F483108

General Info

Members Datasets Scaffolds Average Seq Length
841 267 841 303

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0004353|Ga0501040_0004353_6067_6942
Length 291
Sequence VPELPDVELYLERLAPLVLDRPLERLRVASPFLVRTVDPPLGDLEGRRVVGLRRLGKRLVIELEGDLFLVLHLMVAGRLRWRERGAAVPGRVGLAAFDFPAGTLLLTEAGTKKRASLHAVRGAEGVRAFDRGGLEPLAADLDAFRDALLRENRTLKGALTDPRLFSGIGNAYADEILHRARLSPLRLTRRLTPADVERLHRAARDTLAHWLDRLRRETEGFPEKVTAFRPGMAVHGRYGQPCPDCGAPVQRIVHADNETNYCARCQTGGRLLADRALSRLLRKDWPAKLDD

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
198 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
202 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
222 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
225 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
226 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.97
Rhizosphere 95.72
Stem 0
Stem Tuber 0
Unclassified 1.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10092327 3300003316 Bacteria 2576
2 Ga0065712_10001235 3300005290 Bacteria 11731
3 Ga0065712_10075702 3300005290 Bacteria 3805
4 Ga0065715_10174411 3300005293 Bacteria 1485
5 Ga0065715_10218435 3300005293 Bacteria 1282
6 Ga0065715_10323265 3300005293 Bacteria 998
7 Ga0065707_10182615 3300005295 Bacteria 1409
8 Ga0065707_10195218 3300005295 Bacteria 1322
9 Ga0070676_10000044 3300005328 Bacteria 38502
10 Ga0070676_10055753 3300005328 Bacteria 2333
11 Ga0070683_100000860 3300005329 Bacteria 22454
12 Ga0070683_100006984 3300005329 Bacteria 9500
13 Ga0070683_100016102 3300005329 Bacteria 6582
14 Ga0070683_100024856 3300005329 Bacteria 5371
15 Ga0070683_100046381 3300005329 Bacteria 4015
16 Ga0070683_100070997 3300005329 Bacteria 3249
17 Ga0070683_100186958 3300005329 Bacteria 1967
18 Ga0070690_100000115 3300005330 Bacteria 42075
19 Ga0070690_100007942 3300005330 Bacteria 6091
20 Ga0070690_100054046 3300005330 Bacteria 2570
21 Ga0070690_100147769 3300005330 Bacteria 1601
22 Ga0070690_100265974 3300005330 Bacteria 1218
23 Ga0070670_100000440 3300005331 Bacteria 33924
24 Ga0070670_100002718 3300005331 Bacteria 14606
25 Ga0070670_100016837 3300005331 Bacteria 6274
26 Ga0070670_100068774 3300005331 Unclassified 3040
27 Ga0070677_10000321 3300005333 Bacteria 16729
28 Ga0068869_100000129 3300005334 Bacteria 36610
29 Ga0068869_100000231 3300005334 Bacteria 29332
30 Ga0068869_100008317 3300005334 Bacteria 6687
31 Ga0070666_10000277 3300005335 Bacteria 33924
32 Ga0070666_10037238 3300005335 Bacteria 3234
33 Ga0070680_100005081 3300005336 Bacteria 9926
34 Ga0070680_100041457 3300005336 Bacteria 3733
35 Ga0070680_100253975 3300005336 Bacteria 1487
36 Ga0070682_100002665 3300005337 Bacteria 9865
37 Ga0070682_100032795 3300005337 Bacteria 3152
38 Ga0068868_100000812 3300005338 Bacteria 21172
39 Ga0068868_100035807 3300005338 Bacteria 3838
40 Ga0068868_100103173 3300005338 Bacteria 2310
41 Ga0068868_100348843 3300005338 Bacteria 1267
42 Ga0070660_100000052 3300005339 Bacteria 68022
43 Ga0070660_100002606 3300005339 Bacteria 12381
44 Ga0070660_100057761 3300005339 Bacteria 3007
45 Ga0070689_100000089 3300005340 Bacteria 52483
46 Ga0070689_100016053 3300005340 Bacteria 5477
47 Ga0070689_100016352 3300005340 Bacteria 5429
48 Ga0070689_100059971 3300005340 Bacteria 2957
49 Ga0070691_10055894 3300005341 Bacteria 1891
50 Ga0070687_100000046 3300005343 Bacteria 39050
51 Ga0070687_100011700 3300005343 Bacteria 3849
52 Ga0070661_100000932 3300005344 Bacteria 20930
53 Ga0070661_100005995 3300005344 Bacteria 8365
54 Ga0070661_100006204 3300005344 Bacteria 8242
55 Ga0070661_100082666 3300005344 Bacteria 2372
56 Ga0070661_100240985 3300005344 Bacteria 1392
57 Ga0070692_10000429 3300005345 Bacteria 12747
58 Ga0070692_10006253 3300005345 Bacteria 5158
59 Ga0070692_10012704 3300005345 Bacteria 3908
60 Ga0070692_10036909 3300005345 Bacteria 2482
61 Ga0070668_100001886 3300005347 Bacteria 15324
62 Ga0070668_100001956 3300005347 Bacteria 15030
63 Ga0070668_100146173 3300005347 Bacteria 1908
64 Ga0070669_100000477 3300005353 Bacteria 30375
65 Ga0070669_100004675 3300005353 Bacteria 9882
66 Ga0070669_100008083 3300005353 Bacteria 7516
67 Ga0070669_100011442 3300005353 Bacteria 6299
68 Ga0070669_100047644 3300005353 Bacteria 3127
69 Ga0070675_100000114 3300005354 Bacteria 47091
70 Ga0070675_100005509 3300005354 Bacteria 9687
71 Ga0070675_100076866 3300005354 Bacteria 2778
72 Ga0070675_100107032 3300005354 Bacteria 2361
73 Ga0070671_100000284 3300005355 Bacteria 34431
74 Ga0070671_100001522 3300005355 Bacteria 17395
75 Ga0070671_100006915 3300005355 Bacteria 9086
76 Ga0070671_100097544 3300005355 Bacteria 2465
77 Ga0070674_100000067 3300005356 Bacteria 47588
78 Ga0070674_100000516 3300005356 Bacteria 19392
79 Ga0070673_100000108 3300005364 Bacteria 37855
80 Ga0070673_100011700 3300005364 Bacteria 5998
81 Ga0070673_100026030 3300005364 Bacteria 4315
82 Ga0070673_100094254 3300005364 Bacteria 2454
83 Ga0070673_100103712 3300005364 Bacteria 2347
84 Ga0070688_100000035 3300005365 Bacteria 62234
85 Ga0070688_100005046 3300005365 Bacteria 6914
86 Ga0070688_100110004 3300005365 Bacteria 1831
87 Ga0070688_100110010 3300005365 Bacteria 1831
88 Ga0070688_100134690 3300005365 Bacteria 1671
89 Ga0070688_100232576 3300005365 Bacteria 1305
90 Ga0070659_100000369 3300005366 Bacteria 33924
91 Ga0070659_100052790 3300005366 Bacteria 3198
92 Ga0070659_100171398 3300005366 Bacteria 1778
93 Ga0070667_100000478 3300005367 Bacteria 41066
94 Ga0070667_100015673 3300005367 Bacteria 6266
95 Ga0070667_100038314 3300005367 Bacteria 4019
96 Ga0070667_100079407 3300005367 Bacteria 2805
97 Ga0070701_10000234 3300005438 Bacteria 17676
98 Ga0070701_10002593 3300005438 Bacteria 7001
99 Ga0070701_10085221 3300005438 Bacteria 1720
100 Ga0070701_10113673 3300005438 Bacteria 1516
101 Ga0070701_10165500 3300005438 Bacteria 1284
102 Ga0070705_100000267 3300005440 Bacteria 31449
103 Ga0070705_100001707 3300005440 Bacteria 11442
104 Ga0070705_100004213 3300005440 Bacteria 7022
105 Ga0070705_100035112 3300005440 Bacteria 2808
106 Ga0070705_100292877 3300005440 Bacteria 1163
107 Ga0070700_100000247 3300005441 Bacteria 29520
108 Ga0070700_100003776 3300005441 Bacteria 7839
109 Ga0070700_100070199 3300005441 Bacteria 2233
110 Ga0070694_100000036 3300005444 Bacteria 61430
111 Ga0070694_100034242 3300005444 Bacteria 3348
112 Ga0070694_100067985 3300005444 Bacteria 2447
113 Ga0070694_100082418 3300005444 Bacteria 2240
114 Ga0070694_100156721 3300005444 Bacteria 1667
115 Ga0070694_100198603 3300005444 Bacteria 1494
116 Ga0070694_100363470 3300005444 Bacteria 1124
117 Ga0070708_100079116 3300005445 Bacteria 2974
118 Ga0070708_100214266 3300005445 Bacteria 1805
119 Ga0070708_100290690 3300005445 Bacteria 1538
120 Ga0070663_100011308 3300005455 Bacteria 5597
121 Ga0070663_100014725 3300005455 Bacteria 5027
122 Ga0070663_100141728 3300005455 Bacteria 1836
123 Ga0070678_100000162 3300005456 Bacteria 28234
124 Ga0070678_100003327 3300005456 Bacteria 8946
125 Ga0070678_100008129 3300005456 Bacteria 6268
126 Ga0070678_100203397 3300005456 Bacteria 1636
127 Ga0070662_100000106 3300005457 Bacteria 46076
128 Ga0070662_100000261 3300005457 Bacteria 31212
129 Ga0070662_100032632 3300005457 Bacteria 3660
130 Ga0070662_100254843 3300005457 Bacteria 1412
131 Ga0070681_10013470 3300005458 Bacteria 8126
132 Ga0070681_10022472 3300005458 Bacteria 6333
133 Ga0070681_10124115 3300005458 Bacteria 2515
134 Ga0068867_100000105 3300005459 Bacteria 53757
135 Ga0068867_100000316 3300005459 Bacteria 31942
136 Ga0068867_100000414 3300005459 Bacteria 28602
137 Ga0070685_10000242 3300005466 Bacteria 35649
138 Ga0070685_10288774 3300005466 Bacteria 1101
139 Ga0070706_100010107 3300005467 Bacteria 8771
140 Ga0070706_100017608 3300005467 Bacteria 6593
141 Ga0070706_100267495 3300005467 Bacteria 1595
142 Ga0070707_100037852 3300005468 Bacteria 4606
143 Ga0070707_100088448 3300005468 Bacteria 2996
144 Ga0070707_100186097 3300005468 Bacteria 2025
145 Ga0070698_100144213 3300005471 Bacteria 2331
146 Ga0070698_100254357 3300005471 Bacteria 1689
147 Ga0070699_100000003 3300005518 Bacteria 418047
148 Ga0070699_100005646 3300005518 Bacteria 10957
149 Ga0070699_100010504 3300005518 Bacteria 8010
150 Ga0070699_100014136 3300005518 Bacteria 6867
151 Ga0070699_100028835 3300005518 Bacteria 4785
152 Ga0070699_100079035 3300005518 Bacteria 2865
153 Ga0070699_100228616 3300005518 Bacteria 1659
154 Ga0070699_100232920 3300005518 Bacteria 1642
155 Ga0070699_100574851 3300005518 Bacteria 1027
156 Ga0070679_100002944 3300005530 Bacteria 15511
157 Ga0070679_100035189 3300005530 Bacteria 4968
158 Ga0070679_100283164 3300005530 Bacteria 1610
159 Ga0070684_100000380 3300005535 Bacteria 30791
160 Ga0070684_100000962 3300005535 Bacteria 20525
161 Ga0070684_100024751 3300005535 Bacteria 5039
162 Ga0070684_100100398 3300005535 Bacteria 2584
163 Ga0070697_100000676 3300005536 Bacteria 25620
164 Ga0070697_100033537 3300005536 Bacteria 4135
165 Ga0070697_100055484 3300005536 Bacteria 3221
166 Ga0070697_100100621 3300005536 Bacteria 2401
167 Ga0070697_100111617 3300005536 Bacteria 2279
168 Ga0070697_100120907 3300005536 Bacteria 2190
169 Ga0070697_100169138 3300005536 Bacteria 1849
170 Ga0068853_100000288 3300005539 Bacteria 35623
171 Ga0068853_100014900 3300005539 Bacteria 6385
172 Ga0068853_100032766 3300005539 Bacteria 4404
173 Ga0070672_100000076 3300005543 Bacteria 45960
174 Ga0070672_100004256 3300005543 Bacteria 9358
175 Ga0070672_100035559 3300005543 Bacteria 3787
176 Ga0070672_100086209 3300005543 Bacteria 2525
177 Ga0070672_100190633 3300005543 Bacteria 1711
178 Ga0070686_100000368 3300005544 Bacteria 28655
179 Ga0070686_100001922 3300005544 Bacteria 11551
180 Ga0070686_100037390 3300005544 Bacteria 3011
181 Ga0070686_100046575 3300005544 Bacteria 2737
182 Ga0070686_100153439 3300005544 Bacteria 1615
183 Ga0070695_100004579 3300005545 Bacteria 8112
184 Ga0070695_100025572 3300005545 Bacteria 3647
185 Ga0070695_100222275 3300005545 Bacteria 1361
186 Ga0070695_100344481 3300005545 Bacteria 1115
187 Ga0070696_100008223 3300005546 Bacteria 6982
188 Ga0070696_100008545 3300005546 Bacteria 6852
189 Ga0070696_100009243 3300005546 Bacteria 6599
190 Ga0070696_100021901 3300005546 Bacteria 4336
191 Ga0070696_100029142 3300005546 Bacteria 3770
192 Ga0070696_100074760 3300005546 Bacteria 2390
193 Ga0070693_100027964 3300005547 Bacteria 3062
194 Ga0070665_100001106 3300005548 Bacteria 33278
195 Ga0070704_100003479 3300005549 Bacteria 9041
196 Ga0070704_100087937 3300005549 Bacteria 2307
