F483106

General Info

Members Datasets Scaffolds Average Seq Length
841 350 1682 268

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0076859|Ga0501031_0076859_738_1691
Length 317
Sequence VADQTAEKALGTTEAKPGDMAGGKTDGRAAGQAGADPADATALRDGPAAEADPPAPGEPEGGAGGSRVPTVIVDGLHVVYRIYGAGAGHGNATAALRRLLLRQGSPNVQTVHAVKGVTFTAYRGEAIGIIGSNGSGKTTLLKAVAGLLPAERGKVYTDGQPSLLGVNAALMNDLTGGTNVILGGLAMGMSQEEVRRRYQGIVDFSGINEKGDFISLPMRTYSSGMAARLRFSIAAAKNHDVLMIDEALATGDRAFQKRSEARIRELRKEAGTVFLVSHNNKSIRDTCDRVLWLEKGELLMDGPTDEVIKAYEAHTGK

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
27 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
28 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
46 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
47 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
48 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
49 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
55 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
56 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
57 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
63 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
72 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
73 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
74 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
75 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
76 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
77 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
78 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
79 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
80 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
81 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
97 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
111 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
217 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
218 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
226 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
227 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
228 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
229 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
230 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
231 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
232 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
233 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
236 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
237 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
238 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
239 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
240 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
241 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
244 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
245 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
246 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
247 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
252 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
253 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
254 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
255 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
256 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
257 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
258 2643221548 Streptomyces sp. Root55 Isolate Unclassified
259 2643221578 Streptomyces sp. Root63 Isolate Unclassified
260 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
261 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
262 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
263 2643221647 Streptomyces sp. Root369 Isolate Unclassified
264 2643221670 Streptomyces sp. Root431 Isolate Unclassified
265 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
266 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
267 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
268 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
269 2643221714 Streptomyces sp. Root264 Isolate Unclassified
270 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
271 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
272 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
273 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
274 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
275 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
276 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
277 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
278 2808606448 Streptomyces sp. 193411 Isolate Unclassified
279 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
280 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
281 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
282 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
283 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
284 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
285 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
286 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
287 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
288 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
289 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
290 2862574272 Streptomyces sp. AcE210 Isolate Nodule
291 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
292 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
293 2867369537 Streptomyces sp. Z26 Isolate Unclassified
294 2867428634 Streptomyces sp. RP5T Isolate Unclassified
295 2867475112 Streptomyces sp. TM32 Isolate Unclassified
296 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
297 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
298 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
299 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
300 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
301 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
302 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
303 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
304 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
305 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
306 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
307 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
308 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
309 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
310 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
311 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
312 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
313 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
314 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
315 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
316 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
317 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
318 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
319 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
320 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
321 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
322 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
323 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
324 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
325 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
326 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
327 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
328 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
329 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
330 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
331 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
332 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
333 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
334 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
335 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
336 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
337 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
338 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
339 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
340 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
341 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
342 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
343 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
344 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
345 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
346 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
