F483108
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 841 | 267 | 841 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0004353|Ga0501040_0004353_6067_6942 |
| Length | 291 |
| Sequence | VPELPDVELYLERLAPLVLDRPLERLRVASPFLVRTVDPPLGDLEGRRVVGLRRLGKRLVIELEGDLFLVLHLMVAGRLRWRERGAAVPGRVGLAAFDFPAGTLLLTEAGTKKRASLHAVRGAEGVRAFDRGGLEPLAADLDAFRDALLRENRTLKGALTDPRLFSGIGNAYADEILHRARLSPLRLTRRLTPADVERLHRAARDTLAHWLDRLRRETEGFPEKVTAFRPGMAVHGRYGQPCPDCGAPVQRIVHADNETNYCARCQTGGRLLADRALSRLLRKDWPAKLDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 198 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 202 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 205 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 221 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 222 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 223 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 224 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 225 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 226 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.97 |
| Rhizosphere | 95.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10092327 | 3300003316 | Bacteria | 2576 |
| 2 | Ga0065712_10001235 | 3300005290 | Bacteria | 11731 |
| 3 | Ga0065712_10075702 | 3300005290 | Bacteria | 3805 |
| 4 | Ga0065715_10174411 | 3300005293 | Bacteria | 1485 |
| 5 | Ga0065715_10218435 | 3300005293 | Bacteria | 1282 |
| 6 | Ga0065715_10323265 | 3300005293 | Bacteria | 998 |
| 7 | Ga0065707_10182615 | 3300005295 | Bacteria | 1409 |
| 8 | Ga0065707_10195218 | 3300005295 | Bacteria | 1322 |
| 9 | Ga0070676_10000044 | 3300005328 | Bacteria | 38502 |
| 10 | Ga0070676_10055753 | 3300005328 | Bacteria | 2333 |
| 11 | Ga0070683_100000860 | 3300005329 | Bacteria | 22454 |
| 12 | Ga0070683_100006984 | 3300005329 | Bacteria | 9500 |
| 13 | Ga0070683_100016102 | 3300005329 | Bacteria | 6582 |
| 14 | Ga0070683_100024856 | 3300005329 | Bacteria | 5371 |
| 15 | Ga0070683_100046381 | 3300005329 | Bacteria | 4015 |
| 16 | Ga0070683_100070997 | 3300005329 | Bacteria | 3249 |
| 17 | Ga0070683_100186958 | 3300005329 | Bacteria | 1967 |
| 18 | Ga0070690_100000115 | 3300005330 | Bacteria | 42075 |
| 19 | Ga0070690_100007942 | 3300005330 | Bacteria | 6091 |
| 20 | Ga0070690_100054046 | 3300005330 | Bacteria | 2570 |
| 21 | Ga0070690_100147769 | 3300005330 | Bacteria | 1601 |
| 22 | Ga0070690_100265974 | 3300005330 | Bacteria | 1218 |
| 23 | Ga0070670_100000440 | 3300005331 | Bacteria | 33924 |
| 24 | Ga0070670_100002718 | 3300005331 | Bacteria | 14606 |
| 25 | Ga0070670_100016837 | 3300005331 | Bacteria | 6274 |
| 26 | Ga0070670_100068774 | 3300005331 | Unclassified | 3040 |
| 27 | Ga0070677_10000321 | 3300005333 | Bacteria | 16729 |
| 28 | Ga0068869_100000129 | 3300005334 | Bacteria | 36610 |
| 29 | Ga0068869_100000231 | 3300005334 | Bacteria | 29332 |
| 30 | Ga0068869_100008317 | 3300005334 | Bacteria | 6687 |
| 31 | Ga0070666_10000277 | 3300005335 | Bacteria | 33924 |
| 32 | Ga0070666_10037238 | 3300005335 | Bacteria | 3234 |
| 33 | Ga0070680_100005081 | 3300005336 | Bacteria | 9926 |
| 34 | Ga0070680_100041457 | 3300005336 | Bacteria | 3733 |
| 35 | Ga0070680_100253975 | 3300005336 | Bacteria | 1487 |
| 36 | Ga0070682_100002665 | 3300005337 | Bacteria | 9865 |
| 37 | Ga0070682_100032795 | 3300005337 | Bacteria | 3152 |
| 38 | Ga0068868_100000812 | 3300005338 | Bacteria | 21172 |
| 39 | Ga0068868_100035807 | 3300005338 | Bacteria | 3838 |
| 40 | Ga0068868_100103173 | 3300005338 | Bacteria | 2310 |
| 41 | Ga0068868_100348843 | 3300005338 | Bacteria | 1267 |
| 42 | Ga0070660_100000052 | 3300005339 | Bacteria | 68022 |
| 43 | Ga0070660_100002606 | 3300005339 | Bacteria | 12381 |
| 44 | Ga0070660_100057761 | 3300005339 | Bacteria | 3007 |
| 45 | Ga0070689_100000089 | 3300005340 | Bacteria | 52483 |
| 46 | Ga0070689_100016053 | 3300005340 | Bacteria | 5477 |
| 47 | Ga0070689_100016352 | 3300005340 | Bacteria | 5429 |
| 48 | Ga0070689_100059971 | 3300005340 | Bacteria | 2957 |
| 49 | Ga0070691_10055894 | 3300005341 | Bacteria | 1891 |
| 50 | Ga0070687_100000046 | 3300005343 | Bacteria | 39050 |
| 51 | Ga0070687_100011700 | 3300005343 | Bacteria | 3849 |
| 52 | Ga0070661_100000932 | 3300005344 | Bacteria | 20930 |
| 53 | Ga0070661_100005995 | 3300005344 | Bacteria | 8365 |
| 54 | Ga0070661_100006204 | 3300005344 | Bacteria | 8242 |
| 55 | Ga0070661_100082666 | 3300005344 | Bacteria | 2372 |
| 56 | Ga0070661_100240985 | 3300005344 | Bacteria | 1392 |
| 57 | Ga0070692_10000429 | 3300005345 | Bacteria | 12747 |
| 58 | Ga0070692_10006253 | 3300005345 | Bacteria | 5158 |
| 59 | Ga0070692_10012704 | 3300005345 | Bacteria | 3908 |
| 60 | Ga0070692_10036909 | 3300005345 | Bacteria | 2482 |
| 61 | Ga0070668_100001886 | 3300005347 | Bacteria | 15324 |
| 62 | Ga0070668_100001956 | 3300005347 | Bacteria | 15030 |
| 63 | Ga0070668_100146173 | 3300005347 | Bacteria | 1908 |
| 64 | Ga0070669_100000477 | 3300005353 | Bacteria | 30375 |
| 65 | Ga0070669_100004675 | 3300005353 | Bacteria | 9882 |
| 66 | Ga0070669_100008083 | 3300005353 | Bacteria | 7516 |
| 67 | Ga0070669_100011442 | 3300005353 | Bacteria | 6299 |
| 68 | Ga0070669_100047644 | 3300005353 | Bacteria | 3127 |
| 69 | Ga0070675_100000114 | 3300005354 | Bacteria | 47091 |
| 70 | Ga0070675_100005509 | 3300005354 | Bacteria | 9687 |
| 71 | Ga0070675_100076866 | 3300005354 | Bacteria | 2778 |
| 72 | Ga0070675_100107032 | 3300005354 | Bacteria | 2361 |
| 73 | Ga0070671_100000284 | 3300005355 | Bacteria | 34431 |
| 74 | Ga0070671_100001522 | 3300005355 | Bacteria | 17395 |
| 75 | Ga0070671_100006915 | 3300005355 | Bacteria | 9086 |
| 76 | Ga0070671_100097544 | 3300005355 | Bacteria | 2465 |
| 77 | Ga0070674_100000067 | 3300005356 | Bacteria | 47588 |
| 78 | Ga0070674_100000516 | 3300005356 | Bacteria | 19392 |
| 79 | Ga0070673_100000108 | 3300005364 | Bacteria | 37855 |
| 80 | Ga0070673_100011700 | 3300005364 | Bacteria | 5998 |
| 81 | Ga0070673_100026030 | 3300005364 | Bacteria | 4315 |
| 82 | Ga0070673_100094254 | 3300005364 | Bacteria | 2454 |
| 83 | Ga0070673_100103712 | 3300005364 | Bacteria | 2347 |
| 84 | Ga0070688_100000035 | 3300005365 | Bacteria | 62234 |
| 85 | Ga0070688_100005046 | 3300005365 | Bacteria | 6914 |
| 86 | Ga0070688_100110004 | 3300005365 | Bacteria | 1831 |
| 87 | Ga0070688_100110010 | 3300005365 | Bacteria | 1831 |
| 88 | Ga0070688_100134690 | 3300005365 | Bacteria | 1671 |
| 89 | Ga0070688_100232576 | 3300005365 | Bacteria | 1305 |
| 90 | Ga0070659_100000369 | 3300005366 | Bacteria | 33924 |
| 91 | Ga0070659_100052790 | 3300005366 | Bacteria | 3198 |
| 92 | Ga0070659_100171398 | 3300005366 | Bacteria | 1778 |
| 93 | Ga0070667_100000478 | 3300005367 | Bacteria | 41066 |
| 94 | Ga0070667_100015673 | 3300005367 | Bacteria | 6266 |
| 95 | Ga0070667_100038314 | 3300005367 | Bacteria | 4019 |
| 96 | Ga0070667_100079407 | 3300005367 | Bacteria | 2805 |
| 97 | Ga0070701_10000234 | 3300005438 | Bacteria | 17676 |
| 98 | Ga0070701_10002593 | 3300005438 | Bacteria | 7001 |
| 99 | Ga0070701_10085221 | 3300005438 | Bacteria | 1720 |
| 100 | Ga0070701_10113673 | 3300005438 | Bacteria | 1516 |
| 101 | Ga0070701_10165500 | 3300005438 | Bacteria | 1284 |
| 102 | Ga0070705_100000267 | 3300005440 | Bacteria | 31449 |
| 103 | Ga0070705_100001707 | 3300005440 | Bacteria | 11442 |
| 104 | Ga0070705_100004213 | 3300005440 | Bacteria | 7022 |
| 105 | Ga0070705_100035112 | 3300005440 | Bacteria | 2808 |
| 106 | Ga0070705_100292877 | 3300005440 | Bacteria | 1163 |
| 107 | Ga0070700_100000247 | 3300005441 | Bacteria | 29520 |
| 108 | Ga0070700_100003776 | 3300005441 | Bacteria | 7839 |
| 109 | Ga0070700_100070199 | 3300005441 | Bacteria | 2233 |
| 110 | Ga0070694_100000036 | 3300005444 | Bacteria | 61430 |
| 111 | Ga0070694_100034242 | 3300005444 | Bacteria | 3348 |
| 112 | Ga0070694_100067985 | 3300005444 | Bacteria | 2447 |
| 113 | Ga0070694_100082418 | 3300005444 | Bacteria | 2240 |
| 114 | Ga0070694_100156721 | 3300005444 | Bacteria | 1667 |
| 115 | Ga0070694_100198603 | 3300005444 | Bacteria | 1494 |
| 116 | Ga0070694_100363470 | 3300005444 | Bacteria | 1124 |
| 117 | Ga0070708_100079116 | 3300005445 | Bacteria | 2974 |
| 118 | Ga0070708_100214266 | 3300005445 | Bacteria | 1805 |
| 119 | Ga0070708_100290690 | 3300005445 | Bacteria | 1538 |
| 120 | Ga0070663_100011308 | 3300005455 | Bacteria | 5597 |
| 121 | Ga0070663_100014725 | 3300005455 | Bacteria | 5027 |
| 122 | Ga0070663_100141728 | 3300005455 | Bacteria | 1836 |
| 123 | Ga0070678_100000162 | 3300005456 | Bacteria | 28234 |
| 124 | Ga0070678_100003327 | 3300005456 | Bacteria | 8946 |
| 125 | Ga0070678_100008129 | 3300005456 | Bacteria | 6268 |
| 126 | Ga0070678_100203397 | 3300005456 | Bacteria | 1636 |
| 127 | Ga0070662_100000106 | 3300005457 | Bacteria | 46076 |
| 128 | Ga0070662_100000261 | 3300005457 | Bacteria | 31212 |
| 129 | Ga0070662_100032632 | 3300005457 | Bacteria | 3660 |
| 130 | Ga0070662_100254843 | 3300005457 | Bacteria | 1412 |
| 131 | Ga0070681_10013470 | 3300005458 | Bacteria | 8126 |
| 132 | Ga0070681_10022472 | 3300005458 | Bacteria | 6333 |
| 133 | Ga0070681_10124115 | 3300005458 | Bacteria | 2515 |
| 134 | Ga0068867_100000105 | 3300005459 | Bacteria | 53757 |
| 135 | Ga0068867_100000316 | 3300005459 | Bacteria | 31942 |
| 136 | Ga0068867_100000414 | 3300005459 | Bacteria | 28602 |
| 137 | Ga0070685_10000242 | 3300005466 | Bacteria | 35649 |
| 138 | Ga0070685_10288774 | 3300005466 | Bacteria | 1101 |
| 139 | Ga0070706_100010107 | 3300005467 | Bacteria | 8771 |
| 140 | Ga0070706_100017608 | 3300005467 | Bacteria | 6593 |
| 141 | Ga0070706_100267495 | 3300005467 | Bacteria | 1595 |
| 142 | Ga0070707_100037852 | 3300005468 | Bacteria | 4606 |
| 143 | Ga0070707_100088448 | 3300005468 | Bacteria | 2996 |
| 144 | Ga0070707_100186097 | 3300005468 | Bacteria | 2025 |
| 145 | Ga0070698_100144213 | 3300005471 | Bacteria | 2331 |
| 146 | Ga0070698_100254357 | 3300005471 | Bacteria | 1689 |
| 147 | Ga0070699_100000003 | 3300005518 | Bacteria | 418047 |
| 148 | Ga0070699_100005646 | 3300005518 | Bacteria | 10957 |
| 149 | Ga0070699_100010504 | 3300005518 | Bacteria | 8010 |
| 150 | Ga0070699_100014136 | 3300005518 | Bacteria | 6867 |
| 151 | Ga0070699_100028835 | 3300005518 | Bacteria | 4785 |
| 152 | Ga0070699_100079035 | 3300005518 | Bacteria | 2865 |
| 153 | Ga0070699_100228616 | 3300005518 | Bacteria | 1659 |
| 154 | Ga0070699_100232920 | 3300005518 | Bacteria | 1642 |
| 155 | Ga0070699_100574851 | 3300005518 | Bacteria | 1027 |
| 156 | Ga0070679_100002944 | 3300005530 | Bacteria | 15511 |
| 157 | Ga0070679_100035189 | 3300005530 | Bacteria | 4968 |
| 158 | Ga0070679_100283164 | 3300005530 | Bacteria | 1610 |
| 159 | Ga0070684_100000380 | 3300005535 | Bacteria | 30791 |
| 160 | Ga0070684_100000962 | 3300005535 | Bacteria | 20525 |
| 161 | Ga0070684_100024751 | 3300005535 | Bacteria | 5039 |
| 162 | Ga0070684_100100398 | 3300005535 | Bacteria | 2584 |
| 163 | Ga0070697_100000676 | 3300005536 | Bacteria | 25620 |
| 164 | Ga0070697_100033537 | 3300005536 | Bacteria | 4135 |
| 165 | Ga0070697_100055484 | 3300005536 | Bacteria | 3221 |
| 166 | Ga0070697_100100621 | 3300005536 | Bacteria | 2401 |
| 167 | Ga0070697_100111617 | 3300005536 | Bacteria | 2279 |
| 168 | Ga0070697_100120907 | 3300005536 | Bacteria | 2190 |
| 169 | Ga0070697_100169138 | 3300005536 | Bacteria | 1849 |
| 170 | Ga0068853_100000288 | 3300005539 | Bacteria | 35623 |
| 171 | Ga0068853_100014900 | 3300005539 | Bacteria | 6385 |
| 172 | Ga0068853_100032766 | 3300005539 | Bacteria | 4404 |
| 173 | Ga0070672_100000076 | 3300005543 | Bacteria | 45960 |
| 174 | Ga0070672_100004256 | 3300005543 | Bacteria | 9358 |
| 175 | Ga0070672_100035559 | 3300005543 | Bacteria | 3787 |
| 176 | Ga0070672_100086209 | 3300005543 | Bacteria | 2525 |
| 177 | Ga0070672_100190633 | 3300005543 | Bacteria | 1711 |
| 178 | Ga0070686_100000368 | 3300005544 | Bacteria | 28655 |
| 179 | Ga0070686_100001922 | 3300005544 | Bacteria | 11551 |
| 180 | Ga0070686_100037390 | 3300005544 | Bacteria | 3011 |
| 181 | Ga0070686_100046575 | 3300005544 | Bacteria | 2737 |
| 182 | Ga0070686_100153439 | 3300005544 | Bacteria | 1615 |
| 183 | Ga0070695_100004579 | 3300005545 | Bacteria | 8112 |
| 184 | Ga0070695_100025572 | 3300005545 | Bacteria | 3647 |
| 185 | Ga0070695_100222275 | 3300005545 | Bacteria | 1361 |
| 186 | Ga0070695_100344481 | 3300005545 | Bacteria | 1115 |
| 187 | Ga0070696_100008223 | 3300005546 | Bacteria | 6982 |
| 188 | Ga0070696_100008545 | 3300005546 | Bacteria | 6852 |
| 189 | Ga0070696_100009243 | 3300005546 | Bacteria | 6599 |
| 190 | Ga0070696_100021901 | 3300005546 | Bacteria | 4336 |
| 191 | Ga0070696_100029142 | 3300005546 | Bacteria | 3770 |
| 192 | Ga0070696_100074760 | 3300005546 | Bacteria | 2390 |
| 193 | Ga0070693_100027964 | 3300005547 | Bacteria | 3062 |
| 194 | Ga0070665_100001106 | 3300005548 | Bacteria | 33278 |
| 195 | Ga0070704_100003479 | 3300005549 | Bacteria | 9041 |
| 196 | Ga0070704_100087937 | 3300005549 | Bacteria | 2307 |
| 197 | Ga0068855_100000202 | 3300005563 | Bacteria | 76682 |
| 198 | Ga0068855_100038538 | 3300005563 | Bacteria | 5679 |
| 199 | Ga0068855_100093825 | 3300005563 | Bacteria | 3461 |
| 200 | Ga0070664_100000353 | 3300005564 | Bacteria | 33733 |
| 201 | Ga0070664_100000533 | 3300005564 | Bacteria | 29057 |
| 202 | Ga0070664_100008556 | 3300005564 | Bacteria | 8278 |
| 203 | Ga0070664_100019574 | 3300005564 | Bacteria | 5570 |
| 204 | Ga0070664_100159087 | 3300005564 | Bacteria | 1997 |
| 205 | Ga0068857_100002680 | 3300005577 | Bacteria | 14624 |
| 206 | Ga0068857_100011983 | 3300005577 | Bacteria | 7542 |
| 207 | Ga0068857_100025161 | 3300005577 | Bacteria | 5241 |
| 208 | Ga0068857_100148705 | 3300005577 | Bacteria | 2121 |
| 209 | Ga0068854_100000154 | 3300005578 | Bacteria | 46923 |
| 210 | Ga0068854_100017526 | 3300005578 | Bacteria | 4792 |
| 211 | Ga0068854_100074637 | 3300005578 | Bacteria | 2488 |
| 212 | Ga0068856_100001685 | 3300005614 | Bacteria | 23109 |
| 213 | Ga0070702_100000069 | 3300005615 | Bacteria | 28968 |
| 214 | Ga0070702_100005235 | 3300005615 | Bacteria | 6015 |
| 215 | Ga0070702_100078389 | 3300005615 | Bacteria | 1972 |
| 216 | Ga0068852_100000109 | 3300005616 | Bacteria | 55376 |
| 217 | Ga0068852_100026111 | 3300005616 | Bacteria | 4742 |
| 218 | Ga0068852_100066024 | 3300005616 | Bacteria | 3159 |