197 Ga0068855_100000202 3300005563 Bacteria 76682
198 Ga0068855_100038538 3300005563 Bacteria 5679
199 Ga0068855_100093825 3300005563 Bacteria 3461
200 Ga0070664_100000353 3300005564 Bacteria 33733
201 Ga0070664_100000533 3300005564 Bacteria 29057
202 Ga0070664_100008556 3300005564 Bacteria 8278
203 Ga0070664_100019574 3300005564 Bacteria 5570
204 Ga0070664_100159087 3300005564 Bacteria 1997
205 Ga0068857_100002680 3300005577 Bacteria 14624
206 Ga0068857_100011983 3300005577 Bacteria 7542
207 Ga0068857_100025161 3300005577 Bacteria 5241
208 Ga0068857_100148705 3300005577 Bacteria 2121
209 Ga0068854_100000154 3300005578 Bacteria 46923
210 Ga0068854_100017526 3300005578 Bacteria 4792
211 Ga0068854_100074637 3300005578 Bacteria 2488
212 Ga0068856_100001685 3300005614 Bacteria 23109
213 Ga0070702_100000069 3300005615 Bacteria 28968
214 Ga0070702_100005235 3300005615 Bacteria 6015
215 Ga0070702_100078389 3300005615 Bacteria 1972
216 Ga0068852_100000109 3300005616 Bacteria 55376
217 Ga0068852_100026111 3300005616 Bacteria 4742
218 Ga0068852_100066024 3300005616 Bacteria 3159
219 Ga0068859_100049514 3300005617 Bacteria 4219
220 Ga0068859_100074998 3300005617 Bacteria 3422
221 Ga0068859_100091401 3300005617 Bacteria 3094
222 Ga0068859_100190120 3300005617 Bacteria 2137
223 Ga0068864_100000374 3300005618 Bacteria 39012
224 Ga0068864_100007605 3300005618 Bacteria 8923
225 Ga0068864_100316586 3300005618 Bacteria 1464
226 Ga0068866_10000059 3300005718 Bacteria 43112
227 Ga0068866_10000089 3300005718 Bacteria 37940
228 Ga0068866_10000436 3300005718 Bacteria 19322
229 Ga0068861_100000059 3300005719 Bacteria 52167
230 Ga0068861_100003296 3300005719 Bacteria 10682
231 Ga0068861_100006973 3300005719 Bacteria 7718
232 Ga0068861_100008684 3300005719 Bacteria 6989
233 Ga0068861_100148810 3300005719 Bacteria 1919
234 Ga0068861_100312945 3300005719 Bacteria 1365
235 Ga0068851_10000065 3300005834 Bacteria 58958
236 Ga0068851_10012877 3300005834 Bacteria 3951
237 Ga0068870_10000327 3300005840 Bacteria 17695
238 Ga0068870_10006716 3300005840 Bacteria 5093
239 Ga0068870_10068220 3300005840 Bacteria 1931
240 Ga0068863_100001278 3300005841 Bacteria 25108
241 Ga0068863_100016732 3300005841 Bacteria 7036
242 Ga0068863_100046442 3300005841 Bacteria 4122
243 Ga0068863_100199577 3300005841 Bacteria 1924
244 Ga0068863_100756392 3300005841 Bacteria 968
245 Ga0068858_100000496 3300005842 Bacteria 41146
246 Ga0068858_100000680 3300005842 Bacteria 35434
247 Ga0068858_100009116 3300005842 Bacteria 9488
248 Ga0068858_100091311 3300005842 Bacteria 2834
249 Ga0068860_100000483 3300005843 Bacteria 49359
250 Ga0068860_100002818 3300005843 Bacteria 18080
251 Ga0068860_100007920 3300005843 Bacteria 10604
252 Ga0068860_100014859 3300005843 Bacteria 7613
253 Ga0068860_100025657 3300005843 Bacteria 5684
254 Ga0068860_100047080 3300005843 Bacteria 4110
255 Ga0068860_100119133 3300005843 Bacteria 2527
256 Ga0068862_100000523 3300005844 Bacteria 40565
257 Ga0068862_100017232 3300005844 Bacteria 6012
258 Ga0068862_100019127 3300005844 Bacteria 5711
259 Ga0068862_100035561 3300005844 Bacteria 4220
260 Ga0068862_100104689 3300005844 Bacteria 2479
261 Ga0068862_100182069 3300005844 Bacteria 1886
262 Ga0081540_1000298 3300005983 Bacteria 51452
263 Ga0081540_1007881 3300005983 Bacteria 7525
264 Ga0097621_100000831 3300006237 Bacteria 21816
265 Ga0097621_100010143 3300006237 Bacteria 6877
266 Ga0097621_100017185 3300006237 Bacteria 5490
267 Ga0097621_100077266 3300006237 Bacteria 2763
268 Ga0068871_100004079 3300006358 Bacteria 10105
269 Ga0068871_100004948 3300006358 Bacteria 9307
270 Ga0068871_100126138 3300006358 Bacteria 2167
271 Ga0068871_100369402 3300006358 Bacteria 1272
272 Ga0075428_100021190 3300006844 Bacteria 7197
273 Ga0075428_100064929 3300006844 Bacteria 3998
274 Ga0075428_100119830 3300006844 Bacteria 2864
275 Ga0075428_100298887 3300006844 Bacteria 1731
276 Ga0075428_100355877 3300006844 Bacteria 1571
277 Ga0075428_100555835 3300006844 Unclassified 1227
278 Ga0075430_100017795 3300006846 Bacteria 6050
279 Ga0075430_100020970 3300006846 Bacteria 5555
280 Ga0075430_100034643 3300006846 Bacteria 4286
281 Ga0075430_100046158 3300006846 Bacteria 3679
282 Ga0075430_100085726 3300006846 Bacteria 2637
283 Ga0075430_100132371 3300006846 Bacteria 2078
284 Ga0075430_100136911 3300006846 Bacteria 2040
285 Ga0075430_100149274 3300006846 Bacteria 1946
286 Ga0075431_100016053 3300006847 Bacteria 7600
287 Ga0075431_100016795 3300006847 Bacteria 7435
288 Ga0075431_100021860 3300006847 Bacteria 6540
289 Ga0075431_100063294 3300006847 Bacteria 3817
290 Ga0075431_100072276 3300006847 Bacteria 3560
291 Ga0075431_100090296 3300006847 Bacteria 3162
292 Ga0075431_100325759 3300006847 Bacteria 1548
293 Ga0075431_100361018 3300006847 Bacteria 1459
294 Ga0075431_100415083 3300006847 Bacteria 1346
295 Ga0075433_10001841 3300006852 Bacteria 15928
296 Ga0075433_10013820 3300006852 Bacteria 6581
297 Ga0075433_10014676 3300006852 Bacteria 6408
298 Ga0075433_10018829 3300006852 Bacteria 5746
299 Ga0075433_10018948 3300006852 Bacteria 5728
300 Ga0075433_10022793 3300006852 Bacteria 5261
301 Ga0075433_10271427 3300006852 Unclassified 1503
302 Ga0075434_100001524 3300006871 Bacteria 19574
303 Ga0075434_100006981 3300006871 Bacteria 10409
304 Ga0075434_100040841 3300006871 Bacteria 4594
305 Ga0075434_100042354 3300006871 Bacteria 4514
306 Ga0075434_100084435 3300006871 Bacteria 3174
307 Ga0075434_100333652 3300006871 Bacteria 1537
308 Ga0075429_100064517 3300006880 Bacteria 3189
309 Ga0075429_100073997 3300006880 Bacteria 2967
310 Ga0075429_100120000 3300006880 Bacteria 2298
311 Ga0075429_100241580 3300006880 Bacteria 1582
312 Ga0075429_100293680 3300006880 Bacteria 1423
313 Ga0068865_100000080 3300006881 Bacteria 51324
314 Ga0068865_100000304 3300006881 Bacteria 27162
315 Ga0068865_100002537 3300006881 Bacteria 10819
316 Ga0068865_100085680 3300006881 Bacteria 2273
317 Ga0075436_100018848 3300006914 Bacteria 4725
318 Ga0097620_100049515 3300006931 Bacteria 4219
319 Ga0097620_100074996 3300006931 Bacteria 3422
320 Ga0097620_100091396 3300006931 Bacteria 3094
321 Ga0097620_100190132 3300006931 Bacteria 2137
322 Ga0075435_100025966 3300007076 Bacteria 4566
323 Ga0075435_100037247 3300007076 Bacteria 3871
324 Ga0075435_100261048 3300007076 Bacteria 1476
325 Ga0105240_10025630 3300009093 Bacteria 7744
326 Ga0105240_10061623 3300009093 Bacteria 4674
327 Ga0105240_10077015 3300009093 Bacteria 4110
328 Ga0105240_10166009 3300009093 Bacteria 2618
329 Ga0111539_10029943 3300009094 Bacteria 6621
330 Ga0111539_10052759 3300009094 Bacteria 4840
331 Ga0111539_10058716 3300009094 Bacteria 4563
332 Ga0111539_10069222 3300009094 Bacteria 4167
333 Ga0111539_10076994 3300009094 Bacteria 3927
334 Ga0111539_10115411 3300009094 Bacteria 3149
335 Ga0105245_10001106 3300009098 Bacteria 24405
336 Ga0105245_10002431 3300009098 Bacteria 16858
337 Ga0105245_10003537 3300009098 Bacteria 13968
338 Ga0105245_10025097 3300009098 Bacteria 5241
339 Ga0105245_10040281 3300009098 Bacteria 4161
340 Ga0105245_10299659 3300009098 Bacteria 1577
341 Ga0105247_10001615 3300009101 Bacteria 15958
342 Ga0105247_10120795 3300009101 Bacteria 1697
343 Ga0114129_10002787 3300009147 Bacteria 24362
344 Ga0114129_10005266 3300009147 Bacteria 18241
345 Ga0114129_10012653 3300009147 Bacteria 12014
346 Ga0114129_10014040 3300009147 Bacteria 11410
347 Ga0114129_10064503 3300009147 Bacteria 5112
348 Ga0114129_10149834 3300009147 Bacteria 3193
349 Ga0114129_10151970 3300009147 Bacteria 3168
350 Ga0105243_10003932 3300009148 Bacteria 11860
351 Ga0105243_10010142 3300009148 Bacteria 7164
352 Ga0105243_10199404 3300009148 Bacteria 1754
353 Ga0105243_10206258 3300009148 Bacteria 1727
354 Ga0105243_10383877 3300009148 Bacteria 1300
355 Ga0105241_10000182 3300009174 Bacteria 47072
356 Ga0105241_10014236 3300009174 Bacteria 5827
357 Ga0105242_10003250 3300009176 Bacteria 12679
358 Ga0105242_10004015 3300009176 Bacteria 11443
359 Ga0105242_10004174 3300009176 Bacteria 11256
360 Ga0105248_10001050 3300009177 Bacteria 30582
361 Ga0105248_10001923 3300009177 Bacteria 23052
362 Ga0105248_10004922 3300009177 Bacteria 14752
363 Ga0105248_10028418 3300009177 Bacteria 6230
364 Ga0105248_10043358 3300009177 Bacteria 5044
365 Ga0105248_10450563 3300009177 Bacteria 1450
366 Ga0105237_10000190 3300009545 Bacteria 87182
367 Ga0105238_10000297 3300009551 Bacteria 54482
368 Ga0105238_10041612 3300009551 Bacteria 4653
369 Ga0105238_10758793 3300009551 Bacteria 984
370 Ga0105249_10000280 3300009553 Bacteria 53516
371 Ga0105249_10000720 3300009553 Bacteria 30109
372 Ga0105249_10004530 3300009553 Bacteria 12012
373 Ga0105249_10021962 3300009553 Bacteria 5715
374 Ga0105249_10052096 3300009553 Bacteria 3736
375 Ga0105249_10052819 3300009553 Bacteria 3713
376 Ga0105249_10301018 3300009553 Bacteria 1608
377 Ga0105239_10000709 3300010375 Bacteria 47208
378 Ga0105239_10010391 3300010375 Bacteria 10415
379 Ga0105239_10041496 3300010375 Bacteria 5042
380 Ga0105239_10186026 3300010375 Bacteria 2324
381 Ga0105246_10169792 3300011119 Bacteria 1669
382 Ga0105246_10504339 3300011119 Bacteria 1028
383 Ga0157373_10005090 3300013100 Bacteria 9881
384 Ga0157371_10000340 3300013102 Bacteria 59959
385 Ga0157369_10001580 3300013105 Bacteria 27876
386 Ga0157374_10000208 3300013296 Bacteria 54031
387 Ga0157374_10013897 3300013296 Bacteria 7035
388 Ga0157374_10239996 3300013296 Bacteria 1782
389 Ga0157374_10263745 3300013296 Bacteria 1697
390 Ga0157378_10000152 3300013297 Bacteria 64999
391 Ga0157378_10001229 3300013297 Bacteria 23157
392 Ga0157378_10002577 3300013297 Bacteria 16133
393 Ga0163162_10005524 3300013306 Bacteria 12221
394 Ga0163162_10034653 3300013306 Bacteria 5024
395 Ga0163162_10037985 3300013306 Bacteria 4806
396 Ga0163162_10095064 3300013306 Bacteria 3066
397 Ga0157372_10001598 3300013307 Bacteria 24617
398 Ga0157372_10088228 3300013307 Bacteria 3521
399 Ga0157372_10153593 3300013307 Bacteria 2658
400 Ga0157372_10394123 3300013307 Bacteria 1614
401 Ga0157375_10000252 3300013308 Bacteria 48594
402 Ga0157375_10016342 3300013308 Bacteria 6662
403 Ga0157375_10115329 3300013308 Bacteria 2789
404 Ga0157375_10371322 3300013308 Bacteria 1597
405 Ga0157375_10510425 3300013308 Bacteria 1366
406 Ga0163163_10010093 3300014325 Bacteria 8473
407 Ga0163163_10010283 3300014325 Bacteria 8408
408 Ga0163163_10017851 3300014325 Bacteria 6624
409 Ga0163163_10474705 3300014325 Bacteria 1311
410 Ga0163163_10663475 3300014325 Bacteria 1106