347 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
348 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
349 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
350 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.33
Metatranscriptomes 0.59
Isolates 18.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 0.59
Rhizoplane 0.71
Rhizosphere 74.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0076859 3300049568 Bacteria 2175
2 JGI24737J22298_10024845 3300001990 Bacteria 1896
3 JGI24735J21928_10029586 3300002067 Bacteria 1630
4 JGI24738J21930_10018443 3300002075 Bacteria 1458
5 JGI24738J21930_10046777 3300002075 Bacteria 880
6 JGI25153J46596_10039005 3300003215 Bacteria 1489
7 rootH1_10011106 3300003316 Bacteria 12110
8 JGI25160J50197_1011063 3300003354 Bacteria 3223
9 Ga0006562J51391_1098900 3300003578 Bacteria 977
10 Ga0006562J51391_1121973 3300003578 Bacteria 3850
11 Ga0006562J51391_1199503 3300003578 Bacteria 950
12 Ga0006562J51391_1199504 3300003578 Bacteria 940
13 Ga0070683_100278457 3300005329 Bacteria 1591
14 Ga0068853_100033113 3300005539 Bacteria 4383
15 Ga0068856_100123386 3300005614 Bacteria 2593
16 Ga0075365_10269027 3300006038 Bacteria 1199
17 Ga0075368_10020748 3300006042 Bacteria 2490
18 Ga0075368_10042322 3300006042 Bacteria 1792
19 Ga0075363_100000602 3300006048 Bacteria 11878
20 Ga0075363_100024672 3300006048 Bacteria 3059
21 Ga0075367_10007175 3300006178 Bacteria 5688
22 Ga0075369_10097653 3300006186 Bacteria 1316
23 Ga0075370_10089133 3300006353 Bacteria 1779
24 Ga0075370_10109428 3300006353 Bacteria 1604
25 Ga0105243_10133094 3300009148 Bacteria 2112
26 Ga0105248_10520187 3300009177 Bacteria 1342
27 Ga0105238_10760336 3300009551 Bacteria 983
28 Ga0105246_10011543 3300011119 Bacteria 5484
29 Ga0105246_10077671 3300011119 Bacteria 2356
30 Ga0157369_10191806 3300013105 Bacteria 2147
31 Ga0157369_10219520 3300013105 Bacteria 1990
32 Ga0157372_10077114 3300013307 Bacteria 3764
33 Ga0182008_10000665 3300014497 Bacteria 24929
34 Ga0182008_10004348 3300014497 Bacteria 8287
35 Ga0182007_10000138 3300015262 Bacteria 50255
36 Ga0182007_10001425 3300015262 Bacteria 12838
37 Ga0183367_1001 3300015688 Bacteria 1225545
38 Ga0183367_1006 3300015688 Bacteria 648044
39 Ga0213875_10002768 3300021388 Bacteria 10351
40 Ga0209758_1004461 3300025297 Bacteria 11632
41 Ga0209758_1005428 3300025297 Bacteria 9828
42 Ga0207426_1003208 3300025302 Bacteria 9208
43 Ga0207426_1012734 3300025302 Bacteria 3148
44 Ga0207696_1019465 3300025711 Bacteria 2209
45 Ga0207713_1011958 3300025735 Bacteria 4680
46 Ga0207647_10008432 3300025904 Bacteria 7393
47 Ga0207694_10608111 3300025924 Bacteria 919
48 Ga0207661_10223720 3300025944 Bacteria 1664
49 Ga0207640_10311295 3300025981 Bacteria 1250
50 Ga0207639_10025377 3300026041 Bacteria 4297
51 Ga0207678_10232044 3300026067 Bacteria 1580
52 Ga0209371_1019061 3300027312 Bacteria 1722
53 Ga0209813_10021112 3300027866 Bacteria 1828
54 Ga0209813_10029098 3300027866 Bacteria 1616
55 Ga0268266_10158180 3300028379 Bacteria 2048
56 Ga0268266_10253747 3300028379 Bacteria 1628
57 Ga0307517_10002567 3300028786 Bacteria 28918
58 Ga0307517_10006702 3300028786 Bacteria 16954
59 Ga0307515_10000163 3300028794 Bacteria 163159
60 Ga0307515_10001581 3300028794 Bacteria 50851
61 Ga0268256_1015603 3300030500 Bacteria 2210
62 Ga0268256_1019425 3300030500 Bacteria 1862
63 Ga0307511_10001316 3300030521 Bacteria 26369
64 Ga0307511_10113322 3300030521 Bacteria 1714
65 Ga0307512_10002523 3300030522 Bacteria 22925
66 Ga0307512_10002993 3300030522 Bacteria 20370
67 Ga0307512_10015983 3300030522 Bacteria 6936
68 Ga0307512_10028893 3300030522 Bacteria 4851
69 Ga0307512_10049373 3300030522 Bacteria 3394
70 Ga0307513_10014953 3300031456 Bacteria 9427
71 Ga0307513_10020326 3300031456 Bacteria 7879
72 Ga0307513_10091273 3300031456 Bacteria 3104
73 Ga0307513_10155730 3300031456 Bacteria 2185
74 Ga0307509_10058360 3300031507 Bacteria 4088
75 Ga0307509_10072727 3300031507 Bacteria 3581
76 Ga0307509_10093941 3300031507 Bacteria 3059
77 Ga0307509_10109080 3300031507 Bacteria 2779
78 Ga0307509_10118725 3300031507 Bacteria 2627
79 Ga0307509_10133714 3300031507 Bacteria 2430
80 Ga0307508_10005082 3300031616 Bacteria 12622
81 Ga0307508_10011341 3300031616 Bacteria 8148
82 Ga0307508_10014464 3300031616 Bacteria 7197
83 Ga0307508_10015618 3300031616 Bacteria 6917
84 Ga0307508_10017234 3300031616 Bacteria 6567
85 Ga0307508_10026758 3300031616 Bacteria 5227
86 Ga0307508_10027209 3300031616 Bacteria 5180
87 Ga0307508_10029127 3300031616 Bacteria 4991
88 Ga0307508_10104540 3300031616 Bacteria 2429
89 Ga0307508_10132711 3300031616 Bacteria 2094
90 Ga0307508_10308379 3300031616 Bacteria 1175
91 Ga0307514_10025847 3300031649 Bacteria 4748
92 Ga0307514_10077440 3300031649 Bacteria 2473
93 Ga0307514_10079084 3300031649 Bacteria 2438
94 Ga0307514_10092512 3300031649 Bacteria 2199
95 Ga0307514_10171660 3300031649 Bacteria 1415
96 Ga0307516_10002626 3300031730 Bacteria 23819
97 Ga0307516_10006868 3300031730 Bacteria 13257
98 Ga0307516_10007700 3300031730 Bacteria 12325
99 Ga0307516_10013194 3300031730 Bacteria 8823
100 Ga0307516_10025378 3300031730 Bacteria 6036
101 Ga0307516_10042784 3300031730 Bacteria 4491
102 Ga0307518_10134871 3300031838 Bacteria 1730
103 Ga0307518_10182675 3300031838 Bacteria 1416
104 Ga0307409_100469985 3300031995 Bacteria 1218
105 Ga0307416_100054875 3300032002 Bacteria 3205
106 Ga0307507_10005088 3300033179 Bacteria 22118
107 Ga0307507_10100191 3300033179 Bacteria 2429
108 Ga0307507_10107744 3300033179 Bacteria 2294
109 Ga0307510_10007994 3300033180 Bacteria 12584
110 Ga0307510_10025317 3300033180 Bacteria 6843
111 Ga0307510_10044446 3300033180 Bacteria 4811
112 Ga0307510_10053280 3300033180 Bacteria 4254
113 Ga0307510_10064068 3300033180 Bacteria 3736
114 Ga0307510_10129781 3300033180 Bacteria 2197
115 Ga0307510_10136571 3300033180 Bacteria 2108
116 Ga0395900_0031806 3300037418 Bacteria 5424
117 Ga0395900_0041212 3300037418 Bacteria 4761
118 Ga0395898_0002800 3300037466 Bacteria 19992
119 Ga0395898_0015938 3300037466 Bacteria 7702
120 Ga0395898_0023672 3300037466 Bacteria 6200
121 Ga0436364_1179377 3300037853 Bacteria 13192
122 Ga0395901_0023825 3300038443 Bacteria 6278
123 Ga0395901_0324146 3300038443 Bacteria 1593
124 Ga0395901_0583682 3300038443 Bacteria 1129
125 Ga0439436_0002576 3300041404 Bacteria 5454
126 Ga0439436_0013048 3300041404 Bacteria 2516
127 Ga0439436_0013390 3300041404 Bacteria 2481
128 Ga0439436_0019952 3300041404 Bacteria 1997
129 Ga0439439_0021518 3300041406 Bacteria 1607
130 Ga0451797_0058893 3300041453 Bacteria 1205
131 Ga0451841_0267804 3300041498 Bacteria 1239
132 Ga0451853_0177550 3300041512 Bacteria 8101
133 Ga0451853_0939466 3300041512 Bacteria 5254
134 Ga0451853_1932420 3300041512 Bacteria 1505
135 Ga0451853_2768772 3300041512 Bacteria 3921
136 Ga0439433_0001313 3300041999 Bacteria 5109
137 Ga0439433_0002459 3300041999 Bacteria 3928
138 Ga0439448_0045057 3300042005 Bacteria 1435
139 Ga0439448_0070718 3300042005 Bacteria 1162
140 Ga0439432_032394 3300042006 Bacteria 1685
141 Ga0439449_0001600 3300042007 Bacteria 8878
142 Ga0439449_0003189 3300042007 Bacteria 6390
143 Ga0439449_0014357 3300042007 Bacteria 2977
144 Ga0439449_0061162 3300042007 Bacteria 1389
145 Ga0439450_005101 3300042008 Bacteria 2289
146 Ga0439455_0002252 3300042012 Bacteria 3463
147 Ga0439457_000007 3300042014 Bacteria 43988
148 Ga0439457_045260 3300042014 Bacteria 983
149 Ga0439462_0005965 3300042015 Bacteria 3018
150 Ga0439462_0013324 3300042015 Bacteria 2106
151 Ga0450894_000041 3300042131 Bacteria 18796
152 Ga0450894_000185 3300042131 Bacteria 11266
153 Ga0450895_003510 3300042132 Bacteria 1212
154 Ga0450896_003173 3300042133 Bacteria 2171
155 Ga0450898_000103 3300042134 Bacteria 7907
156 Ga0450899_000188 3300042135 Bacteria 6250
157 Ga0450899_001330 3300042135 Bacteria 2775
158 Ga0450900_001665 3300042136 Bacteria 2223
159 Ga0450900_002725 3300042136 Bacteria 1901
160 Ga0450903_000472 3300042138 Bacteria 8468
161 Ga0450903_002415 3300042138 Bacteria 3332
162 Ga0450903_005834 3300042138 Bacteria 2054
163 Ga0450906_000610 3300042145 Bacteria 7625
164 Ga0450906_000953 3300042145 Bacteria 6331
165 Ga0439458_0005054 3300042157 Bacteria 2980
166 Ga0439458_0006142 3300042157 Bacteria 2680
167 Ga0466969_0204142 3300044656 Bacteria 901
168 Ga0466972_0013839 3300044658 Bacteria 4049
169 Ga0466972_0016549 3300044658 Bacteria 3687
170 Ga0466965_0000238 3300044683 Bacteria 17680
171 Ga0466965_0002882 3300044683 Bacteria 7422