| 219 | Ga0068859_100049514 | 3300005617 | Bacteria | 4219 |
| 220 | Ga0068859_100074998 | 3300005617 | Bacteria | 3422 |
| 221 | Ga0068859_100091401 | 3300005617 | Bacteria | 3094 |
| 222 | Ga0068859_100190120 | 3300005617 | Bacteria | 2137 |
| 223 | Ga0068864_100000374 | 3300005618 | Bacteria | 39012 |
| 224 | Ga0068864_100007605 | 3300005618 | Bacteria | 8923 |
| 225 | Ga0068864_100316586 | 3300005618 | Bacteria | 1464 |
| 226 | Ga0068866_10000059 | 3300005718 | Bacteria | 43112 |
| 227 | Ga0068866_10000089 | 3300005718 | Bacteria | 37940 |
| 228 | Ga0068866_10000436 | 3300005718 | Bacteria | 19322 |
| 229 | Ga0068861_100000059 | 3300005719 | Bacteria | 52167 |
| 230 | Ga0068861_100003296 | 3300005719 | Bacteria | 10682 |
| 231 | Ga0068861_100006973 | 3300005719 | Bacteria | 7718 |
| 232 | Ga0068861_100008684 | 3300005719 | Bacteria | 6989 |
| 233 | Ga0068861_100148810 | 3300005719 | Bacteria | 1919 |
| 234 | Ga0068861_100312945 | 3300005719 | Bacteria | 1365 |
| 235 | Ga0068851_10000065 | 3300005834 | Bacteria | 58958 |
| 236 | Ga0068851_10012877 | 3300005834 | Bacteria | 3951 |
| 237 | Ga0068870_10000327 | 3300005840 | Bacteria | 17695 |
| 238 | Ga0068870_10006716 | 3300005840 | Bacteria | 5093 |
| 239 | Ga0068870_10068220 | 3300005840 | Bacteria | 1931 |
| 240 | Ga0068863_100001278 | 3300005841 | Bacteria | 25108 |
| 241 | Ga0068863_100016732 | 3300005841 | Bacteria | 7036 |
| 242 | Ga0068863_100046442 | 3300005841 | Bacteria | 4122 |
| 243 | Ga0068863_100199577 | 3300005841 | Bacteria | 1924 |
| 244 | Ga0068863_100756392 | 3300005841 | Bacteria | 968 |
| 245 | Ga0068858_100000496 | 3300005842 | Bacteria | 41146 |
| 246 | Ga0068858_100000680 | 3300005842 | Bacteria | 35434 |
| 247 | Ga0068858_100009116 | 3300005842 | Bacteria | 9488 |
| 248 | Ga0068858_100091311 | 3300005842 | Bacteria | 2834 |
| 249 | Ga0068860_100000483 | 3300005843 | Bacteria | 49359 |
| 250 | Ga0068860_100002818 | 3300005843 | Bacteria | 18080 |
| 251 | Ga0068860_100007920 | 3300005843 | Bacteria | 10604 |
| 252 | Ga0068860_100014859 | 3300005843 | Bacteria | 7613 |
| 253 | Ga0068860_100025657 | 3300005843 | Bacteria | 5684 |
| 254 | Ga0068860_100047080 | 3300005843 | Bacteria | 4110 |
| 255 | Ga0068860_100119133 | 3300005843 | Bacteria | 2527 |
| 256 | Ga0068862_100000523 | 3300005844 | Bacteria | 40565 |
| 257 | Ga0068862_100017232 | 3300005844 | Bacteria | 6012 |
| 258 | Ga0068862_100019127 | 3300005844 | Bacteria | 5711 |
| 259 | Ga0068862_100035561 | 3300005844 | Bacteria | 4220 |
| 260 | Ga0068862_100104689 | 3300005844 | Bacteria | 2479 |
| 261 | Ga0068862_100182069 | 3300005844 | Bacteria | 1886 |
| 262 | Ga0081540_1000298 | 3300005983 | Bacteria | 51452 |
| 263 | Ga0081540_1007881 | 3300005983 | Bacteria | 7525 |
| 264 | Ga0097621_100000831 | 3300006237 | Bacteria | 21816 |
| 265 | Ga0097621_100010143 | 3300006237 | Bacteria | 6877 |
| 266 | Ga0097621_100017185 | 3300006237 | Bacteria | 5490 |
| 267 | Ga0097621_100077266 | 3300006237 | Bacteria | 2763 |
| 268 | Ga0068871_100004079 | 3300006358 | Bacteria | 10105 |
| 269 | Ga0068871_100004948 | 3300006358 | Bacteria | 9307 |
| 270 | Ga0068871_100126138 | 3300006358 | Bacteria | 2167 |
| 271 | Ga0068871_100369402 | 3300006358 | Bacteria | 1272 |
| 272 | Ga0075428_100021190 | 3300006844 | Bacteria | 7197 |
| 273 | Ga0075428_100064929 | 3300006844 | Bacteria | 3998 |
| 274 | Ga0075428_100119830 | 3300006844 | Bacteria | 2864 |
| 275 | Ga0075428_100298887 | 3300006844 | Bacteria | 1731 |
| 276 | Ga0075428_100355877 | 3300006844 | Bacteria | 1571 |
| 277 | Ga0075428_100555835 | 3300006844 | Unclassified | 1227 |
| 278 | Ga0075430_100017795 | 3300006846 | Bacteria | 6050 |
| 279 | Ga0075430_100020970 | 3300006846 | Bacteria | 5555 |
| 280 | Ga0075430_100034643 | 3300006846 | Bacteria | 4286 |
| 281 | Ga0075430_100046158 | 3300006846 | Bacteria | 3679 |
| 282 | Ga0075430_100085726 | 3300006846 | Bacteria | 2637 |
| 283 | Ga0075430_100132371 | 3300006846 | Bacteria | 2078 |
| 284 | Ga0075430_100136911 | 3300006846 | Bacteria | 2040 |
| 285 | Ga0075430_100149274 | 3300006846 | Bacteria | 1946 |
| 286 | Ga0075431_100016053 | 3300006847 | Bacteria | 7600 |
| 287 | Ga0075431_100016795 | 3300006847 | Bacteria | 7435 |
| 288 | Ga0075431_100021860 | 3300006847 | Bacteria | 6540 |
| 289 | Ga0075431_100063294 | 3300006847 | Bacteria | 3817 |
| 290 | Ga0075431_100072276 | 3300006847 | Bacteria | 3560 |
| 291 | Ga0075431_100090296 | 3300006847 | Bacteria | 3162 |
| 292 | Ga0075431_100325759 | 3300006847 | Bacteria | 1548 |
| 293 | Ga0075431_100361018 | 3300006847 | Bacteria | 1459 |
| 294 | Ga0075431_100415083 | 3300006847 | Bacteria | 1346 |
| 295 | Ga0075433_10001841 | 3300006852 | Bacteria | 15928 |
| 296 | Ga0075433_10013820 | 3300006852 | Bacteria | 6581 |
| 297 | Ga0075433_10014676 | 3300006852 | Bacteria | 6408 |
| 298 | Ga0075433_10018829 | 3300006852 | Bacteria | 5746 |
| 299 | Ga0075433_10018948 | 3300006852 | Bacteria | 5728 |
| 300 | Ga0075433_10022793 | 3300006852 | Bacteria | 5261 |
| 301 | Ga0075433_10271427 | 3300006852 | Unclassified | 1503 |
| 302 | Ga0075434_100001524 | 3300006871 | Bacteria | 19574 |
| 303 | Ga0075434_100006981 | 3300006871 | Bacteria | 10409 |
| 304 | Ga0075434_100040841 | 3300006871 | Bacteria | 4594 |
| 305 | Ga0075434_100042354 | 3300006871 | Bacteria | 4514 |
| 306 | Ga0075434_100084435 | 3300006871 | Bacteria | 3174 |
| 307 | Ga0075434_100333652 | 3300006871 | Bacteria | 1537 |
| 308 | Ga0075429_100064517 | 3300006880 | Bacteria | 3189 |
| 309 | Ga0075429_100073997 | 3300006880 | Bacteria | 2967 |
| 310 | Ga0075429_100120000 | 3300006880 | Bacteria | 2298 |
| 311 | Ga0075429_100241580 | 3300006880 | Bacteria | 1582 |
| 312 | Ga0075429_100293680 | 3300006880 | Bacteria | 1423 |
| 313 | Ga0068865_100000080 | 3300006881 | Bacteria | 51324 |
| 314 | Ga0068865_100000304 | 3300006881 | Bacteria | 27162 |
| 315 | Ga0068865_100002537 | 3300006881 | Bacteria | 10819 |
| 316 | Ga0068865_100085680 | 3300006881 | Bacteria | 2273 |
| 317 | Ga0075436_100018848 | 3300006914 | Bacteria | 4725 |
| 318 | Ga0097620_100049515 | 3300006931 | Bacteria | 4219 |
| 319 | Ga0097620_100074996 | 3300006931 | Bacteria | 3422 |
| 320 | Ga0097620_100091396 | 3300006931 | Bacteria | 3094 |
| 321 | Ga0097620_100190132 | 3300006931 | Bacteria | 2137 |
| 322 | Ga0075435_100025966 | 3300007076 | Bacteria | 4566 |
| 323 | Ga0075435_100037247 | 3300007076 | Bacteria | 3871 |
| 324 | Ga0075435_100261048 | 3300007076 | Bacteria | 1476 |
| 325 | Ga0105240_10025630 | 3300009093 | Bacteria | 7744 |
| 326 | Ga0105240_10061623 | 3300009093 | Bacteria | 4674 |
| 327 | Ga0105240_10077015 | 3300009093 | Bacteria | 4110 |
| 328 | Ga0105240_10166009 | 3300009093 | Bacteria | 2618 |
| 329 | Ga0111539_10029943 | 3300009094 | Bacteria | 6621 |
| 330 | Ga0111539_10052759 | 3300009094 | Bacteria | 4840 |
| 331 | Ga0111539_10058716 | 3300009094 | Bacteria | 4563 |
| 332 | Ga0111539_10069222 | 3300009094 | Bacteria | 4167 |
| 333 | Ga0111539_10076994 | 3300009094 | Bacteria | 3927 |
| 334 | Ga0111539_10115411 | 3300009094 | Bacteria | 3149 |
| 335 | Ga0105245_10001106 | 3300009098 | Bacteria | 24405 |
| 336 | Ga0105245_10002431 | 3300009098 | Bacteria | 16858 |
| 337 | Ga0105245_10003537 | 3300009098 | Bacteria | 13968 |
| 338 | Ga0105245_10025097 | 3300009098 | Bacteria | 5241 |
| 339 | Ga0105245_10040281 | 3300009098 | Bacteria | 4161 |
| 340 | Ga0105245_10299659 | 3300009098 | Bacteria | 1577 |
| 341 | Ga0105247_10001615 | 3300009101 | Bacteria | 15958 |
| 342 | Ga0105247_10120795 | 3300009101 | Bacteria | 1697 |
| 343 | Ga0114129_10002787 | 3300009147 | Bacteria | 24362 |
| 344 | Ga0114129_10005266 | 3300009147 | Bacteria | 18241 |
| 345 | Ga0114129_10012653 | 3300009147 | Bacteria | 12014 |
| 346 | Ga0114129_10014040 | 3300009147 | Bacteria | 11410 |
| 347 | Ga0114129_10064503 | 3300009147 | Bacteria | 5112 |
| 348 | Ga0114129_10149834 | 3300009147 | Bacteria | 3193 |
| 349 | Ga0114129_10151970 | 3300009147 | Bacteria | 3168 |
| 350 | Ga0105243_10003932 | 3300009148 | Bacteria | 11860 |
| 351 | Ga0105243_10010142 | 3300009148 | Bacteria | 7164 |
| 352 | Ga0105243_10199404 | 3300009148 | Bacteria | 1754 |
| 353 | Ga0105243_10206258 | 3300009148 | Bacteria | 1727 |
| 354 | Ga0105243_10383877 | 3300009148 | Bacteria | 1300 |
| 355 | Ga0105241_10000182 | 3300009174 | Bacteria | 47072 |
| 356 | Ga0105241_10014236 | 3300009174 | Bacteria | 5827 |
| 357 | Ga0105242_10003250 | 3300009176 | Bacteria | 12679 |
| 358 | Ga0105242_10004015 | 3300009176 | Bacteria | 11443 |
| 359 | Ga0105242_10004174 | 3300009176 | Bacteria | 11256 |
| 360 | Ga0105248_10001050 | 3300009177 | Bacteria | 30582 |
| 361 | Ga0105248_10001923 | 3300009177 | Bacteria | 23052 |
| 362 | Ga0105248_10004922 | 3300009177 | Bacteria | 14752 |
| 363 | Ga0105248_10028418 | 3300009177 | Bacteria | 6230 |
| 364 | Ga0105248_10043358 | 3300009177 | Bacteria | 5044 |
| 365 | Ga0105248_10450563 | 3300009177 | Bacteria | 1450 |
| 366 | Ga0105237_10000190 | 3300009545 | Bacteria | 87182 |
| 367 | Ga0105238_10000297 | 3300009551 | Bacteria | 54482 |
| 368 | Ga0105238_10041612 | 3300009551 | Bacteria | 4653 |
| 369 | Ga0105238_10758793 | 3300009551 | Bacteria | 984 |
| 370 | Ga0105249_10000280 | 3300009553 | Bacteria | 53516 |
| 371 | Ga0105249_10000720 | 3300009553 | Bacteria | 30109 |
| 372 | Ga0105249_10004530 | 3300009553 | Bacteria | 12012 |
| 373 | Ga0105249_10021962 | 3300009553 | Bacteria | 5715 |
| 374 | Ga0105249_10052096 | 3300009553 | Bacteria | 3736 |
| 375 | Ga0105249_10052819 | 3300009553 | Bacteria | 3713 |
| 376 | Ga0105249_10301018 | 3300009553 | Bacteria | 1608 |
| 377 | Ga0105239_10000709 | 3300010375 | Bacteria | 47208 |
| 378 | Ga0105239_10010391 | 3300010375 | Bacteria | 10415 |
| 379 | Ga0105239_10041496 | 3300010375 | Bacteria | 5042 |
| 380 | Ga0105239_10186026 | 3300010375 | Bacteria | 2324 |
| 381 | Ga0105246_10169792 | 3300011119 | Bacteria | 1669 |
| 382 | Ga0105246_10504339 | 3300011119 | Bacteria | 1028 |
| 383 | Ga0157373_10005090 | 3300013100 | Bacteria | 9881 |
| 384 | Ga0157371_10000340 | 3300013102 | Bacteria | 59959 |
| 385 | Ga0157369_10001580 | 3300013105 | Bacteria | 27876 |
| 386 | Ga0157374_10000208 | 3300013296 | Bacteria | 54031 |
| 387 | Ga0157374_10013897 | 3300013296 | Bacteria | 7035 |
| 388 | Ga0157374_10239996 | 3300013296 | Bacteria | 1782 |
| 389 | Ga0157374_10263745 | 3300013296 | Bacteria | 1697 |
| 390 | Ga0157378_10000152 | 3300013297 | Bacteria | 64999 |
| 391 | Ga0157378_10001229 | 3300013297 | Bacteria | 23157 |
| 392 | Ga0157378_10002577 | 3300013297 | Bacteria | 16133 |
| 393 | Ga0163162_10005524 | 3300013306 | Bacteria | 12221 |
| 394 | Ga0163162_10034653 | 3300013306 | Bacteria | 5024 |
| 395 | Ga0163162_10037985 | 3300013306 | Bacteria | 4806 |
| 396 | Ga0163162_10095064 | 3300013306 | Bacteria | 3066 |
| 397 | Ga0157372_10001598 | 3300013307 | Bacteria | 24617 |
| 398 | Ga0157372_10088228 | 3300013307 | Bacteria | 3521 |
| 399 | Ga0157372_10153593 | 3300013307 | Bacteria | 2658 |
| 400 | Ga0157372_10394123 | 3300013307 | Bacteria | 1614 |
| 401 | Ga0157375_10000252 | 3300013308 | Bacteria | 48594 |
| 402 | Ga0157375_10016342 | 3300013308 | Bacteria | 6662 |
| 403 | Ga0157375_10115329 | 3300013308 | Bacteria | 2789 |
| 404 | Ga0157375_10371322 | 3300013308 | Bacteria | 1597 |
| 405 | Ga0157375_10510425 | 3300013308 | Bacteria | 1366 |
| 406 | Ga0163163_10010093 | 3300014325 | Bacteria | 8473 |
| 407 | Ga0163163_10010283 | 3300014325 | Bacteria | 8408 |
| 408 | Ga0163163_10017851 | 3300014325 | Bacteria | 6624 |
| 409 | Ga0163163_10474705 | 3300014325 | Bacteria | 1311 |
| 410 | Ga0163163_10663475 | 3300014325 | Bacteria | 1106 |
| 411 | Ga0157380_10003085 | 3300014326 | Bacteria | 11362 |
| 412 | Ga0157380_10009292 | 3300014326 | Bacteria | 7037 |
| 413 | Ga0157380_10024336 | 3300014326 | Bacteria | 4581 |
| 414 | Ga0157380_10142905 | 3300014326 | Bacteria | 2058 |
| 415 | Ga0157380_10360644 | 3300014326 | Bacteria | 1364 |
| 416 | Ga0157377_10000141 | 3300014745 | Bacteria | 45798 |
| 417 | Ga0157377_10020567 | 3300014745 | Bacteria | 3460 |
| 418 | Ga0157379_10000079 | 3300014968 | Bacteria | 63166 |
| 419 | Ga0157379_10000316 | 3300014968 | Bacteria | 38472 |
| 420 | Ga0157379_10012769 | 3300014968 | Bacteria | 7346 |
| 421 | Ga0157379_10351549 | 3300014968 | Bacteria | 1349 |
| 422 | Ga0157376_10027626 | 3300014969 | Bacteria | 4500 |
| 423 | Ga0157376_10095751 | 3300014969 | Bacteria | 2582 |
| 424 | Ga0163161_10005385 | 3300017792 | Bacteria | 8892 |
| 425 | Ga0163161_10156683 | 3300017792 | Unclassified | 1734 |
| 426 | Ga0207697_10001148 | 3300025315 | Bacteria | 14557 |
| 427 | Ga0207697_10002770 | 3300025315 | Bacteria | 8940 |
| 428 | Ga0207656_10000341 | 3300025321 | Bacteria | 15879 |
| 429 | Ga0207656_10021214 | 3300025321 | Unclassified | 2593 |
| 430 | Ga0207682_10002257 | 3300025893 | Bacteria | 8687 |
| 431 | Ga0207642_10000041 | 3300025899 | Bacteria | 37235 |
| 432 | Ga0207642_10000420 | 3300025899 | Bacteria | 12791 |
| 433 | Ga0207642_10004156 | 3300025899 | Bacteria | 4649 |
| 434 | Ga0207710_10000704 | 3300025900 | Bacteria | 18751 |
| 435 | Ga0207688_10000015 | 3300025901 | Bacteria | 57722 |
| 436 | Ga0207688_10029369 | 3300025901 | Bacteria | 3027 |
| 437 | Ga0207680_10000063 | 3300025903 | Bacteria | 48393 |
| 438 | Ga0207680_10047216 | 3300025903 | Bacteria | 2550 |
| 439 | Ga0207680_10136185 | 3300025903 | Bacteria | 1623 |
| 440 | Ga0207647_10001319 | 3300025904 | Bacteria | 19055 |
| 441 | Ga0207647_10047160 | 3300025904 | Bacteria | 2681 |
| 442 | Ga0207645_10000025 | 3300025907 | Bacteria | 98264 |
| 443 | Ga0207645_10000096 | 3300025907 | Bacteria | 64474 |
| 444 | Ga0207645_10004995 | 3300025907 | Bacteria | 9718 |
| 445 | Ga0207643_10000023 | 3300025908 | Bacteria | 104515 |
| 446 | Ga0207643_10008678 | 3300025908 | Bacteria | 5453 |
| 447 | Ga0207643_10044197 | 3300025908 | Bacteria | 2515 |
| 448 | Ga0207643_10090806 | 3300025908 | Bacteria | 1781 |
| 449 | Ga0207705_10001179 | 3300025909 | Bacteria | 21237 |
| 450 | Ga0207684_10000996 | 3300025910 | Bacteria | 31775 |
| 451 | Ga0207684_10008157 | 3300025910 | Bacteria | 9330 |
| 452 | Ga0207684_10011745 | 3300025910 | Bacteria | 7640 |
| 453 | Ga0207654_10003091 | 3300025911 | Bacteria | 8429 |
| 454 | Ga0207707_10001121 | 3300025912 | Bacteria | 25421 |
| 455 | Ga0207707_10001396 | 3300025912 | Bacteria | 22390 |