411 Ga0157380_10003085 3300014326 Bacteria 11362
412 Ga0157380_10009292 3300014326 Bacteria 7037
413 Ga0157380_10024336 3300014326 Bacteria 4581
414 Ga0157380_10142905 3300014326 Bacteria 2058
415 Ga0157380_10360644 3300014326 Bacteria 1364
416 Ga0157377_10000141 3300014745 Bacteria 45798
417 Ga0157377_10020567 3300014745 Bacteria 3460
418 Ga0157379_10000079 3300014968 Bacteria 63166
419 Ga0157379_10000316 3300014968 Bacteria 38472
420 Ga0157379_10012769 3300014968 Bacteria 7346
421 Ga0157379_10351549 3300014968 Bacteria 1349
422 Ga0157376_10027626 3300014969 Bacteria 4500
423 Ga0157376_10095751 3300014969 Bacteria 2582
424 Ga0163161_10005385 3300017792 Bacteria 8892
425 Ga0163161_10156683 3300017792 Unclassified 1734
426 Ga0207697_10001148 3300025315 Bacteria 14557
427 Ga0207697_10002770 3300025315 Bacteria 8940
428 Ga0207656_10000341 3300025321 Bacteria 15879
429 Ga0207656_10021214 3300025321 Unclassified 2593
430 Ga0207682_10002257 3300025893 Bacteria 8687
431 Ga0207642_10000041 3300025899 Bacteria 37235
432 Ga0207642_10000420 3300025899 Bacteria 12791
433 Ga0207642_10004156 3300025899 Bacteria 4649
434 Ga0207710_10000704 3300025900 Bacteria 18751
435 Ga0207688_10000015 3300025901 Bacteria 57722
436 Ga0207688_10029369 3300025901 Bacteria 3027
437 Ga0207680_10000063 3300025903 Bacteria 48393
438 Ga0207680_10047216 3300025903 Bacteria 2550
439 Ga0207680_10136185 3300025903 Bacteria 1623
440 Ga0207647_10001319 3300025904 Bacteria 19055
441 Ga0207647_10047160 3300025904 Bacteria 2681
442 Ga0207645_10000025 3300025907 Bacteria 98264
443 Ga0207645_10000096 3300025907 Bacteria 64474
444 Ga0207645_10004995 3300025907 Bacteria 9718
445 Ga0207643_10000023 3300025908 Bacteria 104515
446 Ga0207643_10008678 3300025908 Bacteria 5453
447 Ga0207643_10044197 3300025908 Bacteria 2515
448 Ga0207643_10090806 3300025908 Bacteria 1781
449 Ga0207705_10001179 3300025909 Bacteria 21237
450 Ga0207684_10000996 3300025910 Bacteria 31775
451 Ga0207684_10008157 3300025910 Bacteria 9330
452 Ga0207684_10011745 3300025910 Bacteria 7640
453 Ga0207654_10003091 3300025911 Bacteria 8429
454 Ga0207707_10001121 3300025912 Bacteria 25421
455 Ga0207707_10001396 3300025912 Bacteria 22390
456 Ga0207707_10041889 3300025912 Bacteria 3998
457 Ga0207707_10097164 3300025912 Bacteria 2574
458 Ga0207695_10019759 3300025913 Bacteria 7744
459 Ga0207671_10000645 3300025914 Bacteria 45564
460 Ga0207660_10039750 3300025917 Bacteria 3290
461 Ga0207660_10051258 3300025917 Bacteria 2934
462 Ga0207660_10070273 3300025917 Bacteria 2545
463 Ga0207660_10107856 3300025917 Bacteria 2091
464 Ga0207660_10173920 3300025917 Bacteria 1668
465 Ga0207660_10258959 3300025917 Bacteria 1375
466 Ga0207662_10000020 3300025918 Bacteria 72933
467 Ga0207662_10036238 3300025918 Bacteria 2883
468 Ga0207657_10000067 3300025919 Bacteria 97934
469 Ga0207657_10024846 3300025919 Bacteria 5538
470 Ga0207657_10074344 3300025919 Bacteria 2870
471 Ga0207657_10157073 3300025919 Bacteria 1849
472 Ga0207649_10001061 3300025920 Bacteria 16846
473 Ga0207649_10003304 3300025920 Bacteria 8829
474 Ga0207649_10039341 3300025920 Bacteria 2867
475 Ga0207649_10059029 3300025920 Bacteria 2405
476 Ga0207652_10002725 3300025921 Bacteria 14819
477 Ga0207652_10018299 3300025921 Bacteria 5746
478 Ga0207652_10282805 3300025921 Bacteria 1497
479 Ga0207646_10001766 3300025922 Bacteria 26193
480 Ga0207646_10003426 3300025922 Bacteria 17920
481 Ga0207646_10202677 3300025922 Bacteria 1792
482 Ga0207681_10000192 3300025923 Bacteria 49214
483 Ga0207681_10012927 3300025923 Bacteria 5161
484 Ga0207681_10036120 3300025923 Bacteria 3258
485 Ga0207681_10066897 3300025923 Bacteria 2489
486 Ga0207681_10103865 3300025923 Bacteria 2054
487 Ga0207681_10206251 3300025923 Bacteria 1512
488 Ga0207694_10000636 3300025924 Bacteria 31729
489 Ga0207650_10000147 3300025925 Bacteria 85501
490 Ga0207650_10006362 3300025925 Bacteria 8043
491 Ga0207650_10012452 3300025925 Bacteria 5873
492 Ga0207650_10031229 3300025925 Bacteria 3845
493 Ga0207650_10103803 3300025925 Bacteria 2192
494 Ga0207659_10000083 3300025926 Bacteria 57057
495 Ga0207659_10096406 3300025926 Bacteria 2220
496 Ga0207659_10124013 3300025926 Bacteria 1984
497 Ga0207659_10193606 3300025926 Bacteria 1619
498 Ga0207659_10259352 3300025926 Bacteria 1413
499 Ga0207687_10000664 3300025927 Bacteria 23135
500 Ga0207687_10001087 3300025927 Bacteria 18464
501 Ga0207687_10036476 3300025927 Bacteria 3350
502 Ga0207687_10041261 3300025927 Bacteria 3167
503 Ga0207644_10000711 3300025931 Bacteria 21133
504 Ga0207644_10038362 3300025931 Bacteria 3374
505 Ga0207644_10099848 3300025931 Bacteria 2178
506 Ga0207690_10000121 3300025932 Bacteria 65227
507 Ga0207690_10091327 3300025932 Bacteria 2152
508 Ga0207706_10000067 3300025933 Bacteria 108077
509 Ga0207706_10000119 3300025933 Bacteria 84681
510 Ga0207706_10010192 3300025933 Bacteria 8598
511 Ga0207706_10080200 3300025933 Bacteria 2870
512 Ga0207706_10225912 3300025933 Bacteria 1638
513 Ga0207686_10000108 3300025934 Bacteria 66086
514 Ga0207686_10001827 3300025934 Bacteria 11844
515 Ga0207686_10012642 3300025934 Bacteria 4645
516 Ga0207686_10037288 3300025934 Bacteria 2932
517 Ga0207709_10004686 3300025935 Bacteria 7866
518 Ga0207709_10128229 3300025935 Bacteria 1724
519 Ga0207709_10142613 3300025935 Bacteria 1649
520 Ga0207709_10151347 3300025935 Bacteria 1607
521 Ga0207670_10000100 3300025936 Bacteria 59919
522 Ga0207670_10001085 3300025936 Bacteria 14341
523 Ga0207670_10016088 3300025936 Bacteria 4487
524 Ga0207669_10000541 3300025937 Bacteria 16449
525 Ga0207669_10002112 3300025937 Bacteria 8425
526 Ga0207704_10000080 3300025938 Bacteria 57205
527 Ga0207704_10000730 3300025938 Bacteria 14453
528 Ga0207704_10027930 3300025938 Bacteria 3122
529 Ga0207691_10000079 3300025940 Bacteria 82300
530 Ga0207691_10000246 3300025940 Bacteria 53559
531 Ga0207691_10008430 3300025940 Bacteria 9899
532 Ga0207691_10035191 3300025940 Bacteria 4652
533 Ga0207711_10000189 3300025941 Bacteria 65922
534 Ga0207711_10019936 3300025941 Bacteria 5589
535 Ga0207711_10050601 3300025941 Bacteria 3557
536 Ga0207711_10133418 3300025941 Unclassified 2228
537 Ga0207689_10000073 3300025942 Bacteria 81232
538 Ga0207689_10000089 3300025942 Bacteria 73617
539 Ga0207689_10000496 3300025942 Bacteria 37082
540 Ga0207689_10017216 3300025942 Bacteria 6117
541 Ga0207689_10225248 3300025942 Bacteria 1550
542 Ga0207661_10001303 3300025944 Bacteria 16687
543 Ga0207661_10008040 3300025944 Bacteria 7518
544 Ga0207661_10097722 3300025944 Bacteria 2459
545 Ga0207661_10227593 3300025944 Bacteria 1650
546 Ga0207661_10505453 3300025944 Bacteria 1104
547 Ga0207679_10000478 3300025945 Bacteria 28113
548 Ga0207679_10000687 3300025945 Bacteria 22666
549 Ga0207679_10000719 3300025945 Bacteria 22033
550 Ga0207679_10008494 3300025945 Bacteria 6543
551 Ga0207679_10023066 3300025945 Bacteria 4249
552 Ga0207679_10040700 3300025945 Bacteria 3329
553 Ga0207679_10251489 3300025945 Bacteria 1503
554 Ga0207667_10003595 3300025949 Bacteria 19143
555 Ga0207667_10053457 3300025949 Bacteria 4250
556 Ga0207667_10093647 3300025949 Bacteria 3102
557 Ga0207651_10000054 3300025960 Bacteria 51552
558 Ga0207651_10010912 3300025960 Bacteria 5058
559 Ga0207651_10049873 3300025960 Bacteria 2839
560 Ga0207651_10051407 3300025960 Bacteria 2804
561 Ga0207651_10108107 3300025960 Bacteria 2081
562 Ga0207651_10539720 3300025960 Bacteria 1013
563 Ga0207712_10000157 3300025961 Bacteria 70058
564 Ga0207712_10002997 3300025961 Bacteria 10791
565 Ga0207712_10005822 3300025961 Bacteria 7769
566 Ga0207712_10013755 3300025961 Bacteria 5191
567 Ga0207712_10013897 3300025961 Bacteria 5163
568 Ga0207712_10110921 3300025961 Bacteria 2058
569 Ga0207712_10314754 3300025961 Bacteria 1289
570 Ga0207668_10000445 3300025972 Bacteria 26148
571 Ga0207668_10012456 3300025972 Bacteria 5207
572 Ga0207668_10088439 3300025972 Bacteria 2269
573 Ga0207668_10185524 3300025972 Bacteria 1644
574 Ga0207668_10304929 3300025972 Bacteria 1315
575 Ga0207640_10000170 3300025981 Bacteria 47258
576 Ga0207640_10015712 3300025981 Bacteria 4387
577 Ga0207640_10335032 3300025981 Bacteria 1210
578 Ga0207658_10000331 3300025986 Bacteria 47462
579 Ga0207658_10093837 3300025986 Bacteria 2334
580 Ga0207658_10098232 3300025986 Bacteria 2288
581 Ga0207658_10155465 3300025986 Bacteria 1868
582 Ga0207677_10000113 3300026023 Bacteria 65880
583 Ga0207677_10262550 3300026023 Bacteria 1408
584 Ga0207703_10000265 3300026035 Bacteria 58474
585 Ga0207703_10003671 3300026035 Bacteria 12794
586 Ga0207703_10082391 3300026035 Bacteria 2684
587 Ga0207703_10110291 3300026035 Bacteria 2347
588 Ga0207639_10003211 3300026041 Bacteria 10987
589 Ga0207639_10011378 3300026041 Bacteria 6179
590 Ga0207639_10153143 3300026041 Bacteria 1933
591 Ga0207678_10000591 3300026067 Bacteria 33171
592 Ga0207678_10284646 3300026067 Bacteria 1419
593 Ga0207708_10000150 3300026075 Bacteria 55752
594 Ga0207708_10001214 3300026075 Bacteria 19464
595 Ga0207708_10074778 3300026075 Bacteria 2597
596 Ga0207708_10107466 3300026075 Bacteria 2163
597 Ga0207702_10009455 3300026078 Bacteria 8187
598 Ga0207702_10174927 3300026078 Bacteria 1972
599 Ga0207641_10001477 3300026088 Bacteria 23046
600 Ga0207641_10094618 3300026088 Bacteria 2620
601 Ga0207641_10587128 3300026088 Bacteria 1089
602 Ga0207648_10000029 3300026089 Bacteria 130026
603 Ga0207648_10000095 3300026089 Bacteria 84340
604 Ga0207648_10001547 3300026089 Bacteria 25319
605 Ga0207648_10058382 3300026089 Bacteria 3364
606 Ga0207648_10235363 3300026089 Bacteria 1630
607 Ga0207648_10710975 3300026089 Bacteria 931
608 Ga0207676_10000226 3300026095 Bacteria 48869
609 Ga0207676_10004153 3300026095 Bacteria 10228
610 Ga0207676_10070456 3300026095 Bacteria 2804
611 Ga0207676_10365316 3300026095 Bacteria 1339
612 Ga0207674_10000177 3300026116 Bacteria 78243
613 Ga0207674_10001314 3300026116 Bacteria 32414
614 Ga0207674_10006241 3300026116 Bacteria 14046
615 Ga0207674_10007864 3300026116 Bacteria 12393
616 Ga0207674_10011262 3300026116 Bacteria 10054
617 Ga0207674_10132536 3300026116 Bacteria 2455
618 Ga0207674_10212180 3300026116 Bacteria 1885
619 Ga0207675_100000201 3300026118 Bacteria 55349
620 Ga0207675_100039122 3300026118 Bacteria 4426
621 Ga0207675_100040882 3300026118 Bacteria 4331
622 Ga0207683_10000050 3300026121 Bacteria 87435
623 Ga0207683_10003044 3300026121 Bacteria 14658
624 Ga0207683_10008087 3300026121 Bacteria 8996
625 Ga0207683_10099143 3300026121 Bacteria 2600