172 Ga0466965_0006979 3300044683 Bacteria 5167
173 Ga0466965_0015984 3300044683 Bacteria 3566
174 Ga0466965_0050935 3300044683 Bacteria 2054
175 Ga0466965_0072432 3300044683 Bacteria 1734
176 Ga0466965_0153825 3300044683 Bacteria 1203
177 Ga0466965_0154968 3300044683 Bacteria 1199
178 Ga0466966_0001953 3300044684 Bacteria 13346
179 Ga0466966_0008911 3300044684 Bacteria 6646
180 Ga0466966_0038819 3300044684 Bacteria 3066
181 Ga0466966_0041611 3300044684 Bacteria 2952
182 Ga0466961_0000633 3300044693 Bacteria 22027
183 Ga0466961_0005921 3300044693 Bacteria 7748
184 Ga0466961_0051961 3300044693 Bacteria 2616
185 Ga0466961_0081949 3300044693 Bacteria 2041
186 Ga0466963_0001746 3300044694 Bacteria 11838
187 Ga0466963_0006328 3300044694 Bacteria 7000
188 Ga0466963_0058798 3300044694 Bacteria 2564
189 Ga0466963_0118270 3300044694 Bacteria 1822
190 Ga0466964_0000403 3300044706 Bacteria 13125
191 Ga0466964_0007182 3300044706 Bacteria 4166
192 Ga0466971_0000288 3300044719 Bacteria 19218
193 Ga0466971_0001336 3300044719 Bacteria 10312
194 Ga0466971_0009907 3300044719 Bacteria 4162
195 Ga0466971_0038480 3300044719 Bacteria 2146
196 Ga0466971_0043232 3300044719 Bacteria 2025
197 Ga0466968_0020908 3300044735 Bacteria 2646
198 Ga0466970_0000573 3300044765 Bacteria 17967
199 Ga0466970_0001607 3300044765 Bacteria 10888
200 Ga0466970_0004042 3300044765 Bacteria 7201
201 Ga0466957_0005800 3300044842 Bacteria 6945
202 Ga0466957_0040765 3300044842 Bacteria 2805
203 Ga0466957_0056001 3300044842 Bacteria 2410
204 Ga0466959_0001737 3300045049 Bacteria 13550
205 Ga0466959_0013422 3300045049 Bacteria 5936
206 Ga0466959_0033229 3300045049 Bacteria 3816
207 Ga0466959_0061114 3300045049 Bacteria 2740
208 Ga0466958_0000978 3300045836 Bacteria 12915
209 Ga0466967_0001276 3300045976 Bacteria 14307
210 Ga0466967_0001936 3300045976 Bacteria 12523
211 Ga0466967_0018954 3300045976 Bacteria 5520
212 Ga0466967_0023680 3300045976 Bacteria 5036
213 Ga0466967_0042524 3300045976 Bacteria 3927
214 Ga0466967_0315850 3300045976 Bacteria 1506
215 Ga0495617_023662 3300046452 Bacteria 2074
216 Ga0495627_037790 3300046453 Bacteria 1496
217 Ga0495592_0009074 3300046454 Bacteria 7480
218 Ga0495592_0012861 3300046454 Bacteria 6363
219 Ga0495592_0017186 3300046454 Bacteria 5493
220 Ga0495603_0000713 3300046455 Bacteria 18791
221 Ga0495603_0001801 3300046455 Bacteria 12645
222 Ga0495603_0001820 3300046455 Bacteria 12588
223 Ga0495603_0002025 3300046455 Bacteria 11931
224 Ga0495603_0002581 3300046455 Bacteria 10685
225 Ga0495603_0005919 3300046455 Bacteria 7308
226 Ga0495603_0008084 3300046455 Bacteria 6356
227 Ga0495603_0034304 3300046455 Bacteria 3050
228 Ga0495603_0034339 3300046455 Bacteria 3049
229 Ga0495603_0046883 3300046455 Bacteria 2574
230 Ga0495629_0000446 3300046459 Bacteria 34452
231 Ga0495629_0001244 3300046459 Bacteria 20005
232 Ga0495629_0005475 3300046459 Bacteria 9476
233 Ga0495629_0005950 3300046459 Bacteria 9082
234 Ga0495629_0006653 3300046459 Bacteria 8553
235 Ga0495629_0014204 3300046459 Bacteria 5734
236 Ga0495629_0017287 3300046459 Bacteria 5171
237 Ga0495629_0018801 3300046459 Bacteria 4938
238 Ga0495629_0022644 3300046459 Bacteria 4477
239 Ga0495629_0113838 3300046459 Bacteria 1885
240 Ga0495629_0116917 3300046459 Bacteria 1858
241 Ga0495629_0144378 3300046459 Bacteria 1656
242 Ga0495629_0150988 3300046459 Bacteria 1614
243 Ga0495629_0293198 3300046459 Bacteria 1115
244 Ga0495638_0033093 3300046460 Bacteria 3307
245 Ga0495638_0056259 3300046460 Bacteria 2441
246 Ga0495638_0295606 3300046460 Bacteria 874
247 Ga0495651_0002046 3300046462 Bacteria 15585
248 Ga0495651_0004606 3300046462 Bacteria 10538
249 Ga0495651_0010968 3300046462 Bacteria 6973
250 Ga0495651_0072846 3300046462 Bacteria 2608
251 Ga0495653_0012407 3300046463 Bacteria 6955
252 Ga0495582_0019755 3300046473 Bacteria 3683
253 Ga0495582_0028422 3300046473 Bacteria 3069
254 Ga0495605_0005625 3300046474 Bacteria 7284
255 Ga0495605_0010689 3300046474 Bacteria 5131
256 Ga0495662_0000320 3300046476 Bacteria 20955
257 Ga0495662_0000380 3300046476 Bacteria 19673
258 Ga0495662_0000603 3300046476 Bacteria 16591
259 Ga0495662_0004382 3300046476 Bacteria 7087
260 Ga0495662_0015459 3300046476 Bacteria 3704
261 Ga0495662_0032377 3300046476 Bacteria 2525
262 Ga0495662_0041346 3300046476 Bacteria 2225
263 Ga0495662_0145658 3300046476 Bacteria 1166
264 Ga0495664_0000276 3300046477 Bacteria 24487
265 Ga0495664_0000381 3300046477 Bacteria 21601
266 Ga0495664_0001678 3300046477 Bacteria 11772
267 Ga0495664_0139136 3300046477 Bacteria 1471
268 Ga0495585_0009597 3300046492 Bacteria 5793
269 Ga0495585_0042152 3300046492 Bacteria 2558
270 Ga0495585_0072393 3300046492 Bacteria 1878
271 Ga0495585_0092242 3300046492 Bacteria 1630
272 Ga0495594_0000421 3300046499 Bacteria 21344
273 Ga0495594_0001106 3300046499 Bacteria 14069
274 Ga0495594_0012750 3300046499 Bacteria 4385
275 Ga0495594_0019570 3300046499 Bacteria 3598
276 Ga0495594_0021072 3300046499 Bacteria 3477
277 Ga0495594_0099243 3300046499 Bacteria 1637
278 Ga0495594_0136729 3300046499 Bacteria 1389
279 Ga0495594_0250492 3300046499 Bacteria 1009
280 Ga0495596_0018883 3300046500 Bacteria 2838
281 Ga0495596_0095159 3300046500 Bacteria 1156
282 Ga0495607_0038880 3300046501 Bacteria 2846
283 Ga0495607_0086415 3300046501 Bacteria 1710
284 Ga0495607_0101429 3300046501 Bacteria 1541
285 Ga0495607_0104689 3300046501 Bacteria 1509
286 Ga0495583_0062178 3300046506 Bacteria 1663
287 Ga0495606_0006850 3300046507 Bacteria 10399
288 Ga0495606_0013139 3300046507 Bacteria 6572
289 Ga0495608_0002494 3300046511 Bacteria 13194
290 Ga0495610_0034481 3300046512 Bacteria 2606
291 Ga0495610_0129092 3300046512 Bacteria 1099
292 Ga0495616_0003832 3300046513 Bacteria 9587
293 Ga0495618_0006028 3300046514 Bacteria 7364
294 Ga0495628_0004297 3300046516 Bacteria 12666
295 Ga0495628_0058564 3300046516 Bacteria 3026
296 Ga0495628_0104148 3300046516 Bacteria 2187
297 Ga0495628_0168310 3300046516 Bacteria 1662
298 Ga0495630_0007356 3300046517 Bacteria 7865
299 Ga0495630_0097830 3300046517 Bacteria 2219
300 Ga0495631_0013977 3300046518 Bacteria 3882
301 Ga0495637_0029919 3300046520 Bacteria 2420
302 Ga0495637_0053660 3300046520 Bacteria 1677
303 Ga0495643_0004392 3300046522 Bacteria 9876
304 Ga0495643_0007065 3300046522 Bacteria 7286
305 Ga0495643_0023015 3300046522 Bacteria 3546
306 Ga0495643_0026409 3300046522 Bacteria 3277
307 Ga0495648_0051264 3300046524 Bacteria 2515
308 Ga0495648_0151691 3300046524 Bacteria 1208
309 Ga0495648_0156416 3300046524 Bacteria 1183
310 Ga0495666_0000341 3300046526 Bacteria 20408
311 Ga0495666_0060543 3300046526 Bacteria 1809
312 Ga0495642_0016945 3300046528 Bacteria 2844
313 Ga0495652_0028908 3300046529 Bacteria 4873
314 Ga0495652_0038014 3300046529 Bacteria 4172
315 Ga0495652_0040421 3300046529 Bacteria 4031
316 Ga0495654_0094319 3300046530 Bacteria 1385
317 Ga0495665_0006572 3300046531 Bacteria 6279
318 Ga0495665_0059166 3300046531 Bacteria 2023
319 Ga0495640_0003231 3300046533 Bacteria 13123
320 Ga0495640_0003668 3300046533 Bacteria 12341
321 Ga0495640_0004405 3300046533 Bacteria 11237
322 Ga0495640_0020491 3300046533 Bacteria 4866
323 Ga0495586_0009046 3300046535 Bacteria 5297
324 Ga0495586_0113656 3300046535 Bacteria 1508
325 Ga0495587_0002014 3300046536 Bacteria 13538
326 Ga0495587_0005301 3300046536 Bacteria 8429
327 Ga0495587_0008296 3300046536 Bacteria 6688
328 Ga0495609_0008069 3300046538 Bacteria 5188
329 Ga0495609_0023777 3300046538 Bacteria 2814
330 Ga0495645_0006649 3300046543 Bacteria 8033
331 Ga0495645_0007407 3300046543 Bacteria 7634
332 Ga0495645_0008580 3300046543 Bacteria 7138
333 Ga0495645_0067849 3300046543 Bacteria 2575
334 Ga0495622_0040938 3300046557 Bacteria 2155
335 Ga0495622_0063539 3300046557 Bacteria 1708
336 Ga0495622_0065875 3300046557 Bacteria 1674
337 Ga0495622_0066529 3300046557 Bacteria 1665
338 Ga0495622_0074810 3300046557 Bacteria 1561
339 Ga0495633_0014275 3300046558 Bacteria 4159
340 Ga0495633_0020939 3300046558 Bacteria 3278
341 Ga0495633_0071002 3300046558 Bacteria 1625
342 Ga0495633_0094971 3300046558 Bacteria 1385
343 Ga0495667_0002879 3300046559 Bacteria 11533
344 Ga0495667_0070328 3300046559 Bacteria 2283
345 Ga0495667_0098898 3300046559 Bacteria 1889
346 Ga0495668_0005061 3300046616 Bacteria 9084
347 Ga0495668_0009505 3300046616 Bacteria 5966
348 Ga0495634_0000467 3300046642 Bacteria 40017
349 Ga0495634_0003019 3300046642 Bacteria 13695
350 Ga0495634_0006539 3300046642 Bacteria 8845