| 456 | Ga0207707_10041889 | 3300025912 | Bacteria | 3998 |
| 457 | Ga0207707_10097164 | 3300025912 | Bacteria | 2574 |
| 458 | Ga0207695_10019759 | 3300025913 | Bacteria | 7744 |
| 459 | Ga0207671_10000645 | 3300025914 | Bacteria | 45564 |
| 460 | Ga0207660_10039750 | 3300025917 | Bacteria | 3290 |
| 461 | Ga0207660_10051258 | 3300025917 | Bacteria | 2934 |
| 462 | Ga0207660_10070273 | 3300025917 | Bacteria | 2545 |
| 463 | Ga0207660_10107856 | 3300025917 | Bacteria | 2091 |
| 464 | Ga0207660_10173920 | 3300025917 | Bacteria | 1668 |
| 465 | Ga0207660_10258959 | 3300025917 | Bacteria | 1375 |
| 466 | Ga0207662_10000020 | 3300025918 | Bacteria | 72933 |
| 467 | Ga0207662_10036238 | 3300025918 | Bacteria | 2883 |
| 468 | Ga0207657_10000067 | 3300025919 | Bacteria | 97934 |
| 469 | Ga0207657_10024846 | 3300025919 | Bacteria | 5538 |
| 470 | Ga0207657_10074344 | 3300025919 | Bacteria | 2870 |
| 471 | Ga0207657_10157073 | 3300025919 | Bacteria | 1849 |
| 472 | Ga0207649_10001061 | 3300025920 | Bacteria | 16846 |
| 473 | Ga0207649_10003304 | 3300025920 | Bacteria | 8829 |
| 474 | Ga0207649_10039341 | 3300025920 | Bacteria | 2867 |
| 475 | Ga0207649_10059029 | 3300025920 | Bacteria | 2405 |
| 476 | Ga0207652_10002725 | 3300025921 | Bacteria | 14819 |
| 477 | Ga0207652_10018299 | 3300025921 | Bacteria | 5746 |
| 478 | Ga0207652_10282805 | 3300025921 | Bacteria | 1497 |
| 479 | Ga0207646_10001766 | 3300025922 | Bacteria | 26193 |
| 480 | Ga0207646_10003426 | 3300025922 | Bacteria | 17920 |
| 481 | Ga0207646_10202677 | 3300025922 | Bacteria | 1792 |
| 482 | Ga0207681_10000192 | 3300025923 | Bacteria | 49214 |
| 483 | Ga0207681_10012927 | 3300025923 | Bacteria | 5161 |
| 484 | Ga0207681_10036120 | 3300025923 | Bacteria | 3258 |
| 485 | Ga0207681_10066897 | 3300025923 | Bacteria | 2489 |
| 486 | Ga0207681_10103865 | 3300025923 | Bacteria | 2054 |
| 487 | Ga0207681_10206251 | 3300025923 | Bacteria | 1512 |
| 488 | Ga0207694_10000636 | 3300025924 | Bacteria | 31729 |
| 489 | Ga0207650_10000147 | 3300025925 | Bacteria | 85501 |
| 490 | Ga0207650_10006362 | 3300025925 | Bacteria | 8043 |
| 491 | Ga0207650_10012452 | 3300025925 | Bacteria | 5873 |
| 492 | Ga0207650_10031229 | 3300025925 | Bacteria | 3845 |
| 493 | Ga0207650_10103803 | 3300025925 | Bacteria | 2192 |
| 494 | Ga0207659_10000083 | 3300025926 | Bacteria | 57057 |
| 495 | Ga0207659_10096406 | 3300025926 | Bacteria | 2220 |
| 496 | Ga0207659_10124013 | 3300025926 | Bacteria | 1984 |
| 497 | Ga0207659_10193606 | 3300025926 | Bacteria | 1619 |
| 498 | Ga0207659_10259352 | 3300025926 | Bacteria | 1413 |
| 499 | Ga0207687_10000664 | 3300025927 | Bacteria | 23135 |
| 500 | Ga0207687_10001087 | 3300025927 | Bacteria | 18464 |
| 501 | Ga0207687_10036476 | 3300025927 | Bacteria | 3350 |
| 502 | Ga0207687_10041261 | 3300025927 | Bacteria | 3167 |
| 503 | Ga0207644_10000711 | 3300025931 | Bacteria | 21133 |
| 504 | Ga0207644_10038362 | 3300025931 | Bacteria | 3374 |
| 505 | Ga0207644_10099848 | 3300025931 | Bacteria | 2178 |
| 506 | Ga0207690_10000121 | 3300025932 | Bacteria | 65227 |
| 507 | Ga0207690_10091327 | 3300025932 | Bacteria | 2152 |
| 508 | Ga0207706_10000067 | 3300025933 | Bacteria | 108077 |
| 509 | Ga0207706_10000119 | 3300025933 | Bacteria | 84681 |
| 510 | Ga0207706_10010192 | 3300025933 | Bacteria | 8598 |
| 511 | Ga0207706_10080200 | 3300025933 | Bacteria | 2870 |
| 512 | Ga0207706_10225912 | 3300025933 | Bacteria | 1638 |
| 513 | Ga0207686_10000108 | 3300025934 | Bacteria | 66086 |
| 514 | Ga0207686_10001827 | 3300025934 | Bacteria | 11844 |
| 515 | Ga0207686_10012642 | 3300025934 | Bacteria | 4645 |
| 516 | Ga0207686_10037288 | 3300025934 | Bacteria | 2932 |
| 517 | Ga0207709_10004686 | 3300025935 | Bacteria | 7866 |
| 518 | Ga0207709_10128229 | 3300025935 | Bacteria | 1724 |
| 519 | Ga0207709_10142613 | 3300025935 | Bacteria | 1649 |
| 520 | Ga0207709_10151347 | 3300025935 | Bacteria | 1607 |
| 521 | Ga0207670_10000100 | 3300025936 | Bacteria | 59919 |
| 522 | Ga0207670_10001085 | 3300025936 | Bacteria | 14341 |
| 523 | Ga0207670_10016088 | 3300025936 | Bacteria | 4487 |
| 524 | Ga0207669_10000541 | 3300025937 | Bacteria | 16449 |
| 525 | Ga0207669_10002112 | 3300025937 | Bacteria | 8425 |
| 526 | Ga0207704_10000080 | 3300025938 | Bacteria | 57205 |
| 527 | Ga0207704_10000730 | 3300025938 | Bacteria | 14453 |
| 528 | Ga0207704_10027930 | 3300025938 | Bacteria | 3122 |
| 529 | Ga0207691_10000079 | 3300025940 | Bacteria | 82300 |
| 530 | Ga0207691_10000246 | 3300025940 | Bacteria | 53559 |
| 531 | Ga0207691_10008430 | 3300025940 | Bacteria | 9899 |
| 532 | Ga0207691_10035191 | 3300025940 | Bacteria | 4652 |
| 533 | Ga0207711_10000189 | 3300025941 | Bacteria | 65922 |
| 534 | Ga0207711_10019936 | 3300025941 | Bacteria | 5589 |
| 535 | Ga0207711_10050601 | 3300025941 | Bacteria | 3557 |
| 536 | Ga0207711_10133418 | 3300025941 | Unclassified | 2228 |
| 537 | Ga0207689_10000073 | 3300025942 | Bacteria | 81232 |
| 538 | Ga0207689_10000089 | 3300025942 | Bacteria | 73617 |
| 539 | Ga0207689_10000496 | 3300025942 | Bacteria | 37082 |
| 540 | Ga0207689_10017216 | 3300025942 | Bacteria | 6117 |
| 541 | Ga0207689_10225248 | 3300025942 | Bacteria | 1550 |
| 542 | Ga0207661_10001303 | 3300025944 | Bacteria | 16687 |
| 543 | Ga0207661_10008040 | 3300025944 | Bacteria | 7518 |
| 544 | Ga0207661_10097722 | 3300025944 | Bacteria | 2459 |
| 545 | Ga0207661_10227593 | 3300025944 | Bacteria | 1650 |
| 546 | Ga0207661_10505453 | 3300025944 | Bacteria | 1104 |
| 547 | Ga0207679_10000478 | 3300025945 | Bacteria | 28113 |
| 548 | Ga0207679_10000687 | 3300025945 | Bacteria | 22666 |
| 549 | Ga0207679_10000719 | 3300025945 | Bacteria | 22033 |
| 550 | Ga0207679_10008494 | 3300025945 | Bacteria | 6543 |
| 551 | Ga0207679_10023066 | 3300025945 | Bacteria | 4249 |
| 552 | Ga0207679_10040700 | 3300025945 | Bacteria | 3329 |
| 553 | Ga0207679_10251489 | 3300025945 | Bacteria | 1503 |
| 554 | Ga0207667_10003595 | 3300025949 | Bacteria | 19143 |
| 555 | Ga0207667_10053457 | 3300025949 | Bacteria | 4250 |
| 556 | Ga0207667_10093647 | 3300025949 | Bacteria | 3102 |
| 557 | Ga0207651_10000054 | 3300025960 | Bacteria | 51552 |
| 558 | Ga0207651_10010912 | 3300025960 | Bacteria | 5058 |
| 559 | Ga0207651_10049873 | 3300025960 | Bacteria | 2839 |
| 560 | Ga0207651_10051407 | 3300025960 | Bacteria | 2804 |
| 561 | Ga0207651_10108107 | 3300025960 | Bacteria | 2081 |
| 562 | Ga0207651_10539720 | 3300025960 | Bacteria | 1013 |
| 563 | Ga0207712_10000157 | 3300025961 | Bacteria | 70058 |
| 564 | Ga0207712_10002997 | 3300025961 | Bacteria | 10791 |
| 565 | Ga0207712_10005822 | 3300025961 | Bacteria | 7769 |
| 566 | Ga0207712_10013755 | 3300025961 | Bacteria | 5191 |
| 567 | Ga0207712_10013897 | 3300025961 | Bacteria | 5163 |
| 568 | Ga0207712_10110921 | 3300025961 | Bacteria | 2058 |
| 569 | Ga0207712_10314754 | 3300025961 | Bacteria | 1289 |
| 570 | Ga0207668_10000445 | 3300025972 | Bacteria | 26148 |
| 571 | Ga0207668_10012456 | 3300025972 | Bacteria | 5207 |
| 572 | Ga0207668_10088439 | 3300025972 | Bacteria | 2269 |
| 573 | Ga0207668_10185524 | 3300025972 | Bacteria | 1644 |
| 574 | Ga0207668_10304929 | 3300025972 | Bacteria | 1315 |
| 575 | Ga0207640_10000170 | 3300025981 | Bacteria | 47258 |
| 576 | Ga0207640_10015712 | 3300025981 | Bacteria | 4387 |
| 577 | Ga0207640_10335032 | 3300025981 | Bacteria | 1210 |
| 578 | Ga0207658_10000331 | 3300025986 | Bacteria | 47462 |
| 579 | Ga0207658_10093837 | 3300025986 | Bacteria | 2334 |
| 580 | Ga0207658_10098232 | 3300025986 | Bacteria | 2288 |
| 581 | Ga0207658_10155465 | 3300025986 | Bacteria | 1868 |
| 582 | Ga0207677_10000113 | 3300026023 | Bacteria | 65880 |
| 583 | Ga0207677_10262550 | 3300026023 | Bacteria | 1408 |
| 584 | Ga0207703_10000265 | 3300026035 | Bacteria | 58474 |
| 585 | Ga0207703_10003671 | 3300026035 | Bacteria | 12794 |
| 586 | Ga0207703_10082391 | 3300026035 | Bacteria | 2684 |
| 587 | Ga0207703_10110291 | 3300026035 | Bacteria | 2347 |
| 588 | Ga0207639_10003211 | 3300026041 | Bacteria | 10987 |
| 589 | Ga0207639_10011378 | 3300026041 | Bacteria | 6179 |
| 590 | Ga0207639_10153143 | 3300026041 | Bacteria | 1933 |
| 591 | Ga0207678_10000591 | 3300026067 | Bacteria | 33171 |
| 592 | Ga0207678_10284646 | 3300026067 | Bacteria | 1419 |
| 593 | Ga0207708_10000150 | 3300026075 | Bacteria | 55752 |
| 594 | Ga0207708_10001214 | 3300026075 | Bacteria | 19464 |
| 595 | Ga0207708_10074778 | 3300026075 | Bacteria | 2597 |
| 596 | Ga0207708_10107466 | 3300026075 | Bacteria | 2163 |
| 597 | Ga0207702_10009455 | 3300026078 | Bacteria | 8187 |
| 598 | Ga0207702_10174927 | 3300026078 | Bacteria | 1972 |
| 599 | Ga0207641_10001477 | 3300026088 | Bacteria | 23046 |
| 600 | Ga0207641_10094618 | 3300026088 | Bacteria | 2620 |
| 601 | Ga0207641_10587128 | 3300026088 | Bacteria | 1089 |
| 602 | Ga0207648_10000029 | 3300026089 | Bacteria | 130026 |
| 603 | Ga0207648_10000095 | 3300026089 | Bacteria | 84340 |
| 604 | Ga0207648_10001547 | 3300026089 | Bacteria | 25319 |
| 605 | Ga0207648_10058382 | 3300026089 | Bacteria | 3364 |
| 606 | Ga0207648_10235363 | 3300026089 | Bacteria | 1630 |
| 607 | Ga0207648_10710975 | 3300026089 | Bacteria | 931 |
| 608 | Ga0207676_10000226 | 3300026095 | Bacteria | 48869 |
| 609 | Ga0207676_10004153 | 3300026095 | Bacteria | 10228 |
| 610 | Ga0207676_10070456 | 3300026095 | Bacteria | 2804 |
| 611 | Ga0207676_10365316 | 3300026095 | Bacteria | 1339 |
| 612 | Ga0207674_10000177 | 3300026116 | Bacteria | 78243 |
| 613 | Ga0207674_10001314 | 3300026116 | Bacteria | 32414 |
| 614 | Ga0207674_10006241 | 3300026116 | Bacteria | 14046 |
| 615 | Ga0207674_10007864 | 3300026116 | Bacteria | 12393 |
| 616 | Ga0207674_10011262 | 3300026116 | Bacteria | 10054 |
| 617 | Ga0207674_10132536 | 3300026116 | Bacteria | 2455 |
| 618 | Ga0207674_10212180 | 3300026116 | Bacteria | 1885 |
| 619 | Ga0207675_100000201 | 3300026118 | Bacteria | 55349 |
| 620 | Ga0207675_100039122 | 3300026118 | Bacteria | 4426 |
| 621 | Ga0207675_100040882 | 3300026118 | Bacteria | 4331 |
| 622 | Ga0207683_10000050 | 3300026121 | Bacteria | 87435 |
| 623 | Ga0207683_10003044 | 3300026121 | Bacteria | 14658 |
| 624 | Ga0207683_10008087 | 3300026121 | Bacteria | 8996 |
| 625 | Ga0207683_10099143 | 3300026121 | Bacteria | 2600 |
| 626 | Ga0207683_10169344 | 3300026121 | Bacteria | 1978 |
| 627 | Ga0207698_10000149 | 3300026142 | Bacteria | 44780 |
| 628 | Ga0207698_10119257 | 3300026142 | Bacteria | 2229 |
| 629 | Ga0207698_10169314 | 3300026142 | Unclassified | 1921 |
| 630 | Ga0209974_10043485 | 3300027876 | Bacteria | 1497 |
| 631 | Ga0207428_10021298 | 3300027907 | Bacteria | 5491 |
| 632 | Ga0207428_10137523 | 3300027907 | Bacteria | 1867 |
| 633 | Ga0207428_10144266 | 3300027907 | Unclassified | 1815 |
| 634 | Ga0268266_10000415 | 3300028379 | Bacteria | 64982 |
| 635 | Ga0268266_10023519 | 3300028379 | Bacteria | 5245 |
| 636 | Ga0268265_10000581 | 3300028380 | Bacteria | 37025 |
| 637 | Ga0268265_10010291 | 3300028380 | Bacteria | 6317 |
| 638 | Ga0268265_10051584 | 3300028380 | Bacteria | 3105 |
| 639 | Ga0268265_10210532 | 3300028380 | Bacteria | 1693 |
| 640 | Ga0268265_10234053 | 3300028380 | Bacteria | 1616 |
| 641 | Ga0268264_10000485 | 3300028381 | Bacteria | 52938 |
| 642 | Ga0268264_10012196 | 3300028381 | Bacteria | 7073 |
| 643 | Ga0268264_10013128 | 3300028381 | Bacteria | 6812 |
| 644 | Ga0268264_10024518 | 3300028381 | Bacteria | 4925 |
| 645 | Ga0268264_10118559 | 3300028381 | Bacteria | 2329 |
| 646 | Ga0268264_10383297 | 3300028381 | Bacteria | 1347 |
| 647 | Ga0265320_10030264 | 3300031240 | Bacteria | 2793 |
| 648 | Ga0307509_10000112 | 3300031507 | Bacteria | 117028 |
| 649 | Ga0307509_10124024 | 3300031507 | Bacteria | 2554 |
| 650 | Ga0307408_100006188 | 3300031548 | Bacteria | 7947 |
| 651 | Ga0307408_100112465 | 3300031548 | Bacteria | 2094 |
| 652 | Ga0265314_10010946 | 3300031711 | Bacteria | 7529 |
| 653 | Ga0307405_10124015 | 3300031731 | Bacteria | 1773 |
| 654 | Ga0307406_10000992 | 3300031901 | Bacteria | 15750 |
| 655 | Ga0307406_10009756 | 3300031901 | Bacteria | 5399 |
| 656 | Ga0307409_100126225 | 3300031995 | Bacteria | 2177 |
| 657 | Ga0307409_100603695 | 3300031995 | Bacteria | 1085 |
| 658 | Ga0307411_10234800 | 3300032005 | Bacteria | 1432 |
| 659 | Ga0307415_100034242 | 3300032126 | Bacteria | 3305 |
| 660 | Ga0307415_100270345 | 3300032126 | Bacteria | 1392 |
| 661 | Ga0373945_0054202 | 3300035116 | Bacteria | 1482 |
| 662 | Ga0373943_0022391 | 3300035170 | Bacteria | 2928 |
| 663 | Ga0373946_0045980 | 3300035171 | Bacteria | 1808 |
| 664 | Ga0373931_0132354 | 3300035691 | Bacteria | 1437 |
| 665 | Ga0373927_0010358 | 3300035695 | Bacteria | 6224 |
| 666 | Ga0373927_0179400 | 3300035695 | Bacteria | 1389 |
| 667 | Ga0373947_0019264 | 3300035725 | Bacteria | 3934 |
| 668 | Ga0373947_0027662 | 3300035725 | Bacteria | 3320 |
| 669 | Ga0373937_0001843 | 3300036401 | Bacteria | 17813 |
| 670 | Ga0373937_0016632 | 3300036401 | Bacteria | 6536 |
| 671 | Ga0373925_0001061 | 3300037068 | Bacteria | 24808 |
| 672 | Ga0373925_0001237 | 3300037068 | Bacteria | 22546 |
| 673 | Ga0395900_0168410 | 3300037418 | Bacteria | 2232 |
| 674 | Ga0395905_0046639 | 3300037471 | Bacteria | 4064 |
| 675 | Ga0400490_24643 | 3300038726 | Bacteria | 58439 |
| 676 | Ga0400491_13982 | 3300038727 | Bacteria | 2652 |
| 677 | Ga0436365_0565193 | 3300039437 | Bacteria | 4714 |
| 678 | Ga0436365_1377439 | 3300039437 | Bacteria | 4887 |
| 679 | Ga0436365_1852592 | 3300039437 | Bacteria | 1236 |
| 680 | Ga0436363_1343188 | 3300039450 | Bacteria | 3843 |
| 681 | Ga0451849_0210341 | 3300041505 | Bacteria | 1812 |
| 682 | Ga0450896_011034 | 3300042133 | Bacteria | 1270 |
| 683 | Ga0439435_0044466 | 3300042436 | Bacteria | 1252 |
| 684 | Ga0451577_0020932 | 3300042876 | Bacteria | 5995 |
| 685 | Ga0451577_0037789 | 3300042876 | Bacteria | 4345 |
| 686 | Ga0451577_0090668 | 3300042876 | Bacteria | 2728 |
| 687 | Ga0451577_0094760 | 3300042876 | Bacteria | 2666 |
| 688 | Ga0453684_0070149 | 3300044712 | Bacteria | 4439 |
| 689 | Ga0466957_0252986 | 3300044842 | Bacteria | 1172 |
| 690 | Ga0451576_0005179 | 3300045051 | Bacteria | 16492 |
| 691 | Ga0451576_0059539 | 3300045051 | Bacteria | 3986 |
| 692 | Ga0451576_0100913 | 3300045051 | Bacteria | 3001 |
| 693 | Ga0451576_0142405 | 3300045051 | Bacteria | 2500 |