626 Ga0207683_10169344 3300026121 Bacteria 1978
627 Ga0207698_10000149 3300026142 Bacteria 44780
628 Ga0207698_10119257 3300026142 Bacteria 2229
629 Ga0207698_10169314 3300026142 Unclassified 1921
630 Ga0209974_10043485 3300027876 Bacteria 1497
631 Ga0207428_10021298 3300027907 Bacteria 5491
632 Ga0207428_10137523 3300027907 Bacteria 1867
633 Ga0207428_10144266 3300027907 Unclassified 1815
634 Ga0268266_10000415 3300028379 Bacteria 64982
635 Ga0268266_10023519 3300028379 Bacteria 5245
636 Ga0268265_10000581 3300028380 Bacteria 37025
637 Ga0268265_10010291 3300028380 Bacteria 6317
638 Ga0268265_10051584 3300028380 Bacteria 3105
639 Ga0268265_10210532 3300028380 Bacteria 1693
640 Ga0268265_10234053 3300028380 Bacteria 1616
641 Ga0268264_10000485 3300028381 Bacteria 52938
642 Ga0268264_10012196 3300028381 Bacteria 7073
643 Ga0268264_10013128 3300028381 Bacteria 6812
644 Ga0268264_10024518 3300028381 Bacteria 4925
645 Ga0268264_10118559 3300028381 Bacteria 2329
646 Ga0268264_10383297 3300028381 Bacteria 1347
647 Ga0265320_10030264 3300031240 Bacteria 2793
648 Ga0307509_10000112 3300031507 Bacteria 117028
649 Ga0307509_10124024 3300031507 Bacteria 2554
650 Ga0307408_100006188 3300031548 Bacteria 7947
651 Ga0307408_100112465 3300031548 Bacteria 2094
652 Ga0265314_10010946 3300031711 Bacteria 7529
653 Ga0307405_10124015 3300031731 Bacteria 1773
654 Ga0307406_10000992 3300031901 Bacteria 15750
655 Ga0307406_10009756 3300031901 Bacteria 5399
656 Ga0307409_100126225 3300031995 Bacteria 2177
657 Ga0307409_100603695 3300031995 Bacteria 1085
658 Ga0307411_10234800 3300032005 Bacteria 1432
659 Ga0307415_100034242 3300032126 Bacteria 3305
660 Ga0307415_100270345 3300032126 Bacteria 1392
661 Ga0373945_0054202 3300035116 Bacteria 1482
662 Ga0373943_0022391 3300035170 Bacteria 2928
663 Ga0373946_0045980 3300035171 Bacteria 1808
664 Ga0373931_0132354 3300035691 Bacteria 1437
665 Ga0373927_0010358 3300035695 Bacteria 6224
666 Ga0373927_0179400 3300035695 Bacteria 1389
667 Ga0373947_0019264 3300035725 Bacteria 3934
668 Ga0373947_0027662 3300035725 Bacteria 3320
669 Ga0373937_0001843 3300036401 Bacteria 17813
670 Ga0373937_0016632 3300036401 Bacteria 6536
671 Ga0373925_0001061 3300037068 Bacteria 24808
672 Ga0373925_0001237 3300037068 Bacteria 22546
673 Ga0395900_0168410 3300037418 Bacteria 2232
674 Ga0395905_0046639 3300037471 Bacteria 4064
675 Ga0400490_24643 3300038726 Bacteria 58439
676 Ga0400491_13982 3300038727 Bacteria 2652
677 Ga0436365_0565193 3300039437 Bacteria 4714
678 Ga0436365_1377439 3300039437 Bacteria 4887
679 Ga0436365_1852592 3300039437 Bacteria 1236
680 Ga0436363_1343188 3300039450 Bacteria 3843
681 Ga0451849_0210341 3300041505 Bacteria 1812
682 Ga0450896_011034 3300042133 Bacteria 1270
683 Ga0439435_0044466 3300042436 Bacteria 1252
684 Ga0451577_0020932 3300042876 Bacteria 5995
685 Ga0451577_0037789 3300042876 Bacteria 4345
686 Ga0451577_0090668 3300042876 Bacteria 2728
687 Ga0451577_0094760 3300042876 Bacteria 2666
688 Ga0453684_0070149 3300044712 Bacteria 4439
689 Ga0466957_0252986 3300044842 Bacteria 1172
690 Ga0451576_0005179 3300045051 Bacteria 16492
691 Ga0451576_0059539 3300045051 Bacteria 3986
692 Ga0451576_0100913 3300045051 Bacteria 3001
693 Ga0451576_0142405 3300045051 Bacteria 2500
694 Ga0451576_0336365 3300045051 Bacteria 1580
695 Ga0495603_0093829 3300046455 Bacteria 1754
696 Ga0495608_0225555 3300046511 Bacteria 1174
697 Ga0495586_0001823 3300046535 Bacteria 11631
698 Ga0495634_0129804 3300046642 Bacteria 1608
699 Ga0495635_0056341 3300046663 Bacteria 2706
700 Ga0495647_0104382 3300046681 Bacteria 1176
701 Ga0495658_0003780 3300046683 Bacteria 7493
702 Ga0495676_0014703 3300047321 Bacteria 6995
703 Ga0495684_0060607 3300047471 Bacteria 2880
704 Ga0495684_0148393 3300047471 Bacteria 1755
705 Ga0495686_0005090 3300047472 Bacteria 10518
706 Ga0495686_0021780 3300047472 Bacteria 4251
707 Ga0496100_0106006 3300048903 Bacteria 1945
708 Ga0496101_0180074 3300048904 Bacteria 1627
709 Ga0496102_0004082 3300048905 Bacteria 12377
710 Ga0496103_0013364 3300048906 Bacteria 4866
711 Ga0496104_0021139 3300048907 Bacteria 5971
712 Ga0496104_0055354 3300048907 Bacteria 3751
713 Ga0496105_0022542 3300048908 Bacteria 5101
714 Ga0496105_0302198 3300048908 Bacteria 1286
715 Ga0496106_0008043 3300048909 Bacteria 7790
716 Ga0496107_0027874 3300048910 Bacteria 4012
717 Ga0496108_0038333 3300048911 Bacteria 3992
718 Ga0496108_0068704 3300048911 Bacteria 2989
719 Ga0496109_0000709 3300048912 Bacteria 27720
720 Ga0496109_0003803 3300048912 Bacteria 12597
721 Ga0496110_0004326 3300048913 Bacteria 10991
722 Ga0496110_0205069 3300048913 Bacteria 1792
723 Ga0496111_0179552 3300048914 Bacteria 1573
724 Ga0496112_0000210 3300048915 Bacteria 37637
725 Ga0496112_0006951 3300048915 Bacteria 9989
726 Ga0496112_0017314 3300048915 Bacteria 6768
727 Ga0496112_0290762 3300048915 Bacteria 1580
728 Ga0496113_0128631 3300048916 Bacteria 1985
729 Ga0496113_0248643 3300048916 Bacteria 1419
730 Ga0496114_0033530 3300048917 Bacteria 4231
731 Ga0496115_0055846 3300048918 Bacteria 3173
732 Ga0496116_0222923 3300048919 Bacteria 964
733 Ga0501032_0092299 3300049569 Bacteria 2009
734 Ga0501036_0091618 3300049572 Bacteria 2568
735 Ga0501036_0256190 3300049572 Bacteria 1466
736 Ga0501039_0072157 3300049575 Bacteria 2683
737 Ga0501040_0004353 3300049576 Bacteria 9206
738 Ga0501040_0011752 3300049576 Bacteria 5726
739 Ga0501040_0060164 3300049576 Bacteria 2610
740 Ga0501041_0046124 3300049577 Bacteria 2651
741 Ga0501041_0049742 3300049577 Bacteria 2554
742 Ga0501041_0058944 3300049577 Bacteria 2350
743 Ga0501041_0091079 3300049577 Bacteria 1883
744 Ga0501042_0081155 3300049578 Bacteria 2324
745 Ga0501042_0146431 3300049578 Bacteria 1703
746 Ga0501042_0292117 3300049578 Bacteria 1177
747 Ga0501046_0169864 3300049580 Bacteria 1637
748 Ga0501070_0098562 3300049586 Bacteria 2417
749 Ga0501070_0198321 3300049586 Bacteria 1648
750 Ga0501071_0056564 3300049587 Bacteria 2834
751 Ga0501071_0334427 3300049587 Bacteria 1151
752 Ga0501071_0364103 3300049587 Bacteria 1101
753 Ga0501072_0015127 3300049588 Bacteria 5917
754 Ga0501072_0077055 3300049588 Bacteria 2639
755 Ga0501072_0187850 3300049588 Bacteria 1648
756 Ga0501073_0027147 3300049589 Bacteria 4098
757 Ga0501074_0071506 3300049590 Bacteria 2494
758 Ga0501074_0143319 3300049590 Bacteria 1709
759 Ga0501075_0005525 3300049591 Bacteria 8646
760 Ga0501075_0027856 3300049591 Bacteria 4166
761 Ga0501075_0077022 3300049591 Bacteria 2523
762 Ga0501076_0029525 3300049592 Bacteria 4264
763 Ga0501076_0047016 3300049592 Bacteria 3411
764 Ga0501076_0333028 3300049592 Bacteria 1245
765 Ga0501079_0041756 3300049741 Bacteria 3542
766 Ga0501079_0196165 3300049741 Bacteria 1576
767 Ga0501079_0198577 3300049741 Bacteria 1566
768 Ga0501079_0199719 3300049741 Bacteria 1562
769 Ga0501079_0276686 3300049741 Bacteria 1312
770 Ga0501080_0087644 3300049742 Bacteria 2892
771 Ga0501080_0287620 3300049742 Bacteria 1493
772 Ga0501080_0391417 3300049742 Bacteria 1251
773 Ga0501081_0013622 3300049743 Bacteria 5346
774 Ga0501081_0021316 3300049743 Bacteria 4323
775 Ga0501081_0021658 3300049743 Bacteria 4291
776 Ga0501081_0101243 3300049743 Bacteria 2037
777 Ga0501081_0157612 3300049743 Bacteria 1634
778 Ga0501083_0001915 3300049744 Bacteria 14294
779 Ga0501045_0005172 3300049824 Bacteria 9026
780 Ga0501045_0009660 3300049824 Bacteria 6751
781 Ga0501045_0103026 3300049824 Bacteria 2113
782 nmdc:mga05p37_13006_c1 3300050507 Bacteria 9960
783 nmdc:mga05p37_18646_c1 3300050507 Bacteria 8386
784 nmdc:mga05p37_212385_c1 3300050507 Bacteria 2339
785 nmdc:mga05p37_3575_c1 3300050507 Bacteria 18163
786 nmdc:mga05p37_36354_c1 3300050507 Bacteria 6042
787 nmdc:mga09592_41786_c1 3300050508 Bacteria 3856
788 nmdc:mga09592_426062_c1 3300050508 Bacteria 1146
789 nmdc:mga09592_73997_c1 3300050508 Bacteria 2895
790 nmdc:mga09592_86506_c1 3300050508 Bacteria 2675
791 nmdc:mga0qj67_121754_c1 3300050509 Bacteria 2111
792 nmdc:mga0qj67_147854_c1 3300050509 Bacteria 1905
793 nmdc:mga0qj67_21964_c1 3300050509 Bacteria 4897
794 nmdc:mga06r32_101213_c1 3300050510 Bacteria 2828
795 nmdc:mga06r32_101700_c1 3300050510 Bacteria 2821
796 nmdc:mga06r32_128852_c1 3300050510 Bacteria 2500
797 nmdc:mga06r32_196281_c1 3300050510 Bacteria 2006
798 nmdc:mga06r32_72991_c1 3300050510 Bacteria 3323
799 nmdc:mga06r32_75695_c1 3300050510 Bacteria 3267
800 nmdc:mga06r32_8042_c1 3300050510 Bacteria 9489
801 nmdc:mga08y16_128281_c1 3300050511 Bacteria 2638
802 nmdc:mga08y16_23198_c1 3300050511 Bacteria 6550
803 nmdc:mga08y16_24927_c1 3300050511 Bacteria 6309
804 nmdc:mga08y16_340357_c1 3300050511 Bacteria 1542
805 nmdc:mga08y16_57366_c1 3300050511 Bacteria 4069
806 nmdc:mga08y16_69326_c1 3300050511 Bacteria 3676
807 nmdc:mga0n895_111158_c1 3300050512 Bacteria 2756
808 nmdc:mga0n895_171633_c1 3300050512 Bacteria 2201
809 nmdc:mga0n895_4755_c1 3300050512 Bacteria 11224
810 nmdc:mga0n895_52897_c1 3300050512 Bacteria 3988
811 nmdc:mga0n895_6204_c1 3300050512 Bacteria 10111
812 nmdc:mga0n895_6750_c1 3300050512 Bacteria 9789
813 nmdc:mga0n895_73424_c1 3300050512 Bacteria 3396
814 nmdc:mga0n895_78706_c1 3300050512 Bacteria 3281
815 nmdc:mga0rr50_519812_c1 3300050513 Bacteria 1013
816 nmdc:mga0rr50_546731_c1 3300050513 Bacteria 986
817 nmdc:mga08x19_17398_c1 3300050514 Bacteria 4398
818 nmdc:mga08x19_28392_c1 3300050514 Bacteria 3504
819 nmdc:mga0a205_18154_c1 3300050515 Bacteria 6608
820 nmdc:mga0a205_19740_c1 3300050515 Bacteria 6359
821 nmdc:mga0a205_313389_c1 3300050515 Bacteria 1441
822 nmdc:mga0a205_320828_c1 3300050515 Unclassified 1420
823 nmdc:mga0a205_38288_c1 3300050515 Bacteria 4612
824 nmdc:mga0a205_39079_c1 3300050515 Bacteria 4566
825 nmdc:mga0a205_3952_c1 3300050515 Bacteria 13256
826 nmdc:mga0a205_5436_c1 3300050515 Bacteria 11479
827 Ga0495601_0032831 3300053077 Bacteria 3233
828 Ga0495601_0192329 3300053077 Bacteria 1333
829 Ga0501084_0027551 3300054114 Bacteria 4748
830 Ga0501084_0033204 3300054114 Bacteria 4317
831 Ga0501084_0036657 3300054114 Bacteria 4097
832 Ga0501084_0315185 3300054114 Bacteria 1321
833 Ga0590075_006095 3300059424 Bacteria 2856
834 Ga0501082_0026649 3300060353 Bacteria 4983
835 Ga0501082_0105490 3300060353 Bacteria 2438
836 Ga0501082_0105554 3300060353 Bacteria 2437
837 Ga0501082_0242523 3300060353 Bacteria 1568
838 Ga0501082_0322527 3300060353 Bacteria 1346
839 Ga0501082_0546601 3300060353 Bacteria 1013
840 Ga0530510_0016524 3300061734 Bacteria 5226
841 Ga0530510_0076676 3300061734 Bacteria 2429