351 Ga0495634_0012774 3300046642 Bacteria 6078
352 Ga0495634_0171164 3300046642 Bacteria 1364
353 Ga0495611_0028362 3300046648 Bacteria 2450
354 Ga0495611_0035040 3300046648 Bacteria 2222
355 Ga0495611_0075641 3300046648 Bacteria 1543
356 Ga0495611_0197320 3300046648 Bacteria 939
357 Ga0495625_0010025 3300046660 Bacteria 7878
358 Ga0495625_0033792 3300046660 Bacteria 3777
359 Ga0495625_0038751 3300046660 Bacteria 3486
360 Ga0495625_0121616 3300046660 Bacteria 1776
361 Ga0495635_0000258 3300046663 Bacteria 33989
362 Ga0495635_0002195 3300046663 Bacteria 13272
363 Ga0495635_0022574 3300046663 Bacteria 4384
364 Ga0495661_0089843 3300046665 Bacteria 1750
365 Ga0495588_0008499 3300046674 Bacteria 4716
366 Ga0495588_0067138 3300046674 Bacteria 1861
367 Ga0495588_0106460 3300046674 Bacteria 1476
368 Ga0495657_0003345 3300046675 Bacteria 13116
369 Ga0495657_0003387 3300046675 Bacteria 13024
370 Ga0495657_0005383 3300046675 Bacteria 10123
371 Ga0495657_0006967 3300046675 Bacteria 8775
372 Ga0495657_0015808 3300046675 Bacteria 5512
373 Ga0495657_0060791 3300046675 Bacteria 2501
374 Ga0495657_0060984 3300046675 Bacteria 2496
375 Ga0495599_0009442 3300046678 Bacteria 5963
376 Ga0495599_0049879 3300046678 Bacteria 2624
377 Ga0495623_0025493 3300046679 Bacteria 3809
378 Ga0495623_0037451 3300046679 Bacteria 3103
379 Ga0495623_0057270 3300046679 Bacteria 2452
380 Ga0495623_0061300 3300046679 Bacteria 2359
381 Ga0495646_0000179 3300046680 Bacteria 31613
382 Ga0495646_0000678 3300046680 Bacteria 18683
383 Ga0495646_0001066 3300046680 Bacteria 15908
384 Ga0495646_0114230 3300046680 Bacteria 1534
385 Ga0495658_0012478 3300046683 Bacteria 4306
386 Ga0495658_0053400 3300046683 Bacteria 2295
387 Ga0495658_0208894 3300046683 Bacteria 1219
388 Ga0495613_0001528 3300046689 Bacteria 17617
389 Ga0495613_0002286 3300046689 Bacteria 14502
390 Ga0495613_0002984 3300046689 Bacteria 12675
391 Ga0495613_0004842 3300046689 Bacteria 10099
392 Ga0495613_0006255 3300046689 Bacteria 8900
393 Ga0495613_0014796 3300046689 Bacteria 5790
394 Ga0495613_0016827 3300046689 Bacteria 5444
395 Ga0495613_0037027 3300046689 Bacteria 3617
396 Ga0495613_0096840 3300046689 Bacteria 2134
397 Ga0495613_0260575 3300046689 Bacteria 1208
398 Ga0495613_0378484 3300046689 Bacteria 968
399 Ga0495613_0448453 3300046689 Bacteria 874
400 Ga0495624_0032500 3300046690 Bacteria 3383
401 Ga0495624_0105845 3300046690 Bacteria 1731
402 Ga0495624_0107463 3300046690 Bacteria 1716
403 Ga0495670_0002744 3300046691 Bacteria 8701
404 Ga0495670_0026210 3300046691 Bacteria 2885
405 Ga0495670_0029777 3300046691 Bacteria 2711
406 Ga0495670_0131403 3300046691 Bacteria 1305
407 Ga0495671_0007075 3300046692 Bacteria 6424
408 Ga0495649_0053195 3300046694 Bacteria 2192
409 Ga0495649_0066039 3300046694 Bacteria 1941
410 Ga0495649_0106440 3300046694 Bacteria 1488
411 Ga0495649_0112002 3300046694 Bacteria 1447
412 Ga0495589_0008592 3300046794 Bacteria 5323
413 Ga0495589_0008783 3300046794 Bacteria 5258
414 Ga0495589_0009491 3300046794 Bacteria 5059
415 Ga0495589_0016618 3300046794 Bacteria 3780
416 Ga0495589_0017887 3300046794 Bacteria 3635
417 Ga0495589_0029411 3300046794 Bacteria 2770
418 Ga0495589_0133784 3300046794 Bacteria 1189
419 Ga0495589_0177121 3300046794 Bacteria 1012
420 Ga0495600_0003334 3300046809 Bacteria 9432
421 Ga0495600_0010394 3300046809 Bacteria 5778
422 Ga0495600_0050725 3300046809 Bacteria 2707
423 Ga0495600_0209069 3300046809 Bacteria 1251
424 Ga0495600_0373523 3300046809 Bacteria 890
425 Ga0495660_0029352 3300046810 Bacteria 3104
426 Ga0495581_0025746 3300047315 Bacteria 3411
427 Ga0495581_0028800 3300047315 Bacteria 3220
428 Ga0495581_0077443 3300047315 Bacteria 1924
429 Ga0495581_0127645 3300047315 Bacteria 1481
430 Ga0495581_0172072 3300047315 Bacteria 1266
431 Ga0495604_0000243 3300047317 Bacteria 48550
432 Ga0495604_0002783 3300047317 Bacteria 14023
433 Ga0495604_0003232 3300047317 Bacteria 13024
434 Ga0495604_0005871 3300047317 Bacteria 9732
435 Ga0495604_0017876 3300047317 Bacteria 5672
436 Ga0495604_0033343 3300047317 Bacteria 4077
437 Ga0495604_0087478 3300047317 Bacteria 2321
438 Ga0495636_0001039 3300047318 Bacteria 10416
439 Ga0495636_0007846 3300047318 Bacteria 4202
440 Ga0495636_0023182 3300047318 Bacteria 2512
441 Ga0495636_0061061 3300047318 Bacteria 1593
442 Ga0495636_0084894 3300047318 Bacteria 1368
443 Ga0495636_0174372 3300047318 Bacteria 973
444 Ga0495674_0006224 3300047319 Bacteria 11446
445 Ga0495674_0102992 3300047319 Bacteria 2427
446 Ga0495672_0039795 3300047320 Bacteria 2856
447 Ga0495672_0126752 3300047320 Bacteria 1349
448 Ga0495676_0001137 3300047321 Bacteria 22580
449 Ga0495676_0002573 3300047321 Bacteria 16160
450 Ga0495676_0003376 3300047321 Bacteria 14423
451 Ga0495676_0004614 3300047321 Bacteria 12619
452 Ga0495676_0010185 3300047321 Bacteria 8538
453 Ga0495676_0017899 3300047321 Bacteria 6254
454 Ga0495676_0023538 3300047321 Bacteria 5344
455 Ga0495676_0029126 3300047321 Bacteria 4704
456 Ga0495676_0033053 3300047321 Bacteria 4360
457 Ga0495676_0051832 3300047321 Bacteria 3279
458 Ga0495676_0059659 3300047321 Bacteria 2994
459 Ga0495676_0179153 3300047321 Bacteria 1486
460 Ga0495680_0024008 3300047322 Bacteria 5063
461 Ga0495680_0039101 3300047322 Bacteria 3786
462 Ga0495687_001918 3300047443 Bacteria 17859
463 Ga0495687_017258 3300047443 Bacteria 3606
464 Ga0495687_024664 3300047443 Bacteria 2854
465 Ga0495687_037246 3300047443 Bacteria 2168
466 Ga0495687_063498 3300047443 Bacteria 1511
467 Ga0495687_079985 3300047443 Bacteria 1283
468 Ga0495687_081068 3300047443 Bacteria 1270
469 Ga0495675_0002940 3300047444 Bacteria 10236
470 Ga0495675_0007790 3300047444 Bacteria 6611
471 Ga0495675_0015556 3300047444 Bacteria 4810
472 Ga0495675_0019920 3300047444 Bacteria 4263
473 Ga0495675_0044000 3300047444 Bacteria 2844
474 Ga0495675_0054853 3300047444 Bacteria 2528
475 Ga0495679_058771 3300047446 Bacteria 1133
476 Ga0495685_000097 3300047447 Bacteria 31828
477 Ga0495685_000874 3300047447 Bacteria 9186
478 Ga0495685_004520 3300047447 Bacteria 4503
479 Ga0495685_006818 3300047447 Bacteria 3755
480 Ga0495685_009176 3300047447 Bacteria 3299
481 Ga0495685_012390 3300047447 Bacteria 2888
482 Ga0495685_027531 3300047447 Bacteria 1955
483 Ga0495685_059379 3300047447 Bacteria 1290
484 Ga0495685_092701 3300047447 Bacteria 1000
485 Ga0495681_0000311 3300047470 Bacteria 38913
486 Ga0495681_0001598 3300047470 Bacteria 16840
487 Ga0495681_0001982 3300047470 Bacteria 14953
488 Ga0495681_0002757 3300047470 Bacteria 12436
489 Ga0495681_0013091 3300047470 Bacteria 4837
490 Ga0495681_0047160 3300047470 Bacteria 2051
491 Ga0495684_0030042 3300047471 Bacteria 4172
492 Ga0495684_0061811 3300047471 Bacteria 2849
493 Ga0495684_0143699 3300047471 Bacteria 1788
494 Ga0495684_0179184 3300047471 Bacteria 1571
495 Ga0495686_0030622 3300047472 Bacteria 3494
496 Ga0495686_0098473 3300047472 Bacteria 1767
497 Ga0495593_0000841 3300047673 Bacteria 17847
498 Ga0495593_0037428 3300047673 Bacteria 2624
499 Ga0495602_0098464 3300048088 Bacteria 2406
500 Ga0495602_0098643 3300048088 Bacteria 2403
501 Ga0495614_0001085 3300048089 Bacteria 11639
502 Ga0495614_0002870 3300048089 Bacteria 7663
503 Ga0495614_0018049 3300048089 Bacteria 3058
504 Ga0495614_0084178 3300048089 Bacteria 1379
505 Ga0495626_0024329 3300048091 Bacteria 2970
506 Ga0496102_0139144 3300048905 Bacteria 2275
507 Ga0496107_0075868 3300048910 Bacteria 2448
508 Ga0496109_0053601 3300048912 Bacteria 3679
509 Ga0495678_039544 3300049459 Bacteria 1902
510 Ga0495678_039708 3300049459 Bacteria 1897
511 Ga0495682_0024068 3300049460 Bacteria 2273
512 Ga0501323_023747 3300049539 Bacteria 825
513 Ga0501031_0002011 3300049568 Bacteria 12815
514 Ga0501031_0004264 3300049568 Bacteria 9239
515 Ga0501031_0016842 3300049568 Bacteria 4746
516 Ga0501031_0029189 3300049568 Bacteria 3598
517 Ga0501031_0033305 3300049568 Bacteria 3360
518 Ga0501032_0009200 3300049569 Bacteria 7162
519 Ga0501032_0073247 3300049569 Bacteria 2282
520 Ga0501033_0002003 3300049570 Bacteria 17735
521 Ga0501033_0002271 3300049570 Bacteria 16436
522 Ga0501033_0003695 3300049570 Bacteria 12443
523 Ga0501033_0013108 3300049570 Bacteria 6316
524 Ga0501033_0043911 3300049570 Bacteria 3327
525 Ga0501033_0049095 3300049570 Bacteria 3133
526 Ga0501033_0052820 3300049570 Bacteria 3012
527 Ga0501033_0126070 3300049570 Bacteria 1856
528 Ga0501033_0402203 3300049570 Bacteria 955
529 Ga0501034_0012461 3300049571 Bacteria 8781
530 Ga0501034_0013353 3300049571 Bacteria 8456
531 Ga0501034_0018958 3300049571 Bacteria 7049
532 Ga0501034_0020200 3300049571 Bacteria 6801
533 Ga0501034_0071877 3300049571 Bacteria 3468
534 Ga0501034_0079153 3300049571 Bacteria 3290
535 Ga0501034_0199486 3300049571 Bacteria 1960
536 Ga0501034_0665917 3300049571 Bacteria 941
537 Ga0501036_0000912 3300049572 Bacteria 22166
538 Ga0501036_0012423 3300049572 Bacteria 7055
539 Ga0501036_0014015 3300049572 Bacteria 6663
540 Ga0501036_0068759 3300049572 Bacteria 2997
541 Ga0501036_0102203 3300049572 Bacteria 2425
542 Ga0501036_0289333 3300049572 Bacteria 1371
543 Ga0501037_0000908 3300049573 Bacteria 22108
544 Ga0501037_0015271 3300049573 Bacteria 5649
545 Ga0501037_0025205 3300049573 Bacteria 4394
546 Ga0501037_0042216 3300049573 Bacteria 3352
547 Ga0501037_0110737 3300049573 Bacteria 1978
548 Ga0501037_0257939 3300049573 Bacteria 1218
549 Ga0501038_0018579 3300049574 Bacteria 6278
550 Ga0501038_0021147 3300049574 Bacteria 5845
551 Ga0501038_0043953 3300049574 Bacteria 3883
552 Ga0501038_0051994 3300049574 Bacteria 3533
553 Ga0501038_0061138 3300049574 Bacteria 3222
554 Ga0501038_0068876 3300049574 Bacteria 3007
555 Ga0501038_0505553 3300049574 Bacteria 923
556 Ga0501039_0064419 3300049575 Bacteria 2841
557 Ga0501039_0119571 3300049575 Bacteria 2064
558 Ga0501041_0001638 3300049577 Bacteria 12511
559 Ga0501042_0101203 3300049578 Bacteria 2072
560 Ga0501042_0365976 3300049578 Bacteria 1043
561 Ga0501043_0000935 3300049579 Bacteria 25870
562 Ga0501043_0004583 3300049579 Bacteria 11213
563 Ga0501043_0005696 3300049579 Bacteria 10038
564 Ga0501043_0027475 3300049579 Bacteria 4467
565 Ga0501043_0039992 3300049579 Bacteria 3685
566 Ga0501043_0061263 3300049579 Bacteria 2955
567 Ga0501046_0010424 3300049580 Bacteria 7984
568 Ga0501046_0039365 3300049580 Bacteria 3786
569 Ga0501046_0039856 3300049580 Bacteria 3757
570 Ga0501047_0000118 3300049581 Bacteria 96347
571 Ga0501047_0003839 3300049581 Bacteria 14128
572 Ga0501047_0015115 3300049581 Bacteria 7348
573 Ga0501047_0017273 3300049581 Bacteria 6908
574 Ga0501047_0027723 3300049581 Bacteria 5458
575 Ga0501047_0033818 3300049581 Bacteria 4934
576 Ga0501047_0045972 3300049581 Bacteria 4221
577 Ga0501047_0119098 3300049581 Bacteria 2522
578 Ga0501047_0155877 3300049581 Bacteria 2157
579 Ga0501048_0001218 3300049582 Bacteria 19474
580 Ga0501048_0003822 3300049582 Bacteria 11485
581 Ga0501048_0018180 3300049582 Bacteria 5171
582 Ga0501067_0004365 3300049583 Bacteria 7792
583 Ga0501068_0003116 3300049584 Bacteria 8864
584 Ga0501068_0037018 3300049584 Bacteria 2921
585 Ga0501068_0057820 3300049584 Bacteria 2352
586 Ga0501069_0092712 3300049585 Bacteria 1709
587 Ga0501070_0002731 3300049586 Bacteria 15403
588 Ga0501070_0004111 3300049586 Bacteria 12512
589 Ga0501070_0015741 3300049586 Bacteria 6359
590 Ga0501070_0030531 3300049586 Bacteria 4516
591 Ga0501070_0332818 3300049586 Bacteria 1234
592 Ga0501071_0007384 3300049587 Bacteria 7211
593 Ga0501072_0000627 3300049588 Bacteria 25332
594 Ga0501072_0175800 3300049588 Bacteria 1708
595 Ga0501073_0099905 3300049589 Bacteria 2015
596 Ga0501074_0112166 3300049590 Bacteria 1951
597 Ga0501076_0004062 3300049592 Bacteria 10349
598 Ga0501077_0028737 3300049593 Bacteria 3534
599 Ga0501079_0003778 3300049741 Bacteria 11186
600 Ga0501080_0010852 3300049742 Bacteria 8337
601 Ga0501080_0027991 3300049742 Bacteria 5241
602 Ga0501083_0000556 3300049744 Bacteria 23900
603 Ga0501035_0000900 3300049822 Bacteria 31404
604 Ga0501035_0002053 3300049822 Bacteria 20069
605 Ga0501035_0023543 3300049822 Bacteria 5649
606 Ga0501035_0122393 3300049822 Bacteria 2273
607 Ga0501035_0124797 3300049822 Bacteria 2248
608 Ga0501035_0209789 3300049822 Bacteria 1667
609 Ga0501035_0271803 3300049822 Bacteria 1434
610 Ga0501035_0313516 3300049822 Bacteria 1319
611 Ga0501044_0003862 3300049823 Bacteria 16787
612 Ga0501044_0004846 3300049823 Bacteria 15044
613 Ga0501044_0032600 3300049823 Bacteria 5475
614 Ga0501044_0042523 3300049823 Bacteria 4725
615 Ga0501044_0097967 3300049823 Bacteria 2952
616 Ga0501044_0111572 3300049823 Bacteria 2742
617 Ga0501044_0122939 3300049823 Bacteria 2594
618 Ga0501044_0134715 3300049823 Bacteria 2462
619 Ga0501044_0220044 3300049823 Bacteria 1849
620 Ga0501044_0264620 3300049823 Bacteria 1657
621 Ga0501044_0577546 3300049823 Bacteria 1019
622 Ga0501045_0053836 3300049824 Bacteria 2941
623 nmdc:mga03n38_6810_c1 3300050490 Bacteria 4004
624 nmdc:mga03n38_9051_c1 3300050490 Bacteria 3602
625 nmdc:mga06z11_12354_c1 3300050494 Bacteria 3713
626 nmdc:mga06z11_32611_c1 3300050494 Bacteria 2542
627 nmdc:mga04h51_10473_c1 3300050495 Bacteria 2547
628 nmdc:mga04h51_8438_c1 3300050495 Bacteria 2756
629 nmdc:mga07m45_137698_c1 3300050496 Bacteria 1413
630 nmdc:mga07m45_138823_c1 3300050496 Bacteria 1407
631 nmdc:mga0sz30_88013_c1 3300050516 Bacteria 1349
632 Ga0495601_0036861 3300053077 Bacteria 3056
633 Ga0495612_0021483 3300053078 Bacteria 2590
634 Ga0495655_0016904 3300053083 Bacteria 1580
635 Ga0495655_0030265 3300053083 Bacteria 1308
636 Ga0500578_0016161 3300053086 Bacteria 4790
637 Ga0500578_0041224 3300053086 Bacteria 2965
638 Ga0500644_0203056 3300053088 Bacteria 820
639 Ga0500646_0007165 3300053090 Bacteria 2845
640 Ga0500651_0209479 3300053093 Bacteria 1147
641 Ga0500566_0055559 3300053094 Bacteria 2254
642 Ga0500640_011042 3300053095 Bacteria 3669
643 Ga0500640_024186 3300053095 Bacteria 2636
644 Ga0500641_0080449 3300053096 Bacteria 1382
645 Ga0500660_023806 3300053100 Bacteria 3243
646 Ga0500660_084420 3300053100 Bacteria 1442
647 Ga0500553_037429 3300053101 Bacteria 2395
648 Ga0500553_057289 3300053101 Bacteria 1844
649 Ga0500553_107630 3300053101 Bacteria 1181
650 Ga0500558_116599 3300053106 Bacteria 1040
651 Ga0500560_000629 3300053107 Bacteria 5161
652 Ga0500560_029476 3300053107 Bacteria 1646
653 Ga0500569_004320 3300053109 Bacteria 2978
654 Ga0500569_017294 3300053109 Bacteria 1841
655 Ga0500572_001912 3300053111 Bacteria 5227
656 Ga0500572_005958 3300053111 Bacteria 2776
657 Ga0500582_115218 3300053114 Bacteria 936
658 Ga0500608_172047 3300053122 Bacteria 927
659 Ga0500628_005912 3300053129 Bacteria 2056
660 Ga0500628_030339 3300053129 Bacteria 1168
661 Ga0500652_003290 3300053131 Bacteria 4892
662 Ga0500652_026047 3300053131 Bacteria 2247
663 Ga0500658_0004463 3300053134 Bacteria 5228
664 Ga0500658_0004659 3300053134 Bacteria 5117
665 Ga0500561_0003761 3300053137 Bacteria 2690
666 Ga0500561_0004147 3300053137 Bacteria 2593
667 Ga0500573_0253986 3300053140 Bacteria 904
668 Ga0500577_0084596 3300053142 Bacteria 1271
669 Ga0500579_021267 3300053143 Bacteria 4208
670 Ga0500579_125731 3300053143 Bacteria 1222
671 Ga0500600_0008110 3300053149 Bacteria 6332
672 Ga0500600_0009283 3300053149 Bacteria 5935
673 Ga0500600_0050759 3300053149 Bacteria 2354
674 Ga0500606_080572 3300053152 Bacteria 1102
675 Ga0500616_0000905 3300053153 Bacteria 32539
676 Ga0500616_0008117 3300053153 Bacteria 6565
677 Ga0500616_0010872 3300053153 Bacteria 5423
678 Ga0500633_0017012 3300053160 Bacteria 2123
679 Ga0500633_0037561 3300053160 Bacteria 1608
680 Ga0500634_0004723 3300053161 Bacteria 6359
681 Ga0500634_0024669 3300053161 Bacteria 3270
682 Ga0500656_012822 3300053732 Bacteria 951
683 Ga0500565_008680 3300053734 Bacteria 995
684 Ga0500587_001712 3300053739 Bacteria 3116
685 Ga0501084_0102810 3300054114 Bacteria 2399
686 Ga0501082_0104809 3300060353 Bacteria 2446
687 Ga0466962_0000508 3300061719 Bacteria 16941
688 Ga0466962_0000514 3300061719 Bacteria 16895
689 Ga0466962_0001988 3300061719 Bacteria 9656
690 2547407209 2547132111 Bacteria 8013147
691 2547412171 2547132111 Bacteria 8013147
692 2554260848 2554235005 Bacteria 6457341
693 2585301940 2582581312 Bacteria 7308206
694 2585302156 2582581312 Bacteria 7308206
695 2585304071 2582581313 Bacteria 10042643
696 2585310541 2582581313 Bacteria 10042643
697 2585312059 2582581314 Bacteria 11452267
698 2585315646 2582581314 Bacteria 11452267
699 2616697382 2616644814 Bacteria 11555299
700 2616901259 2616644941 Bacteria 8510691
701 2643762366 2643221548 Bacteria 8053412
702 2643765515 2643221548 Bacteria 8053412
703 2643898307 2643221578 Bacteria 9213798
704 2643946095 2643221587 Bacteria 7586415
705 2644013684 2643221601 Bacteria 7493239
706 2644178686 2643221631 Bacteria 8168043
707 2644263834 2643221647 Bacteria 10741251
708 2644264450 2643221647 Bacteria 10741251
709 2644387869 2643221670 Bacteria 6497041
710 2644407852 2643221673 Bacteria 9196637
711 2644409452 2643221673 Bacteria 9196637
712 2644432884 2643221677 Bacteria 7584031
713 2644436792 2643221678 Bacteria 9540101
714 2644438160 2643221678 Bacteria 9540101
715 2644458855 2643221682 Bacteria 6743283
716 2644462413 2643221682 Bacteria 6743283
717 2644625419 2643221714 Bacteria 9015452
718 2644631848 2643221714 Bacteria 9015452
719 2768645347 2767802112 Bacteria 6465194
720 2784588264 2784132148 Bacteria 8627943
721 2784591928 2784132148 Bacteria 8627943
722 2785339787 2784746763 Bacteria 9783172
723 2785343753 2784746763 Bacteria 9783172
724 2785369077 2784746768 Bacteria 10036182
725 2785373156 2784746768 Bacteria 10036182
726 2786670222 2786546132 Bacteria 10419719
727 2786674882 2786546132 Bacteria 10419719
728 2804849129 2802429296 Bacteria 7227771
729 2808841686 2808606359 Bacteria 9866990
730 2808845294 2808606359 Bacteria 9866990
731 2808914994 2808606375 Bacteria 9466072
732 2808920222 2808606375 Bacteria 9466072
733 2809235538 2808606448 Bacteria 8656184
734 2811843222 2808606982 Bacteria 7791042
735 2812354413 2811994879 Bacteria 9313447
736 2812358563 2811994879 Bacteria 9313447
737 2812477392 2811994917 Bacteria 7761064
738 2812480887 2811994917 Bacteria 7761064
739 2819693285 2818991463 Bacteria 7948711
740 2819743840 2818991472 Bacteria 10089953
741 2852636037 2852635781 Bacteria 8251373
742 2852642690 2852635781 Bacteria 8251373
743 2862184304 2862178590 Bacteria 8583590
744 2862184548 2862178590 Bacteria 8583590
745 2862283077 2862281513 Bacteria 9621493
746 2862290947 2862290372 Bacteria 7471434
747 2862291755 2862290372 Bacteria 7471434
748 2862392467 2862382967 Bacteria 10317375
749 2862515164 2862507626 Bacteria 9425308
750 2862576226 2862574272 Bacteria 10567477
751 2862579582 2862574272 Bacteria 10567477
752 2862707801 2862705112 Bacteria 6563286
753 2863405085 2863404153 Bacteria 9672205
754 2867374895 2867369537 Bacteria 6501581
755 2867431817 2867428634 Bacteria 9590268
756 2867434275 2867428634 Bacteria 9590268
757 2867476057 2867475112 Bacteria 6909112
758 2867477355 2867475112 Bacteria 6909112
759 2873152652 2873151551 Bacteria 8625867
760 2873156130 2873151551 Bacteria 8625867
761 2875397900 2875391855 Bacteria 7600475
762 2877677745 2877676314 Bacteria 9512378
763 2877681482 2877676314 Bacteria 9512378
764 2912716033 2912715099 Bacteria 9460473
765 2912720447 2912715099 Bacteria 9460473
766 2912728986 2912723979 Bacteria 8557534
767 2912764083 2912757875 Bacteria 7940295
768 2918507673 2918501144 Bacteria 8668083
769 2919470916 2919468124 Bacteria 9133025
770 2935392946 2935390628 Bacteria 7043367
771 2946046593 2946045630 Bacteria 8527308
772 2946050422 2946045630 Bacteria 8527308
773 2946067316 2946064051 Bacteria 8957905
774 2946071289 2946064051 Bacteria 8957905
775 2946075578 2946072368 Bacteria 8999607
776 2946079122 2946072368 Bacteria 8999607
777 2947225458 2947224130 Bacteria 9938529
778 2947229926 2947224130 Bacteria 9938529
779 2954004762 2954002825 Bacteria 9173742
780 2954009672 2954002825 Bacteria 9173742
781 2954382527 2954380949 Bacteria 10050426
782 2954386613 2954380949 Bacteria 10050426
783 2954676564 2954673503 Bacteria 9685905
784 2954680519 2954673503 Bacteria 9685905
785 2954683634 2954682443 Bacteria 9862841
786 2954687603 2954682443 Bacteria 9862841
787 2954693327 2954691527 Bacteria 10720516
788 2954697426 2954691527 Bacteria 10720516
789 2954704829 2954701450 Bacteria 10834262
790 2954708420 2954701450 Bacteria 10834262
791 2954713034 2954711539 Bacteria 10867210
792 2954716592 2954711539 Bacteria 10867210
793 2954722993 2954721474 Bacteria 10456478
794 2954726538 2954721474 Bacteria 10456478
795 2954735257 2954731030 Bacteria 10243860
796 2954738836 2954731030 Bacteria 10243860
797 2954741903 2954740390 Bacteria 10229294
798 2954745462 2954740390 Bacteria 10229294
799 2954754126 2954749733 Bacteria 10366972
800 2954757694 2954749733 Bacteria 10366972
801 2954760880 2954759201 Bacteria 9358192
802 2954764435 2954759201 Bacteria 9358192
803 2966599570 2966598605 Bacteria 7676064
804 2966602900 2966598605 Bacteria 7676064
805 2990046819 2990044586 Bacteria 6603797
806 2990067512 2990059506 Bacteria 9321252
807 2990089079 2990088156 Bacteria 6657676
808 2995470870 2995463766 Bacteria 8577691
809 2997455221 2997451912 Bacteria 8492419
810 3006328235 3006321560 Bacteria 8247479
811 3006429080 3006425503 Bacteria 6491253
812 3006486724 3006486233 Bacteria 8157040
813 3006499072 3006493962 Bacteria 8825450
814 3006500068 3006493962 Bacteria 8825450
815 8003860038 8003856774 Bacteria 7675274
816 8008490874 8008485437 Bacteria 7198341
817 8008564229 8008558824 Bacteria 10610750
818 8008568009 8008558824 Bacteria 10610750
819 8008575900 8008574985 Bacteria 7815457
820 8008579188 8008574985 Bacteria 7815457
821 8023631419 8023623736 Bacteria 8593882
822 8025416381 8025413630 Bacteria 7014048
823 8025479977 8025478263 Bacteria 8209203
824 8025527783 8025524527 Bacteria 7197316
825 8025533403 8025530807 Bacteria 8495698
826 8033687327 8033684223 Bacteria 6906479
827 8047895045 8047893842 Bacteria 11723082
828 8047896284 8047893842 Bacteria 11723082
829 8048136265 8048127548 Bacteria 11053136
830 8048362652 8048356638 Bacteria 11044339
831 8048372072 8048369669 Bacteria 11666822
832 8048373293 8048369669 Bacteria 11666822
833 8048381006 8048379754 Bacteria 11877923
834 8048384949 8048379754 Bacteria 11877923
835 8054160981 8054160619 Bacteria 7783213
836 8054166198 8054160619 Bacteria 7783213
837 8056064098 8056060235 Bacteria 7259403
838 8056450247 8056447290 Bacteria 7680491
839 8056669498 8056667051 Bacteria 6953971
840 8056830446 8056829672 Bacteria 9045328
841 8056836079 8056829672 Bacteria 9045328
842 Ga0501031_0076859
843 JGI24737J22298_10024845
844 JGI24735J21928_10029586
845 JGI24738J21930_10018443
846 JGI24738J21930_10046777
847 JGI25153J46596_10039005
848 rootH1_10011106
849 JGI25160J50197_1011063
850 Ga0006562J51391_1098900
851 Ga0006562J51391_1121973
852 Ga0006562J51391_1199503
853 Ga0006562J51391_1199504
854 Ga0070683_100278457
855 Ga0068853_100033113
856 Ga0068856_100123386
857 Ga0075365_10269027
858 Ga0075368_10020748
859 Ga0075368_10042322
860 Ga0075363_100000602
861 Ga0075363_100024672
862 Ga0075367_10007175
863 Ga0075369_10097653
864 Ga0075370_10089133
865 Ga0075370_10109428
866 Ga0105243_10133094
867 Ga0105248_10520187
868 Ga0105238_10760336
869 Ga0105246_10011543
870 Ga0105246_10077671
871 Ga0157369_10191806
872 Ga0157369_10219520
873 Ga0157372_10077114
874 Ga0182008_10000665
875 Ga0182008_10004348
876 Ga0182007_10000138
877 Ga0182007_10001425
878 Ga0183367_1001
879 Ga0183367_1006
880 Ga0213875_10002768
881 Ga0209758_1004461
882 Ga0209758_1005428
883 Ga0207426_1003208
884 Ga0207426_1012734
885 Ga0207696_1019465
886 Ga0207713_1011958
887 Ga0207647_10008432
888 Ga0207694_10608111
889 Ga0207661_10223720
890 Ga0207640_10311295
891 Ga0207639_10025377
892 Ga0207678_10232044
893 Ga0209371_1019061
894 Ga0209813_10021112
895 Ga0209813_10029098
896 Ga0268266_10158180
897 Ga0268266_10253747
898 Ga0307517_10002567
899 Ga0307517_10006702
900 Ga0307515_10000163
901 Ga0307515_10001581
902 Ga0268256_1015603
903 Ga0268256_1019425
904 Ga0307511_10001316
905 Ga0307511_10113322
906 Ga0307512_10002523
907 Ga0307512_10002993
908 Ga0307512_10015983
909 Ga0307512_10028893
910 Ga0307512_10049373
911 Ga0307513_10014953
912 Ga0307513_10020326
913 Ga0307513_10091273
914 Ga0307513_10155730
915 Ga0307509_10058360
916 Ga0307509_10072727
917 Ga0307509_10093941
918 Ga0307509_10109080
919 Ga0307509_10118725
920 Ga0307509_10133714
921 Ga0307508_10005082
922 Ga0307508_10011341
923 Ga0307508_10014464
924 Ga0307508_10015618
925 Ga0307508_10017234
926 Ga0307508_10026758
927 Ga0307508_10027209
928 Ga0307508_10029127
929 Ga0307508_10104540
930 Ga0307508_10132711
931 Ga0307508_10308379
932 Ga0307514_10025847
933 Ga0307514_10077440
934 Ga0307514_10079084
935 Ga0307514_10092512
936 Ga0307514_10171660
937 Ga0307516_10002626
938 Ga0307516_10006868
939 Ga0307516_10007700
940 Ga0307516_10013194
941 Ga0307516_10025378
942 Ga0307516_10042784
943 Ga0307518_10134871
944 Ga0307518_10182675
945 Ga0307409_100469985
946 Ga0307416_100054875
947 Ga0307507_10005088
948 Ga0307507_10100191
949 Ga0307507_10107744
950 Ga0307510_10007994
951 Ga0307510_10025317
952 Ga0307510_10044446
953 Ga0307510_10053280
954 Ga0307510_10064068
955 Ga0307510_10129781
956 Ga0307510_10136571
957 Ga0395900_0031806
958 Ga0395900_0041212
959 Ga0395898_0002800
960 Ga0395898_0015938
961 Ga0395898_0023672
962 Ga0436364_1179377
963 Ga0395901_0023825
964 Ga0395901_0324146
965 Ga0395901_0583682
966 Ga0439436_0002576
967 Ga0439436_0013048
968 Ga0439436_0013390
969 Ga0439436_0019952
970 Ga0439439_0021518
971 Ga0451797_0058893
972 Ga0451841_0267804
973 Ga0451853_0177550
974 Ga0451853_0939466
975 Ga0451853_1932420
976 Ga0451853_2768772
977 Ga0439433_0001313
978 Ga0439433_0002459
979 Ga0439448_0045057
980 Ga0439448_0070718
981 Ga0439432_032394
982 Ga0439449_0001600
983 Ga0439449_0003189
984 Ga0439449_0014357
985 Ga0439449_0061162
986 Ga0439450_005101
987 Ga0439455_0002252
988 Ga0439457_000007
989 Ga0439457_045260
990 Ga0439462_0005965
991 Ga0439462_0013324
992 Ga0450894_000041
993 Ga0450894_000185
994 Ga0450895_003510
995 Ga0450896_003173
996 Ga0450898_000103
997 Ga0450899_000188
998 Ga0450899_001330
999 Ga0450900_001665
1000 Ga0450900_002725
1001 Ga0450903_000472
1002 Ga0450903_002415
1003 Ga0450903_005834
1004 Ga0450906_000610
1005 Ga0450906_000953
1006 Ga0439458_0005054
1007 Ga0439458_0006142
1008 Ga0466969_0204142
1009 Ga0466972_0013839
1010 Ga0466972_0016549
1011 Ga0466965_0000238
1012 Ga0466965_0002882
1013 Ga0466965_0006979
1014 Ga0466965_0015984
1015 Ga0466965_0050935
1016 Ga0466965_0072432
1017 Ga0466965_0153825
1018 Ga0466965_0154968
1019 Ga0466966_0001953
1020 Ga0466966_0008911
1021 Ga0466966_0038819
1022 Ga0466966_0041611
1023 Ga0466961_0000633
1024 Ga0466961_0005921
1025 Ga0466961_0051961
1026 Ga0466961_0081949
1027 Ga0466963_0001746
1028 Ga0466963_0006328
1029 Ga0466963_0058798
1030 Ga0466963_0118270
1031 Ga0466964_0000403
1032 Ga0466964_0007182
1033 Ga0466971_0000288
1034 Ga0466971_0001336
1035 Ga0466971_0009907
1036 Ga0466971_0038480
1037 Ga0466971_0043232
1038 Ga0466968_0020908
1039 Ga0466970_0000573
1040 Ga0466970_0001607
1041 Ga0466970_0004042
1042 Ga0466957_0005800
1043 Ga0466957_0040765
1044 Ga0466957_0056001
1045 Ga0466959_0001737
1046 Ga0466959_0013422
1047 Ga0466959_0033229
1048 Ga0466959_0061114
1049 Ga0466958_0000978
1050 Ga0466967_0001276
1051 Ga0466967_0001936
1052 Ga0466967_0018954
1053 Ga0466967_0023680
1054 Ga0466967_0042524
1055 Ga0466967_0315850
1056 Ga0495617_023662
1057 Ga0495627_037790
1058 Ga0495592_0009074
1059 Ga0495592_0012861
1060 Ga0495592_0017186
1061 Ga0495603_0000713
1062 Ga0495603_0001801
1063 Ga0495603_0001820
1064 Ga0495603_0002025
1065 Ga0495603_0002581
1066 Ga0495603_0005919
1067 Ga0495603_0008084
1068 Ga0495603_0034304
1069 Ga0495603_0034339
1070 Ga0495603_0046883
1071 Ga0495629_0000446
1072 Ga0495629_0001244
1073 Ga0495629_0005475
1074 Ga0495629_0005950
1075 Ga0495629_0006653
1076 Ga0495629_0014204
1077 Ga0495629_0017287
1078 Ga0495629_0018801
1079 Ga0495629_0022644
1080 Ga0495629_0113838
1081 Ga0495629_0116917
1082 Ga0495629_0144378
1083 Ga0495629_0150988
1084 Ga0495629_0293198
1085 Ga0495638_0033093
1086 Ga0495638_0056259
1087 Ga0495638_0295606
1088 Ga0495651_0002046
1089 Ga0495651_0004606
1090 Ga0495651_0010968
1091 Ga0495651_0072846
1092 Ga0495653_0012407
1093 Ga0495582_0019755
1094 Ga0495582_0028422
1095 Ga0495605_0005625
1096 Ga0495605_0010689
1097 Ga0495662_0000320
1098 Ga0495662_0000380
1099 Ga0495662_0000603
1100 Ga0495662_0004382
1101 Ga0495662_0015459
1102 Ga0495662_0032377
1103 Ga0495662_0041346
1104 Ga0495662_0145658
1105 Ga0495664_0000276
1106 Ga0495664_0000381
1107 Ga0495664_0001678
1108 Ga0495664_0139136
1109 Ga0495585_0009597
1110 Ga0495585_0042152
1111 Ga0495585_0072393
1112 Ga0495585_0092242
1113 Ga0495594_0000421
1114 Ga0495594_0001106
1115 Ga0495594_0012750
1116 Ga0495594_0019570
1117 Ga0495594_0021072
1118 Ga0495594_0099243
1119 Ga0495594_0136729
1120 Ga0495594_0250492
1121 Ga0495596_0018883
1122 Ga0495596_0095159
1123 Ga0495607_0038880
1124 Ga0495607_0086415
1125 Ga0495607_0101429
1126 Ga0495607_0104689
1127 Ga0495583_0062178
1128 Ga0495606_0006850
1129 Ga0495606_0013139
1130 Ga0495608_0002494
1131 Ga0495610_0034481
1132 Ga0495610_0129092
1133 Ga0495616_0003832
1134 Ga0495618_0006028
1135 Ga0495628_0004297
1136 Ga0495628_0058564
1137 Ga0495628_0104148
1138 Ga0495628_0168310
1139 Ga0495630_0007356
1140 Ga0495630_0097830
1141 Ga0495631_0013977
1142 Ga0495637_0029919
1143 Ga0495637_0053660
1144 Ga0495643_0004392
1145 Ga0495643_0007065
1146 Ga0495643_0023015
1147 Ga0495643_0026409
1148 Ga0495648_0051264
1149 Ga0495648_0151691
1150 Ga0495648_0156416
1151 Ga0495666_0000341
1152 Ga0495666_0060543
1153 Ga0495642_0016945
1154 Ga0495652_0028908
1155 Ga0495652_0038014
1156 Ga0495652_0040421
1157 Ga0495654_0094319
1158 Ga0495665_0006572
1159 Ga0495665_0059166
1160 Ga0495640_0003231
1161 Ga0495640_0003668
1162 Ga0495640_0004405
1163 Ga0495640_0020491
1164 Ga0495586_0009046
1165 Ga0495586_0113656
1166 Ga0495587_0002014
1167 Ga0495587_0005301
1168 Ga0495587_0008296
1169 Ga0495609_0008069
1170 Ga0495609_0023777
1171 Ga0495645_0006649
1172 Ga0495645_0007407
1173 Ga0495645_0008580
1174 Ga0495645_0067849
1175 Ga0495622_0040938
1176 Ga0495622_0063539
1177 Ga0495622_0065875
1178 Ga0495622_0066529
1179 Ga0495622_0074810
1180 Ga0495633_0014275
1181 Ga0495633_0020939
1182 Ga0495633_0071002
1183 Ga0495633_0094971
1184 Ga0495667_0002879
1185 Ga0495667_0070328
1186 Ga0495667_0098898
1187 Ga0495668_0005061
1188 Ga0495668_0009505
1189 Ga0495634_0000467
1190 Ga0495634_0003019
1191 Ga0495634_0006539
1192 Ga0495634_0012774
1193 Ga0495634_0171164
1194 Ga0495611_0028362
1195 Ga0495611_0035040
1196 Ga0495611_0075641
1197 Ga0495611_0197320
1198 Ga0495625_0010025
1199 Ga0495625_0033792
1200 Ga0495625_0038751
1201 Ga0495625_0121616
1202 Ga0495635_0000258
1203 Ga0495635_0002195
1204 Ga0495635_0022574
1205 Ga0495661_0089843
1206 Ga0495588_0008499
1207 Ga0495588_0067138
1208 Ga0495588_0106460
1209 Ga0495657_0003345
1210 Ga0495657_0003387
1211 Ga0495657_0005383
1212 Ga0495657_0006967
1213 Ga0495657_0015808
1214 Ga0495657_0060791
1215 Ga0495657_0060984
1216 Ga0495599_0009442
1217 Ga0495599_0049879
1218 Ga0495623_0025493
1219 Ga0495623_0037451
1220 Ga0495623_0057270
1221 Ga0495623_0061300
1222 Ga0495646_0000179
1223 Ga0495646_0000678
1224 Ga0495646_0001066
1225 Ga0495646_0114230
1226 Ga0495658_0012478
1227 Ga0495658_0053400
1228 Ga0495658_0208894
1229 Ga0495613_0001528
1230 Ga0495613_0002286
1231 Ga0495613_0002984
1232 Ga0495613_0004842
1233 Ga0495613_0006255
1234 Ga0495613_0014796
1235 Ga0495613_0016827
1236 Ga0495613_0037027
1237 Ga0495613_0096840
1238 Ga0495613_0260575
1239 Ga0495613_0378484
1240 Ga0495613_0448453
1241 Ga0495624_0032500
1242 Ga0495624_0105845
1243 Ga0495624_0107463
1244 Ga0495670_0002744
1245 Ga0495670_0026210
1246 Ga0495670_0029777
1247 Ga0495670_0131403
1248 Ga0495671_0007075
1249 Ga0495649_0053195
1250 Ga0495649_0066039
1251 Ga0495649_0106440
1252 Ga0495649_0112002
1253 Ga0495589_0008592
1254 Ga0495589_0008783
1255 Ga0495589_0009491
1256 Ga0495589_0016618
1257 Ga0495589_0017887
1258 Ga0495589_0029411
1259 Ga0495589_0133784
1260 Ga0495589_0177121
1261 Ga0495600_0003334
1262 Ga0495600_0010394
1263 Ga0495600_0050725
1264 Ga0495600_0209069
1265 Ga0495600_0373523
1266 Ga0495660_0029352
1267 Ga0495581_0025746
1268 Ga0495581_0028800
1269 Ga0495581_0077443
1270 Ga0495581_0127645
1271 Ga0495581_0172072
1272 Ga0495604_0000243
1273 Ga0495604_0002783
1274 Ga0495604_0003232
1275 Ga0495604_0005871
1276 Ga0495604_0017876
1277 Ga0495604_0033343
1278 Ga0495604_0087478
1279 Ga0495636_0001039
1280 Ga0495636_0007846
1281 Ga0495636_0023182
1282 Ga0495636_0061061
1283 Ga0495636_0084894
1284 Ga0495636_0174372
1285 Ga0495674_0006224
1286 Ga0495674_0102992
1287 Ga0495672_0039795
1288 Ga0495672_0126752
1289 Ga0495676_0001137
1290 Ga0495676_0002573
1291 Ga0495676_0003376
1292 Ga0495676_0004614
1293 Ga0495676_0010185
1294 Ga0495676_0017899
1295 Ga0495676_0023538
1296 Ga0495676_0029126
1297 Ga0495676_0033053
1298 Ga0495676_0051832
1299 Ga0495676_0059659
1300 Ga0495676_0179153
1301 Ga0495680_0024008
1302 Ga0495680_0039101
1303 Ga0495687_001918
1304 Ga0495687_017258
1305 Ga0495687_024664
1306 Ga0495687_037246
1307 Ga0495687_063498
1308 Ga0495687_079985
1309 Ga0495687_081068
1310 Ga0495675_0002940
1311 Ga0495675_0007790
1312 Ga0495675_0015556
1313 Ga0495675_0019920
1314 Ga0495675_0044000
1315 Ga0495675_0054853
1316 Ga0495679_058771
1317 Ga0495685_000097
1318 Ga0495685_000874
1319 Ga0495685_004520
1320 Ga0495685_006818
1321 Ga0495685_009176
1322 Ga0495685_012390
1323 Ga0495685_027531
1324 Ga0495685_059379
1325 Ga0495685_092701
1326 Ga0495681_0000311
1327 Ga0495681_0001598
1328 Ga0495681_0001982
1329 Ga0495681_0002757
1330 Ga0495681_0013091
1331 Ga0495681_0047160
1332 Ga0495684_0030042
1333 Ga0495684_0061811
1334 Ga0495684_0143699
1335 Ga0495684_0179184
1336 Ga0495686_0030622
1337 Ga0495686_0098473
1338 Ga0495593_0000841
1339 Ga0495593_0037428
1340 Ga0495602_0098464
1341 Ga0495602_0098643
1342 Ga0495614_0001085
1343 Ga0495614_0002870
1344 Ga0495614_0018049
1345 Ga0495614_0084178
1346 Ga0495626_0024329
1347 Ga0496102_0139144
1348 Ga0496107_0075868
1349 Ga0496109_0053601
1350 Ga0495678_039544
1351 Ga0495678_039708
1352 Ga0495682_0024068
1353 Ga0501323_023747
1354 Ga0501031_0002011
1355 Ga0501031_0004264
1356 Ga0501031_0016842
1357 Ga0501031_0029189
1358 Ga0501031_0033305
1359 Ga0501032_0009200
1360 Ga0501032_0073247
1361 Ga0501033_0002003
1362 Ga0501033_0002271
1363 Ga0501033_0003695
1364 Ga0501033_0013108
1365 Ga0501033_0043911
1366 Ga0501033_0049095
1367 Ga0501033_0052820
1368 Ga0501033_0126070
1369 Ga0501033_0402203
1370 Ga0501034_0012461
1371 Ga0501034_0013353
1372 Ga0501034_0018958
1373 Ga0501034_0020200
1374 Ga0501034_0071877
1375 Ga0501034_0079153
1376 Ga0501034_0199486
1377 Ga0501034_0665917
1378 Ga0501036_0000912
1379 Ga0501036_0012423
1380 Ga0501036_0014015
1381 Ga0501036_0068759
1382 Ga0501036_0102203
1383 Ga0501036_0289333
1384 Ga0501037_0000908
1385 Ga0501037_0015271
1386 Ga0501037_0025205
1387 Ga0501037_0042216
1388 Ga0501037_0110737
1389 Ga0501037_0257939
1390 Ga0501038_0018579
1391 Ga0501038_0021147
1392 Ga0501038_0043953
1393 Ga0501038_0051994
1394 Ga0501038_0061138
1395 Ga0501038_0068876
1396 Ga0501038_0505553
1397 Ga0501039_0064419
1398 Ga0501039_0119571
1399 Ga0501041_0001638
1400 Ga0501042_0101203
1401 Ga0501042_0365976
1402 Ga0501043_0000935
1403 Ga0501043_0004583
1404 Ga0501043_0005696
1405 Ga0501043_0027475
1406 Ga0501043_0039992
1407 Ga0501043_0061263
1408 Ga0501046_0010424
1409 Ga0501046_0039365
1410 Ga0501046_0039856
1411 Ga0501047_0000118
1412 Ga0501047_0003839
1413 Ga0501047_0015115
1414 Ga0501047_0017273
1415 Ga0501047_0027723
1416 Ga0501047_0033818
1417 Ga0501047_0045972
1418 Ga0501047_0119098
1419 Ga0501047_0155877
1420 Ga0501048_0001218
1421 Ga0501048_0003822
1422 Ga0501048_0018180
1423 Ga0501067_0004365
1424 Ga0501068_0003116
1425 Ga0501068_0037018
1426 Ga0501068_0057820
1427 Ga0501069_0092712
1428 Ga0501070_0002731
1429 Ga0501070_0004111
1430 Ga0501070_0015741
1431 Ga0501070_0030531
1432 Ga0501070_0332818
1433 Ga0501071_0007384
1434 Ga0501072_0000627
1435 Ga0501072_0175800
1436 Ga0501073_0099905
1437 Ga0501074_0112166
1438 Ga0501076_0004062
1439 Ga0501077_0028737
1440 Ga0501079_0003778
1441 Ga0501080_0010852
1442 Ga0501080_0027991
1443 Ga0501083_0000556
1444 Ga0501035_0000900
1445 Ga0501035_0002053
1446 Ga0501035_0023543
1447 Ga0501035_0122393
1448 Ga0501035_0124797
1449 Ga0501035_0209789
1450 Ga0501035_0271803
1451 Ga0501035_0313516
1452 Ga0501044_0003862
1453 Ga0501044_0004846
1454 Ga0501044_0032600
1455 Ga0501044_0042523
1456 Ga0501044_0097967
1457 Ga0501044_0111572
1458 Ga0501044_0122939
1459 Ga0501044_0134715
1460 Ga0501044_0220044
1461 Ga0501044_0264620
1462 Ga0501044_0577546
1463 Ga0501045_0053836
1464 nmdc:mga03n38_6810_c1
1465 nmdc:mga03n38_9051_c1
1466 nmdc:mga06z11_12354_c1
1467 nmdc:mga06z11_32611_c1
1468 nmdc:mga04h51_10473_c1
1469 nmdc:mga04h51_8438_c1
1470 nmdc:mga07m45_137698_c1
1471 nmdc:mga07m45_138823_c1
1472 nmdc:mga0sz30_88013_c1
1473 Ga0495601_0036861
1474 Ga0495612_0021483
1475 Ga0495655_0016904
1476 Ga0495655_0030265
1477 Ga0500578_0016161
1478 Ga0500578_0041224
1479 Ga0500644_0203056
1480 Ga0500646_0007165
1481 Ga0500651_0209479
1482 Ga0500566_0055559
1483 Ga0500640_011042
1484 Ga0500640_024186
1485 Ga0500641_0080449
1486 Ga0500660_023806
1487 Ga0500660_084420
1488 Ga0500553_037429
1489 Ga0500553_057289
1490 Ga0500553_107630
1491 Ga0500558_116599
1492 Ga0500560_000629
1493 Ga0500560_029476
1494 Ga0500569_004320
1495 Ga0500569_017294
1496 Ga0500572_001912
1497 Ga0500572_005958
1498 Ga0500582_115218
1499 Ga0500608_172047
1500 Ga0500628_005912
1501 Ga0500628_030339
1502 Ga0500652_003290
1503 Ga0500652_026047
1504 Ga0500658_0004463
1505 Ga0500658_0004659
1506 Ga0500561_0003761
1507 Ga0500561_0004147
1508 Ga0500573_0253986
1509 Ga0500577_0084596
1510 Ga0500579_021267
1511 Ga0500579_125731
1512 Ga0500600_0008110
1513 Ga0500600_0009283
1514 Ga0500600_0050759
1515 Ga0500606_080572
1516 Ga0500616_0000905
1517 Ga0500616_0008117
1518 Ga0500616_0010872
1519 Ga0500633_0017012
1520 Ga0500633_0037561
1521 Ga0500634_0004723
1522 Ga0500634_0024669
1523 Ga0500656_012822
1524 Ga0500565_008680
1525 Ga0500587_001712
1526 Ga0501084_0102810
1527 Ga0501082_0104809
1528 Ga0466962_0000508
1529 Ga0466962_0000514
1530 Ga0466962_0001988
1531 2547407209
1532 2547412171
1533 2554260848
1534 2585301940
1535 2585302156
1536 2585304071
1537 2585310541
1538 2585312059
1539 2585315646
1540 2616697382
1541 2616901259
1542 2643762366
1543 2643765515
1544 2643898307
1545 2643946095
1546 2644013684
1547 2644178686
1548 2644263834
1549 2644264450
1550 2644387869
1551 2644407852
1552 2644409452
1553 2644432884
1554 2644436792
1555 2644438160
1556 2644458855
1557 2644462413
1558 2644625419
1559 2644631848
1560 2768645347
1561 2784588264
1562 2784591928
1563 2785339787
1564 2785343753
1565 2785369077
1566 2785373156
1567 2786670222
1568 2786674882
1569 2804849129
1570 2808841686
1571 2808845294
1572 2808914994
1573 2808920222
1574 2809235538
1575 2811843222
1576 2812354413
1577 2812358563
1578 2812477392
1579 2812480887
1580 2819693285
1581 2819743840
1582 2852636037
1583 2852642690
1584 2862184304
1585 2862184548
1586 2862283077
1587 2862290947
1588 2862291755
1589 2862392467
1590 2862515164
1591 2862576226
1592 2862579582
1593 2862707801
1594 2863405085
1595 2867374895
1596 2867431817
1597 2867434275
1598 2867476057
1599 2867477355
1600 2873152652
1601 2873156130
1602 2875397900
1603 2877677745
1604 2877681482
1605 2912716033
1606 2912720447
1607 2912728986
1608 2912764083
1609 2918507673
1610 2919470916
1611 2935392946
1612 2946046593
1613 2946050422
1614 2946067316
1615 2946071289
1616 2946075578
1617 2946079122
1618 2947225458
1619 2947229926
1620 2954004762
1621 2954009672
1622 2954382527
1623 2954386613
1624 2954676564
1625 2954680519
1626 2954683634
1627 2954687603
1628 2954693327
1629 2954697426
1630 2954704829
1631 2954708420
1632 2954713034
1633 2954716592
1634 2954722993
1635 2954726538
1636 2954735257
1637 2954738836
1638 2954741903
1639 2954745462
1640 2954754126
1641 2954757694
1642 2954760880
1643 2954764435
1644 2966599570
1645 2966602900
1646 2990046819
1647 2990067512
1648 2990089079
1649 2995470870
1650 2997455221
1651 3006328235
1652 3006429080
1653 3006486724
1654 3006499072
1655 3006500068
1656 8003860038
1657 8008490874
1658 8008564229
1659 8008568009
1660 8008575900
1661 8008579188
1662 8023631419
1663 8025416381
1664 8025479977
1665 8025527783
1666 8025533403
1667 8033687327
1668 8047895045
1669 8047896284
1670 8048136265
1671 8048362652
1672 8048372072
1673 8048373293
1674 8048381006
1675 8048384949
1676 8054160981
1677 8054166198
1678 8056064098
1679 8056450247
1680 8056669498
1681 8056830446
1682 8056836079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

114

249

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dd0-assembly1.cif.gz_C crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8864 9 260
7dd0-assembly2.cif.gz_D crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8813 9 260
7dd0-assembly1.cif.gz_A crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.877 9 267
8dne-assembly1.cif.gz_C cryoem structure of the a.aeolicus wzmwzt transporter bound to atp 0.8469 12 264
7dd0-assembly2.cif.gz_B crystal structure of the n-terminal domain of tagh from bacillus subtilis 0.8441 10 260
ID Description Score Start End Superfamily
af_Q2G2H3_25_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8523 57 266 3.40.50.300
af_Q58429_1_224_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8464 10 251 3.40.50.300
af_Q2G2L1_4_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8117 11 267 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8046 10 244 3.40.50.300
af_P72047_42_272_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8045 57 256 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A846SKN9-F1-model_v4 deleted 0.9036 55 260
AF-A0A1Q7AJ00-F1-model_v4 ABC transporter domain-containing protein 0.8869 55 259 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A1B6AK36-F1-model_v4 Putative polysaccharide ABC transporter ATP-binding protein 0.878 53 237 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A1B6AK36-F1-model_v4 Putative polysaccharide ABC transporter ATP-binding protein 0.8693 53 237 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A7W3B8Q2-F1-model_v4 deleted 0.8684 10 259

Map