| 694 | Ga0451576_0336365 | 3300045051 | Bacteria | 1580 |
| 695 | Ga0495603_0093829 | 3300046455 | Bacteria | 1754 |
| 696 | Ga0495608_0225555 | 3300046511 | Bacteria | 1174 |
| 697 | Ga0495586_0001823 | 3300046535 | Bacteria | 11631 |
| 698 | Ga0495634_0129804 | 3300046642 | Bacteria | 1608 |
| 699 | Ga0495635_0056341 | 3300046663 | Bacteria | 2706 |
| 700 | Ga0495647_0104382 | 3300046681 | Bacteria | 1176 |
| 701 | Ga0495658_0003780 | 3300046683 | Bacteria | 7493 |
| 702 | Ga0495676_0014703 | 3300047321 | Bacteria | 6995 |
| 703 | Ga0495684_0060607 | 3300047471 | Bacteria | 2880 |
| 704 | Ga0495684_0148393 | 3300047471 | Bacteria | 1755 |
| 705 | Ga0495686_0005090 | 3300047472 | Bacteria | 10518 |
| 706 | Ga0495686_0021780 | 3300047472 | Bacteria | 4251 |
| 707 | Ga0496100_0106006 | 3300048903 | Bacteria | 1945 |
| 708 | Ga0496101_0180074 | 3300048904 | Bacteria | 1627 |
| 709 | Ga0496102_0004082 | 3300048905 | Bacteria | 12377 |
| 710 | Ga0496103_0013364 | 3300048906 | Bacteria | 4866 |
| 711 | Ga0496104_0021139 | 3300048907 | Bacteria | 5971 |
| 712 | Ga0496104_0055354 | 3300048907 | Bacteria | 3751 |
| 713 | Ga0496105_0022542 | 3300048908 | Bacteria | 5101 |
| 714 | Ga0496105_0302198 | 3300048908 | Bacteria | 1286 |
| 715 | Ga0496106_0008043 | 3300048909 | Bacteria | 7790 |
| 716 | Ga0496107_0027874 | 3300048910 | Bacteria | 4012 |
| 717 | Ga0496108_0038333 | 3300048911 | Bacteria | 3992 |
| 718 | Ga0496108_0068704 | 3300048911 | Bacteria | 2989 |
| 719 | Ga0496109_0000709 | 3300048912 | Bacteria | 27720 |
| 720 | Ga0496109_0003803 | 3300048912 | Bacteria | 12597 |
| 721 | Ga0496110_0004326 | 3300048913 | Bacteria | 10991 |
| 722 | Ga0496110_0205069 | 3300048913 | Bacteria | 1792 |
| 723 | Ga0496111_0179552 | 3300048914 | Bacteria | 1573 |
| 724 | Ga0496112_0000210 | 3300048915 | Bacteria | 37637 |
| 725 | Ga0496112_0006951 | 3300048915 | Bacteria | 9989 |
| 726 | Ga0496112_0017314 | 3300048915 | Bacteria | 6768 |
| 727 | Ga0496112_0290762 | 3300048915 | Bacteria | 1580 |
| 728 | Ga0496113_0128631 | 3300048916 | Bacteria | 1985 |
| 729 | Ga0496113_0248643 | 3300048916 | Bacteria | 1419 |
| 730 | Ga0496114_0033530 | 3300048917 | Bacteria | 4231 |
| 731 | Ga0496115_0055846 | 3300048918 | Bacteria | 3173 |
| 732 | Ga0496116_0222923 | 3300048919 | Bacteria | 964 |
| 733 | Ga0501032_0092299 | 3300049569 | Bacteria | 2009 |
| 734 | Ga0501036_0091618 | 3300049572 | Bacteria | 2568 |
| 735 | Ga0501036_0256190 | 3300049572 | Bacteria | 1466 |
| 736 | Ga0501039_0072157 | 3300049575 | Bacteria | 2683 |
| 737 | Ga0501040_0004353 | 3300049576 | Bacteria | 9206 |
| 738 | Ga0501040_0011752 | 3300049576 | Bacteria | 5726 |
| 739 | Ga0501040_0060164 | 3300049576 | Bacteria | 2610 |
| 740 | Ga0501041_0046124 | 3300049577 | Bacteria | 2651 |
| 741 | Ga0501041_0049742 | 3300049577 | Bacteria | 2554 |
| 742 | Ga0501041_0058944 | 3300049577 | Bacteria | 2350 |
| 743 | Ga0501041_0091079 | 3300049577 | Bacteria | 1883 |
| 744 | Ga0501042_0081155 | 3300049578 | Bacteria | 2324 |
| 745 | Ga0501042_0146431 | 3300049578 | Bacteria | 1703 |
| 746 | Ga0501042_0292117 | 3300049578 | Bacteria | 1177 |
| 747 | Ga0501046_0169864 | 3300049580 | Bacteria | 1637 |
| 748 | Ga0501070_0098562 | 3300049586 | Bacteria | 2417 |
| 749 | Ga0501070_0198321 | 3300049586 | Bacteria | 1648 |
| 750 | Ga0501071_0056564 | 3300049587 | Bacteria | 2834 |
| 751 | Ga0501071_0334427 | 3300049587 | Bacteria | 1151 |
| 752 | Ga0501071_0364103 | 3300049587 | Bacteria | 1101 |
| 753 | Ga0501072_0015127 | 3300049588 | Bacteria | 5917 |
| 754 | Ga0501072_0077055 | 3300049588 | Bacteria | 2639 |
| 755 | Ga0501072_0187850 | 3300049588 | Bacteria | 1648 |
| 756 | Ga0501073_0027147 | 3300049589 | Bacteria | 4098 |
| 757 | Ga0501074_0071506 | 3300049590 | Bacteria | 2494 |
| 758 | Ga0501074_0143319 | 3300049590 | Bacteria | 1709 |
| 759 | Ga0501075_0005525 | 3300049591 | Bacteria | 8646 |
| 760 | Ga0501075_0027856 | 3300049591 | Bacteria | 4166 |
| 761 | Ga0501075_0077022 | 3300049591 | Bacteria | 2523 |
| 762 | Ga0501076_0029525 | 3300049592 | Bacteria | 4264 |
| 763 | Ga0501076_0047016 | 3300049592 | Bacteria | 3411 |
| 764 | Ga0501076_0333028 | 3300049592 | Bacteria | 1245 |
| 765 | Ga0501079_0041756 | 3300049741 | Bacteria | 3542 |
| 766 | Ga0501079_0196165 | 3300049741 | Bacteria | 1576 |
| 767 | Ga0501079_0198577 | 3300049741 | Bacteria | 1566 |
| 768 | Ga0501079_0199719 | 3300049741 | Bacteria | 1562 |
| 769 | Ga0501079_0276686 | 3300049741 | Bacteria | 1312 |
| 770 | Ga0501080_0087644 | 3300049742 | Bacteria | 2892 |
| 771 | Ga0501080_0287620 | 3300049742 | Bacteria | 1493 |
| 772 | Ga0501080_0391417 | 3300049742 | Bacteria | 1251 |
| 773 | Ga0501081_0013622 | 3300049743 | Bacteria | 5346 |
| 774 | Ga0501081_0021316 | 3300049743 | Bacteria | 4323 |
| 775 | Ga0501081_0021658 | 3300049743 | Bacteria | 4291 |
| 776 | Ga0501081_0101243 | 3300049743 | Bacteria | 2037 |
| 777 | Ga0501081_0157612 | 3300049743 | Bacteria | 1634 |
| 778 | Ga0501083_0001915 | 3300049744 | Bacteria | 14294 |
| 779 | Ga0501045_0005172 | 3300049824 | Bacteria | 9026 |
| 780 | Ga0501045_0009660 | 3300049824 | Bacteria | 6751 |
| 781 | Ga0501045_0103026 | 3300049824 | Bacteria | 2113 |
| 782 | nmdc:mga05p37_13006_c1 | 3300050507 | Bacteria | 9960 |
| 783 | nmdc:mga05p37_18646_c1 | 3300050507 | Bacteria | 8386 |
| 784 | nmdc:mga05p37_212385_c1 | 3300050507 | Bacteria | 2339 |
| 785 | nmdc:mga05p37_3575_c1 | 3300050507 | Bacteria | 18163 |
| 786 | nmdc:mga05p37_36354_c1 | 3300050507 | Bacteria | 6042 |
| 787 | nmdc:mga09592_41786_c1 | 3300050508 | Bacteria | 3856 |
| 788 | nmdc:mga09592_426062_c1 | 3300050508 | Bacteria | 1146 |
| 789 | nmdc:mga09592_73997_c1 | 3300050508 | Bacteria | 2895 |
| 790 | nmdc:mga09592_86506_c1 | 3300050508 | Bacteria | 2675 |
| 791 | nmdc:mga0qj67_121754_c1 | 3300050509 | Bacteria | 2111 |
| 792 | nmdc:mga0qj67_147854_c1 | 3300050509 | Bacteria | 1905 |
| 793 | nmdc:mga0qj67_21964_c1 | 3300050509 | Bacteria | 4897 |
| 794 | nmdc:mga06r32_101213_c1 | 3300050510 | Bacteria | 2828 |
| 795 | nmdc:mga06r32_101700_c1 | 3300050510 | Bacteria | 2821 |
| 796 | nmdc:mga06r32_128852_c1 | 3300050510 | Bacteria | 2500 |
| 797 | nmdc:mga06r32_196281_c1 | 3300050510 | Bacteria | 2006 |
| 798 | nmdc:mga06r32_72991_c1 | 3300050510 | Bacteria | 3323 |
| 799 | nmdc:mga06r32_75695_c1 | 3300050510 | Bacteria | 3267 |
| 800 | nmdc:mga06r32_8042_c1 | 3300050510 | Bacteria | 9489 |
| 801 | nmdc:mga08y16_128281_c1 | 3300050511 | Bacteria | 2638 |
| 802 | nmdc:mga08y16_23198_c1 | 3300050511 | Bacteria | 6550 |
| 803 | nmdc:mga08y16_24927_c1 | 3300050511 | Bacteria | 6309 |
| 804 | nmdc:mga08y16_340357_c1 | 3300050511 | Bacteria | 1542 |
| 805 | nmdc:mga08y16_57366_c1 | 3300050511 | Bacteria | 4069 |
| 806 | nmdc:mga08y16_69326_c1 | 3300050511 | Bacteria | 3676 |
| 807 | nmdc:mga0n895_111158_c1 | 3300050512 | Bacteria | 2756 |
| 808 | nmdc:mga0n895_171633_c1 | 3300050512 | Bacteria | 2201 |
| 809 | nmdc:mga0n895_4755_c1 | 3300050512 | Bacteria | 11224 |
| 810 | nmdc:mga0n895_52897_c1 | 3300050512 | Bacteria | 3988 |
| 811 | nmdc:mga0n895_6204_c1 | 3300050512 | Bacteria | 10111 |
| 812 | nmdc:mga0n895_6750_c1 | 3300050512 | Bacteria | 9789 |
| 813 | nmdc:mga0n895_73424_c1 | 3300050512 | Bacteria | 3396 |
| 814 | nmdc:mga0n895_78706_c1 | 3300050512 | Bacteria | 3281 |
| 815 | nmdc:mga0rr50_519812_c1 | 3300050513 | Bacteria | 1013 |
| 816 | nmdc:mga0rr50_546731_c1 | 3300050513 | Bacteria | 986 |
| 817 | nmdc:mga08x19_17398_c1 | 3300050514 | Bacteria | 4398 |
| 818 | nmdc:mga08x19_28392_c1 | 3300050514 | Bacteria | 3504 |
| 819 | nmdc:mga0a205_18154_c1 | 3300050515 | Bacteria | 6608 |
| 820 | nmdc:mga0a205_19740_c1 | 3300050515 | Bacteria | 6359 |
| 821 | nmdc:mga0a205_313389_c1 | 3300050515 | Bacteria | 1441 |
| 822 | nmdc:mga0a205_320828_c1 | 3300050515 | Unclassified | 1420 |
| 823 | nmdc:mga0a205_38288_c1 | 3300050515 | Bacteria | 4612 |
| 824 | nmdc:mga0a205_39079_c1 | 3300050515 | Bacteria | 4566 |
| 825 | nmdc:mga0a205_3952_c1 | 3300050515 | Bacteria | 13256 |
| 826 | nmdc:mga0a205_5436_c1 | 3300050515 | Bacteria | 11479 |
| 827 | Ga0495601_0032831 | 3300053077 | Bacteria | 3233 |
| 828 | Ga0495601_0192329 | 3300053077 | Bacteria | 1333 |
| 829 | Ga0501084_0027551 | 3300054114 | Bacteria | 4748 |
| 830 | Ga0501084_0033204 | 3300054114 | Bacteria | 4317 |
| 831 | Ga0501084_0036657 | 3300054114 | Bacteria | 4097 |
| 832 | Ga0501084_0315185 | 3300054114 | Bacteria | 1321 |
| 833 | Ga0590075_006095 | 3300059424 | Bacteria | 2856 |
| 834 | Ga0501082_0026649 | 3300060353 | Bacteria | 4983 |
| 835 | Ga0501082_0105490 | 3300060353 | Bacteria | 2438 |
| 836 | Ga0501082_0105554 | 3300060353 | Bacteria | 2437 |
| 837 | Ga0501082_0242523 | 3300060353 | Bacteria | 1568 |
| 838 | Ga0501082_0322527 | 3300060353 | Bacteria | 1346 |
| 839 | Ga0501082_0546601 | 3300060353 | Bacteria | 1013 |
| 840 | Ga0530510_0016524 | 3300061734 | Bacteria | 5226 |
| 841 | Ga0530510_0076676 | 3300061734 | Bacteria | 2429 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044842 | Ga0466957_0252986 | Ga0466957_0252986_57_887 | 264 |
| 2 | 3300009545 | Ga0105237_10000190 | Ga0105237_1000019040 | 281 |
| 3 | 3300042436 | Ga0439435_0044466 | Ga0439435_0044466_383_1231 | 282 |
| 4 | 3300005355 | Ga0070671_100000284 | Ga0070671_1000002842 | 286 |
| 5 | 3300025931 | Ga0207644_10038362 | Ga0207644_100383622 | 286 |
| 6 | 3300025919 | Ga0207657_10157073 | Ga0207657_101570732 | 291 |
| 7 | 3300049576 | Ga0501040_0004353 | Ga0501040_0004353_6067_6942 | 291 |
| 8 | 3300049577 | Ga0501041_0091079 | Ga0501041_0091079_149_1024 | 291 |
| 9 | 3300049580 | Ga0501046_0169864 | Ga0501046_0169864_671_1546 | 291 |
| 10 | 3300049587 | Ga0501071_0056564 | Ga0501071_0056564_1265_2140 | 291 |
| 11 | 3300049590 | Ga0501074_0143319 | Ga0501074_0143319_110_985 | 291 |
| 12 | 3300049591 | Ga0501075_0005525 | Ga0501075_0005525_1414_2289 | 291 |
| 13 | 3300049592 | Ga0501076_0047016 | Ga0501076_0047016_1680_2555 | 291 |
| 14 | 3300049742 | Ga0501080_0287620 | Ga0501080_0287620_503_1378 | 291 |
| 15 | 3300049743 | Ga0501081_0021316 | Ga0501081_0021316_3383_4258 | 291 |
| 16 | 3300049824 | Ga0501045_0009660 | Ga0501045_0009660_249_1124 | 291 |
| 17 | 3300054114 | Ga0501084_0027551 | Ga0501084_0027551_1584_2459 | 291 |
| 18 | 3300060353 | Ga0501082_0026649 | Ga0501082_0026649_466_1341 | 291 |
| 19 | 3300005445 | Ga0070708_100214266 | Ga0070708_1002142662 | 292 |
| 20 | 3300005471 | Ga0070698_100254357 | Ga0070698_1002543572 | 292 |
| 21 | 3300005331 | Ga0070670_100016837 | Ga0070670_1000168375 | 293 |
| 22 | 3300005577 | Ga0068857_100148705 | Ga0068857_1001487052 | 293 |
| 23 | 3300014326 | Ga0157380_10360644 | Ga0157380_103606441 | 293 |
| 24 | 3300025925 | Ga0207650_10031229 | Ga0207650_100312292 | 293 |
| 25 | 3300026116 | Ga0207674_10212180 | Ga0207674_102121802 | 293 |
| 26 | 3300005293 | Ga0065715_10174411 | Ga0065715_101744111 | 294 |
| 27 | 3300005293 | Ga0065715_10323265 | Ga0065715_103232651 | 294 |
| 28 | 3300005295 | Ga0065707_10195218 | Ga0065707_101952182 | 294 |
| 29 | 3300005328 | Ga0070676_10055753 | Ga0070676_100557531 | 294 |
| 30 | 3300005329 | Ga0070683_100006984 | Ga0070683_1000069844 | 294 |
| 31 | 3300005329 | Ga0070683_100016102 | Ga0070683_1000161024 | 294 |
| 32 | 3300005329 | Ga0070683_100046381 | Ga0070683_1000463811 | 294 |
| 33 | 3300005329 | Ga0070683_100070997 | Ga0070683_1000709975 | 294 |
| 34 | 3300005330 | Ga0070690_100007942 | Ga0070690_1000079423 | 294 |
| 35 | 3300005330 | Ga0070690_100265974 | Ga0070690_1002659741 | 294 |
| 36 | 3300005331 | Ga0070670_100068774 | Ga0070670_1000687743 | 294 |
| 37 | 3300005334 | Ga0068869_100000231 | Ga0068869_10000023115 | 294 |
| 38 | 3300005337 | Ga0070682_100032795 | Ga0070682_1000327953 | 294 |
| 39 | 3300005338 | Ga0068868_100035807 | Ga0068868_1000358075 | 294 |
| 40 | 3300005338 | Ga0068868_100348843 | Ga0068868_1003488432 | 294 |
| 41 | 3300005339 | Ga0070660_100002606 | Ga0070660_10000260612 | 294 |
| 42 | 3300005339 | Ga0070660_100057761 | Ga0070660_1000577612 | 294 |
| 43 | 3300005340 | Ga0070689_100016053 | Ga0070689_1000160536 | 294 |
| 44 | 3300005340 | Ga0070689_100059971 | Ga0070689_1000599713 | 294 |
| 45 | 3300005341 | Ga0070691_10055894 | Ga0070691_100558942 | 294 |
| 46 | 3300005343 | Ga0070687_100011700 | Ga0070687_1000117002 | 294 |
| 47 | 3300005344 | Ga0070661_100006204 | Ga0070661_1000062048 | 294 |
| 48 | 3300005344 | Ga0070661_100240985 | Ga0070661_1002409851 | 294 |
| 49 | 3300005345 | Ga0070692_10000429 | Ga0070692_100004294 | 294 |
| 50 | 3300005345 | Ga0070692_10012704 | Ga0070692_100127044 | 294 |
| 51 | 3300005347 | Ga0070668_100001886 | Ga0070668_10000188612 | 294 |
| 52 | 3300005353 | Ga0070669_100008083 | Ga0070669_1000080839 | 294 |
| 53 | 3300005354 | Ga0070675_100005509 | Ga0070675_1000055094 | 294 |
| 54 | 3300005364 | Ga0070673_100026030 | Ga0070673_1000260302 | 294 |
| 55 | 3300005365 | Ga0070688_100005046 | Ga0070688_1000050464 | 294 |
| 56 | 3300005365 | Ga0070688_100134690 | Ga0070688_1001346902 | 294 |
| 57 | 3300005366 | Ga0070659_100052790 | Ga0070659_1000527903 | 294 |
| 58 | 3300005366 | Ga0070659_100171398 | Ga0070659_1001713983 | 294 |
| 59 | 3300005367 | Ga0070667_100079407 | Ga0070667_1000794071 | 294 |
| 60 | 3300005438 | Ga0070701_10000234 | Ga0070701_1000023410 | 294 |
| 61 | 3300005438 | Ga0070701_10165500 | Ga0070701_101655002 | 294 |
| 62 | 3300005440 | Ga0070705_100004213 | Ga0070705_1000042134 | 294 |
| 63 | 3300005441 | Ga0070700_100000247 | Ga0070700_1000002478 | 294 |
| 64 | 3300005441 | Ga0070700_100070199 | Ga0070700_1000701992 | 294 |
| 65 | 3300005444 | Ga0070694_100034242 | Ga0070694_1000342422 | 294 |
| 66 | 3300005444 | Ga0070694_100082418 | Ga0070694_1000824182 | 294 |
| 67 | 3300005444 | Ga0070694_100156721 | Ga0070694_1001567213 | 294 |
| 68 | 3300005456 | Ga0070678_100003327 | Ga0070678_1000033276 | 294 |
| 69 | 3300005457 | Ga0070662_100032632 | Ga0070662_1000326324 | 294 |
| 70 | 3300005457 | Ga0070662_100254843 | Ga0070662_1002548431 | 294 |
| 71 | 3300005458 | Ga0070681_10013470 | Ga0070681_100134706 | 294 |
| 72 | 3300005459 | Ga0068867_100000316 | Ga0068867_10000031614 | 294 |
| 73 | 3300005466 | Ga0070685_10288774 | Ga0070685_102887741 | 294 |
| 74 | 3300005518 | Ga0070699_100079035 | Ga0070699_1000790353 | 294 |
| 75 | 3300005530 | Ga0070679_100283164 | Ga0070679_1002831641 | 294 |