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0252986 Ga0466957_0252986_57_887 264
2 3300009545 Ga0105237_10000190 Ga0105237_1000019040 281
3 3300042436 Ga0439435_0044466 Ga0439435_0044466_383_1231 282
4 3300005355 Ga0070671_100000284 Ga0070671_1000002842 286
5 3300025931 Ga0207644_10038362 Ga0207644_100383622 286
6 3300025919 Ga0207657_10157073 Ga0207657_101570732 291
7 3300049576 Ga0501040_0004353 Ga0501040_0004353_6067_6942 291
8 3300049577 Ga0501041_0091079 Ga0501041_0091079_149_1024 291
9 3300049580 Ga0501046_0169864 Ga0501046_0169864_671_1546 291
10 3300049587 Ga0501071_0056564 Ga0501071_0056564_1265_2140 291
11 3300049590 Ga0501074_0143319 Ga0501074_0143319_110_985 291
12 3300049591 Ga0501075_0005525 Ga0501075_0005525_1414_2289 291
13 3300049592 Ga0501076_0047016 Ga0501076_0047016_1680_2555 291
14 3300049742 Ga0501080_0287620 Ga0501080_0287620_503_1378 291
15 3300049743 Ga0501081_0021316 Ga0501081_0021316_3383_4258 291
16 3300049824 Ga0501045_0009660 Ga0501045_0009660_249_1124 291
17 3300054114 Ga0501084_0027551 Ga0501084_0027551_1584_2459 291
18 3300060353 Ga0501082_0026649 Ga0501082_0026649_466_1341 291
19 3300005445 Ga0070708_100214266 Ga0070708_1002142662 292
20 3300005471 Ga0070698_100254357 Ga0070698_1002543572 292
21 3300005331 Ga0070670_100016837 Ga0070670_1000168375 293
22 3300005577 Ga0068857_100148705 Ga0068857_1001487052 293
23 3300014326 Ga0157380_10360644 Ga0157380_103606441 293
24 3300025925 Ga0207650_10031229 Ga0207650_100312292 293
25 3300026116 Ga0207674_10212180 Ga0207674_102121802 293
26 3300005293 Ga0065715_10174411 Ga0065715_101744111 294
27 3300005293 Ga0065715_10323265 Ga0065715_103232651 294
28 3300005295 Ga0065707_10195218 Ga0065707_101952182 294
29 3300005328 Ga0070676_10055753 Ga0070676_100557531 294
30 3300005329 Ga0070683_100006984 Ga0070683_1000069844 294
31 3300005329 Ga0070683_100016102 Ga0070683_1000161024 294
32 3300005329 Ga0070683_100046381 Ga0070683_1000463811 294
33 3300005329 Ga0070683_100070997 Ga0070683_1000709975 294
34 3300005330 Ga0070690_100007942 Ga0070690_1000079423 294
35 3300005330 Ga0070690_100265974 Ga0070690_1002659741 294
36 3300005331 Ga0070670_100068774 Ga0070670_1000687743 294
37 3300005334 Ga0068869_100000231 Ga0068869_10000023115 294
38 3300005337 Ga0070682_100032795 Ga0070682_1000327953 294
39 3300005338 Ga0068868_100035807 Ga0068868_1000358075 294
40 3300005338 Ga0068868_100348843 Ga0068868_1003488432 294
41 3300005339 Ga0070660_100002606 Ga0070660_10000260612 294
42 3300005339 Ga0070660_100057761 Ga0070660_1000577612 294
43 3300005340 Ga0070689_100016053 Ga0070689_1000160536 294
44 3300005340 Ga0070689_100059971 Ga0070689_1000599713 294
45 3300005341 Ga0070691_10055894 Ga0070691_100558942 294
46 3300005343 Ga0070687_100011700 Ga0070687_1000117002 294
47 3300005344 Ga0070661_100006204 Ga0070661_1000062048 294
48 3300005344 Ga0070661_100240985 Ga0070661_1002409851 294
49 3300005345 Ga0070692_10000429 Ga0070692_100004294 294
50 3300005345 Ga0070692_10012704 Ga0070692_100127044 294
51 3300005347 Ga0070668_100001886 Ga0070668_10000188612 294
52 3300005353 Ga0070669_100008083 Ga0070669_1000080839 294
53 3300005354 Ga0070675_100005509 Ga0070675_1000055094 294
54 3300005364 Ga0070673_100026030 Ga0070673_1000260302 294
55 3300005365 Ga0070688_100005046 Ga0070688_1000050464 294
56 3300005365 Ga0070688_100134690 Ga0070688_1001346902 294
57 3300005366 Ga0070659_100052790 Ga0070659_1000527903 294
58 3300005366 Ga0070659_100171398 Ga0070659_1001713983 294
59 3300005367 Ga0070667_100079407 Ga0070667_1000794071 294
60 3300005438 Ga0070701_10000234 Ga0070701_1000023410 294
61 3300005438 Ga0070701_10165500 Ga0070701_101655002 294
62 3300005440 Ga0070705_100004213 Ga0070705_1000042134 294
63 3300005441 Ga0070700_100000247 Ga0070700_1000002478 294
64 3300005441 Ga0070700_100070199 Ga0070700_1000701992 294
65 3300005444 Ga0070694_100034242 Ga0070694_1000342422 294
66 3300005444 Ga0070694_100082418 Ga0070694_1000824182 294
67 3300005444 Ga0070694_100156721 Ga0070694_1001567213 294
68 3300005456 Ga0070678_100003327 Ga0070678_1000033276 294
69 3300005457 Ga0070662_100032632 Ga0070662_1000326324 294
70 3300005457 Ga0070662_100254843 Ga0070662_1002548431 294
71 3300005458 Ga0070681_10013470 Ga0070681_100134706 294
72 3300005459 Ga0068867_100000316 Ga0068867_10000031614 294
73 3300005466 Ga0070685_10288774 Ga0070685_102887741 294
74 3300005518 Ga0070699_100079035 Ga0070699_1000790353 294
75 3300005530 Ga0070679_100283164 Ga0070679_1002831641 294
76 3300005535 Ga0070684_100000962 Ga0070684_10000096217 294
77 3300005539 Ga0068853_100014900 Ga0068853_1000149006 294
78 3300005543 Ga0070672_100004256 Ga0070672_1000042568 294
79 3300005543 Ga0070672_100035559 Ga0070672_1000355594 294
80 3300005544 Ga0070686_100001922 Ga0070686_1000019228 294
81 3300005545 Ga0070695_100004579 Ga0070695_1000045796 294
82 3300005546 Ga0070696_100021901 Ga0070696_1000219014 294
83 3300005563 Ga0068855_100038538 Ga0068855_1000385388 294
84 3300005564 Ga0070664_100008556 Ga0070664_1000085566 294
85 3300005564 Ga0070664_100159087 Ga0070664_1001590871 294
86 3300005577 Ga0068857_100011983 Ga0068857_1000119831 294
87 3300005577 Ga0068857_100025161 Ga0068857_1000251615 294
88 3300005578 Ga0068854_100074637 Ga0068854_1000746373 294
89 3300005615 Ga0070702_100000069 Ga0070702_10000006913 294
90 3300005616 Ga0068852_100026111 Ga0068852_1000261112 294
91 3300005617 Ga0068859_100190120 Ga0068859_1001901201 294
92 3300005618 Ga0068864_100316586 Ga0068864_1003165863 294
93 3300005718 Ga0068866_10000436 Ga0068866_100004367 294
94 3300005719 Ga0068861_100003296 Ga0068861_1000032968 294
95 3300005719 Ga0068861_100008684 Ga0068861_1000086848 294
96 3300005719 Ga0068861_100148810 Ga0068861_1001488102 294
97 3300005834 Ga0068851_10012877 Ga0068851_100128773 294
98 3300005840 Ga0068870_10006716 Ga0068870_100067166 294
99 3300005840 Ga0068870_10068220 Ga0068870_100682202 294
100 3300005841 Ga0068863_100046442 Ga0068863_1000464426 294
101 3300005841 Ga0068863_100756392 Ga0068863_1007563921 294
102 3300005842 Ga0068858_100000496 Ga0068858_10000049629 294
103 3300005842 Ga0068858_100091311 Ga0068858_1000913112 294
104 3300005843 Ga0068860_100007920 Ga0068860_1000079203 294
105 3300005844 Ga0068862_100019127 Ga0068862_1000191274 294
106 3300005844 Ga0068862_100035561 Ga0068862_1000355614 294
107 3300005844 Ga0068862_100182069 Ga0068862_1001820692 294
108 3300006237 Ga0097621_100010143 Ga0097621_1000101434 294
109 3300006358 Ga0068871_100004079 Ga0068871_1000040796 294
110 3300006844 Ga0075428_100064929 Ga0075428_1000649292 294
111 3300006846 Ga0075430_100017795 Ga0075430_1000177955 294
112 3300006846 Ga0075430_100034643 Ga0075430_1000346434 294
113 3300006846 Ga0075430_100046158 Ga0075430_1000461584 294
114 3300006847 Ga0075431_100016795 Ga0075431_1000167955 294
115 3300006847 Ga0075431_100063294 Ga0075431_1000632941 294
116 3300006847 Ga0075431_100090296 Ga0075431_1000902964 294
117 3300006847 Ga0075431_100325759 Ga0075431_1003257592 294
118 3300006852 Ga0075433_10013820 Ga0075433_100138207 294
119 3300006852 Ga0075433_10014676 Ga0075433_100146764 294
120 3300006871 Ga0075434_100001524 Ga0075434_1000015246 294
121 3300006880 Ga0075429_100064517 Ga0075429_1000645175 294
122 3300006881 Ga0068865_100000304 Ga0068865_1000003049 294
123 3300006881 Ga0068865_100085680 Ga0068865_1000856801 294
124 3300006931 Ga0097620_100190132 Ga0097620_1001901321 294
125 3300009094 Ga0111539_10069222 Ga0111539_100692224 294
126 3300009098 Ga0105245_10001106 Ga0105245_1000110614 294
127 3300009098 Ga0105245_10299659 Ga0105245_102996591 294
128 3300009147 Ga0114129_10012653 Ga0114129_1001265310 294
129 3300009147 Ga0114129_10014040 Ga0114129_1001404014 294
130 3300009147 Ga0114129_10151970 Ga0114129_101519702 294
131 3300009148 Ga0105243_10003932 Ga0105243_100039326 294
132 3300009148 Ga0105243_10206258 Ga0105243_102062582 294
133 3300009176 Ga0105242_10003250 Ga0105242_100032508 294
134 3300009177 Ga0105248_10028418 Ga0105248_100284183 294
135 3300009177 Ga0105248_10450563 Ga0105248_104505633 294
136 3300009551 Ga0105238_10758793 Ga0105238_107587931 294
137 3300009553 Ga0105249_10021962 Ga0105249_100219624 294
138 3300009553 Ga0105249_10052096 Ga0105249_100520964 294
139 3300010375 Ga0105239_10010391 Ga0105239_100103912 294
140 3300013296 Ga0157374_10263745 Ga0157374_102637453 294
141 3300013297 Ga0157378_10001229 Ga0157378_100012296 294
142 3300013306 Ga0163162_10037985 Ga0163162_100379853 294
143 3300013306 Ga0163162_10095064 Ga0163162_100950644 294
144 3300013307 Ga0157372_10088228 Ga0157372_100882282 294
145 3300013308 Ga0157375_10115329 Ga0157375_101153294 294
146 3300014325 Ga0163163_10663475 Ga0163163_106634751 294
147 3300014326 Ga0157380_10003085 Ga0157380_100030858 294
148 3300014326 Ga0157380_10024336 Ga0157380_100243363 294
149 3300014745 Ga0157377_10020567 Ga0157377_100205672 294
150 3300017792 Ga0163161_10156683 Ga0163161_101566832 294
151 3300025315 Ga0207697_10002770 Ga0207697_100027709 294
152 3300025321 Ga0207656_10021214 Ga0207656_100212145 294
153 3300025899 Ga0207642_10000420 Ga0207642_100004207 294
154 3300025901 Ga0207688_10029369 Ga0207688_100293694 294
155 3300025904 Ga0207647_10047160 Ga0207647_100471604 294
156 3300025907 Ga0207645_10000096 Ga0207645_1000009614 294
157 3300025908 Ga0207643_10008678 Ga0207643_100086785 294
158 3300025908 Ga0207643_10044197 Ga0207643_100441971 294
159 3300025908 Ga0207643_10090806 Ga0207643_100908061 294
160 3300025912 Ga0207707_10001121 Ga0207707_1000112115 294
161 3300025918 Ga0207662_10036238 Ga0207662_100362384 294
162 3300025919 Ga0207657_10024846 Ga0207657_100248466 294
163 3300025919 Ga0207657_10074344 Ga0207657_100743445 294
164 3300025920 Ga0207649_10003304 Ga0207649_100033042 294
165 3300025920 Ga0207649_10059029 Ga0207649_100590291 294
166 3300025921 Ga0207652_10018299 Ga0207652_100182998 294
167 3300025923 Ga0207681_10036120 Ga0207681_100361204 294
168 3300025923 Ga0207681_10103865 Ga0207681_101038651 294
169 3300025923 Ga0207681_10206251 Ga0207681_102062511 294
170 3300025925 Ga0207650_10103803 Ga0207650_101038031 294
171 3300025926 Ga0207659_10096406 Ga0207659_100964061 294
172 3300025926 Ga0207659_10193606 Ga0207659_101936062 294
173 3300025927 Ga0207687_10000664 Ga0207687_1000066420 294
174 3300025932 Ga0207690_10091327 Ga0207690_100913271 294
175 3300025933 Ga0207706_10010192 Ga0207706_100101924 294
176 3300025933 Ga0207706_10080200 Ga0207706_100802003 294
177 3300025933 Ga0207706_10225912 Ga0207706_102259122 294
178 3300025934 Ga0207686_10001827 Ga0207686_100018278 294
179 3300025935 Ga0207709_10128229 Ga0207709_101282292 294
180 3300025936 Ga0207670_10001085 Ga0207670_1000108511 294
181 3300025938 Ga0207704_10000730 Ga0207704_100007307 294
182 3300025938 Ga0207704_10027930 Ga0207704_100279301 294
183 3300025940 Ga0207691_10000246 Ga0207691_1000024625 294
184 3300025940 Ga0207691_10008430 Ga0207691_100084308 294
185 3300025941 Ga0207711_10133418 Ga0207711_101334182 294
186 3300025942 Ga0207689_10000073 Ga0207689_1000007355 294
187 3300025942 Ga0207689_10017216 Ga0207689_100172164 294
188 3300025944 Ga0207661_10008040 Ga0207661_100080405 294
189 3300025944 Ga0207661_10505453 Ga0207661_105054531 294
190 3300025945 Ga0207679_10000719 Ga0207679_100007194 294
191 3300025945 Ga0207679_10008494 Ga0207679_100084942 294
192 3300025945 Ga0207679_10023066 Ga0207679_100230665 294
193 3300025949 Ga0207667_10093647 Ga0207667_100936472 294
194 3300025960 Ga0207651_10010912 Ga0207651_100109128 294
195 3300025960 Ga0207651_10051407 Ga0207651_100514071 294
196 3300025961 Ga0207712_10002997 Ga0207712_1000299712 294
197 3300025961 Ga0207712_10005822 Ga0207712_100058226 294
198 3300025961 Ga0207712_10013897 Ga0207712_100138974 294
199 3300025972 Ga0207668_10012456 Ga0207668_100124565 294
200 3300025972 Ga0207668_10088439 Ga0207668_100884395 294
201 3300025972 Ga0207668_10304929 Ga0207668_103049291 294
202 3300025981 Ga0207640_10335032 Ga0207640_103350322 294
203 3300025986 Ga0207658_10098232 Ga0207658_100982322 294
204 3300026023 Ga0207677_10262550 Ga0207677_102625501 294
205 3300026035 Ga0207703_10003671 Ga0207703_100036719 294
206 3300026041 Ga0207639_10153143 Ga0207639_101531433 294
207 3300026067 Ga0207678_10284646 Ga0207678_102846461 294
208 3300026075 Ga0207708_10000150 Ga0207708_1000015022 294
209 3300026075 Ga0207708_10074778 Ga0207708_100747782 294
210 3300026088 Ga0207641_10587128 Ga0207641_105871281 294
211 3300026089 Ga0207648_10001547 Ga0207648_100015477 294
212 3300026089 Ga0207648_10058382 Ga0207648_100583823 294
213 3300026089 Ga0207648_10235363 Ga0207648_102353632 294
214 3300026095 Ga0207676_10070456 Ga0207676_100704565 294
215 3300026095 Ga0207676_10365316 Ga0207676_103653162 294
216 3300026116 Ga0207674_10001314 Ga0207674_100013148 294
217 3300026116 Ga0207674_10006241 Ga0207674_1000624115 294
218 3300026116 Ga0207674_10011262 Ga0207674_100112621 294
219 3300026118 Ga0207675_100000201 Ga0207675_10000020122 294
220 3300026118 Ga0207675_100040882 Ga0207675_1000408822 294
221 3300026121 Ga0207683_10008087 Ga0207683_100080876 294
222 3300026142 Ga0207698_10169314 Ga0207698_101693143 294
223 3300027907 Ga0207428_10137523 Ga0207428_101375232 294
224 3300027907 Ga0207428_10144266 Ga0207428_101442662 294
225 3300028379 Ga0268266_10023519 Ga0268266_100235194 294
226 3300028380 Ga0268265_10010291 Ga0268265_100102916 294
227 3300028380 Ga0268265_10051584 Ga0268265_100515844 294
228 3300028380 Ga0268265_10210532 Ga0268265_102105321 294
229 3300028381 Ga0268264_10118559 Ga0268264_101185593 294
230 3300031548 Ga0307408_100006188 Ga0307408_1000061889 294
231 3300031731 Ga0307405_10124015 Ga0307405_101240152 294
232 3300031901 Ga0307406_10000992 Ga0307406_1000099214 294
233 3300031995 Ga0307409_100126225 Ga0307409_1001262252 294
234 3300032126 Ga0307415_100034242 Ga0307415_1000342421 294
235 3300037471 Ga0395905_0046639 Ga0395905_0046639_3089_3973 294
236 3300039437 Ga0436365_1852592 Ga0436365_1852592_253_1137 294
237 3300042133 Ga0450896_011034 Ga0450896_011034_71_955 294
238 3300045051 Ga0451576_0142405 Ga0451576_0142405_241_1125 294
239 3300050507 nmdc:mga05p37_212385_c1 nmdc:mga05p37_212385_c1_1355_2239 294
240 3300050507 nmdc:mga05p37_36354_c1 nmdc:mga05p37_36354_c1_1377_2261 294
241 3300050508 nmdc:mga09592_41786_c1 nmdc:mga09592_41786_c1_1387_2271 294
242 3300050509 nmdc:mga0qj67_21964_c1 nmdc:mga0qj67_21964_c1_2543_3427 294
243 3300050510 nmdc:mga06r32_101700_c1 nmdc:mga06r32_101700_c1_239_1123 294
244 3300050510 nmdc:mga06r32_75695_c1 nmdc:mga06r32_75695_c1_650_1534 294
245 3300050510 nmdc:mga06r32_8042_c1 nmdc:mga06r32_8042_c1_4089_4973 294
246 3300050511 nmdc:mga08y16_57366_c1 nmdc:mga08y16_57366_c1_1934_2818 294
247 3300050512 nmdc:mga0n895_111158_c1 nmdc:mga0n895_111158_c1_1376_2260 294
248 3300050512 nmdc:mga0n895_6204_c1 nmdc:mga0n895_6204_c1_5341_6225 294
249 3300050512 nmdc:mga0n895_6750_c1 nmdc:mga0n895_6750_c1_2146_3030 294
250 3300050515 nmdc:mga0a205_18154_c1 nmdc:mga0a205_18154_c1_527_1411 294
251 3300050515 nmdc:mga0a205_38288_c1 nmdc:mga0a205_38288_c1_3556_4440 294
252 3300050515 nmdc:mga0a205_3952_c1 nmdc:mga0a205_3952_c1_9277_10161 294
253 3300005330 Ga0070690_100147769 Ga0070690_1001477692 295
254 3300005340 Ga0070689_100016352 Ga0070689_1000163524 295
255 3300005365 Ga0070688_100110010 Ga0070688_1001100102 295
256 3300005468 Ga0070707_100037852 Ga0070707_1000378521 295
257 3300005544 Ga0070686_100046575 Ga0070686_1000465752 295
258 3300005617 Ga0068859_100049514 Ga0068859_1000495142 295
259 3300005841 Ga0068863_100199577 Ga0068863_1001995773 295
260 3300006852 Ga0075433_10018829 Ga0075433_100188292 295
261 3300006871 Ga0075434_100084435 Ga0075434_1000844353 295
262 3300006931 Ga0097620_100049515 Ga0097620_1000495152 295
263 3300025936 Ga0207670_10016088 Ga0207670_100160883 295
264 3300046663 Ga0495635_0056341 Ga0495635_0056341_1483_2370 295
265 3300047471 Ga0495684_0148393 Ga0495684_0148393_271_1158 295
266 3300050512 nmdc:mga0n895_171633_c1 nmdc:mga0n895_171633_c1_536_1423 295
267 3300050515 nmdc:mga0a205_313389_c1 nmdc:mga0a205_313389_c1_238_1125 295
268 3300053077 Ga0495601_0192329 Ga0495601_0192329_231_1118 295
269 3300005329 Ga0070683_100186958 Ga0070683_1001869582 296
270 3300005336 Ga0070680_100005081 Ga0070680_1000050814 296
271 3300005337 Ga0070682_100002665 Ga0070682_1000026654 296
272 3300005338 Ga0068868_100103173 Ga0068868_1001031732 296
273 3300005364 Ga0070673_100094254 Ga0070673_1000942542 296
274 3300005445 Ga0070708_100290690 Ga0070708_1002906901 296
275 3300005458 Ga0070681_10022472 Ga0070681_100224723 296
276 3300005530 Ga0070679_100002944 Ga0070679_1000029448 296
277 3300005536 Ga0070697_100055484 Ga0070697_1000554842 296
278 3300005536 Ga0070697_100111617 Ga0070697_1001116172 296
279 3300005539 Ga0068853_100032766 Ga0068853_1000327664 296
280 3300005544 Ga0070686_100153439 Ga0070686_1001534392 296
281 3300005563 Ga0068855_100093825 Ga0068855_1000938252 296
282 3300009098 Ga0105245_10025097 Ga0105245_100250976 296
283 3300009147 Ga0114129_10149834 Ga0114129_101498342 296
284 3300009553 Ga0105249_10052819 Ga0105249_100528192 296
285 3300013296 Ga0157374_10239996 Ga0157374_102399962 296
286 3300025912 Ga0207707_10001396 Ga0207707_1000139611 296
287 3300025917 Ga0207660_10173920 Ga0207660_101739202 296
288 3300025917 Ga0207660_10258959 Ga0207660_102589592 296
289 3300025921 Ga0207652_10002725 Ga0207652_1000272511 296
290 3300025961 Ga0207712_10110921 Ga0207712_101109212 296
291 3300026041 Ga0207639_10011378 Ga0207639_100113785 296
292 3300026089 Ga0207648_10710975 Ga0207648_107109751 296
293 3300005330 Ga0070690_100054046 Ga0070690_1000540464 297
294 3300005336 Ga0070680_100041457 Ga0070680_1000414572 297
295 3300005365 Ga0070688_100232576 Ga0070688_1002325762 297
296 3300005438 Ga0070701_10085221 Ga0070701_100852212 297
297 3300005440 Ga0070705_100035112 Ga0070705_1000351122 297
298 3300005440 Ga0070705_100292877 Ga0070705_1002928771 297
299 3300005444 Ga0070694_100198603 Ga0070694_1001986032 297
300 3300005467 Ga0070706_100010107 Ga0070706_10001010710 297
301 3300005467 Ga0070706_100267495 Ga0070706_1002674952 297
302 3300005468 Ga0070707_100186097 Ga0070707_1001860972 297
303 3300005471 Ga0070698_100144213 Ga0070698_1001442132 297
304 3300005518 Ga0070699_100010504 Ga0070699_1000105043 297
305 3300005518 Ga0070699_100014136 Ga0070699_1000141364 297
306 3300005518 Ga0070699_100228616 Ga0070699_1002286161 297
307 3300005518 Ga0070699_100232920 Ga0070699_1002329202 297
308 3300005518 Ga0070699_100574851 Ga0070699_1005748511 297
309 3300005536 Ga0070697_100000676 Ga0070697_10000067625 297
310 3300005536 Ga0070697_100033537 Ga0070697_1000335374 297
311 3300005536 Ga0070697_100120907 Ga0070697_1001209073 297
312 3300005545 Ga0070695_100222275 Ga0070695_1002222751 297
313 3300005545 Ga0070695_100344481 Ga0070695_1003444811 297
314 3300005546 Ga0070696_100008545 Ga0070696_1000085454 297
315 3300005546 Ga0070696_100074760 Ga0070696_1000747602 297
316 3300005549 Ga0070704_100087937 Ga0070704_1000879371 297
317 3300005617 Ga0068859_100091401 Ga0068859_1000914013 297
318 3300005843 Ga0068860_100047080 Ga0068860_1000470804 297
319 3300005844 Ga0068862_100104689 Ga0068862_1001046892 297
320 3300006931 Ga0097620_100091396 Ga0097620_1000913963 297
321 3300009093 Ga0105240_10077015 Ga0105240_100770152 297
322 3300009177 Ga0105248_10043358 Ga0105248_100433584 297
323 3300013308 Ga0157375_10510425 Ga0157375_105104252 297
324 3300014326 Ga0157380_10142905 Ga0157380_101429052 297
325 3300014968 Ga0157379_10351549 Ga0157379_103515491 297
326 3300025910 Ga0207684_10000996 Ga0207684_1000099614 297
327 3300025910 Ga0207684_10008157 Ga0207684_100081578 297
328 3300025910 Ga0207684_10011745 Ga0207684_100117452 297
329 3300025917 Ga0207660_10039750 Ga0207660_100397503 297
330 3300025922 Ga0207646_10001766 Ga0207646_1000176614 297
331 3300025922 Ga0207646_10003426 Ga0207646_100034267 297
332 3300025942 Ga0207689_10225248 Ga0207689_102252482 297
333 3300026035 Ga0207703_10082391 Ga0207703_100823912 297
334 3300026075 Ga0207708_10107466 Ga0207708_101074663 297
335 3300037418 Ga0395900_0168410 Ga0395900_0168410_76_969 297
336 3300039437 Ga0436365_1377439 Ga0436365_1377439_2138_3031 297
337 3300039450 Ga0436363_1343188 Ga0436363_1343188_667_1560 297
338 3300042876 Ga0451577_0090668 Ga0451577_0090668_1395_2303 297
339 3300045051 Ga0451576_0005179 Ga0451576_0005179_11989_12942 297
340 3300045051 Ga0451576_0059539 Ga0451576_0059539_530_1438 297
341 3300050514 nmdc:mga08x19_28392_c1 nmdc:mga08x19_28392_c1_569_1468 297
342 3300060353 Ga0501082_0322527 Ga0501082_0322527_281_1174 297
343 3300005295 Ga0065707_10182615 Ga0065707_101826151 298
344 3300005364 Ga0070673_100103712 Ga0070673_1001037122 298
345 3300005444 Ga0070694_100000036 Ga0070694_10000003631 298
346 3300005455 Ga0070663_100141728 Ga0070663_1001417282 298
347 3300005518 Ga0070699_100000003 Ga0070699_100000003104 298
348 3300005518 Ga0070699_100028835 Ga0070699_1000288355 298
349 3300006844 Ga0075428_100298887 Ga0075428_1002988872 298
350 3300006847 Ga0075431_100072276 Ga0075431_1000722762 298
351 3300006852 Ga0075433_10001841 Ga0075433_1000184114 298
352 3300006871 Ga0075434_100042354 Ga0075434_1000423545 298
353 3300006871 Ga0075434_100333652 Ga0075434_1003336521 298
354 3300007076 Ga0075435_100025966 Ga0075435_1000259661 298
355 3300009093 Ga0105240_10061623 Ga0105240_100616235 298
356 3300009094 Ga0111539_10029943 Ga0111539_100299435 298
357 3300009094 Ga0111539_10058716 Ga0111539_100587163 298
358 3300009094 Ga0111539_10076994 Ga0111539_100769943 298
359 3300014326 Ga0157380_10009292 Ga0157380_100092923 298
360 3300025912 Ga0207707_10041889 Ga0207707_100418893 298
361 3300025917 Ga0207660_10070273 Ga0207660_100702732 298
362 3300025960 Ga0207651_10108107 Ga0207651_101081072 298
363 3300026116 Ga0207674_10132536 Ga0207674_101325362 298
364 3300027876 Ga0209974_10043485 Ga0209974_100434852 298
365 3300027907 Ga0207428_10021298 Ga0207428_100212984 298
366 3300031548 Ga0307408_100112465 Ga0307408_1001124652 298
367 3300031995 Ga0307409_100603695 Ga0307409_1006036951 298
368 3300032005 Ga0307411_10234800 Ga0307411_102348002 298
369 3300048913 Ga0496110_0205069 Ga0496110_0205069_365_1261 298
370 3300049741 Ga0501079_0199719 Ga0501079_0199719_223_1119 298
371 3300049743 Ga0501081_0101243 Ga0501081_0101243_174_1070 298
372 3300050511 nmdc:mga08y16_23198_c1 nmdc:mga08y16_23198_c1_619_1521 298
373 3300050511 nmdc:mga08y16_24927_c1 nmdc:mga08y16_24927_c1_4366_5262 298
374 3300050511 nmdc:mga08y16_69326_c1 nmdc:mga08y16_69326_c1_500_1498 298
375 3300050512 nmdc:mga0n895_73424_c1 nmdc:mga0n895_73424_c1_962_1858 298
376 3300050513 nmdc:mga0rr50_519812_c1 nmdc:mga0rr50_519812_c1_43_939 298
377 3300050513 nmdc:mga0rr50_546731_c1 nmdc:mga0rr50_546731_c1_17_913 298
378 3300050515 nmdc:mga0a205_19740_c1 nmdc:mga0a205_19740_c1_4404_5300 298
379 3300005331 Ga0070670_100002718 Ga0070670_1000027183 299
380 3300005445 Ga0070708_100079116 Ga0070708_1000791162 299
381 3300005467 Ga0070706_100017608 Ga0070706_1000176086 299
382 3300005468 Ga0070707_100088448 Ga0070707_1000884482 299
383 3300005518 Ga0070699_100005646 Ga0070699_1000056469 299
384 3300005536 Ga0070697_100100621 Ga0070697_1001006213 299
385 3300006846 Ga0075430_100149274 Ga0075430_1001492742 299
386 3300006871 Ga0075434_100040841 Ga0075434_1000408415 299
387 3300006914 Ga0075436_100018848 Ga0075436_1000188483 299
388 3300025925 Ga0207650_10012452 Ga0207650_100124523 299
389 3300031901 Ga0307406_10009756 Ga0307406_100097563 299
390 3300032126 Ga0307415_100270345 Ga0307415_1002703451 299
391 3300038726 Ga0400490_24643 Ga0400490_24643_17189_18088 299
392 3300038727 Ga0400491_13982 Ga0400491_13982_518_1417 299
393 3300039437 Ga0436365_0565193 Ga0436365_0565193_3686_4585 299
394 3300041505 Ga0451849_0210341 Ga0451849_0210341_627_1526 299
395 3300049578 Ga0501042_0081155 Ga0501042_0081155_947_1846 299
396 3300050512 nmdc:mga0n895_4755_c1 nmdc:mga0n895_4755_c1_2195_3094 299
397 3300050514 nmdc:mga08x19_17398_c1 nmdc:mga08x19_17398_c1_1047_1946 299
398 3300006844 Ga0075428_100021190 Ga0075428_1000211908 300
399 3300006852 Ga0075433_10022793 Ga0075433_100227932 300
400 3300006871 Ga0075434_100006981 Ga0075434_1000069817 300
401 3300025922 Ga0207646_10202677 Ga0207646_102026772 300
402 3300036401 Ga0373937_0016632 Ga0373937_0016632_1686_2588 300
403 3300047471 Ga0495684_0060607 Ga0495684_0060607_446_1387 300
404 3300047472 Ga0495686_0005090 Ga0495686_0005090_5701_6741 300
405 3300049569 Ga0501032_0092299 Ga0501032_0092299_195_1097 300
406 3300049572 Ga0501036_0256190 Ga0501036_0256190_513_1415 300
407 3300049575 Ga0501039_0072157 Ga0501039_0072157_1681_2583 300
408 3300049576 Ga0501040_0011752 Ga0501040_0011752_1998_2900 300
409 3300049577 Ga0501041_0046124 Ga0501041_0046124_1116_2018 300
410 3300049577 Ga0501041_0049742 Ga0501041_0049742_1509_2411 300
411 3300049578 Ga0501042_0146431 Ga0501042_0146431_369_1271 300
412 3300049587 Ga0501071_0334427 Ga0501071_0334427_36_938 300
413 3300049588 Ga0501072_0015127 Ga0501072_0015127_2530_3432 300
414 3300049591 Ga0501075_0027856 Ga0501075_0027856_23_925 300
415 3300049741 Ga0501079_0198577 Ga0501079_0198577_128_1030 300
416 3300049742 Ga0501080_0087644 Ga0501080_0087644_1924_2826 300
417 3300049743 Ga0501081_0013622 Ga0501081_0013622_2109_3011 300
418 3300049824 Ga0501045_0005172 Ga0501045_0005172_8010_8912 300
419 3300049824 Ga0501045_0103026 Ga0501045_0103026_123_1025 300
420 3300050512 nmdc:mga0n895_52897_c1 nmdc:mga0n895_52897_c1_206_1108 300
421 3300050515 nmdc:mga0a205_39079_c1 nmdc:mga0a205_39079_c1_1101_2003 300
422 3300054114 Ga0501084_0036657 Ga0501084_0036657_1461_2363 300
423 3300060353 Ga0501082_0105554 Ga0501082_0105554_1144_2046 300
424 3300060353 Ga0501082_0546601 Ga0501082_0546601_85_987 300
425 3300061734 Ga0530510_0076676 Ga0530510_0076676_1070_1972 300
426 3300003316 rootH1_10092327 rootH1_100923272 301
427 3300005290 Ga0065712_10001235 Ga0065712_100012359 301
428 3300005290 Ga0065712_10075702 Ga0065712_100757022 301
429 3300005293 Ga0065715_10218435 Ga0065715_102184351 301
430 3300005328 Ga0070676_10000044 Ga0070676_1000004432 301
431 3300005329 Ga0070683_100000860 Ga0070683_1000008606 301
432 3300005329 Ga0070683_100024856 Ga0070683_1000248563 301
433 3300005330 Ga0070690_100000115 Ga0070690_10000011529 301
434 3300005331 Ga0070670_100000440 Ga0070670_10000044027 301
435 3300005333 Ga0070677_10000321 Ga0070677_100003211 301
436 3300005334 Ga0068869_100000129 Ga0068869_1000001295 301
437 3300005334 Ga0068869_100008317 Ga0068869_1000083173 301
438 3300005335 Ga0070666_10000277 Ga0070666_1000027727 301
439 3300005335 Ga0070666_10037238 Ga0070666_100372382 301
440 3300005336 Ga0070680_100253975 Ga0070680_1002539751 301
441 3300005338 Ga0068868_100000812 Ga0068868_10000081217 301
442 3300005339 Ga0070660_100000052 Ga0070660_10000005222 301
443 3300005340 Ga0070689_100000089 Ga0070689_10000008917 301
444 3300005343 Ga0070687_100000046 Ga0070687_10000004619 301
445 3300005344 Ga0070661_100000932 Ga0070661_1000009328 301
446 3300005344 Ga0070661_100005995 Ga0070661_1000059952 301
447 3300005344 Ga0070661_100082666 Ga0070661_1000826662 301
448 3300005345 Ga0070692_10006253 Ga0070692_100062533 301
449 3300005345 Ga0070692_10036909 Ga0070692_100369092 301
450 3300005347 Ga0070668_100001956 Ga0070668_1000019568 301
451 3300005347 Ga0070668_100146173 Ga0070668_1001461732 301
452 3300005353 Ga0070669_100000477 Ga0070669_1000004778 301
453 3300005353 Ga0070669_100004675 Ga0070669_1000046756 301
454 3300005353 Ga0070669_100011442 Ga0070669_1000114424 301
455 3300005353 Ga0070669_100047644 Ga0070669_1000476442 301
456 3300005354 Ga0070675_100000114 Ga0070675_10000011416 301
457 3300005354 Ga0070675_100076866 Ga0070675_1000768663 301
458 3300005354 Ga0070675_100107032 Ga0070675_1001070322 301
459 3300005355 Ga0070671_100001522 Ga0070671_1000015228 301
460 3300005355 Ga0070671_100006915 Ga0070671_1000069152 301
461 3300005355 Ga0070671_100097544 Ga0070671_1000975441 301
462 3300005356 Ga0070674_100000067 Ga0070674_10000006736 301
463 3300005356 Ga0070674_100000516 Ga0070674_1000005163 301
464 3300005364 Ga0070673_100000108 Ga0070673_1000001083 301
465 3300005364 Ga0070673_100011700 Ga0070673_1000117002 301
466 3300005365 Ga0070688_100000035 Ga0070688_10000003539 301
467 3300005365 Ga0070688_100110004 Ga0070688_1001100042 301
468 3300005366 Ga0070659_100000369 Ga0070659_1000003694 301
469 3300005367 Ga0070667_100000478 Ga0070667_10000047836 301
470 3300005367 Ga0070667_100015673 Ga0070667_1000156735 301
471 3300005367 Ga0070667_100038314 Ga0070667_1000383143 301
472 3300005438 Ga0070701_10002593 Ga0070701_100025934 301
473 3300005438 Ga0070701_10113673 Ga0070701_101136732 301
474 3300005440 Ga0070705_100000267 Ga0070705_1000002672 301
475 3300005440 Ga0070705_100001707 Ga0070705_1000017073 301
476 3300005441 Ga0070700_100003776 Ga0070700_1000037765 301
477 3300005444 Ga0070694_100067985 Ga0070694_1000679853 301
478 3300005444 Ga0070694_100363470 Ga0070694_1003634701 301
479 3300005455 Ga0070663_100011308 Ga0070663_1000113082 301
480 3300005455 Ga0070663_100014725 Ga0070663_1000147253 301
481 3300005456 Ga0070678_100000162 Ga0070678_1000001629 301
482 3300005456 Ga0070678_100008129 Ga0070678_1000081293 301
483 3300005456 Ga0070678_100203397 Ga0070678_1002033972 301
484 3300005457 Ga0070662_100000106 Ga0070662_10000010614 301
485 3300005457 Ga0070662_100000261 Ga0070662_1000002614 301
486 3300005458 Ga0070681_10124115 Ga0070681_101241153 301
487 3300005459 Ga0068867_100000105 Ga0068867_10000010514 301
488 3300005459 Ga0068867_100000414 Ga0068867_10000041418 301
489 3300005466 Ga0070685_10000242 Ga0070685_1000024222 301
490 3300005530 Ga0070679_100035189 Ga0070679_1000351892 301
491 3300005535 Ga0070684_100000380 Ga0070684_10000038019 301
492 3300005535 Ga0070684_100024751 Ga0070684_1000247512 301
493 3300005535 Ga0070684_100100398 Ga0070684_1001003982 301
494 3300005536 Ga0070697_100169138 Ga0070697_1001691382 301
495 3300005539 Ga0068853_100000288 Ga0068853_1000002884 301
496 3300005543 Ga0070672_100000076 Ga0070672_10000007634 301
497 3300005543 Ga0070672_100086209 Ga0070672_1000862092 301
498 3300005543 Ga0070672_100190633 Ga0070672_1001906331 301
499 3300005544 Ga0070686_100000368 Ga0070686_10000036817 301
500 3300005544 Ga0070686_100037390 Ga0070686_1000373902 301
501 3300005545 Ga0070695_100025572 Ga0070695_1000255721 301
502 3300005546 Ga0070696_100008223 Ga0070696_1000082232 301
503 3300005546 Ga0070696_100009243 Ga0070696_1000092433 301
504 3300005546 Ga0070696_100029142 Ga0070696_1000291424 301
505 3300005547 Ga0070693_100027964 Ga0070693_1000279642 301
506 3300005548 Ga0070665_100001106 Ga0070665_10000110627 301
507 3300005549 Ga0070704_100003479 Ga0070704_1000034796 301
508 3300005563 Ga0068855_100000202 Ga0068855_10000020229 301
509 3300005564 Ga0070664_100000353 Ga0070664_10000035311 301
510 3300005564 Ga0070664_100000533 Ga0070664_10000053322 301
511 3300005564 Ga0070664_100019574 Ga0070664_1000195744 301
512 3300005577 Ga0068857_100002680 Ga0068857_10000268011 301
513 3300005578 Ga0068854_100000154 Ga0068854_10000015436 301
514 3300005578 Ga0068854_100017526 Ga0068854_1000175265 301
515 3300005614 Ga0068856_100001685 Ga0068856_1000016856 301
516 3300005615 Ga0070702_100005235 Ga0070702_1000052357 301
517 3300005615 Ga0070702_100078389 Ga0070702_1000783892 301
518 3300005616 Ga0068852_100000109 Ga0068852_10000010912 301
519 3300005616 Ga0068852_100066024 Ga0068852_1000660243 301
520 3300005617 Ga0068859_100074998 Ga0068859_1000749983 301
521 3300005618 Ga0068864_100000374 Ga0068864_10000037434 301
522 3300005618 Ga0068864_100007605 Ga0068864_1000076058 301
523 3300005718 Ga0068866_10000059 Ga0068866_1000005910 301
524 3300005718 Ga0068866_10000089 Ga0068866_100000899 301
525 3300005719 Ga0068861_100000059 Ga0068861_10000005911 301
526 3300005719 Ga0068861_100006973 Ga0068861_1000069734 301
527 3300005719 Ga0068861_100312945 Ga0068861_1003129452 301
528 3300005834 Ga0068851_10000065 Ga0068851_1000006533 301
529 3300005840 Ga0068870_10000327 Ga0068870_100003275 301
530 3300005841 Ga0068863_100001278 Ga0068863_10000127816 301
531 3300005841 Ga0068863_100016732 Ga0068863_1000167323 301
532 3300005842 Ga0068858_100000680 Ga0068858_10000068029 301
533 3300005842 Ga0068858_100009116 Ga0068858_1000091165 301
534 3300005843 Ga0068860_100000483 Ga0068860_10000048310 301
535 3300005843 Ga0068860_100002818 Ga0068860_1000028189 301
536 3300005843 Ga0068860_100014859 Ga0068860_1000148595 301
537 3300005843 Ga0068860_100025657 Ga0068860_1000256575 301
538 3300005843 Ga0068860_100119133 Ga0068860_1001191332 301
539 3300005844 Ga0068862_100000523 Ga0068862_10000052327 301
540 3300005844 Ga0068862_100017232 Ga0068862_1000172323 301
541 3300005983 Ga0081540_1000298 Ga0081540_100029834 301
542 3300005983 Ga0081540_1007881 Ga0081540_10078812 301
543 3300006237 Ga0097621_100000831 Ga0097621_10000083111 301
544 3300006237 Ga0097621_100017185 Ga0097621_1000171856 301
545 3300006237 Ga0097621_100077266 Ga0097621_1000772662 301
546 3300006358 Ga0068871_100004948 Ga0068871_1000049483 301
547 3300006358 Ga0068871_100126138 Ga0068871_1001261383 301
548 3300006358 Ga0068871_100369402 Ga0068871_1003694021 301
549 3300006844 Ga0075428_100119830 Ga0075428_1001198301 301
550 3300006844 Ga0075428_100355877 Ga0075428_1003558771 301
551 3300006844 Ga0075428_100555835 Ga0075428_1005558351 301
552 3300006846 Ga0075430_100020970 Ga0075430_1000209705 301
553 3300006846 Ga0075430_100085726 Ga0075430_1000857263 301
554 3300006846 Ga0075430_100132371 Ga0075430_1001323712 301
555 3300006846 Ga0075430_100136911 Ga0075430_1001369111 301
556 3300006847 Ga0075431_100016053 Ga0075431_1000160532 301
557 3300006847 Ga0075431_100021860 Ga0075431_1000218604 301
558 3300006847 Ga0075431_100361018 Ga0075431_1003610182 301
559 3300006847 Ga0075431_100415083 Ga0075431_1004150831 301
560 3300006852 Ga0075433_10018948 Ga0075433_100189484 301
561 3300006852 Ga0075433_10271427 Ga0075433_102714272 301
562 3300006880 Ga0075429_100073997 Ga0075429_1000739973 301
563 3300006880 Ga0075429_100120000 Ga0075429_1001200001 301
564 3300006880 Ga0075429_100241580 Ga0075429_1002415802 301
565 3300006880 Ga0075429_100293680 Ga0075429_1002936802 301
566 3300006881 Ga0068865_100000080 Ga0068865_10000008039 301
567 3300006881 Ga0068865_100002537 Ga0068865_1000025374 301
568 3300006931 Ga0097620_100074996 Ga0097620_1000749962 301
569 3300007076 Ga0075435_100037247 Ga0075435_1000372471 301
570 3300007076 Ga0075435_100261048 Ga0075435_1002610482 301
571 3300009093 Ga0105240_10025630 Ga0105240_100256308 301
572 3300009093 Ga0105240_10166009 Ga0105240_101660093 301
573 3300009094 Ga0111539_10052759 Ga0111539_100527593 301
574 3300009094 Ga0111539_10115411 Ga0111539_101154111 301
575 3300009098 Ga0105245_10002431 Ga0105245_100024315 301
576 3300009098 Ga0105245_10003537 Ga0105245_100035372 301
577 3300009098 Ga0105245_10040281 Ga0105245_100402813 301
578 3300009101 Ga0105247_10001615 Ga0105247_1000161512 301
579 3300009101 Ga0105247_10120795 Ga0105247_101207951 301
580 3300009147 Ga0114129_10002787 Ga0114129_100027879 301
581 3300009147 Ga0114129_10005266 Ga0114129_100052666 301
582 3300009147 Ga0114129_10064503 Ga0114129_100645033 301
583 3300009148 Ga0105243_10010142 Ga0105243_100101425 301
584 3300009148 Ga0105243_10199404 Ga0105243_101994042 301
585 3300009148 Ga0105243_10383877 Ga0105243_103838772 301
586 3300009174 Ga0105241_10000182 Ga0105241_1000018239 301
587 3300009174 Ga0105241_10014236 Ga0105241_100142363 301
588 3300009176 Ga0105242_10004015 Ga0105242_100040157 301
589 3300009176 Ga0105242_10004174 Ga0105242_100041743 301
590 3300009177 Ga0105248_10001050 Ga0105248_1000105014 301
591 3300009177 Ga0105248_10001923 Ga0105248_100019235 301
592 3300009177 Ga0105248_10004922 Ga0105248_100049223 301
593 3300009551 Ga0105238_10000297 Ga0105238_1000029712 301
594 3300009551 Ga0105238_10041612 Ga0105238_100416124 301
595 3300009553 Ga0105249_10000280 Ga0105249_1000028039 301
596 3300009553 Ga0105249_10000720 Ga0105249_100007202 301
597 3300009553 Ga0105249_10004530 Ga0105249_100045309 301
598 3300009553 Ga0105249_10301018 Ga0105249_103010181 301
599 3300010375 Ga0105239_10000709 Ga0105239_1000070937 301
600 3300010375 Ga0105239_10041496 Ga0105239_100414962 301
601 3300010375 Ga0105239_10186026 Ga0105239_101860264 301
602 3300011119 Ga0105246_10169792 Ga0105246_101697922 301
603 3300011119 Ga0105246_10504339 Ga0105246_105043391 301
604 3300013100 Ga0157373_10005090 Ga0157373_1000509010 301
605 3300013102 Ga0157371_10000340 Ga0157371_1000034039 301
606 3300013105 Ga0157369_10001580 Ga0157369_100015808 301
607 3300013296 Ga0157374_10000208 Ga0157374_1000020816 301
608 3300013296 Ga0157374_10013897 Ga0157374_100138972 301
609 3300013297 Ga0157378_10000152 Ga0157378_1000015246 301
610 3300013297 Ga0157378_10002577 Ga0157378_1000257717 301
611 3300013306 Ga0163162_10005524 Ga0163162_1000552410 301
612 3300013306 Ga0163162_10034653 Ga0163162_100346534 301
613 3300013307 Ga0157372_10001598 Ga0157372_100015986 301
614 3300013307 Ga0157372_10153593 Ga0157372_101535933 301
615 3300013307 Ga0157372_10394123 Ga0157372_103941231 301
616 3300013308 Ga0157375_10000252 Ga0157375_1000025239 301
617 3300013308 Ga0157375_10016342 Ga0157375_100163422 301
618 3300013308 Ga0157375_10371322 Ga0157375_103713222 301
619 3300014325 Ga0163163_10010093 Ga0163163_100100934 301
620 3300014325 Ga0163163_10010283 Ga0163163_100102839 301
621 3300014325 Ga0163163_10017851 Ga0163163_100178515 301
622 3300014325 Ga0163163_10474705 Ga0163163_104747052 301
623 3300014745 Ga0157377_10000141 Ga0157377_1000014134 301
624 3300014968 Ga0157379_10000079 Ga0157379_1000007920 301
625 3300014968 Ga0157379_10000316 Ga0157379_1000031632 301
626 3300014968 Ga0157379_10012769 Ga0157379_100127692 301
627 3300014969 Ga0157376_10027626 Ga0157376_100276265 301
628 3300014969 Ga0157376_10095751 Ga0157376_100957512 301
629 3300017792 Ga0163161_10005385 Ga0163161_100053855 301
630 3300025315 Ga0207697_10001148 Ga0207697_100011483 301
631 3300025321 Ga0207656_10000341 Ga0207656_1000034111 301
632 3300025893 Ga0207682_10002257 Ga0207682_100022571 301
633 3300025899 Ga0207642_10000041 Ga0207642_1000004131 301
634 3300025899 Ga0207642_10004156 Ga0207642_100041563 301
635 3300025900 Ga0207710_10000704 Ga0207710_100007043 301
636 3300025901 Ga0207688_10000015 Ga0207688_1000001523 301
637 3300025903 Ga0207680_10000063 Ga0207680_1000006310 301
638 3300025903 Ga0207680_10047216 Ga0207680_100472163 301
639 3300025903 Ga0207680_10136185 Ga0207680_101361852 301
640 3300025904 Ga0207647_10001319 Ga0207647_100013195 301
641 3300025907 Ga0207645_10000025 Ga0207645_1000002554 301
642 3300025907 Ga0207645_10004995 Ga0207645_1000499510 301
643 3300025908 Ga0207643_10000023 Ga0207643_1000002361 301
644 3300025909 Ga0207705_10001179 Ga0207705_1000117911 301
645 3300025911 Ga0207654_10003091 Ga0207654_100030912 301
646 3300025912 Ga0207707_10097164 Ga0207707_100971642 301
647 3300025913 Ga0207695_10019759 Ga0207695_100197592 301
648 3300025914 Ga0207671_10000645 Ga0207671_100006459 301
649 3300025917 Ga0207660_10051258 Ga0207660_100512583 301
650 3300025917 Ga0207660_10107856 Ga0207660_101078562 301
651 3300025918 Ga0207662_10000020 Ga0207662_1000002017 301
652 3300025919 Ga0207657_10000067 Ga0207657_1000006753 301
653 3300025920 Ga0207649_10001061 Ga0207649_100010614 301
654 3300025920 Ga0207649_10039341 Ga0207649_100393412 301
655 3300025921 Ga0207652_10282805 Ga0207652_102828052 301
656 3300025923 Ga0207681_10000192 Ga0207681_1000019231 301
657 3300025923 Ga0207681_10012927 Ga0207681_100129276 301
658 3300025923 Ga0207681_10066897 Ga0207681_100668973 301
