0501044_0373078_175_834 214
830 3300050490 nmdc:mga03n38_107831_c1 nmdc:mga03n38_107831_c1_632_1282 214
831 3300050495 nmdc:mga04h51_8038_c1 nmdc:mga04h51_8038_c1_712_1371 214
832 3300053077 Ga0495601_0210752 Ga0495601_0210752_56_709 214
833 3300053088 Ga0500644_0014080 Ga0500644_0014080_413_1075 214
834 3300053107 Ga0500560_000508 Ga0500560_000508_1290_1949 214
835 3300053149 Ga0500600_0042669 Ga0500600_0042669_583_1233 214
836 3300054114 Ga0501084_0885665 Ga0501084_0885665_45_695 214
837 3300060353 Ga0501082_0018213 Ga0501082_0018213_675_1349 214
838 3300061719 Ga0466962_0128867 Ga0466962_0128867_423_1070 214
839 iso_pu_bacteria 2862507626 2862512527 214
840 iso_pu_bacteria 2867428634 2867432926 214
841 iso_pu_bacteria 2954002825 2954004373 214
842 iso_pu_bacteria 2997600082 2997606603 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

37

218

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o63-assembly1.cif.gz_A-2 crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis 0.9429 5 214
3o63-assembly2.cif.gz_B-3 crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis 0.9428 5 214
3o63-assembly2.cif.gz_B-3 crystal structure of thiamin phosphate synthase from mycobacterium tuberculosis 0.9295 5 214
1xi3-assembly1.cif.gz_B thiamine phosphate pyrophosphorylase from pyrococcus furiosus pfu-1255191-001 0.9176 6 213
1g4p-assembly2.cif.gz_B thiamin phosphate synthase 0.9088 8 213
ID Description Score Start End Superfamily
3o63B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9428 5 214 3.20.20.70
3o63B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9295 5 214 3.20.20.70
1xi3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9176 6 213 3.20.20.70
af_P40386_1_220_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9138 10 211 3.20.20.70
af_Q5AEJ1_1_231_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9122 12 211 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W7BUZ3-F1-model_v4 deleted 0.9982 2 213
AF-A0A6B1JU72-F1-model_v4 deleted 0.9981 2 193
AF-A0A1D8FZ67-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9977 4 213 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A2W2EZA4-F1-model_v4 Thiamine-phosphate synthase (TP synthase) (TPS) (EC 2.5.1.3) (Thiamine-phosphate pyrophosphorylase) (TMP pyrophosphorylase) (TMP-PPase) 0.9952 8 214 GO:0000287
GO:0004789
GO:0005737
GO:0009228
GO:0009229
AF-A0A429ULY0-F1-model_v4 deleted 0.9951 4 136

Feature Viewer

pLDDT pTM Quality
95.46 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map