| 76 | 3300005535 | Ga0070684_100000962 | Ga0070684_10000096217 | 294 |
| 77 | 3300005539 | Ga0068853_100014900 | Ga0068853_1000149006 | 294 |
| 78 | 3300005543 | Ga0070672_100004256 | Ga0070672_1000042568 | 294 |
| 79 | 3300005543 | Ga0070672_100035559 | Ga0070672_1000355594 | 294 |
| 80 | 3300005544 | Ga0070686_100001922 | Ga0070686_1000019228 | 294 |
| 81 | 3300005545 | Ga0070695_100004579 | Ga0070695_1000045796 | 294 |
| 82 | 3300005546 | Ga0070696_100021901 | Ga0070696_1000219014 | 294 |
| 83 | 3300005563 | Ga0068855_100038538 | Ga0068855_1000385388 | 294 |
| 84 | 3300005564 | Ga0070664_100008556 | Ga0070664_1000085566 | 294 |
| 85 | 3300005564 | Ga0070664_100159087 | Ga0070664_1001590871 | 294 |
| 86 | 3300005577 | Ga0068857_100011983 | Ga0068857_1000119831 | 294 |
| 87 | 3300005577 | Ga0068857_100025161 | Ga0068857_1000251615 | 294 |
| 88 | 3300005578 | Ga0068854_100074637 | Ga0068854_1000746373 | 294 |
| 89 | 3300005615 | Ga0070702_100000069 | Ga0070702_10000006913 | 294 |
| 90 | 3300005616 | Ga0068852_100026111 | Ga0068852_1000261112 | 294 |
| 91 | 3300005617 | Ga0068859_100190120 | Ga0068859_1001901201 | 294 |
| 92 | 3300005618 | Ga0068864_100316586 | Ga0068864_1003165863 | 294 |
| 93 | 3300005718 | Ga0068866_10000436 | Ga0068866_100004367 | 294 |
| 94 | 3300005719 | Ga0068861_100003296 | Ga0068861_1000032968 | 294 |
| 95 | 3300005719 | Ga0068861_100008684 | Ga0068861_1000086848 | 294 |
| 96 | 3300005719 | Ga0068861_100148810 | Ga0068861_1001488102 | 294 |
| 97 | 3300005834 | Ga0068851_10012877 | Ga0068851_100128773 | 294 |
| 98 | 3300005840 | Ga0068870_10006716 | Ga0068870_100067166 | 294 |
| 99 | 3300005840 | Ga0068870_10068220 | Ga0068870_100682202 | 294 |
| 100 | 3300005841 | Ga0068863_100046442 | Ga0068863_1000464426 | 294 |
| 101 | 3300005841 | Ga0068863_100756392 | Ga0068863_1007563921 | 294 |
| 102 | 3300005842 | Ga0068858_100000496 | Ga0068858_10000049629 | 294 |
| 103 | 3300005842 | Ga0068858_100091311 | Ga0068858_1000913112 | 294 |
| 104 | 3300005843 | Ga0068860_100007920 | Ga0068860_1000079203 | 294 |
| 105 | 3300005844 | Ga0068862_100019127 | Ga0068862_1000191274 | 294 |
| 106 | 3300005844 | Ga0068862_100035561 | Ga0068862_1000355614 | 294 |
| 107 | 3300005844 | Ga0068862_100182069 | Ga0068862_1001820692 | 294 |
| 108 | 3300006237 | Ga0097621_100010143 | Ga0097621_1000101434 | 294 |
| 109 | 3300006358 | Ga0068871_100004079 | Ga0068871_1000040796 | 294 |
| 110 | 3300006844 | Ga0075428_100064929 | Ga0075428_1000649292 | 294 |
| 111 | 3300006846 | Ga0075430_100017795 | Ga0075430_1000177955 | 294 |
| 112 | 3300006846 | Ga0075430_100034643 | Ga0075430_1000346434 | 294 |
| 113 | 3300006846 | Ga0075430_100046158 | Ga0075430_1000461584 | 294 |
| 114 | 3300006847 | Ga0075431_100016795 | Ga0075431_1000167955 | 294 |
| 115 | 3300006847 | Ga0075431_100063294 | Ga0075431_1000632941 | 294 |
| 116 | 3300006847 | Ga0075431_100090296 | Ga0075431_1000902964 | 294 |
| 117 | 3300006847 | Ga0075431_100325759 | Ga0075431_1003257592 | 294 |
| 118 | 3300006852 | Ga0075433_10013820 | Ga0075433_100138207 | 294 |
| 119 | 3300006852 | Ga0075433_10014676 | Ga0075433_100146764 | 294 |
| 120 | 3300006871 | Ga0075434_100001524 | Ga0075434_1000015246 | 294 |
| 121 | 3300006880 | Ga0075429_100064517 | Ga0075429_1000645175 | 294 |
| 122 | 3300006881 | Ga0068865_100000304 | Ga0068865_1000003049 | 294 |
| 123 | 3300006881 | Ga0068865_100085680 | Ga0068865_1000856801 | 294 |
| 124 | 3300006931 | Ga0097620_100190132 | Ga0097620_1001901321 | 294 |
| 125 | 3300009094 | Ga0111539_10069222 | Ga0111539_100692224 | 294 |
| 126 | 3300009098 | Ga0105245_10001106 | Ga0105245_1000110614 | 294 |
| 127 | 3300009098 | Ga0105245_10299659 | Ga0105245_102996591 | 294 |
| 128 | 3300009147 | Ga0114129_10012653 | Ga0114129_1001265310 | 294 |
| 129 | 3300009147 | Ga0114129_10014040 | Ga0114129_1001404014 | 294 |
| 130 | 3300009147 | Ga0114129_10151970 | Ga0114129_101519702 | 294 |
| 131 | 3300009148 | Ga0105243_10003932 | Ga0105243_100039326 | 294 |
| 132 | 3300009148 | Ga0105243_10206258 | Ga0105243_102062582 | 294 |
| 133 | 3300009176 | Ga0105242_10003250 | Ga0105242_100032508 | 294 |
| 134 | 3300009177 | Ga0105248_10028418 | Ga0105248_100284183 | 294 |
| 135 | 3300009177 | Ga0105248_10450563 | Ga0105248_104505633 | 294 |
| 136 | 3300009551 | Ga0105238_10758793 | Ga0105238_107587931 | 294 |
| 137 | 3300009553 | Ga0105249_10021962 | Ga0105249_100219624 | 294 |
| 138 | 3300009553 | Ga0105249_10052096 | Ga0105249_100520964 | 294 |
| 139 | 3300010375 | Ga0105239_10010391 | Ga0105239_100103912 | 294 |
| 140 | 3300013296 | Ga0157374_10263745 | Ga0157374_102637453 | 294 |
| 141 | 3300013297 | Ga0157378_10001229 | Ga0157378_100012296 | 294 |
| 142 | 3300013306 | Ga0163162_10037985 | Ga0163162_100379853 | 294 |
| 143 | 3300013306 | Ga0163162_10095064 | Ga0163162_100950644 | 294 |
| 144 | 3300013307 | Ga0157372_10088228 | Ga0157372_100882282 | 294 |
| 145 | 3300013308 | Ga0157375_10115329 | Ga0157375_101153294 | 294 |
| 146 | 3300014325 | Ga0163163_10663475 | Ga0163163_106634751 | 294 |
| 147 | 3300014326 | Ga0157380_10003085 | Ga0157380_100030858 | 294 |
| 148 | 3300014326 | Ga0157380_10024336 | Ga0157380_100243363 | 294 |
| 149 | 3300014745 | Ga0157377_10020567 | Ga0157377_100205672 | 294 |
| 150 | 3300017792 | Ga0163161_10156683 | Ga0163161_101566832 | 294 |
| 151 | 3300025315 | Ga0207697_10002770 | Ga0207697_100027709 | 294 |
| 152 | 3300025321 | Ga0207656_10021214 | Ga0207656_100212145 | 294 |
| 153 | 3300025899 | Ga0207642_10000420 | Ga0207642_100004207 | 294 |
| 154 | 3300025901 | Ga0207688_10029369 | Ga0207688_100293694 | 294 |
| 155 | 3300025904 | Ga0207647_10047160 | Ga0207647_100471604 | 294 |
| 156 | 3300025907 | Ga0207645_10000096 | Ga0207645_1000009614 | 294 |
| 157 | 3300025908 | Ga0207643_10008678 | Ga0207643_100086785 | 294 |
| 158 | 3300025908 | Ga0207643_10044197 | Ga0207643_100441971 | 294 |
| 159 | 3300025908 | Ga0207643_10090806 | Ga0207643_100908061 | 294 |
| 160 | 3300025912 | Ga0207707_10001121 | Ga0207707_1000112115 | 294 |
| 161 | 3300025918 | Ga0207662_10036238 | Ga0207662_100362384 | 294 |
| 162 | 3300025919 | Ga0207657_10024846 | Ga0207657_100248466 | 294 |
| 163 | 3300025919 | Ga0207657_10074344 | Ga0207657_100743445 | 294 |
| 164 | 3300025920 | Ga0207649_10003304 | Ga0207649_100033042 | 294 |
| 165 | 3300025920 | Ga0207649_10059029 | Ga0207649_100590291 | 294 |
| 166 | 3300025921 | Ga0207652_10018299 | Ga0207652_100182998 | 294 |
| 167 | 3300025923 | Ga0207681_10036120 | Ga0207681_100361204 | 294 |
| 168 | 3300025923 | Ga0207681_10103865 | Ga0207681_101038651 | 294 |
| 169 | 3300025923 | Ga0207681_10206251 | Ga0207681_102062511 | 294 |
| 170 | 3300025925 | Ga0207650_10103803 | Ga0207650_101038031 | 294 |
| 171 | 3300025926 | Ga0207659_10096406 | Ga0207659_100964061 | 294 |
| 172 | 3300025926 | Ga0207659_10193606 | Ga0207659_101936062 | 294 |
| 173 | 3300025927 | Ga0207687_10000664 | Ga0207687_1000066420 | 294 |
| 174 | 3300025932 | Ga0207690_10091327 | Ga0207690_100913271 | 294 |
| 175 | 3300025933 | Ga0207706_10010192 | Ga0207706_100101924 | 294 |
| 176 | 3300025933 | Ga0207706_10080200 | Ga0207706_100802003 | 294 |
| 177 | 3300025933 | Ga0207706_10225912 | Ga0207706_102259122 | 294 |
| 178 | 3300025934 | Ga0207686_10001827 | Ga0207686_100018278 | 294 |
| 179 | 3300025935 | Ga0207709_10128229 | Ga0207709_101282292 | 294 |
| 180 | 3300025936 | Ga0207670_10001085 | Ga0207670_1000108511 | 294 |
| 181 | 3300025938 | Ga0207704_10000730 | Ga0207704_100007307 | 294 |
| 182 | 3300025938 | Ga0207704_10027930 | Ga0207704_100279301 | 294 |
| 183 | 3300025940 | Ga0207691_10000246 | Ga0207691_1000024625 | 294 |
| 184 | 3300025940 | Ga0207691_10008430 | Ga0207691_100084308 | 294 |
| 185 | 3300025941 | Ga0207711_10133418 | Ga0207711_101334182 | 294 |
| 186 | 3300025942 | Ga0207689_10000073 | Ga0207689_1000007355 | 294 |
| 187 | 3300025942 | Ga0207689_10017216 | Ga0207689_100172164 | 294 |
| 188 | 3300025944 | Ga0207661_10008040 | Ga0207661_100080405 | 294 |
| 189 | 3300025944 | Ga0207661_10505453 | Ga0207661_105054531 | 294 |
| 190 | 3300025945 | Ga0207679_10000719 | Ga0207679_100007194 | 294 |
| 191 | 3300025945 | Ga0207679_10008494 | Ga0207679_100084942 | 294 |
| 192 | 3300025945 | Ga0207679_10023066 | Ga0207679_100230665 | 294 |
| 193 | 3300025949 | Ga0207667_10093647 | Ga0207667_100936472 | 294 |
| 194 | 3300025960 | Ga0207651_10010912 | Ga0207651_100109128 | 294 |
| 195 | 3300025960 | Ga0207651_10051407 | Ga0207651_100514071 | 294 |
| 196 | 3300025961 | Ga0207712_10002997 | Ga0207712_1000299712 | 294 |
| 197 | 3300025961 | Ga0207712_10005822 | Ga0207712_100058226 | 294 |
| 198 | 3300025961 | Ga0207712_10013897 | Ga0207712_100138974 | 294 |
| 199 | 3300025972 | Ga0207668_10012456 | Ga0207668_100124565 | 294 |
| 200 | 3300025972 | Ga0207668_10088439 | Ga0207668_100884395 | 294 |
| 201 | 3300025972 | Ga0207668_10304929 | Ga0207668_103049291 | 294 |
| 202 | 3300025981 | Ga0207640_10335032 | Ga0207640_103350322 | 294 |
| 203 | 3300025986 | Ga0207658_10098232 | Ga0207658_100982322 | 294 |
| 204 | 3300026023 | Ga0207677_10262550 | Ga0207677_102625501 | 294 |
| 205 | 3300026035 | Ga0207703_10003671 | Ga0207703_100036719 | 294 |
| 206 | 3300026041 | Ga0207639_10153143 | Ga0207639_101531433 | 294 |
| 207 | 3300026067 | Ga0207678_10284646 | Ga0207678_102846461 | 294 |
| 208 | 3300026075 | Ga0207708_10000150 | Ga0207708_1000015022 | 294 |
| 209 | 3300026075 | Ga0207708_10074778 | Ga0207708_100747782 | 294 |
| 210 | 3300026088 | Ga0207641_10587128 | Ga0207641_105871281 | 294 |
| 211 | 3300026089 | Ga0207648_10001547 | Ga0207648_100015477 | 294 |
| 212 | 3300026089 | Ga0207648_10058382 | Ga0207648_100583823 | 294 |
| 213 | 3300026089 | Ga0207648_10235363 | Ga0207648_102353632 | 294 |
| 214 | 3300026095 | Ga0207676_10070456 | Ga0207676_100704565 | 294 |
| 215 | 3300026095 | Ga0207676_10365316 | Ga0207676_103653162 | 294 |
| 216 | 3300026116 | Ga0207674_10001314 | Ga0207674_100013148 | 294 |
| 217 | 3300026116 | Ga0207674_10006241 | Ga0207674_1000624115 | 294 |
| 218 | 3300026116 | Ga0207674_10011262 | Ga0207674_100112621 | 294 |
| 219 | 3300026118 | Ga0207675_100000201 | Ga0207675_10000020122 | 294 |
| 220 | 3300026118 | Ga0207675_100040882 | Ga0207675_1000408822 | 294 |
| 221 | 3300026121 | Ga0207683_10008087 | Ga0207683_100080876 | 294 |
| 222 | 3300026142 | Ga0207698_10169314 | Ga0207698_101693143 | 294 |
| 223 | 3300027907 | Ga0207428_10137523 | Ga0207428_101375232 | 294 |
| 224 | 3300027907 | Ga0207428_10144266 | Ga0207428_101442662 | 294 |
| 225 | 3300028379 | Ga0268266_10023519 | Ga0268266_100235194 | 294 |
| 226 | 3300028380 | Ga0268265_10010291 | Ga0268265_100102916 | 294 |
| 227 | 3300028380 | Ga0268265_10051584 | Ga0268265_100515844 | 294 |
| 228 | 3300028380 | Ga0268265_10210532 | Ga0268265_102105321 | 294 |
| 229 | 3300028381 | Ga0268264_10118559 | Ga0268264_101185593 | 294 |
| 230 | 3300031548 | Ga0307408_100006188 | Ga0307408_1000061889 | 294 |
| 231 | 3300031731 | Ga0307405_10124015 | Ga0307405_101240152 | 294 |
| 232 | 3300031901 | Ga0307406_10000992 | Ga0307406_1000099214 | 294 |
| 233 | 3300031995 | Ga0307409_100126225 | Ga0307409_1001262252 | 294 |
| 234 | 3300032126 | Ga0307415_100034242 | Ga0307415_1000342421 | 294 |
| 235 | 3300037471 | Ga0395905_0046639 | Ga0395905_0046639_3089_3973 | 294 |
| 236 | 3300039437 | Ga0436365_1852592 | Ga0436365_1852592_253_1137 | 294 |
| 237 | 3300042133 | Ga0450896_011034 | Ga0450896_011034_71_955 | 294 |
| 238 | 3300045051 | Ga0451576_0142405 | Ga0451576_0142405_241_1125 | 294 |
| 239 | 3300050507 | nmdc:mga05p37_212385_c1 | nmdc:mga05p37_212385_c1_1355_2239 | 294 |
| 240 | 3300050507 | nmdc:mga05p37_36354_c1 | nmdc:mga05p37_36354_c1_1377_2261 | 294 |
| 241 | 3300050508 | nmdc:mga09592_41786_c1 | nmdc:mga09592_41786_c1_1387_2271 | 294 |
| 242 | 3300050509 | nmdc:mga0qj67_21964_c1 | nmdc:mga0qj67_21964_c1_2543_3427 | 294 |
| 243 | 3300050510 | nmdc:mga06r32_101700_c1 | nmdc:mga06r32_101700_c1_239_1123 | 294 |
| 244 | 3300050510 | nmdc:mga06r32_75695_c1 | nmdc:mga06r32_75695_c1_650_1534 | 294 |
| 245 | 3300050510 | nmdc:mga06r32_8042_c1 | nmdc:mga06r32_8042_c1_4089_4973 | 294 |
| 246 | 3300050511 | nmdc:mga08y16_57366_c1 | nmdc:mga08y16_57366_c1_1934_2818 | 294 |
| 247 | 3300050512 | nmdc:mga0n895_111158_c1 | nmdc:mga0n895_111158_c1_1376_2260 | 294 |
| 248 | 3300050512 | nmdc:mga0n895_6204_c1 | nmdc:mga0n895_6204_c1_5341_6225 | 294 |
| 249 | 3300050512 | nmdc:mga0n895_6750_c1 | nmdc:mga0n895_6750_c1_2146_3030 | 294 |
| 250 | 3300050515 | nmdc:mga0a205_18154_c1 | nmdc:mga0a205_18154_c1_527_1411 | 294 |
| 251 | 3300050515 | nmdc:mga0a205_38288_c1 | nmdc:mga0a205_38288_c1_3556_4440 | 294 |
| 252 | 3300050515 | nmdc:mga0a205_3952_c1 | nmdc:mga0a205_3952_c1_9277_10161 | 294 |
| 253 | 3300005330 | Ga0070690_100147769 | Ga0070690_1001477692 | 295 |
| 254 | 3300005340 | Ga0070689_100016352 | Ga0070689_1000163524 | 295 |
| 255 | 3300005365 | Ga0070688_100110010 | Ga0070688_1001100102 | 295 |
| 256 | 3300005468 | Ga0070707_100037852 | Ga0070707_1000378521 | 295 |
| 257 | 3300005544 | Ga0070686_100046575 | Ga0070686_1000465752 | 295 |
| 258 | 3300005617 | Ga0068859_100049514 | Ga0068859_1000495142 | 295 |
| 259 | 3300005841 | Ga0068863_100199577 | Ga0068863_1001995773 | 295 |
| 260 | 3300006852 | Ga0075433_10018829 | Ga0075433_100188292 | 295 |
| 261 | 3300006871 | Ga0075434_100084435 | Ga0075434_1000844353 | 295 |
| 262 | 3300006931 | Ga0097620_100049515 | Ga0097620_1000495152 | 295 |
| 263 | 3300025936 | Ga0207670_10016088 | Ga0207670_100160883 | 295 |
| 264 | 3300046663 | Ga0495635_0056341 | Ga0495635_0056341_1483_2370 | 295 |
| 265 | 3300047471 | Ga0495684_0148393 | Ga0495684_0148393_271_1158 | 295 |
| 266 | 3300050512 | nmdc:mga0n895_171633_c1 | nmdc:mga0n895_171633_c1_536_1423 | 295 |
| 267 | 3300050515 | nmdc:mga0a205_313389_c1 | nmdc:mga0a205_313389_c1_238_1125 | 295 |
| 268 | 3300053077 | Ga0495601_0192329 | Ga0495601_0192329_231_1118 | 295 |
| 269 | 3300005329 | Ga0070683_100186958 | Ga0070683_1001869582 | 296 |
| 270 | 3300005336 | Ga0070680_100005081 | Ga0070680_1000050814 | 296 |
| 271 | 3300005337 | Ga0070682_100002665 | Ga0070682_1000026654 | 296 |
| 272 | 3300005338 | Ga0068868_100103173 | Ga0068868_1001031732 | 296 |
| 273 | 3300005364 | Ga0070673_100094254 | Ga0070673_1000942542 | 296 |
| 274 | 3300005445 | Ga0070708_100290690 | Ga0070708_1002906901 | 296 |