659 3300025924 Ga0207694_10000636 Ga0207694_1000063614 301
660 3300025925 Ga0207650_10000147 Ga0207650_1000014724 301
661 3300025925 Ga0207650_10006362 Ga0207650_100063622 301
662 3300025926 Ga0207659_10000083 Ga0207659_1000008316 301
663 3300025926 Ga0207659_10124013 Ga0207659_101240132 301
664 3300025926 Ga0207659_10259352 Ga0207659_102593522 301
665 3300025927 Ga0207687_10001087 Ga0207687_100010878 301
666 3300025927 Ga0207687_10036476 Ga0207687_100364763 301
667 3300025927 Ga0207687_10041261 Ga0207687_100412613 301
668 3300025931 Ga0207644_10000711 Ga0207644_100007119 301
669 3300025931 Ga0207644_10099848 Ga0207644_100998482 301
670 3300025932 Ga0207690_10000121 Ga0207690_1000012140 301
671 3300025933 Ga0207706_10000067 Ga0207706_1000006794 301
672 3300025933 Ga0207706_10000119 Ga0207706_1000011940 301
673 3300025934 Ga0207686_10000108 Ga0207686_100001086 301
674 3300025934 Ga0207686_10012642 Ga0207686_100126422 301
675 3300025934 Ga0207686_10037288 Ga0207686_100372882 301
676 3300025935 Ga0207709_10004686 Ga0207709_100046862 301
677 3300025935 Ga0207709_10142613 Ga0207709_101426132 301
678 3300025935 Ga0207709_10151347 Ga0207709_101513472 301
679 3300025936 Ga0207670_10000100 Ga0207670_1000010024 301
680 3300025937 Ga0207669_10000541 Ga0207669_100005412 301
681 3300025937 Ga0207669_10002112 Ga0207669_100021122 301
682 3300025938 Ga0207704_10000080 Ga0207704_1000008016 301
683 3300025940 Ga0207691_10000079 Ga0207691_1000007938 301
684 3300025940 Ga0207691_10035191 Ga0207691_100351913 301
685 3300025941 Ga0207711_10000189 Ga0207711_1000018939 301
686 3300025941 Ga0207711_10019936 Ga0207711_100199363 301
687 3300025941 Ga0207711_10050601 Ga0207711_100506014 301
688 3300025942 Ga0207689_10000089 Ga0207689_1000008954 301
689 3300025942 Ga0207689_10000496 Ga0207689_100004967 301
690 3300025944 Ga0207661_10001303 Ga0207661_100013036 301
691 3300025944 Ga0207661_10097722 Ga0207661_100977222 301
692 3300025944 Ga0207661_10227593 Ga0207661_102275932 301
693 3300025945 Ga0207679_10000478 Ga0207679_1000047810 301
694 3300025945 Ga0207679_10000687 Ga0207679_100006872 301
695 3300025945 Ga0207679_10040700 Ga0207679_100407002 301
696 3300025945 Ga0207679_10251489 Ga0207679_102514892 301
697 3300025949 Ga0207667_10003595 Ga0207667_100035958 301
698 3300025949 Ga0207667_10053457 Ga0207667_100534572 301
699 3300025960 Ga0207651_10000054 Ga0207651_1000005411 301
700 3300025960 Ga0207651_10049873 Ga0207651_100498733 301
701 3300025960 Ga0207651_10539720 Ga0207651_105397201 301
702 3300025961 Ga0207712_10000157 Ga0207712_1000015739 301
703 3300025961 Ga0207712_10013755 Ga0207712_100137552 301
704 3300025961 Ga0207712_10314754 Ga0207712_103147542 301
705 3300025972 Ga0207668_10000445 Ga0207668_1000044523 301
706 3300025972 Ga0207668_10185524 Ga0207668_101855241 301
707 3300025981 Ga0207640_10000170 Ga0207640_1000017016 301
708 3300025981 Ga0207640_10015712 Ga0207640_100157125 301
709 3300025986 Ga0207658_10000331 Ga0207658_1000033138 301
710 3300025986 Ga0207658_10093837 Ga0207658_100938373 301
711 3300025986 Ga0207658_10155465 Ga0207658_101554652 301
712 3300026023 Ga0207677_10000113 Ga0207677_1000011339 301
713 3300026035 Ga0207703_10000265 Ga0207703_1000026547 301
714 3300026035 Ga0207703_10110291 Ga0207703_101102912 301
715 3300026041 Ga0207639_10003211 Ga0207639_100032117 301
716 3300026067 Ga0207678_10000591 Ga0207678_1000059112 301
717 3300026075 Ga0207708_10001214 Ga0207708_100012145 301
718 3300026078 Ga0207702_10009455 Ga0207702_100094555 301
719 3300026078 Ga0207702_10174927 Ga0207702_101749272 301
720 3300026088 Ga0207641_10001477 Ga0207641_1000147715 301
721 3300026088 Ga0207641_10094618 Ga0207641_100946182 301
722 3300026089 Ga0207648_10000029 Ga0207648_1000002995 301
723 3300026089 Ga0207648_10000095 Ga0207648_1000009538 301
724 3300026095 Ga0207676_10000226 Ga0207676_1000022610 301
725 3300026095 Ga0207676_10004153 Ga0207676_100041538 301
726 3300026116 Ga0207674_10000177 Ga0207674_1000017716 301
727 3300026116 Ga0207674_10007864 Ga0207674_100078649 301
728 3300026118 Ga0207675_100039122 Ga0207675_1000391226 301
729 3300026121 Ga0207683_10000050 Ga0207683_1000005029 301
730 3300026121 Ga0207683_10003044 Ga0207683_100030443 301
731 3300026121 Ga0207683_10099143 Ga0207683_100991432 301
732 3300026121 Ga0207683_10169344 Ga0207683_101693442 301
733 3300026142 Ga0207698_10000149 Ga0207698_1000014910 301
734 3300026142 Ga0207698_10119257 Ga0207698_101192572 301
735 3300028379 Ga0268266_10000415 Ga0268266_1000041524 301
736 3300028380 Ga0268265_10000581 Ga0268265_1000058119 301
737 3300028380 Ga0268265_10234053 Ga0268265_102340532 301
738 3300028381 Ga0268264_10000485 Ga0268264_1000048510 301
739 3300028381 Ga0268264_10012196 Ga0268264_100121965 301
740 3300028381 Ga0268264_10013128 Ga0268264_100131284 301
741 3300028381 Ga0268264_10024518 Ga0268264_100245185 301
742 3300028381 Ga0268264_10383297 Ga0268264_103832972 301
743 3300031240 Ga0265320_10030264 Ga0265320_100302642 301
744 3300031507 Ga0307509_10000112 Ga0307509_1000011246 301
745 3300031507 Ga0307509_10124024 Ga0307509_101240243 301
746 3300031711 Ga0265314_10010946 Ga0265314_100109463 301
747 3300035116 Ga0373945_0054202 Ga0373945_0054202_427_1356 301
748 3300035170 Ga0373943_0022391 Ga0373943_0022391_40_969 301
749 3300035171 Ga0373946_0045980 Ga0373946_0045980_46_960 301
750 3300035691 Ga0373931_0132354 Ga0373931_0132354_482_1390 301
751 3300035695 Ga0373927_0010358 Ga0373927_0010358_3114_4028 301
752 3300035695 Ga0373927_0179400 Ga0373927_0179400_19_1074 301
753 3300035725 Ga0373947_0019264 Ga0373947_0019264_1003_1932 301
754 3300035725 Ga0373947_0027662 Ga0373947_0027662_918_1973 301
755 3300036401 Ga0373937_0001843 Ga0373937_0001843_9812_10720 301
756 3300037068 Ga0373925_0001061 Ga0373925_0001061_13480_14409 301
757 3300037068 Ga0373925_0001237 Ga0373925_0001237_12726_13640 301
758 3300042876 Ga0451577_0020932 Ga0451577_0020932_473_1387 301
759 3300042876 Ga0451577_0037789 Ga0451577_0037789_782_1690 301
760 3300042876 Ga0451577_0094760 Ga0451577_0094760_1100_2026 301
761 3300044712 Ga0453684_0070149 Ga0453684_0070149_1037_1951 301
762 3300045051 Ga0451576_0100913 Ga0451576_0100913_1811_2737 301
763 3300045051 Ga0451576_0336365 Ga0451576_0336365_272_1180 301
764 3300046455 Ga0495603_0093829 Ga0495603_0093829_67_975 301
765 3300046511 Ga0495608_0225555 Ga0495608_0225555_143_1048 301
766 3300046535 Ga0495586_0001823 Ga0495586_0001823_6381_7310 301
767 3300046642 Ga0495634_0129804 Ga0495634_0129804_166_1071 301
768 3300046681 Ga0495647_0104382 Ga0495647_0104382_180_1109 301
769 3300046683 Ga0495658_0003780 Ga0495658_0003780_2327_3256 301
770 3300047321 Ga0495676_0014703 Ga0495676_0014703_1836_2765 301
771 3300047472 Ga0495686_0021780 Ga0495686_0021780_1113_2117 301
772 3300048903 Ga0496100_0106006 Ga0496100_0106006_698_1630 301
773 3300048904 Ga0496101_0180074 Ga0496101_0180074_124_1056 301
774 3300048905 Ga0496102_0004082 Ga0496102_0004082_3908_4840 301
775 3300048906 Ga0496103_0013364 Ga0496103_0013364_1365_2297 301
776 3300048907 Ga0496104_0021139 Ga0496104_0021139_2942_3856 301
777 3300048907 Ga0496104_0055354 Ga0496104_0055354_559_1467 301
778 3300048908 Ga0496105_0022542 Ga0496105_0022542_3696_4610 301
779 3300048908 Ga0496105_0302198 Ga0496105_0302198_270_1178 301
780 3300048909 Ga0496106_0008043 Ga0496106_0008043_1891_2823 301
781 3300048910 Ga0496107_0027874 Ga0496107_0027874_2820_3752 301
782 3300048911 Ga0496108_0038333 Ga0496108_0038333_667_1599 301
783 3300048911 Ga0496108_0068704 Ga0496108_0068704_1401_2315 301
784 3300048912 Ga0496109_0000709 Ga0496109_0000709_5765_6697 301
785 3300048912 Ga0496109_0003803 Ga0496109_0003803_1343_2257 301
786 3300048913 Ga0496110_0004326 Ga0496110_0004326_2690_3604 301
787 3300048914 Ga0496111_0179552 Ga0496111_0179552_35_949 301
788 3300048915 Ga0496112_0000210 Ga0496112_0000210_14639_15571 301
789 3300048915 Ga0496112_0006951 Ga0496112_0006951_1343_2257 301
790 3300048915 Ga0496112_0017314 Ga0496112_0017314_5497_6405 301
791 3300048915 Ga0496112_0290762 Ga0496112_0290762_282_1208 301
792 3300048916 Ga0496113_0128631 Ga0496113_0128631_417_1349 301
793 3300048916 Ga0496113_0248643 Ga0496113_0248643_451_1359 301
794 3300048917 Ga0496114_0033530 Ga0496114_0033530_182_1090 301
795 3300048918 Ga0496115_0055846 Ga0496115_0055846_549_1457 301
796 3300048919 Ga0496116_0222923 Ga0496116_0222923_18_923 301
797 3300049572 Ga0501036_0091618 Ga0501036_0091618_339_1259 301
798 3300049576 Ga0501040_0060164 Ga0501040_0060164_1003_1923 301
799 3300049577 Ga0501041_0058944 Ga0501041_0058944_352_1272 301
800 3300049578 Ga0501042_0292117 Ga0501042_0292117_174_1094 301
801 3300049586 Ga0501070_0098562 Ga0501070_0098562_1044_1952 301
802 3300049586 Ga0501070_0198321 Ga0501070_0198321_478_1386 301
803 3300049587 Ga0501071_0364103 Ga0501071_0364103_84_1001 301
804 3300049588 Ga0501072_0077055 Ga0501072_0077055_1414_2322 301
805 3300049588 Ga0501072_0187850 Ga0501072_0187850_222_1142 301
806 3300049589 Ga0501073_0027147 Ga0501073_0027147_282_1199 301
807 3300049590 Ga0501074_0071506 Ga0501074_0071506_340_1260 301
808 3300049591 Ga0501075_0077022 Ga0501075_0077022_430_1350 301
809 3300049592 Ga0501076_0029525 Ga0501076_0029525_1544_2464 301
810 3300049592 Ga0501076_0333028 Ga0501076_0333028_55_972 301
811 3300049741 Ga0501079_0041756 Ga0501079_0041756_673_1593 301
812 3300049741 Ga0501079_0196165 Ga0501079_0196165_166_1086 301
813 3300049741 Ga0501079_0276686 Ga0501079_0276686_119_1036 301
814 3300049742 Ga0501080_0391417 Ga0501080_0391417_262_1191 301
815 3300049743 Ga0501081_0021658 Ga0501081_0021658_2211_3131 301
816 3300049743 Ga0501081_0157612 Ga0501081_0157612_536_1453 301
817 3300049744 Ga0501083_0001915 Ga0501083_0001915_11948_12859 301
818 3300050507 nmdc:mga05p37_13006_c1 nmdc:mga05p37_13006_c1_5660_6568 301
819 3300050507 nmdc:mga05p37_18646_c1 nmdc:mga05p37_18646_c1_2265_3218 301
820 3300050507 nmdc:mga05p37_3575_c1 nmdc:mga05p37_3575_c1_12520_13431 301
821 3300050508 nmdc:mga09592_426062_c1 nmdc:mga09592_426062_c1_167_1090 301
822 3300050508 nmdc:mga09592_73997_c1 nmdc:mga09592_73997_c1_1710_2663 301
823 3300050508 nmdc:mga09592_86506_c1 nmdc:mga09592_86506_c1_1278_2186 301
824 3300050509 nmdc:mga0qj67_121754_c1 nmdc:mga0qj67_121754_c1_86_994 301
825 3300050509 nmdc:mga0qj67_147854_c1 nmdc:mga0qj67_147854_c1_942_1853 301
826 3300050510 nmdc:mga06r32_101213_c1 nmdc:mga06r32_101213_c1_1316_2224 301
827 3300050510 nmdc:mga06r32_128852_c1 nmdc:mga06r32_128852_c1_368_1309 301
828 3300050510 nmdc:mga06r32_196281_c1 nmdc:mga06r32_196281_c1_75_998 301
829 3300050510 nmdc:mga06r32_72991_c1 nmdc:mga06r32_72991_c1_2131_3084 301
830 3300050511 nmdc:mga08y16_128281_c1 nmdc:mga08y16_128281_c1_566_1495 301
831 3300050511 nmdc:mga08y16_340357_c1 nmdc:mga08y16_340357_c1_16_969 301
832 3300050512 nmdc:mga0n895_78706_c1 nmdc:mga0n895_78706_c1_55_972 301
833 3300050515 nmdc:mga0a205_320828_c1 nmdc:mga0a205_320828_c1_441_1355 301
834 3300050515 nmdc:mga0a205_5436_c1 nmdc:mga0a205_5436_c1_6245_7243 301
835 3300053077 Ga0495601_0032831 Ga0495601_0032831_2063_2971 301
836 3300054114 Ga0501084_0033204 Ga0501084_0033204_3219_4139 301
837 3300054114 Ga0501084_0315185 Ga0501084_0315185_47_964 301
838 3300059424 Ga0590075_006095 Ga0590075_006095_1331_2263 301
839 3300060353 Ga0501082_0105490 Ga0501082_0105490_418_1326 301
840 3300060353 Ga0501082_0242523 Ga0501082_0242523_224_1144 301
841 3300061734 Ga0530510_0016524 Ga0530510_0016524_3005_3925 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

239

268

0.97

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

133

218

0.91

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

113

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Am structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.9177 153 201
1i96-assembly1.cif.gz_M crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain) 0.9141 153 204
7nhm-assembly1.cif.gz_n 70s ribosome from staphylococcus aureus 0.8914 168 205
6rok-assembly1.cif.gz_A the crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor 0.8849 2 268
3c58-assembly1.cif.gz_A crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and a n7-benzyl-fapy-dg containing dna 0.8836 2 268
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9127 133 267 1.10.8.50
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9046 168 201 1.10.8.50
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9015 167 205 1.10.8.50
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8913 133 267 1.10.8.50
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8789 133 274 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9917 1 268 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9895 1 214 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7C4U9B8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.988 1 268 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A2V6X5E8-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9849 1 214 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A7Y1SVG2-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.977 1 210 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0016829
GO:0034039

Feature Viewer

pLDDT pTM Quality
92.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map