| 275 | 3300005458 | Ga0070681_10022472 | Ga0070681_100224723 | 296 |
| 276 | 3300005530 | Ga0070679_100002944 | Ga0070679_1000029448 | 296 |
| 277 | 3300005536 | Ga0070697_100055484 | Ga0070697_1000554842 | 296 |
| 278 | 3300005536 | Ga0070697_100111617 | Ga0070697_1001116172 | 296 |
| 279 | 3300005539 | Ga0068853_100032766 | Ga0068853_1000327664 | 296 |
| 280 | 3300005544 | Ga0070686_100153439 | Ga0070686_1001534392 | 296 |
| 281 | 3300005563 | Ga0068855_100093825 | Ga0068855_1000938252 | 296 |
| 282 | 3300009098 | Ga0105245_10025097 | Ga0105245_100250976 | 296 |
| 283 | 3300009147 | Ga0114129_10149834 | Ga0114129_101498342 | 296 |
| 284 | 3300009553 | Ga0105249_10052819 | Ga0105249_100528192 | 296 |
| 285 | 3300013296 | Ga0157374_10239996 | Ga0157374_102399962 | 296 |
| 286 | 3300025912 | Ga0207707_10001396 | Ga0207707_1000139611 | 296 |
| 287 | 3300025917 | Ga0207660_10173920 | Ga0207660_101739202 | 296 |
| 288 | 3300025917 | Ga0207660_10258959 | Ga0207660_102589592 | 296 |
| 289 | 3300025921 | Ga0207652_10002725 | Ga0207652_1000272511 | 296 |
| 290 | 3300025961 | Ga0207712_10110921 | Ga0207712_101109212 | 296 |
| 291 | 3300026041 | Ga0207639_10011378 | Ga0207639_100113785 | 296 |
| 292 | 3300026089 | Ga0207648_10710975 | Ga0207648_107109751 | 296 |
| 293 | 3300005330 | Ga0070690_100054046 | Ga0070690_1000540464 | 297 |
| 294 | 3300005336 | Ga0070680_100041457 | Ga0070680_1000414572 | 297 |
| 295 | 3300005365 | Ga0070688_100232576 | Ga0070688_1002325762 | 297 |
| 296 | 3300005438 | Ga0070701_10085221 | Ga0070701_100852212 | 297 |
| 297 | 3300005440 | Ga0070705_100035112 | Ga0070705_1000351122 | 297 |
| 298 | 3300005440 | Ga0070705_100292877 | Ga0070705_1002928771 | 297 |
| 299 | 3300005444 | Ga0070694_100198603 | Ga0070694_1001986032 | 297 |
| 300 | 3300005467 | Ga0070706_100010107 | Ga0070706_10001010710 | 297 |
| 301 | 3300005467 | Ga0070706_100267495 | Ga0070706_1002674952 | 297 |
| 302 | 3300005468 | Ga0070707_100186097 | Ga0070707_1001860972 | 297 |
| 303 | 3300005471 | Ga0070698_100144213 | Ga0070698_1001442132 | 297 |
| 304 | 3300005518 | Ga0070699_100010504 | Ga0070699_1000105043 | 297 |
| 305 | 3300005518 | Ga0070699_100014136 | Ga0070699_1000141364 | 297 |
| 306 | 3300005518 | Ga0070699_100228616 | Ga0070699_1002286161 | 297 |
| 307 | 3300005518 | Ga0070699_100232920 | Ga0070699_1002329202 | 297 |
| 308 | 3300005518 | Ga0070699_100574851 | Ga0070699_1005748511 | 297 |
| 309 | 3300005536 | Ga0070697_100000676 | Ga0070697_10000067625 | 297 |
| 310 | 3300005536 | Ga0070697_100033537 | Ga0070697_1000335374 | 297 |
| 311 | 3300005536 | Ga0070697_100120907 | Ga0070697_1001209073 | 297 |
| 312 | 3300005545 | Ga0070695_100222275 | Ga0070695_1002222751 | 297 |
| 313 | 3300005545 | Ga0070695_100344481 | Ga0070695_1003444811 | 297 |
| 314 | 3300005546 | Ga0070696_100008545 | Ga0070696_1000085454 | 297 |
| 315 | 3300005546 | Ga0070696_100074760 | Ga0070696_1000747602 | 297 |
| 316 | 3300005549 | Ga0070704_100087937 | Ga0070704_1000879371 | 297 |
| 317 | 3300005617 | Ga0068859_100091401 | Ga0068859_1000914013 | 297 |
| 318 | 3300005843 | Ga0068860_100047080 | Ga0068860_1000470804 | 297 |
| 319 | 3300005844 | Ga0068862_100104689 | Ga0068862_1001046892 | 297 |
| 320 | 3300006931 | Ga0097620_100091396 | Ga0097620_1000913963 | 297 |
| 321 | 3300009093 | Ga0105240_10077015 | Ga0105240_100770152 | 297 |
| 322 | 3300009177 | Ga0105248_10043358 | Ga0105248_100433584 | 297 |
| 323 | 3300013308 | Ga0157375_10510425 | Ga0157375_105104252 | 297 |
| 324 | 3300014326 | Ga0157380_10142905 | Ga0157380_101429052 | 297 |
| 325 | 3300014968 | Ga0157379_10351549 | Ga0157379_103515491 | 297 |
| 326 | 3300025910 | Ga0207684_10000996 | Ga0207684_1000099614 | 297 |
| 327 | 3300025910 | Ga0207684_10008157 | Ga0207684_100081578 | 297 |
| 328 | 3300025910 | Ga0207684_10011745 | Ga0207684_100117452 | 297 |
| 329 | 3300025917 | Ga0207660_10039750 | Ga0207660_100397503 | 297 |
| 330 | 3300025922 | Ga0207646_10001766 | Ga0207646_1000176614 | 297 |
| 331 | 3300025922 | Ga0207646_10003426 | Ga0207646_100034267 | 297 |
| 332 | 3300025942 | Ga0207689_10225248 | Ga0207689_102252482 | 297 |
| 333 | 3300026035 | Ga0207703_10082391 | Ga0207703_100823912 | 297 |
| 334 | 3300026075 | Ga0207708_10107466 | Ga0207708_101074663 | 297 |
| 335 | 3300037418 | Ga0395900_0168410 | Ga0395900_0168410_76_969 | 297 |
| 336 | 3300039437 | Ga0436365_1377439 | Ga0436365_1377439_2138_3031 | 297 |
| 337 | 3300039450 | Ga0436363_1343188 | Ga0436363_1343188_667_1560 | 297 |
| 338 | 3300042876 | Ga0451577_0090668 | Ga0451577_0090668_1395_2303 | 297 |
| 339 | 3300045051 | Ga0451576_0005179 | Ga0451576_0005179_11989_12942 | 297 |
| 340 | 3300045051 | Ga0451576_0059539 | Ga0451576_0059539_530_1438 | 297 |
| 341 | 3300050514 | nmdc:mga08x19_28392_c1 | nmdc:mga08x19_28392_c1_569_1468 | 297 |
| 342 | 3300060353 | Ga0501082_0322527 | Ga0501082_0322527_281_1174 | 297 |
| 343 | 3300005295 | Ga0065707_10182615 | Ga0065707_101826151 | 298 |
| 344 | 3300005364 | Ga0070673_100103712 | Ga0070673_1001037122 | 298 |
| 345 | 3300005444 | Ga0070694_100000036 | Ga0070694_10000003631 | 298 |
| 346 | 3300005455 | Ga0070663_100141728 | Ga0070663_1001417282 | 298 |
| 347 | 3300005518 | Ga0070699_100000003 | Ga0070699_100000003104 | 298 |
| 348 | 3300005518 | Ga0070699_100028835 | Ga0070699_1000288355 | 298 |
| 349 | 3300006844 | Ga0075428_100298887 | Ga0075428_1002988872 | 298 |
| 350 | 3300006847 | Ga0075431_100072276 | Ga0075431_1000722762 | 298 |
| 351 | 3300006852 | Ga0075433_10001841 | Ga0075433_1000184114 | 298 |
| 352 | 3300006871 | Ga0075434_100042354 | Ga0075434_1000423545 | 298 |
| 353 | 3300006871 | Ga0075434_100333652 | Ga0075434_1003336521 | 298 |
| 354 | 3300007076 | Ga0075435_100025966 | Ga0075435_1000259661 | 298 |
| 355 | 3300009093 | Ga0105240_10061623 | Ga0105240_100616235 | 298 |
| 356 | 3300009094 | Ga0111539_10029943 | Ga0111539_100299435 | 298 |
| 357 | 3300009094 | Ga0111539_10058716 | Ga0111539_100587163 | 298 |
| 358 | 3300009094 | Ga0111539_10076994 | Ga0111539_100769943 | 298 |
| 359 | 3300014326 | Ga0157380_10009292 | Ga0157380_100092923 | 298 |
| 360 | 3300025912 | Ga0207707_10041889 | Ga0207707_100418893 | 298 |
| 361 | 3300025917 | Ga0207660_10070273 | Ga0207660_100702732 | 298 |
| 362 | 3300025960 | Ga0207651_10108107 | Ga0207651_101081072 | 298 |
| 363 | 3300026116 | Ga0207674_10132536 | Ga0207674_101325362 | 298 |
| 364 | 3300027876 | Ga0209974_10043485 | Ga0209974_100434852 | 298 |
| 365 | 3300027907 | Ga0207428_10021298 | Ga0207428_100212984 | 298 |
| 366 | 3300031548 | Ga0307408_100112465 | Ga0307408_1001124652 | 298 |
| 367 | 3300031995 | Ga0307409_100603695 | Ga0307409_1006036951 | 298 |
| 368 | 3300032005 | Ga0307411_10234800 | Ga0307411_102348002 | 298 |
| 369 | 3300048913 | Ga0496110_0205069 | Ga0496110_0205069_365_1261 | 298 |
| 370 | 3300049741 | Ga0501079_0199719 | Ga0501079_0199719_223_1119 | 298 |
| 371 | 3300049743 | Ga0501081_0101243 | Ga0501081_0101243_174_1070 | 298 |
| 372 | 3300050511 | nmdc:mga08y16_23198_c1 | nmdc:mga08y16_23198_c1_619_1521 | 298 |
| 373 | 3300050511 | nmdc:mga08y16_24927_c1 | nmdc:mga08y16_24927_c1_4366_5262 | 298 |
| 374 | 3300050511 | nmdc:mga08y16_69326_c1 | nmdc:mga08y16_69326_c1_500_1498 | 298 |
| 375 | 3300050512 | nmdc:mga0n895_73424_c1 | nmdc:mga0n895_73424_c1_962_1858 | 298 |
| 376 | 3300050513 | nmdc:mga0rr50_519812_c1 | nmdc:mga0rr50_519812_c1_43_939 | 298 |
| 377 | 3300050513 | nmdc:mga0rr50_546731_c1 | nmdc:mga0rr50_546731_c1_17_913 | 298 |
| 378 | 3300050515 | nmdc:mga0a205_19740_c1 | nmdc:mga0a205_19740_c1_4404_5300 | 298 |
| 379 | 3300005331 | Ga0070670_100002718 | Ga0070670_1000027183 | 299 |
| 380 | 3300005445 | Ga0070708_100079116 | Ga0070708_1000791162 | 299 |
| 381 | 3300005467 | Ga0070706_100017608 | Ga0070706_1000176086 | 299 |
| 382 | 3300005468 | Ga0070707_100088448 | Ga0070707_1000884482 | 299 |
| 383 | 3300005518 | Ga0070699_100005646 | Ga0070699_1000056469 | 299 |
| 384 | 3300005536 | Ga0070697_100100621 | Ga0070697_1001006213 | 299 |
| 385 | 3300006846 | Ga0075430_100149274 | Ga0075430_1001492742 | 299 |
| 386 | 3300006871 | Ga0075434_100040841 | Ga0075434_1000408415 | 299 |
| 387 | 3300006914 | Ga0075436_100018848 | Ga0075436_1000188483 | 299 |
| 388 | 3300025925 | Ga0207650_10012452 | Ga0207650_100124523 | 299 |
| 389 | 3300031901 | Ga0307406_10009756 | Ga0307406_100097563 | 299 |
| 390 | 3300032126 | Ga0307415_100270345 | Ga0307415_1002703451 | 299 |
| 391 | 3300038726 | Ga0400490_24643 | Ga0400490_24643_17189_18088 | 299 |
| 392 | 3300038727 | Ga0400491_13982 | Ga0400491_13982_518_1417 | 299 |
| 393 | 3300039437 | Ga0436365_0565193 | Ga0436365_0565193_3686_4585 | 299 |
| 394 | 3300041505 | Ga0451849_0210341 | Ga0451849_0210341_627_1526 | 299 |
| 395 | 3300049578 | Ga0501042_0081155 | Ga0501042_0081155_947_1846 | 299 |
| 396 | 3300050512 | nmdc:mga0n895_4755_c1 | nmdc:mga0n895_4755_c1_2195_3094 | 299 |
| 397 | 3300050514 | nmdc:mga08x19_17398_c1 | nmdc:mga08x19_17398_c1_1047_1946 | 299 |
| 398 | 3300006844 | Ga0075428_100021190 | Ga0075428_1000211908 | 300 |
| 399 | 3300006852 | Ga0075433_10022793 | Ga0075433_100227932 | 300 |
| 400 | 3300006871 | Ga0075434_100006981 | Ga0075434_1000069817 | 300 |
| 401 | 3300025922 | Ga0207646_10202677 | Ga0207646_102026772 | 300 |
| 402 | 3300036401 | Ga0373937_0016632 | Ga0373937_0016632_1686_2588 | 300 |
| 403 | 3300047471 | Ga0495684_0060607 | Ga0495684_0060607_446_1387 | 300 |
| 404 | 3300047472 | Ga0495686_0005090 | Ga0495686_0005090_5701_6741 | 300 |
| 405 | 3300049569 | Ga0501032_0092299 | Ga0501032_0092299_195_1097 | 300 |
| 406 | 3300049572 | Ga0501036_0256190 | Ga0501036_0256190_513_1415 | 300 |
| 407 | 3300049575 | Ga0501039_0072157 | Ga0501039_0072157_1681_2583 | 300 |
| 408 | 3300049576 | Ga0501040_0011752 | Ga0501040_0011752_1998_2900 | 300 |
| 409 | 3300049577 | Ga0501041_0046124 | Ga0501041_0046124_1116_2018 | 300 |
| 410 | 3300049577 | Ga0501041_0049742 | Ga0501041_0049742_1509_2411 | 300 |
| 411 | 3300049578 | Ga0501042_0146431 | Ga0501042_0146431_369_1271 | 300 |
| 412 | 3300049587 | Ga0501071_0334427 | Ga0501071_0334427_36_938 | 300 |
| 413 | 3300049588 | Ga0501072_0015127 | Ga0501072_0015127_2530_3432 | 300 |
| 414 | 3300049591 | Ga0501075_0027856 | Ga0501075_0027856_23_925 | 300 |
| 415 | 3300049741 | Ga0501079_0198577 | Ga0501079_0198577_128_1030 | 300 |
| 416 | 3300049742 | Ga0501080_0087644 | Ga0501080_0087644_1924_2826 | 300 |
| 417 | 3300049743 | Ga0501081_0013622 | Ga0501081_0013622_2109_3011 | 300 |
| 418 | 3300049824 | Ga0501045_0005172 | Ga0501045_0005172_8010_8912 | 300 |
| 419 | 3300049824 | Ga0501045_0103026 | Ga0501045_0103026_123_1025 | 300 |
| 420 | 3300050512 | nmdc:mga0n895_52897_c1 | nmdc:mga0n895_52897_c1_206_1108 | 300 |
| 421 | 3300050515 | nmdc:mga0a205_39079_c1 | nmdc:mga0a205_39079_c1_1101_2003 | 300 |
| 422 | 3300054114 | Ga0501084_0036657 | Ga0501084_0036657_1461_2363 | 300 |
| 423 | 3300060353 | Ga0501082_0105554 | Ga0501082_0105554_1144_2046 | 300 |
| 424 | 3300060353 | Ga0501082_0546601 | Ga0501082_0546601_85_987 | 300 |
| 425 | 3300061734 | Ga0530510_0076676 | Ga0530510_0076676_1070_1972 | 300 |
| 426 | 3300003316 | rootH1_10092327 | rootH1_100923272 | 301 |
| 427 | 3300005290 | Ga0065712_10001235 | Ga0065712_100012359 | 301 |
| 428 | 3300005290 | Ga0065712_10075702 | Ga0065712_100757022 | 301 |
| 429 | 3300005293 | Ga0065715_10218435 | Ga0065715_102184351 | 301 |
| 430 | 3300005328 | Ga0070676_10000044 | Ga0070676_1000004432 | 301 |
| 431 | 3300005329 | Ga0070683_100000860 | Ga0070683_1000008606 | 301 |
| 432 | 3300005329 | Ga0070683_100024856 | Ga0070683_1000248563 | 301 |
| 433 | 3300005330 | Ga0070690_100000115 | Ga0070690_10000011529 | 301 |
| 434 | 3300005331 | Ga0070670_100000440 | Ga0070670_10000044027 | 301 |
| 435 | 3300005333 | Ga0070677_10000321 | Ga0070677_100003211 | 301 |
| 436 | 3300005334 | Ga0068869_100000129 | Ga0068869_1000001295 | 301 |
| 437 | 3300005334 | Ga0068869_100008317 | Ga0068869_1000083173 | 301 |
| 438 | 3300005335 | Ga0070666_10000277 | Ga0070666_1000027727 | 301 |
| 439 | 3300005335 | Ga0070666_10037238 | Ga0070666_100372382 | 301 |
| 440 | 3300005336 | Ga0070680_100253975 | Ga0070680_1002539751 | 301 |
| 441 | 3300005338 | Ga0068868_100000812 | Ga0068868_10000081217 | 301 |
| 442 | 3300005339 | Ga0070660_100000052 | Ga0070660_10000005222 | 301 |
| 443 | 3300005340 | Ga0070689_100000089 | Ga0070689_10000008917 | 301 |
| 444 | 3300005343 | Ga0070687_100000046 | Ga0070687_10000004619 | 301 |
| 445 | 3300005344 | Ga0070661_100000932 | Ga0070661_1000009328 | 301 |
| 446 | 3300005344 | Ga0070661_100005995 | Ga0070661_1000059952 | 301 |
| 447 | 3300005344 | Ga0070661_100082666 | Ga0070661_1000826662 | 301 |
| 448 | 3300005345 | Ga0070692_10006253 | Ga0070692_100062533 | 301 |
| 449 | 3300005345 | Ga0070692_10036909 | Ga0070692_100369092 | 301 |
| 450 | 3300005347 | Ga0070668_100001956 | Ga0070668_1000019568 | 301 |
| 451 | 3300005347 | Ga0070668_100146173 | Ga0070668_1001461732 | 301 |
| 452 | 3300005353 | Ga0070669_100000477 | Ga0070669_1000004778 | 301 |
| 453 | 3300005353 | Ga0070669_100004675 | Ga0070669_1000046756 | 301 |
| 454 | 3300005353 | Ga0070669_100011442 | Ga0070669_1000114424 | 301 |
| 455 | 3300005353 | Ga0070669_100047644 | Ga0070669_1000476442 | 301 |
| 456 | 3300005354 | Ga0070675_100000114 | Ga0070675_10000011416 | 301 |
| 457 | 3300005354 | Ga0070675_100076866 | Ga0070675_1000768663 | 301 |
| 458 | 3300005354 | Ga0070675_100107032 | Ga0070675_1001070322 | 301 |
| 459 | 3300005355 | Ga0070671_100001522 | Ga0070671_1000015228 | 301 |
| 460 | 3300005355 | Ga0070671_100006915 | Ga0070671_1000069152 | 301 |
| 461 | 3300005355 | Ga0070671_100097544 | Ga0070671_1000975441 | 301 |
| 462 | 3300005356 | Ga0070674_100000067 | Ga0070674_10000006736 | 301 |
| 463 | 3300005356 | Ga0070674_100000516 | Ga0070674_1000005163 | 301 |
| 464 | 3300005364 | Ga0070673_100000108 | Ga0070673_1000001083 | 301 |
| 465 | 3300005364 | Ga0070673_100011700 | Ga0070673_1000117002 | 301 |
| 466 | 3300005365 | Ga0070688_100000035 | Ga0070688_10000003539 | 301 |
| 467 | 3300005365 | Ga0070688_100110004 | Ga0070688_1001100042 | 301 |
| 468 | 3300005366 | Ga0070659_100000369 | Ga0070659_1000003694 | 301 |
| 469 | 3300005367 | Ga0070667_100000478 | Ga0070667_10000047836 | 301 |
| 470 | 3300005367 | Ga0070667_100015673 | Ga0070667_1000156735 | 301 |
| 471 | 3300005367 | Ga0070667_100038314 | Ga0070667_1000383143 | 301 |
| 472 | 3300005438 | Ga0070701_10002593 | Ga0070701_100025934 | 301 |
| 473 | 3300005438 | Ga0070701_10113673 | Ga0070701_101136732 | 301 |
| 474 | 3300005440 | Ga0070705_100000267 | Ga0070705_1000002672 | 301 |
| 475 | 3300005440 | Ga0070705_100001707 | Ga0070705_1000017073 | 301 |
| 476 | 3300005441 | Ga0070700_100003776 | Ga0070700_1000037765 | 301 |
| 477 | 3300005444 | Ga0070694_100067985 | Ga0070694_1000679853 | 301 |
| 478 | 3300005444 | Ga0070694_100363470 | Ga0070694_1003634701 | 301 |
| 479 | 3300005455 | Ga0070663_100011308 | Ga0070663_1000113082 | 301 |
| 480 | 3300005455 | Ga0070663_100014725 | Ga0070663_1000147253 | 301 |
| 481 | 3300005456 | Ga0070678_100000162 | Ga0070678_1000001629 | 301 |
| 482 | 3300005456 | Ga0070678_100008129 | Ga0070678_1000081293 | 301 |
| 483 | 3300005456 | Ga0070678_100203397 | Ga0070678_1002033972 | 301 |
| 484 | 3300005457 | Ga0070662_100000106 | Ga0070662_10000010614 | 301 |
| 485 | 3300005457 | Ga0070662_100000261 | Ga0070662_1000002614 | 301 |
| 486 | 3300005458 | Ga0070681_10124115 | Ga0070681_101241153 | 301 |
| 487 | 3300005459 | Ga0068867_100000105 | Ga0068867_10000010514 | 301 |
| 488 | 3300005459 | Ga0068867_100000414 | Ga0068867_10000041418 | 301 |
| 489 | 3300005466 | Ga0070685_10000242 | Ga0070685_1000024222 | 301 |
| 490 | 3300005530 | Ga0070679_100035189 | Ga0070679_1000351892 | 301 |
| 491 | 3300005535 | Ga0070684_100000380 | Ga0070684_10000038019 | 301 |
| 492 | 3300005535 | Ga0070684_100024751 | Ga0070684_1000247512 | 301 |
| 493 | 3300005535 | Ga0070684_100100398 | Ga0070684_1001003982 | 301 |
| 494 | 3300005536 | Ga0070697_100169138 | Ga0070697_1001691382 | 301 |
| 495 | 3300005539 | Ga0068853_100000288 | Ga0068853_1000002884 | 301 |
| 496 | 3300005543 | Ga0070672_100000076 | Ga0070672_10000007634 | 301 |
| 497 | 3300005543 | Ga0070672_100086209 | Ga0070672_1000862092 | 301 |
| 498 | 3300005543 | Ga0070672_100190633 | Ga0070672_1001906331 | 301 |
| 499 | 3300005544 | Ga0070686_100000368 | Ga0070686_10000036817 | 301 |
| 500 | 3300005544 | Ga0070686_100037390 | Ga0070686_1000373902 | 301 |
| 501 | 3300005545 | Ga0070695_100025572 | Ga0070695_1000255721 | 301 |
| 502 | 3300005546 | Ga0070696_100008223 | Ga0070696_1000082232 | 301 |
| 503 | 3300005546 | Ga0070696_100009243 | Ga0070696_1000092433 | 301 |
| 504 | 3300005546 | Ga0070696_100029142 | Ga0070696_1000291424 | 301 |
| 505 | 3300005547 | Ga0070693_100027964 | Ga0070693_1000279642 | 301 |
| 506 | 3300005548 | Ga0070665_100001106 | Ga0070665_10000110627 | 301 |
| 507 | 3300005549 | Ga0070704_100003479 | Ga0070704_1000034796 | 301 |
| 508 | 3300005563 | Ga0068855_100000202 | Ga0068855_10000020229 | 301 |
| 509 | 3300005564 | Ga0070664_100000353 | Ga0070664_10000035311 | 301 |
| 510 | 3300005564 | Ga0070664_100000533 | Ga0070664_10000053322 | 301 |
| 511 | 3300005564 | Ga0070664_100019574 | Ga0070664_1000195744 | 301 |
| 512 | 3300005577 | Ga0068857_100002680 | Ga0068857_10000268011 | 301 |
| 513 | 3300005578 | Ga0068854_100000154 | Ga0068854_10000015436 | 301 |
| 514 | 3300005578 | Ga0068854_100017526 | Ga0068854_1000175265 | 301 |
| 515 | 3300005614 | Ga0068856_100001685 | Ga0068856_1000016856 | 301 |
| 516 | 3300005615 | Ga0070702_100005235 | Ga0070702_1000052357 | 301 |
| 517 | 3300005615 | Ga0070702_100078389 | Ga0070702_1000783892 | 301 |
| 518 | 3300005616 | Ga0068852_100000109 | Ga0068852_10000010912 | 301 |
| 519 | 3300005616 | Ga0068852_100066024 | Ga0068852_1000660243 | 301 |
| 520 | 3300005617 | Ga0068859_100074998 | Ga0068859_1000749983 | 301 |
| 521 | 3300005618 | Ga0068864_100000374 | Ga0068864_10000037434 | 301 |
| 522 | 3300005618 | Ga0068864_100007605 | Ga0068864_1000076058 | 301 |
| 523 | 3300005718 | Ga0068866_10000059 | Ga0068866_1000005910 | 301 |
| 524 | 3300005718 | Ga0068866_10000089 | Ga0068866_100000899 | 301 |
| 525 | 3300005719 | Ga0068861_100000059 | Ga0068861_10000005911 | 301 |
| 526 | 3300005719 | Ga0068861_100006973 | Ga0068861_1000069734 | 301 |
| 527 | 3300005719 | Ga0068861_100312945 | Ga0068861_1003129452 | 301 |
| 528 | 3300005834 | Ga0068851_10000065 | Ga0068851_1000006533 | 301 |
| 529 | 3300005840 | Ga0068870_10000327 | Ga0068870_100003275 | 301 |
| 530 | 3300005841 | Ga0068863_100001278 | Ga0068863_10000127816 | 301 |
| 531 | 3300005841 | Ga0068863_100016732 | Ga0068863_1000167323 | 301 |
| 532 | 3300005842 | Ga0068858_100000680 | Ga0068858_10000068029 | 301 |
| 533 | 3300005842 | Ga0068858_100009116 | Ga0068858_1000091165 | 301 |
| 534 | 3300005843 | Ga0068860_100000483 | Ga0068860_10000048310 | 301 |
| 535 | 3300005843 | Ga0068860_100002818 | Ga0068860_1000028189 | 301 |
| 536 | 3300005843 | Ga0068860_100014859 | Ga0068860_1000148595 | 301 |
| 537 | 3300005843 | Ga0068860_100025657 | Ga0068860_1000256575 | 301 |
| 538 | 3300005843 | Ga0068860_100119133 | Ga0068860_1001191332 | 301 |
| 539 | 3300005844 | Ga0068862_100000523 | Ga0068862_10000052327 | 301 |
| 540 | 3300005844 | Ga0068862_100017232 | Ga0068862_1000172323 | 301 |
| 541 | 3300005983 | Ga0081540_1000298 | Ga0081540_100029834 | 301 |
| 542 | 3300005983 | Ga0081540_1007881 | Ga0081540_10078812 | 301 |
| 543 | 3300006237 | Ga0097621_100000831 | Ga0097621_10000083111 | 301 |
| 544 | 3300006237 | Ga0097621_100017185 | Ga0097621_1000171856 | 301 |
| 545 | 3300006237 | Ga0097621_100077266 | Ga0097621_1000772662 | 301 |
| 546 | 3300006358 | Ga0068871_100004948 | Ga0068871_1000049483 | 301 |
| 547 | 3300006358 | Ga0068871_100126138 | Ga0068871_1001261383 | 301 |
| 548 | 3300006358 | Ga0068871_100369402 | Ga0068871_1003694021 | 301 |
| 549 | 3300006844 | Ga0075428_100119830 | Ga0075428_1001198301 | 301 |
| 550 | 3300006844 | Ga0075428_100355877 | Ga0075428_1003558771 | 301 |
| 551 | 3300006844 | Ga0075428_100555835 | Ga0075428_1005558351 | 301 |
| 552 | 3300006846 | Ga0075430_100020970 | Ga0075430_1000209705 | 301 |
| 553 | 3300006846 | Ga0075430_100085726 | Ga0075430_1000857263 | 301 |
| 554 | 3300006846 | Ga0075430_100132371 | Ga0075430_1001323712 | 301 |
| 555 | 3300006846 | Ga0075430_100136911 | Ga0075430_1001369111 | 301 |
| 556 | 3300006847 | Ga0075431_100016053 | Ga0075431_1000160532 | 301 |
| 557 | 3300006847 | Ga0075431_100021860 | Ga0075431_1000218604 | 301 |
| 558 | 3300006847 | Ga0075431_100361018 | Ga0075431_1003610182 | 301 |
| 559 | 3300006847 | Ga0075431_100415083 | Ga0075431_1004150831 | 301 |
| 560 | 3300006852 | Ga0075433_10018948 | Ga0075433_100189484 | 301 |
| 561 | 3300006852 | Ga0075433_10271427 | Ga0075433_102714272 | 301 |
| 562 | 3300006880 | Ga0075429_100073997 | Ga0075429_1000739973 | 301 |
| 563 | 3300006880 | Ga0075429_100120000 | Ga0075429_1001200001 | 301 |
| 564 | 3300006880 | Ga0075429_100241580 | Ga0075429_1002415802 | 301 |
| 565 | 3300006880 | Ga0075429_100293680 | Ga0075429_1002936802 | 301 |
| 566 | 3300006881 | Ga0068865_100000080 | Ga0068865_10000008039 | 301 |
| 567 | 3300006881 | Ga0068865_100002537 | Ga0068865_1000025374 | 301 |
| 568 | 3300006931 | Ga0097620_100074996 | Ga0097620_1000749962 | 301 |
| 569 | 3300007076 | Ga0075435_100037247 | Ga0075435_1000372471 | 301 |
| 570 | 3300007076 | Ga0075435_100261048 | Ga0075435_1002610482 | 301 |
| 571 | 3300009093 | Ga0105240_10025630 | Ga0105240_100256308 | 301 |
| 572 | 3300009093 | Ga0105240_10166009 | Ga0105240_101660093 | 301 |
| 573 | 3300009094 | Ga0111539_10052759 | Ga0111539_100527593 | 301 |
| 574 | 3300009094 | Ga0111539_10115411 | Ga0111539_101154111 | 301 |
| 575 | 3300009098 | Ga0105245_10002431 | Ga0105245_100024315 | 301 |
| 576 | 3300009098 | Ga0105245_10003537 | Ga0105245_100035372 | 301 |
| 577 | 3300009098 | Ga0105245_10040281 | Ga0105245_100402813 | 301 |
| 578 | 3300009101 | Ga0105247_10001615 | Ga0105247_1000161512 | 301 |
| 579 | 3300009101 | Ga0105247_10120795 | Ga0105247_101207951 | 301 |
| 580 | 3300009147 | Ga0114129_10002787 | Ga0114129_100027879 | 301 |
| 581 | 3300009147 | Ga0114129_10005266 | Ga0114129_100052666 | 301 |
| 582 | 3300009147 | Ga0114129_10064503 | Ga0114129_100645033 | 301 |
| 583 | 3300009148 | Ga0105243_10010142 | Ga0105243_100101425 | 301 |
| 584 | 3300009148 | Ga0105243_10199404 | Ga0105243_101994042 | 301 |
| 585 | 3300009148 | Ga0105243_10383877 | Ga0105243_103838772 | 301 |
| 586 | 3300009174 | Ga0105241_10000182 | Ga0105241_1000018239 | 301 |
| 587 | 3300009174 | Ga0105241_10014236 | Ga0105241_100142363 | 301 |
| 588 | 3300009176 | Ga0105242_10004015 | Ga0105242_100040157 | 301 |
| 589 | 3300009176 | Ga0105242_10004174 | Ga0105242_100041743 | 301 |
| 590 | 3300009177 | Ga0105248_10001050 | Ga0105248_1000105014 | 301 |
| 591 | 3300009177 | Ga0105248_10001923 | Ga0105248_100019235 | 301 |
| 592 | 3300009177 | Ga0105248_10004922 | Ga0105248_100049223 | 301 |
| 593 | 3300009551 | Ga0105238_10000297 | Ga0105238_1000029712 | 301 |
| 594 | 3300009551 | Ga0105238_10041612 | Ga0105238_100416124 | 301 |
| 595 | 3300009553 | Ga0105249_10000280 | Ga0105249_1000028039 | 301 |
| 596 | 3300009553 | Ga0105249_10000720 | Ga0105249_100007202 | 301 |
| 597 | 3300009553 | Ga0105249_10004530 | Ga0105249_100045309 | 301 |
| 598 | 3300009553 | Ga0105249_10301018 | Ga0105249_103010181 | 301 |
| 599 | 3300010375 | Ga0105239_10000709 | Ga0105239_1000070937 | 301 |
| 600 | 3300010375 | Ga0105239_10041496 | Ga0105239_100414962 | 301 |
| 601 | 3300010375 | Ga0105239_10186026 | Ga0105239_101860264 | 301 |
| 602 | 3300011119 | Ga0105246_10169792 | Ga0105246_101697922 | 301 |
| 603 | 3300011119 | Ga0105246_10504339 | Ga0105246_105043391 | 301 |
| 604 | 3300013100 | Ga0157373_10005090 | Ga0157373_1000509010 | 301 |
| 605 | 3300013102 | Ga0157371_10000340 | Ga0157371_1000034039 | 301 |
| 606 | 3300013105 | Ga0157369_10001580 | Ga0157369_100015808 | 301 |
| 607 | 3300013296 | Ga0157374_10000208 | Ga0157374_1000020816 | 301 |
| 608 | 3300013296 | Ga0157374_10013897 | Ga0157374_100138972 | 301 |
| 609 | 3300013297 | Ga0157378_10000152 | Ga0157378_1000015246 | 301 |
| 610 | 3300013297 | Ga0157378_10002577 | Ga0157378_1000257717 | 301 |
| 611 | 3300013306 | Ga0163162_10005524 | Ga0163162_1000552410 | 301 |
| 612 | 3300013306 | Ga0163162_10034653 | Ga0163162_100346534 | 301 |
| 613 | 3300013307 | Ga0157372_10001598 | Ga0157372_100015986 | 301 |
| 614 | 3300013307 | Ga0157372_10153593 | Ga0157372_101535933 | 301 |
| 615 | 3300013307 | Ga0157372_10394123 | Ga0157372_103941231 | 301 |
| 616 | 3300013308 | Ga0157375_10000252 | Ga0157375_1000025239 | 301 |
| 617 | 3300013308 | Ga0157375_10016342 | Ga0157375_100163422 | 301 |
| 618 | 3300013308 | Ga0157375_10371322 | Ga0157375_103713222 | 301 |
| 619 | 3300014325 | Ga0163163_10010093 | Ga0163163_100100934 | 301 |
| 620 | 3300014325 | Ga0163163_10010283 | Ga0163163_100102839 | 301 |
| 621 | 3300014325 | Ga0163163_10017851 | Ga0163163_100178515 | 301 |
| 622 | 3300014325 | Ga0163163_10474705 | Ga0163163_104747052 | 301 |
| 623 | 3300014745 | Ga0157377_10000141 | Ga0157377_1000014134 | 301 |
| 624 | 3300014968 | Ga0157379_10000079 | Ga0157379_1000007920 | 301 |
| 625 | 3300014968 | Ga0157379_10000316 | Ga0157379_1000031632 | 301 |
| 626 | 3300014968 | Ga0157379_10012769 | Ga0157379_100127692 | 301 |
| 627 | 3300014969 | Ga0157376_10027626 | Ga0157376_100276265 | 301 |
| 628 | 3300014969 | Ga0157376_10095751 | Ga0157376_100957512 | 301 |
| 629 | 3300017792 | Ga0163161_10005385 | Ga0163161_100053855 | 301 |
| 630 | 3300025315 | Ga0207697_10001148 | Ga0207697_100011483 | 301 |
| 631 | 3300025321 | Ga0207656_10000341 | Ga0207656_1000034111 | 301 |
| 632 | 3300025893 | Ga0207682_10002257 | Ga0207682_100022571 | 301 |
| 633 | 3300025899 | Ga0207642_10000041 | Ga0207642_1000004131 | 301 |
| 634 | 3300025899 | Ga0207642_10004156 | Ga0207642_100041563 | 301 |
| 635 | 3300025900 | Ga0207710_10000704 | Ga0207710_100007043 | 301 |
| 636 | 3300025901 | Ga0207688_10000015 | Ga0207688_1000001523 | 301 |
| 637 | 3300025903 | Ga0207680_10000063 | Ga0207680_1000006310 | 301 |
| 638 | 3300025903 | Ga0207680_10047216 | Ga0207680_100472163 | 301 |
| 639 | 3300025903 | Ga0207680_10136185 | Ga0207680_101361852 | 301 |
| 640 | 3300025904 | Ga0207647_10001319 | Ga0207647_100013195 | 301 |
| 641 | 3300025907 | Ga0207645_10000025 | Ga0207645_1000002554 | 301 |
| 642 | 3300025907 | Ga0207645_10004995 | Ga0207645_1000499510 | 301 |
| 643 | 3300025908 | Ga0207643_10000023 | Ga0207643_1000002361 | 301 |
| 644 | 3300025909 | Ga0207705_10001179 | Ga0207705_1000117911 | 301 |
| 645 | 3300025911 | Ga0207654_10003091 | Ga0207654_100030912 | 301 |
| 646 | 3300025912 | Ga0207707_10097164 | Ga0207707_100971642 | 301 |
| 647 | 3300025913 | Ga0207695_10019759 | Ga0207695_100197592 | 301 |
| 648 | 3300025914 | Ga0207671_10000645 | Ga0207671_100006459 | 301 |
| 649 | 3300025917 | Ga0207660_10051258 | Ga0207660_100512583 | 301 |
| 650 | 3300025917 | Ga0207660_10107856 | Ga0207660_101078562 | 301 |
| 651 | 3300025918 | Ga0207662_10000020 | Ga0207662_1000002017 | 301 |
| 652 | 3300025919 | Ga0207657_10000067 | Ga0207657_1000006753 | 301 |
| 653 | 3300025920 | Ga0207649_10001061 | Ga0207649_100010614 | 301 |
| 654 | 3300025920 | Ga0207649_10039341 | Ga0207649_100393412 | 301 |
| 655 | 3300025921 | Ga0207652_10282805 | Ga0207652_102828052 | 301 |
| 656 | 3300025923 | Ga0207681_10000192 | Ga0207681_1000019231 | 301 |
| 657 | 3300025923 | Ga0207681_10012927 | Ga0207681_100129276 | 301 |
| 658 | 3300025923 | Ga0207681_10066897 | Ga0207681_100668973 | 301 |
| 659 | 3300025924 | Ga0207694_10000636 | Ga0207694_1000063614 | 301 |
| 660 | 3300025925 | Ga0207650_10000147 | Ga0207650_1000014724 | 301 |
| 661 | 3300025925 | Ga0207650_10006362 | Ga0207650_100063622 | 301 |
| 662 | 3300025926 | Ga0207659_10000083 | Ga0207659_1000008316 | 301 |
| 663 | 3300025926 | Ga0207659_10124013 | Ga0207659_101240132 | 301 |
| 664 | 3300025926 | Ga0207659_10259352 | Ga0207659_102593522 | 301 |
| 665 | 3300025927 | Ga0207687_10001087 | Ga0207687_100010878 | 301 |
| 666 | 3300025927 | Ga0207687_10036476 | Ga0207687_100364763 | 301 |
| 667 | 3300025927 | Ga0207687_10041261 | Ga0207687_100412613 | 301 |
| 668 | 3300025931 | Ga0207644_10000711 | Ga0207644_100007119 | 301 |
| 669 | 3300025931 | Ga0207644_10099848 | Ga0207644_100998482 | 301 |
| 670 | 3300025932 | Ga0207690_10000121 | Ga0207690_1000012140 | 301 |
| 671 | 3300025933 | Ga0207706_10000067 | Ga0207706_1000006794 | 301 |
| 672 | 3300025933 | Ga0207706_10000119 | Ga0207706_1000011940 | 301 |
| 673 | 3300025934 | Ga0207686_10000108 | Ga0207686_100001086 | 301 |
| 674 | 3300025934 | Ga0207686_10012642 | Ga0207686_100126422 | 301 |
| 675 | 3300025934 | Ga0207686_10037288 | Ga0207686_100372882 | 301 |
| 676 | 3300025935 | Ga0207709_10004686 | Ga0207709_100046862 | 301 |
| 677 | 3300025935 | Ga0207709_10142613 | Ga0207709_101426132 | 301 |
| 678 | 3300025935 | Ga0207709_10151347 | Ga0207709_101513472 | 301 |
| 679 | 3300025936 | Ga0207670_10000100 | Ga0207670_1000010024 | 301 |
| 680 | 3300025937 | Ga0207669_10000541 | Ga0207669_100005412 | 301 |
| 681 | 3300025937 | Ga0207669_10002112 | Ga0207669_100021122 | 301 |
| 682 | 3300025938 | Ga0207704_10000080 | Ga0207704_1000008016 | 301 |
| 683 | 3300025940 | Ga0207691_10000079 | Ga0207691_1000007938 | 301 |
| 684 | 3300025940 | Ga0207691_10035191 | Ga0207691_100351913 | 301 |
| 685 | 3300025941 | Ga0207711_10000189 | Ga0207711_1000018939 | 301 |
| 686 | 3300025941 | Ga0207711_10019936 | Ga0207711_100199363 | 301 |
| 687 | 3300025941 | Ga0207711_10050601 | Ga0207711_100506014 | 301 |
| 688 | 3300025942 | Ga0207689_10000089 | Ga0207689_1000008954 | 301 |
| 689 | 3300025942 | Ga0207689_10000496 | Ga0207689_100004967 | 301 |
| 690 | 3300025944 | Ga0207661_10001303 | Ga0207661_100013036 | 301 |
| 691 | 3300025944 | Ga0207661_10097722 | Ga0207661_100977222 | 301 |
| 692 | 3300025944 | Ga0207661_10227593 | Ga0207661_102275932 | 301 |
| 693 | 3300025945 | Ga0207679_10000478 | Ga0207679_1000047810 | 301 |
| 694 | 3300025945 | Ga0207679_10000687 | Ga0207679_100006872 | 301 |
| 695 | 3300025945 | Ga0207679_10040700 | Ga0207679_100407002 | 301 |
| 696 | 3300025945 | Ga0207679_10251489 | Ga0207679_102514892 | 301 |
| 697 | 3300025949 | Ga0207667_10003595 | Ga0207667_100035958 | 301 |
| 698 | 3300025949 | Ga0207667_10053457 | Ga0207667_100534572 | 301 |
| 699 | 3300025960 | Ga0207651_10000054 | Ga0207651_1000005411 | 301 |
| 700 | 3300025960 | Ga0207651_10049873 | Ga0207651_100498733 | 301 |
| 701 | 3300025960 | Ga0207651_10539720 | Ga0207651_105397201 | 301 |
| 702 | 3300025961 | Ga0207712_10000157 | Ga0207712_1000015739 | 301 |
| 703 | 3300025961 | Ga0207712_10013755 | Ga0207712_100137552 | 301 |
| 704 | 3300025961 | Ga0207712_10314754 | Ga0207712_103147542 | 301 |
| 705 | 3300025972 | Ga0207668_10000445 | Ga0207668_1000044523 | 301 |
| 706 | 3300025972 | Ga0207668_10185524 | Ga0207668_101855241 | 301 |
| 707 | 3300025981 | Ga0207640_10000170 | Ga0207640_1000017016 | 301 |
| 708 | 3300025981 | Ga0207640_10015712 | Ga0207640_100157125 | 301 |
| 709 | 3300025986 | Ga0207658_10000331 | Ga0207658_1000033138 | 301 |
| 710 | 3300025986 | Ga0207658_10093837 | Ga0207658_100938373 | 301 |
| 711 | 3300025986 | Ga0207658_10155465 | Ga0207658_101554652 | 301 |
| 712 | 3300026023 | Ga0207677_10000113 | Ga0207677_1000011339 | 301 |
| 713 | 3300026035 | Ga0207703_10000265 | Ga0207703_1000026547 | 301 |
| 714 | 3300026035 | Ga0207703_10110291 | Ga0207703_101102912 | 301 |
| 715 | 3300026041 | Ga0207639_10003211 | Ga0207639_100032117 | 301 |
| 716 | 3300026067 | Ga0207678_10000591 | Ga0207678_1000059112 | 301 |
| 717 | 3300026075 | Ga0207708_10001214 | Ga0207708_100012145 | 301 |
| 718 | 3300026078 | Ga0207702_10009455 | Ga0207702_100094555 | 301 |
| 719 | 3300026078 | Ga0207702_10174927 | Ga0207702_101749272 | 301 |
| 720 | 3300026088 | Ga0207641_10001477 | Ga0207641_1000147715 | 301 |
| 721 | 3300026088 | Ga0207641_10094618 | Ga0207641_100946182 | 301 |
| 722 | 3300026089 | Ga0207648_10000029 | Ga0207648_1000002995 | 301 |
| 723 | 3300026089 | Ga0207648_10000095 | Ga0207648_1000009538 | 301 |
| 724 | 3300026095 | Ga0207676_10000226 | Ga0207676_1000022610 | 301 |
| 725 | 3300026095 | Ga0207676_10004153 | Ga0207676_100041538 | 301 |
| 726 | 3300026116 | Ga0207674_10000177 | Ga0207674_1000017716 | 301 |
| 727 | 3300026116 | Ga0207674_10007864 | Ga0207674_100078649 | 301 |
| 728 | 3300026118 | Ga0207675_100039122 | Ga0207675_1000391226 | 301 |
| 729 | 3300026121 | Ga0207683_10000050 | Ga0207683_1000005029 | 301 |
| 730 | 3300026121 | Ga0207683_10003044 | Ga0207683_100030443 | 301 |
| 731 | 3300026121 | Ga0207683_10099143 | Ga0207683_100991432 | 301 |
| 732 | 3300026121 | Ga0207683_10169344 | Ga0207683_101693442 | 301 |
| 733 | 3300026142 | Ga0207698_10000149 | Ga0207698_1000014910 | 301 |
| 734 | 3300026142 | Ga0207698_10119257 | Ga0207698_101192572 | 301 |
| 735 | 3300028379 | Ga0268266_10000415 | Ga0268266_1000041524 | 301 |
| 736 | 3300028380 | Ga0268265_10000581 | Ga0268265_1000058119 | 301 |
| 737 | 3300028380 | Ga0268265_10234053 | Ga0268265_102340532 | 301 |
| 738 | 3300028381 | Ga0268264_10000485 | Ga0268264_1000048510 | 301 |
| 739 | 3300028381 | Ga0268264_10012196 | Ga0268264_100121965 | 301 |
| 740 | 3300028381 | Ga0268264_10013128 | Ga0268264_100131284 | 301 |
| 741 | 3300028381 | Ga0268264_10024518 | Ga0268264_100245185 | 301 |
| 742 | 3300028381 | Ga0268264_10383297 | Ga0268264_103832972 | 301 |
| 743 | 3300031240 | Ga0265320_10030264 | Ga0265320_100302642 | 301 |
| 744 | 3300031507 | Ga0307509_10000112 | Ga0307509_1000011246 | 301 |
| 745 | 3300031507 | Ga0307509_10124024 | Ga0307509_101240243 | 301 |
| 746 | 3300031711 | Ga0265314_10010946 | Ga0265314_100109463 | 301 |
| 747 | 3300035116 | Ga0373945_0054202 | Ga0373945_0054202_427_1356 | 301 |
| 748 | 3300035170 | Ga0373943_0022391 | Ga0373943_0022391_40_969 | 301 |
| 749 | 3300035171 | Ga0373946_0045980 | Ga0373946_0045980_46_960 | 301 |
| 750 | 3300035691 | Ga0373931_0132354 | Ga0373931_0132354_482_1390 | 301 |
| 751 | 3300035695 | Ga0373927_0010358 | Ga0373927_0010358_3114_4028 | 301 |
| 752 | 3300035695 | Ga0373927_0179400 | Ga0373927_0179400_19_1074 | 301 |
| 753 | 3300035725 | Ga0373947_0019264 | Ga0373947_0019264_1003_1932 | 301 |
| 754 | 3300035725 | Ga0373947_0027662 | Ga0373947_0027662_918_1973 | 301 |
| 755 | 3300036401 | Ga0373937_0001843 | Ga0373937_0001843_9812_10720 | 301 |
| 756 | 3300037068 | Ga0373925_0001061 | Ga0373925_0001061_13480_14409 | 301 |
| 757 | 3300037068 | Ga0373925_0001237 | Ga0373925_0001237_12726_13640 | 301 |
| 758 | 3300042876 | Ga0451577_0020932 | Ga0451577_0020932_473_1387 | 301 |
| 759 | 3300042876 | Ga0451577_0037789 | Ga0451577_0037789_782_1690 | 301 |
| 760 | 3300042876 | Ga0451577_0094760 | Ga0451577_0094760_1100_2026 | 301 |
| 761 | 3300044712 | Ga0453684_0070149 | Ga0453684_0070149_1037_1951 | 301 |
| 762 | 3300045051 | Ga0451576_0100913 | Ga0451576_0100913_1811_2737 | 301 |
| 763 | 3300045051 | Ga0451576_0336365 | Ga0451576_0336365_272_1180 | 301 |
| 764 | 3300046455 | Ga0495603_0093829 | Ga0495603_0093829_67_975 | 301 |
| 765 | 3300046511 | Ga0495608_0225555 | Ga0495608_0225555_143_1048 | 301 |
| 766 | 3300046535 | Ga0495586_0001823 | Ga0495586_0001823_6381_7310 | 301 |
| 767 | 3300046642 | Ga0495634_0129804 | Ga0495634_0129804_166_1071 | 301 |
| 768 | 3300046681 | Ga0495647_0104382 | Ga0495647_0104382_180_1109 | 301 |
| 769 | 3300046683 | Ga0495658_0003780 | Ga0495658_0003780_2327_3256 | 301 |
| 770 | 3300047321 | Ga0495676_0014703 | Ga0495676_0014703_1836_2765 | 301 |
| 771 | 3300047472 | Ga0495686_0021780 | Ga0495686_0021780_1113_2117 | 301 |
| 772 | 3300048903 | Ga0496100_0106006 | Ga0496100_0106006_698_1630 | 301 |
| 773 | 3300048904 | Ga0496101_0180074 | Ga0496101_0180074_124_1056 | 301 |
| 774 | 3300048905 | Ga0496102_0004082 | Ga0496102_0004082_3908_4840 | 301 |
| 775 | 3300048906 | Ga0496103_0013364 | Ga0496103_0013364_1365_2297 | 301 |
| 776 | 3300048907 | Ga0496104_0021139 | Ga0496104_0021139_2942_3856 | 301 |
| 777 | 3300048907 | Ga0496104_0055354 | Ga0496104_0055354_559_1467 | 301 |
| 778 | 3300048908 | Ga0496105_0022542 | Ga0496105_0022542_3696_4610 | 301 |
| 779 | 3300048908 | Ga0496105_0302198 | Ga0496105_0302198_270_1178 | 301 |
| 780 | 3300048909 | Ga0496106_0008043 | Ga0496106_0008043_1891_2823 | 301 |
| 781 | 3300048910 | Ga0496107_0027874 | Ga0496107_0027874_2820_3752 | 301 |
| 782 | 3300048911 | Ga0496108_0038333 | Ga0496108_0038333_667_1599 | 301 |
| 783 | 3300048911 | Ga0496108_0068704 | Ga0496108_0068704_1401_2315 | 301 |
| 784 | 3300048912 | Ga0496109_0000709 | Ga0496109_0000709_5765_6697 | 301 |
| 785 | 3300048912 | Ga0496109_0003803 | Ga0496109_0003803_1343_2257 | 301 |
| 786 | 3300048913 | Ga0496110_0004326 | Ga0496110_0004326_2690_3604 | 301 |
| 787 | 3300048914 | Ga0496111_0179552 | Ga0496111_0179552_35_949 | 301 |
| 788 | 3300048915 | Ga0496112_0000210 | Ga0496112_0000210_14639_15571 | 301 |
| 789 | 3300048915 | Ga0496112_0006951 | Ga0496112_0006951_1343_2257 | 301 |
| 790 | 3300048915 | Ga0496112_0017314 | Ga0496112_0017314_5497_6405 | 301 |
| 791 | 3300048915 | Ga0496112_0290762 | Ga0496112_0290762_282_1208 | 301 |
| 792 | 3300048916 | Ga0496113_0128631 | Ga0496113_0128631_417_1349 | 301 |
| 793 | 3300048916 | Ga0496113_0248643 | Ga0496113_0248643_451_1359 | 301 |
| 794 | 3300048917 | Ga0496114_0033530 | Ga0496114_0033530_182_1090 | 301 |
| 795 | 3300048918 | Ga0496115_0055846 | Ga0496115_0055846_549_1457 | 301 |
| 796 | 3300048919 | Ga0496116_0222923 | Ga0496116_0222923_18_923 | 301 |
| 797 | 3300049572 | Ga0501036_0091618 | Ga0501036_0091618_339_1259 | 301 |
| 798 | 3300049576 | Ga0501040_0060164 | Ga0501040_0060164_1003_1923 | 301 |
| 799 | 3300049577 | Ga0501041_0058944 | Ga0501041_0058944_352_1272 | 301 |
| 800 | 3300049578 | Ga0501042_0292117 | Ga0501042_0292117_174_1094 | 301 |
| 801 | 3300049586 | Ga0501070_0098562 | Ga0501070_0098562_1044_1952 | 301 |
| 802 | 3300049586 | Ga0501070_0198321 | Ga0501070_0198321_478_1386 | 301 |
| 803 | 3300049587 | Ga0501071_0364103 | Ga0501071_0364103_84_1001 | 301 |
| 804 | 3300049588 | Ga0501072_0077055 | Ga0501072_0077055_1414_2322 | 301 |
| 805 | 3300049588 | Ga0501072_0187850 | Ga0501072_0187850_222_1142 | 301 |
| 806 | 3300049589 | Ga0501073_0027147 | Ga0501073_0027147_282_1199 | 301 |
| 807 | 3300049590 | Ga0501074_0071506 | Ga0501074_0071506_340_1260 | 301 |
| 808 | 3300049591 | Ga0501075_0077022 | Ga0501075_0077022_430_1350 | 301 |
| 809 | 3300049592 | Ga0501076_0029525 | Ga0501076_0029525_1544_2464 | 301 |
| 810 | 3300049592 | Ga0501076_0333028 | Ga0501076_0333028_55_972 | 301 |
| 811 | 3300049741 | Ga0501079_0041756 | Ga0501079_0041756_673_1593 | 301 |
| 812 | 3300049741 | Ga0501079_0196165 | Ga0501079_0196165_166_1086 | 301 |
| 813 | 3300049741 | Ga0501079_0276686 | Ga0501079_0276686_119_1036 | 301 |
| 814 | 3300049742 | Ga0501080_0391417 | Ga0501080_0391417_262_1191 | 301 |
| 815 | 3300049743 | Ga0501081_0021658 | Ga0501081_0021658_2211_3131 | 301 |
| 816 | 3300049743 | Ga0501081_0157612 | Ga0501081_0157612_536_1453 | 301 |
| 817 | 3300049744 | Ga0501083_0001915 | Ga0501083_0001915_11948_12859 | 301 |
| 818 | 3300050507 | nmdc:mga05p37_13006_c1 | nmdc:mga05p37_13006_c1_5660_6568 | 301 |
| 819 | 3300050507 | nmdc:mga05p37_18646_c1 | nmdc:mga05p37_18646_c1_2265_3218 | 301 |
| 820 | 3300050507 | nmdc:mga05p37_3575_c1 | nmdc:mga05p37_3575_c1_12520_13431 | 301 |
| 821 | 3300050508 | nmdc:mga09592_426062_c1 | nmdc:mga09592_426062_c1_167_1090 | 301 |
| 822 | 3300050508 | nmdc:mga09592_73997_c1 | nmdc:mga09592_73997_c1_1710_2663 | 301 |
| 823 | 3300050508 | nmdc:mga09592_86506_c1 | nmdc:mga09592_86506_c1_1278_2186 | 301 |
| 824 | 3300050509 | nmdc:mga0qj67_121754_c1 | nmdc:mga0qj67_121754_c1_86_994 | 301 |
| 825 | 3300050509 | nmdc:mga0qj67_147854_c1 | nmdc:mga0qj67_147854_c1_942_1853 | 301 |
| 826 | 3300050510 | nmdc:mga06r32_101213_c1 | nmdc:mga06r32_101213_c1_1316_2224 | 301 |
| 827 | 3300050510 | nmdc:mga06r32_128852_c1 | nmdc:mga06r32_128852_c1_368_1309 | 301 |
| 828 | 3300050510 | nmdc:mga06r32_196281_c1 | nmdc:mga06r32_196281_c1_75_998 | 301 |
| 829 | 3300050510 | nmdc:mga06r32_72991_c1 | nmdc:mga06r32_72991_c1_2131_3084 | 301 |
| 830 | 3300050511 | nmdc:mga08y16_128281_c1 | nmdc:mga08y16_128281_c1_566_1495 | 301 |
| 831 | 3300050511 | nmdc:mga08y16_340357_c1 | nmdc:mga08y16_340357_c1_16_969 | 301 |
| 832 | 3300050512 | nmdc:mga0n895_78706_c1 | nmdc:mga0n895_78706_c1_55_972 | 301 |
| 833 | 3300050515 | nmdc:mga0a205_320828_c1 | nmdc:mga0a205_320828_c1_441_1355 | 301 |
| 834 | 3300050515 | nmdc:mga0a205_5436_c1 | nmdc:mga0a205_5436_c1_6245_7243 | 301 |
| 835 | 3300053077 | Ga0495601_0032831 | Ga0495601_0032831_2063_2971 | 301 |
| 836 | 3300054114 | Ga0501084_0033204 | Ga0501084_0033204_3219_4139 | 301 |
| 837 | 3300054114 | Ga0501084_0315185 | Ga0501084_0315185_47_964 | 301 |
| 838 | 3300059424 | Ga0590075_006095 | Ga0590075_006095_1331_2263 | 301 |
| 839 | 3300060353 | Ga0501082_0105490 | Ga0501082_0105490_418_1326 | 301 |
| 840 | 3300060353 | Ga0501082_0242523 | Ga0501082_0242523_224_1144 | 301 |
| 841 | 3300061734 | Ga0530510_0016524 | Ga0530510_0016524_3005_3925 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Am | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.9177 | 153 | 201 |
| 1i96-assembly1.cif.gz_M | crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) | 0.9141 | 153 | 204 |
| 7nhm-assembly1.cif.gz_n | 70s ribosome from staphylococcus aureus | 0.8914 | 168 | 205 |
| 6rok-assembly1.cif.gz_A | the crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor | 0.8849 | 2 | 268 |
| 3c58-assembly1.cif.gz_A | crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and a n7-benzyl-fapy-dg containing dna | 0.8836 | 2 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9127 | 133 | 267 | 1.10.8.50 |
| 2y10M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9046 | 168 | 201 | 1.10.8.50 |
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9015 | 167 | 205 | 1.10.8.50 |
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8913 | 133 | 267 | 1.10.8.50 |
| af_L0T864_10_149_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8789 | 133 | 274 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4U9B8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9917 | 1 | 268 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A2V6X5E8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9895 | 1 | 214 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A7C4U9B8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.988 | 1 | 268 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A2V6X5E8-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9849 | 1 | 214 |
GO:0003684
GO:0006284 GO:0008270 GO:0034039 GO:0140078 |
| AF-A0A7Y1SVG2-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.977 | 1 | 210 |
GO:0003684
GO:0003906 GO:0006284 GO:0008270 GO:0016829 GO:0034039 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar