F483094
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 841 | 345 | 1682 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_1029185|Ga0436364_1029185_97_1179 |
| Length | 360 |
| Sequence | MLQVFDERNRDLIVNVGGRLTHRDRAAVSPFDSVVQGGDAVWEGLRLYAGKIFRLDEHLARLRASARALAFGQIPSDQEITEQIRRTLEANGMRDGVHIRLTLSRGVKITSGMDPRLNQSGPTLIVLAEFKDPVYDMAGITLITSSVRRPAPDCLDPKIHHNNLLPSILAKIEANVAGADDAVVLDHRGFIAETNATHLFMVTGGTLATPTTVSCPEGITRAAVLGLAASAGIACETGDYTLPQLYNAEEAFVTGTMGGLAPVVSVDGRVIGDRAPGPVTKRLTALYADLTATTGTSVTLRRSPNTNVSTRLHDREDFCTLYDLKVFAIMEMSARQHASPRLVGRTELMGPVGLAGWCAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 120 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 214 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 217 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 235 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 236 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 237 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 238 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 342 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 343 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 344 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 345 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.24 |
| Isolates | 0.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.19 |
| Nodule | 0 |
| Rhizoplane | 4.16 |
| Rhizosphere | 91.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_1029185 | 3300037853 | Bacteria | 2065 |
| 2 | CNXas_1000106 | 3300000545 | Bacteria | 15432 |
| 3 | JGI24737J22298_10019269 | 3300001990 | Unclassified | 2183 |
| 4 | JGI25406J46586_10033852 | 3300003203 | Bacteria | 1882 |
| 5 | rootL2_10283179 | 3300003322 | Bacteria | 1626 |
| 6 | rootH1_10297839 | 3300003323 | Bacteria | 1578 |
| 7 | JGI25405J52794_10001159 | 3300003911 | Bacteria | 4247 |
| 8 | Ga0065712_10071752 | 3300005290 | Bacteria | 5079 |
| 9 | Ga0065712_10076362 | 3300005290 | Bacteria | 3657 |
| 10 | Ga0065712_10112324 | 3300005290 | Unclassified | 1799 |
| 11 | Ga0065715_10115992 | 3300005293 | Bacteria | 2395 |
| 12 | Ga0065715_10269210 | 3300005293 | Unclassified | 1116 |
| 13 | Ga0065707_10122970 | 3300005295 | Unclassified | 2070 |
| 14 | Ga0070676_10012441 | 3300005328 | Bacteria | 4645 |
| 15 | Ga0070676_10015058 | 3300005328 | Bacteria | 4261 |
| 16 | Ga0070676_10034917 | 3300005328 | Unclassified | 2889 |
| 17 | Ga0070683_100140986 | 3300005329 | Bacteria | 2284 |
| 18 | Ga0070683_100296192 | 3300005329 | Bacteria | 1539 |
| 19 | Ga0070690_100062878 | 3300005330 | Bacteria | 2394 |
| 20 | Ga0070670_100028308 | 3300005331 | Bacteria | 4822 |
| 21 | Ga0070670_100087004 | 3300005331 | Bacteria | 2685 |
| 22 | Ga0070677_10026578 | 3300005333 | Unclassified | 2172 |
| 23 | Ga0068869_100033967 | 3300005334 | Bacteria | 3604 |
| 24 | Ga0070666_10041763 | 3300005335 | Bacteria | 3065 |
| 25 | Ga0068868_100046597 | 3300005338 | Bacteria | 3394 |
| 26 | Ga0068868_100070885 | 3300005338 | Bacteria | 2779 |
| 27 | Ga0068868_100101000 | 3300005338 | Bacteria | 2334 |
| 28 | Ga0070660_100282824 | 3300005339 | Bacteria | 1358 |
| 29 | Ga0070689_100035065 | 3300005340 | Bacteria | 3831 |
| 30 | Ga0070691_10025837 | 3300005341 | Bacteria | 2736 |
| 31 | Ga0070687_100086316 | 3300005343 | Bacteria | 1725 |
| 32 | Ga0070687_100155061 | 3300005343 | Bacteria | 1348 |
| 33 | Ga0070661_100028111 | 3300005344 | Bacteria | 4055 |
| 34 | Ga0070668_100038731 | 3300005347 | Bacteria | 3645 |
| 35 | Ga0070668_100246024 | 3300005347 | Bacteria | 1483 |
| 36 | Ga0070669_100014019 | 3300005353 | Bacteria | 5699 |
| 37 | Ga0070669_100018362 | 3300005353 | Bacteria | 4998 |
| 38 | Ga0070669_100108537 | 3300005353 | Bacteria | 2103 |
| 39 | Ga0070669_100151585 | 3300005353 | Unclassified | 1795 |
| 40 | Ga0070675_100054888 | 3300005354 | Bacteria | 3279 |
| 41 | Ga0070675_100058891 | 3300005354 | Unclassified | 3168 |
| 42 | Ga0070675_100186316 | 3300005354 | Unclassified | 1796 |
| 43 | Ga0070675_100225353 | 3300005354 | Bacteria | 1634 |
| 44 | Ga0070671_100030011 | 3300005355 | Bacteria | 4486 |
| 45 | Ga0070671_100043837 | 3300005355 | Bacteria | 3718 |
| 46 | Ga0070671_100054892 | 3300005355 | Bacteria | 3313 |
| 47 | Ga0070674_100008238 | 3300005356 | Bacteria | 6194 |
| 48 | Ga0070674_100014578 | 3300005356 | Bacteria | 4890 |
| 49 | Ga0070673_100056039 | 3300005364 | Bacteria | 3108 |
| 50 | Ga0070673_100113898 | 3300005364 | Bacteria | 2246 |
| 51 | Ga0070673_100183194 | 3300005364 | Bacteria | 1794 |
| 52 | Ga0070673_100350367 | 3300005364 | Bacteria | 1310 |
| 53 | Ga0070688_100121353 | 3300005365 | Unclassified | 1751 |
| 54 | Ga0070659_100048869 | 3300005366 | Bacteria | 3324 |
| 55 | Ga0070659_100270224 | 3300005366 | Unclassified | 1412 |
| 56 | Ga0070667_100012780 | 3300005367 | Bacteria | 6938 |
| 57 | Ga0070667_100019907 | 3300005367 | Bacteria | 5569 |
| 58 | Ga0070703_10047024 | 3300005406 | Bacteria | 1366 |
| 59 | Ga0070709_10028768 | 3300005434 | Bacteria | 3317 |
| 60 | Ga0070714_100000657 | 3300005435 | Bacteria | 24532 |
| 61 | Ga0070714_100003814 | 3300005435 | Bacteria | 11324 |
| 62 | Ga0070714_100012376 | 3300005435 | Bacteria | 6811 |
| 63 | Ga0070714_100119023 | 3300005435 | Bacteria | 2347 |
| 64 | Ga0070714_100231101 | 3300005435 | Bacteria | 1704 |
| 65 | Ga0070714_100247744 | 3300005435 | Unclassified | 1646 |
| 66 | Ga0070714_100368592 | 3300005435 | Bacteria | 1352 |
| 67 | Ga0070713_100007742 | 3300005436 | Bacteria | 7563 |
| 68 | Ga0070713_100049570 | 3300005436 | Bacteria | 3464 |
| 69 | Ga0070713_100050796 | 3300005436 | Bacteria | 3427 |
| 70 | Ga0070713_100133263 | 3300005436 | Bacteria | 2193 |
| 71 | Ga0070713_100137712 | 3300005436 | Bacteria | 2159 |
| 72 | Ga0070713_100217106 | 3300005436 | Bacteria | 1734 |
| 73 | Ga0070713_100227310 | 3300005436 | Unclassified | 1695 |
| 74 | Ga0070713_100249253 | 3300005436 | Bacteria | 1619 |
| 75 | Ga0070710_10026241 | 3300005437 | Bacteria | 3093 |
| 76 | Ga0070710_10049348 | 3300005437 | Bacteria | 2354 |
| 77 | Ga0070710_10050771 | 3300005437 | Bacteria | 2326 |
| 78 | Ga0070710_10075868 | 3300005437 | Unclassified | 1949 |
| 79 | Ga0070710_10152075 | 3300005437 | Bacteria | 1428 |
| 80 | Ga0070711_100023987 | 3300005439 | Bacteria | 3975 |
| 81 | Ga0070711_100026953 | 3300005439 | Bacteria | 3768 |
| 82 | Ga0070711_100035490 | 3300005439 | Unclassified | 3335 |
| 83 | Ga0070711_100047568 | 3300005439 | Bacteria | 2929 |
| 84 | Ga0070711_100132476 | 3300005439 | Unclassified | 1858 |
| 85 | Ga0070711_100211195 | 3300005439 | Bacteria | 1503 |
| 86 | Ga0070705_100001164 | 3300005440 | Bacteria | 14412 |
| 87 | Ga0070705_100123953 | 3300005440 | Bacteria | 1673 |
| 88 | Ga0070700_100158380 | 3300005441 | Bacteria | 1556 |
| 89 | Ga0070694_100015975 | 3300005444 | Bacteria | 4722 |
| 90 | Ga0070708_100007147 | 3300005445 | Bacteria | 8911 |
| 91 | Ga0070708_100059301 | 3300005445 | Unclassified | 3412 |
| 92 | Ga0070708_100063183 | 3300005445 | Bacteria | 3313 |
| 93 | Ga0070708_100098970 | 3300005445 | Bacteria | 2667 |
| 94 | Ga0070708_100135317 | 3300005445 | Bacteria | 2282 |
| 95 | Ga0070708_100385045 | 3300005445 | Bacteria | 1322 |
| 96 | Ga0070663_100457018 | 3300005455 | Bacteria | 1054 |
| 97 | Ga0070678_100002602 | 3300005456 | Bacteria | 9918 |
| 98 | Ga0070678_100003517 | 3300005456 | Bacteria | 8737 |
| 99 | Ga0070678_100102376 | 3300005456 | Bacteria | 2222 |
| 100 | Ga0070678_100248859 | 3300005456 | Bacteria | 1489 |
| 101 | Ga0070662_100002629 | 3300005457 | Bacteria | 11077 |
| 102 | Ga0070662_100049702 | 3300005457 | Unclassified | 3024 |
| 103 | Ga0070681_10179079 | 3300005458 | Bacteria | 2041 |
| 104 | Ga0068867_100275390 | 3300005459 | Bacteria | 1378 |
| 105 | Ga0070706_100003809 | 3300005467 | Bacteria | 14733 |
| 106 | Ga0070706_100004920 | 3300005467 | Bacteria | 12788 |
| 107 | Ga0070706_100016008 | 3300005467 | Bacteria | 6926 |
| 108 | Ga0070706_100017361 | 3300005467 | Bacteria | 6640 |
| 109 | Ga0070706_100036664 | 3300005467 | Bacteria | 4530 |
| 110 | Ga0070706_100038135 | 3300005467 | Bacteria | 4436 |
| 111 | Ga0070706_100094958 | 3300005467 | Bacteria | 2767 |
| 112 | Ga0070706_100109506 | 3300005467 | Bacteria | 2570 |
| 113 | Ga0070706_100115675 | 3300005467 | Bacteria | 2497 |
| 114 | Ga0070706_100136973 | 3300005467 | Bacteria | 2285 |
| 115 | Ga0070706_100160527 | 3300005467 | Bacteria | 2099 |
| 116 | Ga0070706_100185736 | 3300005467 | Unclassified | 1942 |
| 117 | Ga0070706_100307310 | 3300005467 | Bacteria | 1479 |
| 118 | Ga0070707_100000596 | 3300005468 | Bacteria | 36368 |
| 119 | Ga0070707_100003415 | 3300005468 | Bacteria | 15008 |
| 120 | Ga0070707_100006151 | 3300005468 | Bacteria | 11183 |
| 121 | Ga0070707_100010754 | 3300005468 | Bacteria | 8524 |
| 122 | Ga0070707_100030394 | 3300005468 | Bacteria | 5143 |
| 123 | Ga0070707_100057882 | 3300005468 | Bacteria | 3718 |
| 124 | Ga0070707_100058776 | 3300005468 | Bacteria | 3688 |
| 125 | Ga0070707_100068074 | 3300005468 | Bacteria | 3425 |
| 126 | Ga0070707_100095466 | 3300005468 | Bacteria | 2879 |
| 127 | Ga0070707_100110212 | 3300005468 | Bacteria | 2669 |
| 128 | Ga0070707_100146377 | 3300005468 | Unclassified | 2299 |
| 129 | Ga0070707_100155480 | 3300005468 | Bacteria | 2228 |
| 130 | Ga0070707_100202583 | 3300005468 | Bacteria | 1934 |
| 131 | Ga0070707_100242917 | 3300005468 | Bacteria | 1752 |
| 132 | Ga0070707_100249724 | 3300005468 | Bacteria | 1726 |
| 133 | Ga0070698_100000272 | 3300005471 | Bacteria | 52507 |
| 134 | Ga0070698_100000415 | 3300005471 | Bacteria | 45479 |
| 135 | Ga0070698_100043551 | 3300005471 | Bacteria | 4601 |
| 136 | Ga0070698_100048934 | 3300005471 | Unclassified | 4318 |
| 137 | Ga0070698_100093507 | 3300005471 | Bacteria | 2986 |
| 138 | Ga0070698_100130972 | 3300005471 | Bacteria | 2463 |
| 139 | Ga0070699_100002396 | 3300005518 | Bacteria | 16820 |
| 140 | Ga0070699_100018135 | 3300005518 | Bacteria | 6047 |
| 141 | Ga0070699_100053079 | 3300005518 | Bacteria | 3509 |
| 142 | Ga0070699_100081547 | 3300005518 | Bacteria | 2820 |
| 143 | Ga0070699_100571562 | 3300005518 | Bacteria | 1030 |
| 144 | Ga0070697_100000864 | 3300005536 | Bacteria | 22790 |
| 145 | Ga0070697_100014825 | 3300005536 | Bacteria | 6117 |
| 146 | Ga0070697_100034248 | 3300005536 | Bacteria | 4094 |
| 147 | Ga0070697_100059774 | 3300005536 | Bacteria | 3105 |
| 148 | Ga0070697_100106012 | 3300005536 | Bacteria | 2338 |
| 149 | Ga0070697_100125384 | 3300005536 | Bacteria | 2151 |
| 150 | Ga0070672_100257353 | 3300005543 | Unclassified | 1471 |
| 151 | Ga0070686_100365828 | 3300005544 | Bacteria | 1088 |
| 152 | Ga0070695_100247210 | 3300005545 | Bacteria | 1297 |
| 153 | Ga0070696_100019431 | 3300005546 | Bacteria | 4600 |
| 154 | Ga0070693_100032597 | 3300005547 | Bacteria | 2867 |
| 155 | Ga0070693_100065965 | 3300005547 | Bacteria | 2117 |
| 156 | Ga0070665_100015082 | 3300005548 | Bacteria | 7758 |
| 157 | Ga0070665_100082041 | 3300005548 | Bacteria | 3230 |
| 158 | Ga0070665_100534849 | 3300005548 | Bacteria | 1184 |
| 159 | Ga0070704_100104116 | 3300005549 | Bacteria | 2145 |
| 160 | Ga0070704_100590672 | 3300005549 | Bacteria | 975 |
| 161 | Ga0068855_100284817 | 3300005563 | Bacteria | 1834 |
| 162 | Ga0070664_100034729 | 3300005564 | Bacteria | 4230 |
| 163 | Ga0070664_100121132 | 3300005564 | Bacteria | 2291 |
| 164 | Ga0068857_100024479 | 3300005577 | Bacteria | 5315 |
| 165 | Ga0068857_100045416 | 3300005577 | Bacteria | 3897 |
| 166 | Ga0068856_100098320 | 3300005614 | Bacteria | 2917 |
| 167 | Ga0068864_100004008 | 3300005618 | Bacteria | 12122 |
| 168 | Ga0068864_100136132 | 3300005618 | Bacteria | 2212 |
| 169 | Ga0068866_10001325 | 3300005718 | Bacteria | 10735 |
| 170 | Ga0068866_10020991 | 3300005718 | Unclassified | 3001 |
| 171 | Ga0068861_100365955 | 3300005719 | Bacteria | 1269 |
| 172 | Ga0068851_10162477 | 3300005834 | Bacteria | 1228 |
| 173 | Ga0068863_100355700 | 3300005841 | Bacteria | 1427 |
| 174 | Ga0068858_100326799 | 3300005842 | Bacteria | 1466 |
| 175 | Ga0068860_100034420 | 3300005843 | Bacteria | 4858 |
| 176 | Ga0068860_100045927 | 3300005843 | Bacteria | 4165 |
| 177 | Ga0068860_100210927 | 3300005843 | Bacteria | 1884 |
| 178 | Ga0068860_100237405 | 3300005843 | Bacteria | 1773 |
| 179 | Ga0068862_100164337 | 3300005844 | Bacteria | 1983 |
| 180 | Ga0081540_1000680 | 3300005983 | Bacteria | 31845 |
| 181 | Ga0081540_1010594 | 3300005983 | Bacteria | 6227 |
| 182 | Ga0081540_1017919 | 3300005983 | Bacteria | 4363 |
| 183 | Ga0081540_1054101 | 3300005983 | Bacteria | 1963 |
| 184 | Ga0081539_10001803 | 3300005985 | Bacteria | 33905 |
| 185 | Ga0081539_10010323 | 3300005985 | Bacteria | 7603 |
| 186 | Ga0070717_10000276 | 3300006028 | Bacteria | 35106 |
| 187 | Ga0070717_10011143 | 3300006028 | Bacteria | 6814 |
| 188 | Ga0070717_10014925 | 3300006028 | Bacteria | 5983 |
| 189 | Ga0070717_10049437 | 3300006028 | Bacteria | 3452 |
| 190 | Ga0070717_10062190 | 3300006028 | Bacteria | 3096 |
| 191 | Ga0070717_10067865 | 3300006028 | Bacteria | 2968 |
| 192 | Ga0070717_10108306 | 3300006028 | Bacteria | 2367 |
| 193 | Ga0070717_10131270 | 3300006028 | Bacteria | 2154 |
| 194 | Ga0070717_10132137 | 3300006028 | Bacteria | 2147 |
| 195 | Ga0070717_10302874 | 3300006028 | Unclassified | 1421 |
| 196 | Ga0075363_100129953 | 3300006048 | Bacteria | 1412 |
| 197 | Ga0075364_10225877 | 3300006051 | Bacteria | 1271 |
| 198 | Ga0070715_10051077 | 3300006163 | Unclassified | 1777 |
| 199 | Ga0070715_10092803 | 3300006163 | Bacteria | 1392 |
| 200 | Ga0070716_100008462 | 3300006173 | Bacteria | 5103 |
| 201 | Ga0070716_100012164 | 3300006173 | Bacteria | 4355 |
| 202 | Ga0070716_100183860 | 3300006173 | Bacteria | 1375 |
| 203 | Ga0070712_100106005 | 3300006175 | Unclassified | 2088 |
| 204 | Ga0070712_100110158 | 3300006175 | Viruses | 2053 |
| 205 | Ga0070712_100133950 | 3300006175 | Bacteria | 1882 |
| 206 | Ga0070712_100147462 | 3300006175 | Bacteria | 1802 |
| 207 | Ga0070712_100244290 | 3300006175 | Unclassified | 1431 |
| 208 | Ga0075366_10029620 | 3300006195 | Bacteria | 3216 |
| 209 | Ga0097621_100056546 | 3300006237 | Bacteria | 3205 |
| 210 | Ga0097621_100075706 | 3300006237 | Bacteria | 2790 |
| 211 | Ga0097621_100139634 | 3300006237 | Bacteria | 2070 |
| 212 | Ga0097621_100345426 | 3300006237 | Bacteria | 1322 |
| 213 | Ga0075370_10006364 | 3300006353 | Bacteria | 5930 |
| 214 | Ga0075428_100001399 | 3300006844 | Bacteria | 25667 |
| 215 | Ga0075431_100577188 | 3300006847 | Bacteria | 1110 |
| 216 | Ga0075433_10059120 | 3300006852 | Bacteria | 3354 |
| 217 | Ga0075434_100000027 | 3300006871 | Bacteria | 66092 |
| 218 | Ga0075434_100017778 | 3300006871 | Bacteria | 6857 |
| 219 | Ga0075434_100576153 | 3300006871 | Unclassified | 1145 |
| 220 | Ga0068865_100093779 | 3300006881 | Bacteria | 2183 |
| 221 | Ga0068865_100103873 | 3300006881 | Unclassified | 2085 |
| 222 | Ga0068865_100312584 | 3300006881 | Unclassified | 1261 |
| 223 | Ga0068865_100440655 | 3300006881 | Bacteria | 1075 |
| 224 | Ga0075436_100023957 | 3300006914 | Bacteria | 4194 |
| 225 | Ga0075436_100034118 | 3300006914 | Unclassified | 3508 |
| 226 | Ga0075436_100128712 | 3300006914 | Bacteria | 1775 |
| 227 | Ga0075435_100002921 | 3300007076 | Bacteria | 11474 |
| 228 | Ga0105240_10032931 | 3300009093 | Bacteria | 6702 |
| 229 | Ga0111539_10000142 | 3300009094 | Bacteria | 82331 |
| 230 | Ga0111539_10001188 | 3300009094 | Bacteria | 34610 |
| 231 | Ga0105245_10009889 | 3300009098 | Bacteria | 8306 |
| 232 | Ga0105245_10091781 | 3300009098 | Bacteria | 2796 |
| 233 | Ga0105247_10053586 | 3300009101 | Bacteria | 2488 |
| 234 | Ga0105247_10123989 | 3300009101 | Bacteria | 1677 |
| 235 | Ga0105247_10355902 | 3300009101 | Bacteria | 1031 |
| 236 | Ga0105247_10382436 | 3300009101 | Unclassified | 998 |
| 237 | Ga0114129_10025353 | 3300009147 | Bacteria | 8402 |
| 238 | Ga0114129_11093987 | 3300009147 | Bacteria | 998 |
| 239 | Ga0105243_10002948 | 3300009148 | Bacteria | 14067 |
| 240 | Ga0105243_10041231 | 3300009148 | Bacteria | 3610 |
| 241 | Ga0105243_10293924 | 3300009148 | Bacteria | 1469 |
| 242 | Ga0105241_10059964 | 3300009174 | Bacteria | 2927 |
| 243 | Ga0105241_10305350 | 3300009174 | Bacteria | 1367 |
| 244 | Ga0105242_10091768 | 3300009176 | Bacteria | 2557 |
| 245 | Ga0105242_10306136 | 3300009176 | Bacteria | 1452 |
| 246 | Ga0105248_10369954 | 3300009177 | Bacteria | 1614 |
| 247 | Ga0105248_10811596 | 3300009177 | Bacteria | 1056 |
| 248 | Ga0105237_10259734 | 3300009545 | Bacteria | 1739 |
| 249 | Ga0105249_10042633 | 3300009553 | Bacteria | 4129 |
| 250 | Ga0105249_10155919 | 3300009553 | Bacteria | 2202 |
| 251 | Ga0105239_10169553 | 3300010375 | Bacteria | 2441 |
| 252 | Ga0105246_10010181 | 3300011119 | Bacteria | 5807 |
| 253 | Ga0105246_10085605 | 3300011119 | Bacteria | 2258 |
| 254 | Ga0105246_10122293 | 3300011119 | Bacteria | 1931 |
| 255 | Ga0105246_10211544 | 3300011119 | Bacteria | 1514 |
| 256 | Ga0157339_1005559 | 3300012505 | Bacteria | 999 |
| 257 | Ga0157371_10023899 | 3300013102 | Bacteria | 4466 |
| 258 | Ga0157370_10077577 | 3300013104 | Bacteria | 3129 |
| 259 | Ga0157369_10062753 | 3300013105 | Bacteria | 4003 |
| 260 | Ga0157369_10145981 | 3300013105 | Bacteria | 2501 |
| 261 | Ga0157374_10021611 | 3300013296 | Bacteria | 5729 |
| 262 | Ga0157374_10051903 | 3300013296 | Bacteria | 3817 |
| 263 | Ga0157374_10187787 | 3300013296 | Unclassified | 2021 |
| 264 | Ga0157374_10209596 | 3300013296 | Bacteria | 1910 |
| 265 | Ga0157374_10382633 | 3300013296 | Unclassified | 1402 |
| 266 | Ga0157378_10066130 | 3300013297 | Bacteria | 3237 |
| 267 | Ga0157378_10204054 | 3300013297 | Bacteria | 1871 |
| 268 | Ga0157378_10289776 | 3300013297 | Unclassified | 1581 |
| 269 | Ga0157378_10290230 | 3300013297 | Bacteria | 1580 |
| 270 | Ga0157378_10364266 | 3300013297 | Unclassified | 1415 |
| 271 | Ga0163162_10006856 | 3300013306 | Bacteria | 11053 |
| 272 | Ga0163162_10120156 | 3300013306 | Unclassified | 2731 |
| 273 | Ga0163162_10182340 | 3300013306 | Unclassified | 2226 |
| 274 | Ga0157372_10109884 | 3300013307 | Bacteria | 3158 |
| 275 | Ga0157372_10173533 | 3300013307 | Unclassified | 2495 |
| 276 | Ga0157375_10009570 | 3300013308 | Bacteria | 8509 |
| 277 | Ga0157375_10020888 | 3300013308 | Bacteria | 5993 |
| 278 | Ga0157375_10071760 | 3300013308 | Bacteria | 3477 |
| 279 | Ga0157375_10113467 | 3300013308 | Bacteria | 2811 |
| 280 | Ga0157375_10159861 | 3300013308 | Bacteria | 2394 |
| 281 | Ga0157375_10275190 | 3300013308 | Bacteria | 1846 |
| 282 | Ga0157375_10432016 | 3300013308 | Bacteria | 1483 |
| 283 | Ga0157380_10176111 | 3300014326 | Bacteria | 1874 |
| 284 | Ga0157380_10316381 | 3300014326 | Bacteria | 1445 |
| 285 | Ga0182008_10059847 | 3300014497 | Bacteria | 1879 |
| 286 | Ga0157377_10011279 | 3300014745 | Bacteria | 4454 |
| 287 | Ga0157376_10005495 | 3300014969 | Bacteria | 8863 |
| 288 | Ga0157376_10072280 | 3300014969 | Bacteria | 2934 |
| 289 | Ga0157376_10096957 | 3300014969 | Unclassified | 2567 |
| 290 | Ga0157376_10167328 | 3300014969 | Bacteria | 1998 |
| 291 | Ga0157376_10215775 | 3300014969 | Bacteria | 1774 |
| 292 | Ga0206353_11242101 | 3300020082 | Bacteria | 1106 |
| 293 | Ga0213875_10000161 | 3300021388 | Bacteria | 70921 |
| 294 | Ga0213875_10000430 | 3300021388 | Bacteria | 36686 |
| 295 | Ga0213875_10008796 | 3300021388 | Bacteria | 5154 |
| 296 | Ga0213875_10011382 | 3300021388 | Bacteria | 4425 |
| 297 | Ga0213875_10052293 | 3300021388 | Bacteria | 1913 |
| 298 | Ga0224712_10065271 | 3300022467 | Bacteria | 1462 |
| 299 | Ga0224572_1001881 | 3300024225 | Bacteria | 3247 |
| 300 | Ga0207697_10003375 | 3300025315 | Bacteria | 7928 |
| 301 | Ga0207697_10009260 | 3300025315 | Unclassified | 4260 |
| 302 | Ga0207653_10020981 | 3300025885 | Bacteria | 2070 |
| 303 | Ga0207682_10005997 | 3300025893 | Bacteria | 4913 |
| 304 | Ga0207692_10011002 | 3300025898 | Bacteria | 3830 |
| 305 | Ga0207692_10092092 | 3300025898 | Bacteria | 1646 |
| 306 | Ga0207642_10005335 | 3300025899 | Bacteria | 4188 |
| 307 | Ga0207642_10010979 | 3300025899 | Bacteria | 3215 |
| 308 | Ga0207642_10011400 | 3300025899 | Bacteria | 3170 |
| 309 | Ga0207688_10019390 | 3300025901 | Bacteria | 3705 |
| 310 | Ga0207688_10068767 | 3300025901 | Bacteria | 2006 |
| 311 | Ga0207688_10092268 | 3300025901 | Bacteria | 1740 |
| 312 | Ga0207647_10102289 | 3300025904 | Bacteria | 1699 |
| 313 | Ga0207685_10067931 | 3300025905 | Bacteria | 1435 |
| 314 | Ga0207699_10003295 | 3300025906 | Bacteria | 7696 |
| 315 | Ga0207699_10018141 | 3300025906 | Bacteria | 3724 |
| 316 | Ga0207699_10096587 | 3300025906 | Bacteria | 1866 |
| 317 | Ga0207699_10101031 | 3300025906 | Bacteria | 1830 |
| 318 | Ga0207699_10101420 | 3300025906 | Bacteria | 1827 |
| 319 | Ga0207699_10230544 | 3300025906 | Bacteria | 1268 |
| 320 | Ga0207645_10001195 | 3300025907 | Bacteria | 21426 |
| 321 | Ga0207645_10008101 | 3300025907 | Bacteria | 7364 |
| 322 | Ga0207645_10133369 | 3300025907 | Bacteria | 1617 |
| 323 | Ga0207684_10001427 | 3300025910 | Bacteria | 25824 |
| 324 | Ga0207684_10003607 | 3300025910 | Bacteria | 15065 |
| 325 | Ga0207684_10003609 | 3300025910 | Bacteria | 15062 |
| 326 | Ga0207684_10018497 | 3300025910 | Bacteria | 5965 |
| 327 | Ga0207684_10021475 | 3300025910 | Bacteria | 5513 |
| 328 | Ga0207684_10029182 | 3300025910 | Bacteria | 4699 |
| 329 | Ga0207684_10031140 | 3300025910 | Bacteria | 4540 |
| 330 | Ga0207684_10042914 | 3300025910 | Bacteria | 3834 |
| 331 | Ga0207684_10055362 | 3300025910 | Bacteria | 3365 |
| 332 | Ga0207684_10071976 | 3300025910 | Bacteria | 2937 |
| 333 | Ga0207684_10073373 | 3300025910 | Bacteria | 2906 |
| 334 | Ga0207684_10096163 | 3300025910 | Bacteria | 2528 |
| 335 | Ga0207684_10170376 | 3300025910 | Bacteria | 1877 |
| 336 | Ga0207684_10411397 | 3300025910 | Bacteria | 1162 |
| 337 | Ga0207654_10266082 | 3300025911 | Bacteria | 1155 |
| 338 | Ga0207654_10297646 | 3300025911 | Bacteria | 1096 |
| 339 | Ga0207695_10000367 | 3300025913 | Bacteria | 103313 |
| 340 | Ga0207693_10019037 | 3300025915 | Bacteria | 5465 |
| 341 | Ga0207693_10032529 | 3300025915 | Bacteria | 4116 |
| 342 | Ga0207693_10032645 | 3300025915 | Bacteria | 4108 |
| 343 | Ga0207693_10034954 | 3300025915 | Bacteria | 3964 |
| 344 | Ga0207693_10040739 | 3300025915 | Bacteria | 3658 |
| 345 | Ga0207693_10045562 | 3300025915 | Bacteria | 3446 |
| 346 | Ga0207693_10073622 | 3300025915 | Bacteria | 2674 |
| 347 | Ga0207693_10158359 | 3300025915 | Bacteria | 1781 |
| 348 | Ga0207693_10306126 | 3300025915 | Bacteria | 1244 |
| 349 | Ga0207693_10437752 | 3300025915 | Bacteria | 1022 |
| 350 | Ga0207663_10013879 | 3300025916 | Unclassified | 4394 |
| 351 | Ga0207663_10022992 | 3300025916 | Bacteria | 3571 |
| 352 | Ga0207663_10035586 | 3300025916 | Bacteria | 2989 |
| 353 | Ga0207663_10043772 | 3300025916 | Bacteria | 2744 |
| 354 | Ga0207663_10117928 | 3300025916 | Bacteria | 1812 |
| 355 | Ga0207663_10165100 | 3300025916 | Bacteria | 1567 |
| 356 | Ga0207663_10407972 | 3300025916 | Bacteria | 1040 |
| 357 | Ga0207662_10005631 | 3300025918 | Bacteria | 6698 |
| 358 | Ga0207657_10014926 | 3300025919 | Bacteria | 7552 |
| 359 | Ga0207652_10154099 | 3300025921 | Bacteria | 2058 |
| 360 | Ga0207646_10000500 | 3300025922 | Bacteria | 52535 |
| 361 | Ga0207646_10000720 | 3300025922 | Bacteria | 42935 |
| 362 | Ga0207646_10010409 | 3300025922 | Bacteria | 9094 |
| 363 | Ga0207646_10015896 | 3300025922 | Bacteria | 7078 |
| 364 | Ga0207646_10032704 | 3300025922 | Bacteria | 4706 |
| 365 | Ga0207646_10043933 | 3300025922 | Bacteria | 4011 |
| 366 | Ga0207646_10050681 | 3300025922 | Unclassified | 3714 |
| 367 | Ga0207646_10051406 | 3300025922 | Bacteria | 3688 |
| 368 | Ga0207646_10085444 | 3300025922 | Bacteria | 2823 |
| 369 | Ga0207646_10117312 | 3300025922 | Bacteria | 2390 |
| 370 | Ga0207646_10208214 | 3300025922 | Bacteria | 1766 |
| 371 | Ga0207646_10258714 | 3300025922 | Bacteria | 1573 |
| 372 | Ga0207646_10288605 | 3300025922 | Bacteria | 1482 |
| 373 | Ga0207646_10330786 | 3300025922 | Unclassified | 1376 |
| 374 | Ga0207646_10390498 | 3300025922 | Bacteria | 1257 |
| 375 | Ga0207681_10029936 | 3300025923 | Bacteria | 3544 |
| 376 | Ga0207681_10035546 | 3300025923 | Bacteria | 3283 |
| 377 | Ga0207681_10418013 | 3300025923 | Bacteria | 1086 |
| 378 | Ga0207694_10210860 | 3300025924 | Bacteria | 1582 |
| 379 | Ga0207694_10212939 | 3300025924 | Bacteria | 1574 |
| 380 | Ga0207650_10010520 | 3300025925 | Bacteria | 6346 |
| 381 | Ga0207650_10103744 | 3300025925 | Bacteria | 2193 |
| 382 | Ga0207659_10003972 | 3300025926 | Bacteria | 8924 |
| 383 | Ga0207659_10018978 | 3300025926 | Bacteria | 4517 |
| 384 | Ga0207687_10024492 | 3300025927 | Bacteria | 4033 |
| 385 | Ga0207700_10014837 | 3300025928 | Bacteria | 5118 |
| 386 | Ga0207700_10020475 | 3300025928 | Bacteria | 4494 |
| 387 | Ga0207700_10057736 | 3300025928 | Bacteria | 2928 |
| 388 | Ga0207700_10176627 | 3300025928 | Bacteria | 1785 |
| 389 | Ga0207700_10381027 | 3300025928 | Bacteria | 1233 |
| 390 | Ga0207664_10002054 | 3300025929 | Bacteria | 13257 |
| 391 | Ga0207664_10022236 | 3300025929 | Bacteria | 4732 |
| 392 | Ga0207664_10063960 | 3300025929 | Bacteria | 2941 |
| 393 | Ga0207664_10195071 | 3300025929 | Bacteria | 1745 |
| 394 | Ga0207664_10195275 | 3300025929 | Bacteria | 1744 |
| 395 | Ga0207664_10278881 | 3300025929 | Bacteria | 1466 |
| 396 | Ga0207644_10019425 | 3300025931 | Bacteria | 4610 |
| 397 | Ga0207644_10024337 | 3300025931 | Bacteria | 4155 |
| 398 | Ga0207644_10066061 | 3300025931 | Bacteria | 2632 |
| 399 | Ga0207706_10000385 | 3300025933 | Bacteria | 48316 |
| 400 | Ga0207706_10017316 | 3300025933 | Bacteria | 6491 |
| 401 | Ga0207706_10336880 | 3300025933 | Bacteria | 1312 |
| 402 | Ga0207686_10000813 | 3300025934 | Bacteria | 19071 |
| 403 | Ga0207709_10034174 | 3300025935 | Bacteria | 2994 |
| 404 | Ga0207709_10041983 | 3300025935 | Bacteria | 2748 |
| 405 | Ga0207709_10327176 | 3300025935 | Bacteria | 1149 |
| 406 | Ga0207670_10192061 | 3300025936 | Unclassified | 1546 |
| 407 | Ga0207669_10139019 | 3300025937 | Unclassified | 1683 |
| 408 | Ga0207704_10001474 | 3300025938 | Bacteria | 10534 |
| 409 | Ga0207665_10002532 | 3300025939 | Bacteria | 12296 |
| 410 | Ga0207665_10004802 | 3300025939 | Bacteria | 9000 |
| 411 | Ga0207665_10006521 | 3300025939 | Bacteria | 7739 |
| 412 | Ga0207665_10014471 | 3300025939 | Bacteria | 5195 |
| 413 | Ga0207665_10018068 | 3300025939 | Bacteria | 4633 |
| 414 | Ga0207691_10031070 | 3300025940 | Bacteria | 4989 |
| 415 | Ga0207691_10284165 | 3300025940 | Bacteria | 1423 |
| 416 | Ga0207711_10004715 | 3300025941 | Bacteria | 11588 |
| 417 | Ga0207711_10140475 | 3300025941 | Bacteria | 2172 |
| 418 | Ga0207689_10014360 | 3300025942 | Bacteria | 6737 |
| 419 | Ga0207679_10126238 | 3300025945 | Bacteria | 2045 |
| 420 | Ga0207667_10341663 | 3300025949 | Bacteria | 1528 |
| 421 | Ga0207667_10507860 | 3300025949 | Bacteria | 1222 |
| 422 | Ga0207651_10006405 | 3300025960 | Bacteria | 6159 |
| 423 | Ga0207651_10220093 | 3300025960 | Unclassified | 1534 |
| 424 | Ga0207651_10221975 | 3300025960 | Bacteria | 1528 |
| 425 | Ga0207712_10001825 | 3300025961 | Bacteria | 14058 |
| 426 | Ga0207668_10295859 | 3300025972 | Bacteria | 1334 |
| 427 | Ga0207640_10001949 | 3300025981 | Bacteria | 11104 |
| 428 | Ga0207658_10019791 | 3300025986 | Bacteria | 4657 |
| 429 | Ga0207658_10130347 | 3300025986 | Bacteria | 2019 |
| 430 | Ga0207677_10023157 | 3300026023 | Bacteria | 3830 |
| 431 | Ga0207677_10079665 | 3300026023 | Bacteria | 2343 |
| 432 | Ga0207677_10271382 | 3300026023 | Bacteria | 1388 |
| 433 | Ga0207703_10042880 | 3300026035 | Bacteria | 3630 |
| 434 | Ga0207703_10080595 | 3300026035 | Bacteria | 2711 |
| 435 | Ga0207639_10077900 | 3300026041 | Bacteria | 2614 |
| 436 | Ga0207678_10022270 | 3300026067 | Bacteria | 5551 |
| 437 | Ga0207678_10065953 | 3300026067 | Bacteria | 3108 |
| 438 | Ga0207678_10334789 | 3300026067 | Bacteria | 1303 |
| 439 | Ga0207708_10009550 | 3300026075 | Bacteria | 7192 |
| 440 | Ga0207708_10082790 | 3300026075 | Bacteria | 2467 |
| 441 | Ga0207702_10090610 | 3300026078 | Bacteria | 2676 |
| 442 | Ga0207702_10552771 | 3300026078 | Bacteria | 1126 |
| 443 | Ga0207641_10195902 | 3300026088 | Bacteria | 1860 |
| 444 | Ga0207648_10000933 | 3300026089 | Bacteria | 32938 |
| 445 | Ga0207648_10420736 | 3300026089 | Bacteria | 1213 |
| 446 | Ga0207676_10117148 | 3300026095 | Bacteria | 2240 |
| 447 | Ga0207676_10262688 | 3300026095 | Bacteria | 1559 |
| 448 | Ga0207674_10016165 | 3300026116 | Bacteria | 8174 |
| 449 | Ga0207674_10024239 | 3300026116 | Bacteria | 6486 |
| 450 | Ga0207674_10389274 | 3300026116 | Bacteria | 1348 |
| 451 | Ga0207674_10551061 | 3300026116 | Bacteria | 1114 |
| 452 | Ga0207675_100004845 | 3300026118 | Bacteria | 12964 |
| 453 | Ga0207675_100019282 | 3300026118 | Bacteria | 6363 |
| 454 | Ga0207683_10008233 | 3300026121 | Bacteria | 8921 |
| 455 | Ga0207683_10008240 | 3300026121 | Bacteria | 8914 |
| 456 | Ga0207683_10111308 | 3300026121 | Bacteria | 2452 |
| 457 | Ga0207698_10200776 | 3300026142 | Bacteria | 1785 |
| 458 | Ga0209966_1017342 | 3300027695 | Bacteria | 1372 |
| 459 | Ga0209974_10005164 | 3300027876 | Bacteria | 4609 |
| 460 | Ga0207428_10025616 | 3300027907 | Bacteria | 4935 |
| 461 | Ga0268266_10023177 | 3300028379 | Bacteria | 5286 |
| 462 | Ga0268265_10032167 | 3300028380 | Bacteria | 3797 |
| 463 | Ga0268264_10003023 | 3300028381 | Bacteria | 14581 |
| 464 | Ga0268264_10049148 | 3300028381 | Bacteria | 3508 |
| 465 | Ga0265338_10004729 | 3300028800 | Bacteria | 18217 |
| 466 | Ga0265338_10076772 | 3300028800 | Bacteria | 2827 |
| 467 | Ga0265320_10096491 | 3300031240 | Bacteria | 1365 |
| 468 | Ga0265325_10056241 | 3300031241 | Bacteria | 2010 |
| 469 | Ga0265327_10000051 | 3300031251 | Bacteria | 257963 |
| 470 | Ga0265316_10041193 | 3300031344 | Bacteria | 3698 |
| 471 | Ga0307408_100025233 | 3300031548 | Bacteria | 4070 |
| 472 | Ga0265313_10017695 | 3300031595 | Bacteria | 4034 |
| 473 | Ga0265313_10092206 | 3300031595 | Bacteria | 1358 |
| 474 | Ga0265314_10032196 | 3300031711 | Bacteria | 3859 |
| 475 | Ga0307413_10081501 | 3300031824 | Bacteria | 2075 |
| 476 | Ga0307410_10019286 | 3300031852 | Bacteria | 4144 |
| 477 | Ga0307406_10321339 | 3300031901 | Bacteria | 1197 |
| 478 | Ga0307412_10034041 | 3300031911 | Bacteria | 3244 |
| 479 | Ga0307409_100061308 | 3300031995 | Bacteria | 2939 |
| 480 | Ga0307416_100034451 | 3300032002 | Bacteria | 3853 |
| 481 | Ga0307416_100059496 | 3300032002 | Bacteria | 3105 |
| 482 | Ga0307416_100075133 | 3300032002 | Bacteria | 2827 |
| 483 | Ga0307414_10096330 | 3300032004 | Bacteria | 2214 |
| 484 | Ga0307411_10059620 | 3300032005 | Bacteria | 2531 |
| 485 | Ga0307415_100005478 | 3300032126 | Bacteria | 6744 |
| 486 | Ga0373926_0004261 | 3300035083 | Bacteria | 4678 |
| 487 | Ga0373926_0023065 | 3300035083 | Bacteria | 2159 |
| 488 | Ga0373934_0016770 | 3300035086 | Bacteria | 2787 |
| 489 | Ga0373934_0035310 | 3300035086 | Bacteria | 1966 |
| 490 | Ga0373944_0002100 | 3300035089 | Bacteria | 5061 |
| 491 | Ga0373944_0023041 | 3300035089 | Bacteria | 1813 |
| 492 | Ga0373944_0072904 | 3300035089 | Bacteria | 1122 |
| 493 | Ga0373923_0002444 | 3300035111 | Bacteria | 5721 |
| 494 | Ga0373923_0020254 | 3300035111 | Bacteria | 2582 |
| 495 | Ga0373936_0000581 | 3300035113 | Bacteria | 12597 |
| 496 | Ga0373936_0001452 | 3300035113 | Bacteria | 8601 |
| 497 | Ga0373936_0002799 | 3300035113 | Bacteria | 6500 |
| 498 | Ga0373936_0017010 | 3300035113 | Bacteria | 2797 |
| 499 | Ga0373936_0028068 | 3300035113 | Bacteria | 2211 |
| 500 | Ga0373945_0001920 | 3300035116 | Bacteria | 6448 |
| 501 | Ga0373954_0004908 | 3300035118 | Bacteria | 5774 |
| 502 | Ga0373954_0029961 | 3300035118 | Bacteria | 2509 |
| 503 | Ga0373954_0158448 | 3300035118 | Bacteria | 1107 |
| 504 | Ga0373956_0005191 | 3300035119 | Bacteria | 5216 |
| 505 | Ga0373956_0008865 | 3300035119 | Bacteria | 4076 |
| 506 | Ga0373956_0033556 | 3300035119 | Bacteria | 2257 |
| 507 | Ga0373957_0013147 | 3300035120 | Bacteria | 2802 |
| 508 | Ga0373957_0027339 | 3300035120 | Bacteria | 2072 |
| 509 | Ga0373943_0000150 | 3300035170 | Bacteria | 26925 |
| 510 | Ga0373943_0013539 | 3300035170 | Bacteria | 3684 |
| 511 | Ga0373943_0038374 | 3300035170 | Bacteria | 2302 |
| 512 | Ga0373946_0000289 | 3300035171 | Bacteria | 16200 |
| 513 | Ga0373946_0000522 | 3300035171 | Bacteria | 12736 |
| 514 | Ga0373946_0044171 | 3300035171 | Bacteria | 1839 |
| 515 | Ga0373955_0046416 | 3300035172 | Bacteria | 2348 |
| 516 | Ga0316574_0063221 | 3300035398 | Bacteria | 2327 |
| 517 | Ga0316574_0330092 | 3300035398 | Unclassified | 967 |
| 518 | Ga0373924_0001686 | 3300035410 | Bacteria | 7277 |
| 519 | Ga0373924_0027279 | 3300035410 | Bacteria | 2270 |
| 520 | Ga0373924_0043036 | 3300035410 | Bacteria | 1854 |
| 521 | Ga0373924_0111743 | 3300035410 | Bacteria | 1181 |
| 522 | Ga0373931_0034787 | 3300035691 | Bacteria | 2616 |
| 523 | Ga0373931_0063176 | 3300035691 | Bacteria | 2001 |
| 524 | Ga0373935_0004988 | 3300035692 | Bacteria | 7812 |
| 525 | Ga0373935_0028214 | 3300035692 | Bacteria | 3469 |
| 526 | Ga0373935_0066842 | 3300035692 | Bacteria | 2310 |
| 527 | Ga0373935_0092436 | 3300035692 | Bacteria | 1982 |
| 528 | Ga0373935_0131996 | 3300035692 | Bacteria | 1679 |
| 529 | Ga0373935_0136007 | 3300035692 | Bacteria | 1656 |
| 530 | Ga0373927_0015021 | 3300035695 | Bacteria | 5121 |
| 531 | Ga0373927_0064527 | 3300035695 | Bacteria | 2369 |
| 532 | Ga0373933_0018855 | 3300035724 | Bacteria | 3886 |
| 533 | Ga0373933_0037900 | 3300035724 | Bacteria | 2830 |
| 534 | Ga0373933_0072989 | 3300035724 | Bacteria | 2090 |
| 535 | Ga0373933_0270824 | 3300035724 | Bacteria | 1096 |
| 536 | Ga0373947_0000012 | 3300035725 | Bacteria | 155188 |
| 537 | Ga0373947_0000160 | 3300035725 | Bacteria | 35837 |
| 538 | Ga0373947_0002086 | 3300035725 | Bacteria | 12203 |
| 539 | Ga0373947_0013982 | 3300035725 | Bacteria | 4601 |
| 540 | Ga0373937_0048253 | 3300036401 | Bacteria | 3897 |
| 541 | Ga0373937_0063380 | 3300036401 | Bacteria | 3399 |
| 542 | Ga0373937_0069210 | 3300036401 | Bacteria | 3253 |
| 543 | Ga0373937_0164610 | 3300036401 | Bacteria | 2079 |
| 544 | Ga0373937_0186686 | 3300036401 | Bacteria | 1947 |
| 545 | Ga0373937_0227613 | 3300036401 | Bacteria | 1755 |
| 546 | Ga0373937_0331458 | 3300036401 | Bacteria | 1440 |
| 547 | Ga0373937_0442724 | 3300036401 | Bacteria | 1233 |
| 548 | Ga0373925_0001574 | 3300037068 | Bacteria | 19299 |
| 549 | Ga0373925_0028061 | 3300037068 | Bacteria | 4122 |
| 550 | Ga0373925_0061501 | 3300037068 | Bacteria | 2821 |
| 551 | Ga0373925_0189938 | 3300037068 | Bacteria | 1629 |
| 552 | Ga0373925_0449967 | 3300037068 | Bacteria | 1054 |
| 553 | Ga0395899_0041455 | 3300037312 | Bacteria | 3440 |
| 554 | Ga0395900_0052844 | 3300037418 | Bacteria | 4182 |
| 555 | Ga0395898_0109542 | 3300037466 | Bacteria | 2647 |
| 556 | Ga0395905_0012512 | 3300037471 | Bacteria | 8166 |
| 557 | Ga0436364_0028100 | 3300037853 | Bacteria | 1757 |
| 558 | Ga0436364_0081322 | 3300037853 | Bacteria | 2253 |
| 559 | Ga0436364_0097537 | 3300037853 | Bacteria | 2370 |
| 560 | Ga0436364_0408959 | 3300037853 | Unclassified | 1464 |
| 561 | Ga0436364_0531667 | 3300037853 | Bacteria | 70971 |
| 562 | Ga0436364_0759698 | 3300037853 | Bacteria | 12534 |
| 563 | Ga0436364_1016447 | 3300037853 | Bacteria | 3760 |
| 564 | Ga0436364_1115616 | 3300037853 | Bacteria | 49992 |
| 565 | Ga0395901_0035108 | 3300038443 | Bacteria | 5181 |
| 566 | Ga0395901_0201684 | 3300038443 | Bacteria | 2085 |
| 567 | Ga0400483_280984 | 3300039062 | Bacteria | 1256 |
| 568 | Ga0436365_1179117 | 3300039437 | Unclassified | 1160 |
| 569 | Ga0436363_0923158 | 3300039450 | Bacteria | 1723 |
| 570 | Ga0436363_1210241 | 3300039450 | Bacteria | 1850 |
| 571 | Ga0439461_0002693 | 3300041410 | Bacteria | 2866 |
| 572 | Ga0451793_0890117 | 3300041452 | Bacteria | 1476 |
| 573 | Ga0451807_0950863 | 3300041486 | Bacteria | 2780 |
| 574 | Ga0451853_1466257 | 3300041512 | Bacteria | 1915 |
| 575 | Ga0439446_0001266 | 3300042156 | Bacteria | 5678 |
| 576 | Ga0450908_007426 | 3300042184 | Bacteria | 2067 |
| 577 | Ga0439435_0000161 | 3300042436 | Bacteria | 9250 |
| 578 | Ga0439460_0021831 | 3300042461 | Bacteria | 1753 |
| 579 | Ga0451577_0474115 | 3300042876 | Bacteria | 1136 |
| 580 | Ga0466963_0045633 | 3300044694 | Bacteria | 2887 |
| 581 | Ga0466963_0167156 | 3300044694 | Bacteria | 1532 |
| 582 | Ga0466959_0057508 | 3300045049 | Bacteria | 2835 |
| 583 | Ga0466967_0178959 | 3300045976 | Bacteria | 1999 |
| 584 | Ga0466967_0408571 | 3300045976 | Bacteria | 1322 |
| 585 | Ga0495629_0001182 | 3300046459 | Bacteria | 20585 |
| 586 | Ga0495641_0028650 | 3300046461 | Bacteria | 2693 |
| 587 | Ga0495651_0024565 | 3300046462 | Bacteria | 4687 |
| 588 | Ga0495651_0056420 | 3300046462 | Bacteria | 3017 |
| 589 | Ga0495651_0076431 | 3300046462 | Bacteria | 2536 |
| 590 | Ga0495651_0080578 | 3300046462 | Bacteria | 2459 |
| 591 | Ga0495651_0098444 | 3300046462 | Bacteria | 2182 |
| 592 | Ga0495653_0008105 | 3300046463 | Bacteria | 8605 |
| 593 | Ga0495653_0039315 | 3300046463 | Bacteria | 3706 |
| 594 | Ga0495653_0080401 | 3300046463 | Bacteria | 2411 |
| 595 | Ga0495653_0109356 | 3300046463 | Bacteria | 1989 |
| 596 | Ga0495580_0025359 | 3300046472 | Bacteria | 4333 |
| 597 | Ga0495580_0072201 | 3300046472 | Unclassified | 2411 |
| 598 | Ga0495582_0010080 | 3300046473 | Bacteria | 5203 |
| 599 | Ga0495582_0020077 | 3300046473 | Bacteria | 3655 |
| 600 | Ga0495639_0004804 | 3300046475 | Bacteria | 5812 |
| 601 | Ga0495639_0035329 | 3300046475 | Bacteria | 2236 |
| 602 | Ga0495662_0001276 | 3300046476 | Bacteria | 12448 |
| 603 | Ga0495662_0025573 | 3300046476 | Bacteria | 2851 |
| 604 | Ga0495662_0053965 | 3300046476 | Bacteria | 1941 |
| 605 | Ga0495662_0164852 | 3300046476 | Bacteria | 1092 |
| 606 | Ga0495664_0001966 | 3300046477 | Bacteria | 10940 |
| 607 | Ga0495664_0007753 | 3300046477 | Bacteria | 5974 |
| 608 | Ga0495664_0028847 | 3300046477 | Bacteria | 3242 |
| 609 | Ga0495664_0037052 | 3300046477 | Bacteria | 2877 |
| 610 | Ga0495664_0043928 | 3300046477 | Bacteria | 2648 |
| 611 | Ga0495664_0076643 | 3300046477 | Bacteria | 2001 |
| 612 | Ga0495594_0012580 | 3300046499 | Bacteria | 4411 |
| 613 | Ga0495594_0037179 | 3300046499 | Bacteria | 2656 |
| 614 | Ga0495608_0003378 | 3300046511 | Bacteria | 11423 |
| 615 | Ga0495608_0007260 | 3300046511 | Bacteria | 7835 |
| 616 | Ga0495608_0048190 | 3300046511 | Bacteria | 2832 |
| 617 | Ga0495618_0038398 | 3300046514 | Bacteria | 3009 |
| 618 | Ga0495618_0107852 | 3300046514 | Bacteria | 1783 |
| 619 | Ga0495628_0042516 | 3300046516 | Bacteria | 3624 |
| 620 | Ga0495628_0087740 | 3300046516 | Bacteria | 2411 |
| 621 | Ga0495628_0145986 | 3300046516 | Bacteria | 1803 |
| 622 | Ga0495628_0285313 | 3300046516 | Bacteria | 1225 |
| 623 | Ga0495630_0003286 | 3300046517 | Bacteria | 11276 |
| 624 | Ga0495630_0018691 | 3300046517 | Bacteria | 5091 |
| 625 | Ga0495630_0074214 | 3300046517 | Bacteria | 2561 |
| 626 | Ga0495630_0111012 | 3300046517 | Bacteria | 2077 |
| 627 | Ga0495666_0034932 | 3300046526 | Bacteria | 2452 |
| 628 | Ga0495652_0038810 | 3300046529 | Bacteria | 4122 |
| 629 | Ga0495652_0046702 | 3300046529 | Bacteria | 3716 |
| 630 | Ga0495652_0120352 | 3300046529 | Bacteria | 2095 |
| 631 | Ga0495665_0000971 | 3300046531 | Bacteria | 15188 |
| 632 | Ga0495665_0015574 | 3300046531 | Bacteria | 4092 |
| 633 | Ga0495640_0066423 | 3300046533 | Bacteria | 2432 |
| 634 | Ga0495586_0011182 | 3300046535 | Bacteria | 4769 |
| 635 | Ga0495586_0082643 | 3300046535 | Bacteria | 1766 |
| 636 | Ga0495587_0005283 | 3300046536 | Bacteria | 8443 |
| 637 | Ga0495587_0023248 | 3300046536 | Bacteria | 3809 |
| 638 | Ga0495587_0166405 | 3300046536 | Bacteria | 1253 |
| 639 | Ga0495645_0003389 | 3300046543 | Bacteria | 10802 |
| 640 | Ga0495645_0005262 | 3300046543 | Bacteria | 8862 |
| 641 | Ga0495645_0019749 | 3300046543 | Bacteria | 4854 |
| 642 | Ga0495622_0040376 | 3300046557 | Bacteria | 2172 |
| 643 | Ga0495667_0022054 | 3300046559 | Bacteria | 4292 |
| 644 | Ga0495667_0040674 | 3300046559 | Bacteria | 3085 |
| 645 | Ga0495667_0049039 | 3300046559 | Bacteria | 2787 |
| 646 | Ga0495667_0087178 | 3300046559 | Bacteria | 2024 |
| 647 | Ga0495634_0002841 | 3300046642 | Bacteria | 14224 |
| 648 | Ga0495634_0024139 | 3300046642 | Bacteria | 4269 |
| 649 | Ga0495634_0087272 | 3300046642 | Bacteria | 2030 |
| 650 | Ga0495634_0170350 | 3300046642 | Bacteria | 1368 |
| 651 | Ga0495635_0000234 | 3300046663 | Bacteria | 35181 |
| 652 | Ga0495635_0014109 | 3300046663 | Bacteria | 5591 |
| 653 | Ga0495635_0052965 | 3300046663 | Bacteria | 2795 |
| 654 | Ga0495657_0004127 | 3300046675 | Bacteria | 11635 |
| 655 | Ga0495657_0004224 | 3300046675 | Bacteria | 11492 |
| 656 | Ga0495657_0036570 | 3300046675 | Bacteria | 3392 |
| 657 | Ga0495657_0088375 | 3300046675 | Bacteria | 1992 |
| 658 | Ga0495657_0096475 | 3300046675 | Bacteria | 1889 |
| 659 | Ga0495599_0011242 | 3300046678 | Bacteria | 5497 |
| 660 | Ga0495599_0023984 | 3300046678 | Bacteria | 3815 |
| 661 | Ga0495599_0114113 | 3300046678 | Bacteria | 1681 |
| 662 | Ga0495623_0022232 | 3300046679 | Bacteria | 4096 |
| 663 | Ga0495623_0057174 | 3300046679 | Bacteria | 2454 |
| 664 | Ga0495623_0059077 | 3300046679 | Bacteria | 2409 |
| 665 | Ga0495623_0061613 | 3300046679 | Bacteria | 2352 |
| 666 | Ga0495646_0046354 | 3300046680 | Bacteria | 2650 |
| 667 | Ga0495658_0002304 | 3300046683 | Bacteria | 9630 |
| 668 | Ga0495669_0034846 | 3300046684 | Bacteria | 2220 |
| 669 | Ga0495613_0043505 | 3300046689 | Bacteria | 3322 |
| 670 | Ga0495613_0130947 | 3300046689 | Bacteria | 1796 |
| 671 | Ga0495613_0325770 | 3300046689 | Bacteria | 1060 |
| 672 | Ga0495624_0004504 | 3300046690 | Bacteria | 10191 |
| 673 | Ga0495624_0049419 | 3300046690 | Bacteria | 2667 |
| 674 | Ga0495624_0100323 | 3300046690 | Bacteria | 1783 |
| 675 | Ga0495600_0005859 | 3300046809 | Bacteria | 7432 |
| 676 | Ga0495600_0030554 | 3300046809 | Bacteria | 3489 |
| 677 | Ga0495600_0042658 | 3300046809 | Bacteria | 2957 |
| 678 | Ga0495600_0128366 | 3300046809 | Bacteria | 1648 |
| 679 | Ga0495581_0000013 | 3300047315 | Bacteria | 62822 |
| 680 | Ga0495581_0003282 | 3300047315 | Bacteria | 9283 |
| 681 | Ga0495604_0011038 | 3300047317 | Bacteria | 7169 |
| 682 | Ga0495604_0126754 | 3300047317 | Bacteria | 1839 |
| 683 | Ga0495604_0275061 | 3300047317 | Bacteria | 1139 |
| 684 | Ga0495604_0372785 | 3300047317 | Bacteria | 944 |
| 685 | Ga0495674_0001144 | 3300047319 | Bacteria | 25572 |
| 686 | Ga0495674_0010460 | 3300047319 | Bacteria | 8783 |
| 687 | Ga0495674_0038127 | 3300047319 | Bacteria | 4315 |
| 688 | Ga0495674_0094207 | 3300047319 | Bacteria | 2554 |
| 689 | Ga0495674_0116372 | 3300047319 | Bacteria | 2261 |
| 690 | Ga0495674_0193679 | 3300047319 | Bacteria | 1688 |
| 691 | Ga0495674_0321871 | 3300047319 | Bacteria | 1260 |
| 692 | Ga0495676_0003561 | 3300047321 | Bacteria | 14122 |
| 693 | Ga0495676_0007271 | 3300047321 | Bacteria | 10155 |
| 694 | Ga0495676_0172416 | 3300047321 | Bacteria | 1522 |
| 695 | Ga0495680_0011975 | 3300047322 | Bacteria | 7655 |
| 696 | Ga0495680_0173038 | 3300047322 | Bacteria | 1562 |
| 697 | Ga0495680_0194998 | 3300047322 | Bacteria | 1456 |
| 698 | Ga0495675_0037486 | 3300047444 | Bacteria | 3087 |
| 699 | Ga0495675_0095252 | 3300047444 | Bacteria | 1866 |
| 700 | Ga0495675_0109780 | 3300047444 | Bacteria | 1722 |
| 701 | Ga0495684_0006947 | 3300047471 | Bacteria | 8789 |
| 702 | Ga0495684_0026233 | 3300047471 | Bacteria | 4477 |
| 703 | Ga0495684_0041957 | 3300047471 | Bacteria | 3506 |
| 704 | Ga0495684_0066890 | 3300047471 | Bacteria | 2732 |
| 705 | Ga0495684_0095581 | 3300047471 | Bacteria | 2249 |
| 706 | Ga0495593_0015001 | 3300047673 | Bacteria | 4400 |
| 707 | Ga0495593_0039215 | 3300047673 | Bacteria | 2554 |
| 708 | Ga0495602_0095181 | 3300048088 | Bacteria | 2459 |
| 709 | Ga0495602_0110350 | 3300048088 | Bacteria | 2236 |
| 710 | Ga0495602_0172308 | 3300048088 | Bacteria | 1678 |
| 711 | Ga0495602_0275589 | 3300048088 | Bacteria | 1242 |
| 712 | Ga0496100_0009792 | 3300048903 | Bacteria | 5398 |
| 713 | Ga0496100_0317204 | 3300048903 | Bacteria | 1170 |
| 714 | Ga0496101_0063697 | 3300048904 | Bacteria | 2684 |
| 715 | Ga0496102_0067335 | 3300048905 | Bacteria | 3284 |
| 716 | Ga0496104_0001838 | 3300048907 | Bacteria | 18348 |
| 717 | Ga0496104_0115934 | 3300048907 | Unclassified | 2571 |
| 718 | Ga0496104_0116854 | 3300048907 | Bacteria | 2560 |
| 719 | Ga0496104_0354787 | 3300048907 | Unclassified | 1379 |
| 720 | Ga0496105_0001913 | 3300048908 | Bacteria | 14958 |
| 721 | Ga0496105_0130143 | 3300048908 | Bacteria | 2075 |
| 722 | Ga0496106_0002885 | 3300048909 | Bacteria | 12770 |
| 723 | Ga0496106_0106899 | 3300048909 | Bacteria | 2175 |
| 724 | Ga0496106_0295254 | 3300048909 | Bacteria | 1299 |
| 725 | Ga0496107_0029197 | 3300048910 | Bacteria | 3922 |
| 726 | Ga0496108_0525131 | 3300048911 | Bacteria | 1033 |
| 727 | Ga0496109_0031624 | 3300048912 | Bacteria | 4752 |
| 728 | Ga0496109_0121911 | 3300048912 | Bacteria | 2429 |
| 729 | Ga0496109_0324416 | 3300048912 | Bacteria | 1453 |
| 730 | Ga0496109_0725368 | 3300048912 | Unclassified | 932 |
| 731 | Ga0496110_0020391 | 3300048913 | Bacteria | 5598 |
| 732 | Ga0496110_0159663 | 3300048913 | Bacteria | 2043 |
| 733 | Ga0496110_0326692 | 3300048913 | Bacteria | 1397 |
| 734 | Ga0496111_0293977 | 3300048914 | Bacteria | 1204 |
| 735 | Ga0496112_0003625 | 3300048915 | Bacteria | 12860 |
| 736 | Ga0496112_0190304 | 3300048915 | Bacteria | 2014 |
| 737 | Ga0496112_0231524 | 3300048915 | Unclassified | 1802 |
| 738 | Ga0496113_0032340 | 3300048916 | Bacteria | 3803 |
| 739 | Ga0496113_0139942 | 3300048916 | Bacteria | 1904 |
| 740 | Ga0496113_0197999 | 3300048916 | Bacteria | 1596 |
| 741 | Ga0496115_0025042 | 3300048918 | Bacteria | 4642 |
| 742 | Ga0496115_0054421 | 3300048918 | Unclassified | 3213 |
| 743 | Ga0496115_0070274 | 3300048918 | Bacteria | 2838 |
| 744 | Ga0496115_0115264 | 3300048918 | Bacteria | 2209 |
| 745 | Ga0501031_0074436 | 3300049568 | Unclassified | 2211 |
| 746 | Ga0501032_0052967 | 3300049569 | Bacteria | 2734 |
| 747 | Ga0501036_0120493 | 3300049572 | Bacteria | 2216 |
| 748 | Ga0501036_0151804 | 3300049572 | Bacteria | 1954 |
| 749 | Ga0501037_0137181 | 3300049573 | Bacteria | 1752 |
| 750 | Ga0501038_0129078 | 3300049574 | Bacteria | 2078 |
| 751 | Ga0501039_0090032 | 3300049575 | Bacteria | 2391 |
| 752 | Ga0501039_0141358 | 3300049575 | Bacteria | 1891 |
| 753 | Ga0501039_0240205 | 3300049575 | Bacteria | 1424 |
| 754 | Ga0501040_0028026 | 3300049576 | Bacteria | 3795 |
| 755 | Ga0501040_0049786 | 3300049576 | Bacteria | 2865 |
| 756 | Ga0501040_0102316 | 3300049576 | Unclassified | 1999 |
| 757 | Ga0501040_0130261 | 3300049576 | Bacteria | 1768 |
| 758 | Ga0501041_0015340 | 3300049577 | Bacteria | 4549 |
| 759 | Ga0501041_0051568 | 3300049577 | Bacteria | 2507 |
| 760 | Ga0501041_0066129 | 3300049577 | Bacteria | 2215 |
| 761 | Ga0501041_0241080 | 3300049577 | Bacteria | 1136 |
| 762 | Ga0501041_0244941 | 3300049577 | Bacteria | 1127 |
| 763 | Ga0501042_0005975 | 3300049578 | Bacteria | 7883 |
| 764 | Ga0501042_0049279 | 3300049578 | Bacteria | 3004 |
| 765 | Ga0501042_0069743 | 3300049578 | Bacteria | 2514 |
| 766 | Ga0501042_0153125 | 3300049578 | Bacteria | 1663 |
| 767 | Ga0501046_0274232 | 3300049580 | Unclassified | 1237 |
| 768 | Ga0501048_0044652 | 3300049582 | Bacteria | 3167 |
| 769 | Ga0501068_0040021 | 3300049584 | Bacteria | 2813 |
| 770 | Ga0501068_0123134 | 3300049584 | Bacteria | 1618 |
| 771 | Ga0501068_0210324 | 3300049584 | Bacteria | 1235 |
| 772 | Ga0501071_0007500 | 3300049587 | Bacteria | 7170 |
| 773 | Ga0501071_0037943 | 3300049587 | Bacteria | 3442 |
| 774 | Ga0501071_0126447 | 3300049587 | Bacteria | 1897 |
| 775 | Ga0501072_0014475 | 3300049588 | Bacteria | 6045 |
| 776 | Ga0501072_0036715 | 3300049588 | Bacteria | 3842 |
| 777 | Ga0501073_0037014 | 3300049589 | Bacteria | 3466 |
| 778 | Ga0501073_0069706 | 3300049589 | Bacteria | 2450 |
| 779 | Ga0501074_0291000 | 3300049590 | Bacteria | 1161 |
| 780 | Ga0501075_0008308 | 3300049591 | Bacteria | 7238 |
| 781 | Ga0501075_0025473 | 3300049591 | Bacteria | 4345 |
| 782 | Ga0501075_0124864 | 3300049591 | Bacteria | 1959 |
| 783 | Ga0501076_0018946 | 3300049592 | Bacteria | 5252 |
| 784 | Ga0501076_0091888 | 3300049592 | Bacteria | 2441 |
| 785 | Ga0501076_0134280 | 3300049592 | Bacteria | 2009 |
| 786 | Ga0501077_0059636 | 3300049593 | Bacteria | 2422 |
| 787 | Ga0501077_0216147 | 3300049593 | Unclassified | 1218 |
| 788 | Ga0501079_0215609 | 3300049741 | Unclassified | 1499 |
| 789 | Ga0501080_0012874 | 3300049742 | Bacteria | 7676 |
| 790 | Ga0501080_0224955 | 3300049742 | Bacteria | 1716 |
| 791 | Ga0501080_0410869 | 3300049742 | Unclassified | 1217 |
| 792 | Ga0501081_0005774 | 3300049743 | Bacteria | 8013 |
| 793 | Ga0501081_0015932 | 3300049743 | Bacteria | 4963 |
| 794 | Ga0501081_0117699 | 3300049743 | Unclassified | 1890 |
| 795 | Ga0501081_0124568 | 3300049743 | Bacteria | 1838 |
| 796 | Ga0501081_0187320 | 3300049743 | Bacteria | 1498 |
| 797 | Ga0501083_0025889 | 3300049744 | Bacteria | 4060 |
| 798 | Ga0501035_0088523 | 3300049822 | Bacteria | 2728 |
| 799 | Ga0501045_0005233 | 3300049824 | Bacteria | 8976 |
| 800 | Ga0501045_0048797 | 3300049824 | Bacteria | 3086 |
| 801 | Ga0501045_0083577 | 3300049824 | Bacteria | 2355 |
| 802 | Ga0501045_0116220 | 3300049824 | Bacteria | 1985 |
| 803 | nmdc:mga03n38_49469_c1 | 3300050490 | Bacteria | 1869 |
| 804 | nmdc:mga00v17_189712_c1 | 3300050491 | Bacteria | 1327 |
| 805 | nmdc:mga00v17_64195_c1 | 3300050491 | Bacteria | 2263 |
| 806 | nmdc:mga06z11_29511_c1 | 3300050494 | Bacteria | 2643 |
| 807 | nmdc:mga04h51_65147_c1 | 3300050495 | Bacteria | 1259 |
| 808 | nmdc:mga07m45_4370_c1 | 3300050496 | Bacteria | 6915 |
| 809 | nmdc:mga0qj67_74332_c1 | 3300050509 | Bacteria | 2716 |
| 810 | nmdc:mga06r32_354652_c1 | 3300050510 | Bacteria | 1451 |
| 811 | nmdc:mga06r32_478516_c1 | 3300050510 | Bacteria | 1223 |
| 812 | nmdc:mga06r32_555225_c1 | 3300050510 | Bacteria | 1122 |
| 813 | nmdc:mga08y16_10065_c1 | 3300050511 | Bacteria | 9926 |
| 814 | nmdc:mga08y16_13733_c1 | 3300050511 | Bacteria | 8526 |
| 815 | nmdc:mga08y16_456047_c1 | 3300050511 | Bacteria | 1303 |
| 816 | nmdc:mga0n895_143_c1 | 3300050512 | Bacteria | 43481 |
| 817 | nmdc:mga0n895_17132_c1 | 3300050512 | Bacteria | 6675 |
| 818 | nmdc:mga0rr50_287088_c1 | 3300050513 | Unclassified | 1374 |
| 819 | nmdc:mga0rr50_45206_c1 | 3300050513 | Bacteria | 3235 |
| 820 | nmdc:mga08x19_21134_c1 | 3300050514 | Bacteria | 4014 |
| 821 | nmdc:mga0a205_69390_c1 | 3300050515 | Bacteria | 3403 |
| 822 | nmdc:mga0a205_87_c1 | 3300050515 | Bacteria | 51120 |
| 823 | Ga0495601_0019368 | 3300053077 | Bacteria | 4151 |
| 824 | Ga0495601_0041515 | 3300053077 | Bacteria | 2884 |
| 825 | Ga0495601_0047877 | 3300053077 | Bacteria | 2692 |
| 826 | Ga0495612_0002015 | 3300053078 | Bacteria | 8365 |
| 827 | Ga0495612_0007405 | 3300053078 | Bacteria | 4486 |
| 828 | Ga0495612_0012708 | 3300053078 | Bacteria | 3393 |
| 829 | Ga0495612_0126289 | 3300053078 | Bacteria | 1103 |
| 830 | Ga0495595_0166859 | 3300053084 | Bacteria | 1088 |
| 831 | Ga0495595_0202937 | 3300053084 | Bacteria | 987 |
| 832 | Ga0495619_0005076 | 3300053085 | Bacteria | 8362 |
| 833 | Ga0501084_0035052 | 3300054114 | Bacteria | 4195 |
| 834 | Ga0501084_0095641 | 3300054114 | Bacteria | 2495 |
| 835 | Ga0501082_0010210 | 3300060353 | Bacteria | 8083 |
| 836 | Ga0501082_0060586 | 3300060353 | Bacteria | 3258 |
| 837 | Ga0530510_0077072 | 3300061734 | Bacteria | 2423 |
| 838 | 2774396473 | 2773857762 | Bacteria | 5971770 |
| 839 | 2809198129 | 2808606439 | Bacteria | 5952208 |
| 840 | 2812353183 | 2811994878 | Bacteria | 5992952 |
| 841 | 2891969194 | 2891968417 | Bacteria | 5821697 |
| 842 | Ga0436364_1029185 | |||
| 843 | CNXas_1000106 | |||
| 844 | JGI24737J22298_10019269 | |||
| 845 | JGI25406J46586_10033852 | |||
| 846 | rootL2_10283179 | |||
| 847 | rootH1_10297839 | |||
| 848 | JGI25405J52794_10001159 | |||
| 849 | Ga0065712_10071752 | |||
| 850 | Ga0065712_10076362 | |||
| 851 | Ga0065712_10112324 | |||
| 852 | Ga0065715_10115992 | |||
| 853 | Ga0065715_10269210 | |||
| 854 | Ga0065707_10122970 | |||
| 855 | Ga0070676_10012441 | |||
| 856 | Ga0070676_10015058 | |||
| 857 | Ga0070676_10034917 | |||
| 858 | Ga0070683_100140986 | |||
| 859 | Ga0070683_100296192 | |||
| 860 | Ga0070690_100062878 | |||
| 861 | Ga0070670_100028308 | |||
| 862 | Ga0070670_100087004 | |||
| 863 | Ga0070677_10026578 | |||
| 864 | Ga0068869_100033967 | |||
| 865 | Ga0070666_10041763 | |||
| 866 | Ga0068868_100046597 | |||
| 867 | Ga0068868_100070885 | |||
| 868 | Ga0068868_100101000 | |||
| 869 | Ga0070660_100282824 | |||
| 870 | Ga0070689_100035065 | |||
| 871 | Ga0070691_10025837 | |||
| 872 | Ga0070687_100086316 | |||
| 873 | Ga0070687_100155061 | |||
| 874 | Ga0070661_100028111 | |||
| 875 | Ga0070668_100038731 | |||
| 876 | Ga0070668_100246024 | |||
| 877 | Ga0070669_100014019 | |||
| 878 | Ga0070669_100018362 | |||
| 879 | Ga0070669_100108537 | |||
| 880 | Ga0070669_100151585 | |||
| 881 | Ga0070675_100054888 | |||
| 882 | Ga0070675_100058891 | |||
| 883 | Ga0070675_100186316 | |||
| 884 | Ga0070675_100225353 | |||
| 885 | Ga0070671_100030011 | |||
| 886 | Ga0070671_100043837 | |||
| 887 | Ga0070671_100054892 | |||
| 888 | Ga0070674_100008238 | |||
| 889 | Ga0070674_100014578 | |||
| 890 | Ga0070673_100056039 | |||
| 891 | Ga0070673_100113898 | |||
| 892 | Ga0070673_100183194 | |||
| 893 | Ga0070673_100350367 | |||
| 894 | Ga0070688_100121353 | |||
| 895 | Ga0070659_100048869 | |||
| 896 | Ga0070659_100270224 | |||
| 897 | Ga0070667_100012780 | |||
| 898 | Ga0070667_100019907 | |||
| 899 | Ga0070703_10047024 | |||
| 900 | Ga0070709_10028768 | |||
| 901 | Ga0070714_100000657 | |||
| 902 | Ga0070714_100003814 | |||
| 903 | Ga0070714_100012376 | |||
| 904 | Ga0070714_100119023 | |||
| 905 | Ga0070714_100231101 | |||
| 906 | Ga0070714_100247744 | |||
| 907 | Ga0070714_100368592 | |||
| 908 | Ga0070713_100007742 | |||
| 909 | Ga0070713_100049570 | |||
| 910 | Ga0070713_100050796 | |||
| 911 | Ga0070713_100133263 | |||
| 912 | Ga0070713_100137712 | |||
| 913 | Ga0070713_100217106 | |||
| 914 | Ga0070713_100227310 | |||
| 915 | Ga0070713_100249253 | |||
| 916 | Ga0070710_10026241 | |||
| 917 | Ga0070710_10049348 | |||
| 918 | Ga0070710_10050771 | |||
| 919 | Ga0070710_10075868 | |||
| 920 | Ga0070710_10152075 | |||
| 921 | Ga0070711_100023987 | |||
| 922 | Ga0070711_100026953 | |||
| 923 | Ga0070711_100035490 | |||
| 924 | Ga0070711_100047568 | |||
| 925 | Ga0070711_100132476 | |||
| 926 | Ga0070711_100211195 | |||
| 927 | Ga0070705_100001164 | |||
| 928 | Ga0070705_100123953 | |||
| 929 | Ga0070700_100158380 | |||
| 930 | Ga0070694_100015975 | |||
| 931 | Ga0070708_100007147 | |||
| 932 | Ga0070708_100059301 | |||
| 933 | Ga0070708_100063183 | |||
| 934 | Ga0070708_100098970 | |||
| 935 | Ga0070708_100135317 | |||
| 936 | Ga0070708_100385045 | |||
| 937 | Ga0070663_100457018 | |||
| 938 | Ga0070678_100002602 | |||
| 939 | Ga0070678_100003517 | |||
| 940 | Ga0070678_100102376 | |||
| 941 | Ga0070678_100248859 | |||
| 942 | Ga0070662_100002629 | |||
| 943 | Ga0070662_100049702 | |||
| 944 | Ga0070681_10179079 | |||
| 945 | Ga0068867_100275390 | |||
| 946 | Ga0070706_100003809 | |||
| 947 | Ga0070706_100004920 | |||
| 948 | Ga0070706_100016008 | |||
| 949 | Ga0070706_100017361 | |||
| 950 | Ga0070706_100036664 | |||
| 951 | Ga0070706_100038135 | |||
| 952 | Ga0070706_100094958 | |||
| 953 | Ga0070706_100109506 | |||
| 954 | Ga0070706_100115675 | |||
| 955 | Ga0070706_100136973 | |||
| 956 | Ga0070706_100160527 | |||
| 957 | Ga0070706_100185736 | |||
| 958 | Ga0070706_100307310 | |||
| 959 | Ga0070707_100000596 | |||
| 960 | Ga0070707_100003415 | |||
| 961 | Ga0070707_100006151 | |||
| 962 | Ga0070707_100010754 | |||
| 963 | Ga0070707_100030394 | |||
| 964 | Ga0070707_100057882 | |||
| 965 | Ga0070707_100058776 | |||
| 966 | Ga0070707_100068074 | |||
| 967 | Ga0070707_100095466 | |||
| 968 | Ga0070707_100110212 | |||
| 969 | Ga0070707_100146377 | |||
| 970 | Ga0070707_100155480 | |||
| 971 | Ga0070707_100202583 | |||
| 972 | Ga0070707_100242917 | |||
| 973 | Ga0070707_100249724 | |||
| 974 | Ga0070698_100000272 | |||
| 975 | Ga0070698_100000415 | |||
| 976 | Ga0070698_100043551 | |||
| 977 | Ga0070698_100048934 | |||
| 978 | Ga0070698_100093507 | |||
| 979 | Ga0070698_100130972 | |||
| 980 | Ga0070699_100002396 | |||
| 981 | Ga0070699_100018135 | |||
| 982 | Ga0070699_100053079 | |||
| 983 | Ga0070699_100081547 | |||
| 984 | Ga0070699_100571562 | |||
| 985 | Ga0070697_100000864 | |||
| 986 | Ga0070697_100014825 | |||
| 987 | Ga0070697_100034248 | |||
| 988 | Ga0070697_100059774 | |||
| 989 | Ga0070697_100106012 | |||
| 990 | Ga0070697_100125384 | |||
| 991 | Ga0070672_100257353 | |||
| 992 | Ga0070686_100365828 | |||
| 993 | Ga0070695_100247210 | |||
| 994 | Ga0070696_100019431 | |||
| 995 | Ga0070693_100032597 | |||
| 996 | Ga0070693_100065965 | |||
| 997 | Ga0070665_100015082 | |||
| 998 | Ga0070665_100082041 | |||
| 999 | Ga0070665_100534849 | |||
| 1000 | Ga0070704_100104116 | |||
| 1001 | Ga0070704_100590672 | |||
| 1002 | Ga0068855_100284817 | |||
| 1003 | Ga0070664_100034729 | |||
| 1004 | Ga0070664_100121132 | |||
| 1005 | Ga0068857_100024479 | |||
| 1006 | Ga0068857_100045416 | |||
| 1007 | Ga0068856_100098320 | |||
| 1008 | Ga0068864_100004008 | |||
| 1009 | Ga0068864_100136132 | |||
| 1010 | Ga0068866_10001325 | |||
| 1011 | Ga0068866_10020991 | |||
| 1012 | Ga0068861_100365955 | |||
| 1013 | Ga0068851_10162477 | |||
| 1014 | Ga0068863_100355700 | |||
| 1015 | Ga0068858_100326799 | |||
| 1016 | Ga0068860_100034420 | |||
| 1017 | Ga0068860_100045927 | |||
| 1018 | Ga0068860_100210927 | |||
| 1019 | Ga0068860_100237405 | |||
| 1020 | Ga0068862_100164337 | |||
| 1021 | Ga0081540_1000680 | |||
| 1022 | Ga0081540_1010594 | |||
| 1023 | Ga0081540_1017919 | |||
| 1024 | Ga0081540_1054101 | |||
| 1025 | Ga0081539_10001803 | |||
| 1026 | Ga0081539_10010323 | |||
| 1027 | Ga0070717_10000276 | |||
| 1028 | Ga0070717_10011143 | |||
| 1029 | Ga0070717_10014925 | |||
| 1030 | Ga0070717_10049437 | |||
| 1031 | Ga0070717_10062190 | |||
| 1032 | Ga0070717_10067865 | |||
| 1033 | Ga0070717_10108306 | |||
| 1034 | Ga0070717_10131270 | |||
| 1035 | Ga0070717_10132137 | |||
| 1036 | Ga0070717_10302874 | |||
| 1037 | Ga0075363_100129953 | |||
| 1038 | Ga0075364_10225877 | |||
| 1039 | Ga0070715_10051077 | |||
| 1040 | Ga0070715_10092803 | |||
| 1041 | Ga0070716_100008462 | |||
| 1042 | Ga0070716_100012164 | |||
| 1043 | Ga0070716_100183860 | |||
| 1044 | Ga0070712_100106005 | |||
| 1045 | Ga0070712_100110158 | |||
| 1046 | Ga0070712_100133950 | |||
| 1047 | Ga0070712_100147462 | |||
| 1048 | Ga0070712_100244290 | |||
| 1049 | Ga0075366_10029620 | |||
| 1050 | Ga0097621_100056546 | |||
| 1051 | Ga0097621_100075706 | |||
| 1052 | Ga0097621_100139634 | |||
| 1053 | Ga0097621_100345426 | |||
| 1054 | Ga0075370_10006364 | |||
| 1055 | Ga0075428_100001399 | |||
| 1056 | Ga0075431_100577188 | |||
| 1057 | Ga0075433_10059120 | |||
| 1058 | Ga0075434_100000027 | |||
| 1059 | Ga0075434_100017778 | |||
| 1060 | Ga0075434_100576153 | |||
| 1061 | Ga0068865_100093779 | |||
| 1062 | Ga0068865_100103873 | |||
| 1063 | Ga0068865_100312584 | |||
| 1064 | Ga0068865_100440655 | |||
| 1065 | Ga0075436_100023957 | |||
| 1066 | Ga0075436_100034118 | |||
| 1067 | Ga0075436_100128712 | |||
| 1068 | Ga0075435_100002921 | |||
| 1069 | Ga0105240_10032931 | |||
| 1070 | Ga0111539_10000142 | |||
| 1071 | Ga0111539_10001188 | |||
| 1072 | Ga0105245_10009889 | |||
| 1073 | Ga0105245_10091781 | |||
| 1074 | Ga0105247_10053586 | |||
| 1075 | Ga0105247_10123989 | |||
| 1076 | Ga0105247_10355902 | |||
| 1077 | Ga0105247_10382436 | |||
| 1078 | Ga0114129_10025353 | |||
| 1079 | Ga0114129_11093987 | |||
| 1080 | Ga0105243_10002948 | |||
| 1081 | Ga0105243_10041231 | |||
| 1082 | Ga0105243_10293924 | |||
| 1083 | Ga0105241_10059964 | |||
| 1084 | Ga0105241_10305350 | |||
| 1085 | Ga0105242_10091768 | |||
| 1086 | Ga0105242_10306136 | |||
| 1087 | Ga0105248_10369954 | |||
| 1088 | Ga0105248_10811596 | |||
| 1089 | Ga0105237_10259734 | |||
| 1090 | Ga0105249_10042633 | |||
| 1091 | Ga0105249_10155919 | |||
| 1092 | Ga0105239_10169553 | |||
| 1093 | Ga0105246_10010181 | |||
| 1094 | Ga0105246_10085605 | |||
| 1095 | Ga0105246_10122293 | |||
| 1096 | Ga0105246_10211544 | |||
| 1097 | Ga0157339_1005559 | |||
| 1098 | Ga0157371_10023899 | |||
| 1099 | Ga0157370_10077577 | |||
| 1100 | Ga0157369_10062753 | |||
| 1101 | Ga0157369_10145981 | |||
| 1102 | Ga0157374_10021611 | |||
| 1103 | Ga0157374_10051903 | |||
| 1104 | Ga0157374_10187787 | |||
| 1105 | Ga0157374_10209596 | |||
| 1106 | Ga0157374_10382633 | |||
| 1107 | Ga0157378_10066130 | |||
| 1108 | Ga0157378_10204054 | |||
| 1109 | Ga0157378_10289776 | |||
| 1110 | Ga0157378_10290230 | |||
| 1111 | Ga0157378_10364266 | |||
| 1112 | Ga0163162_10006856 | |||
| 1113 | Ga0163162_10120156 | |||
| 1114 | Ga0163162_10182340 | |||
| 1115 | Ga0157372_10109884 | |||
| 1116 | Ga0157372_10173533 | |||
| 1117 | Ga0157375_10009570 | |||
| 1118 | Ga0157375_10020888 | |||
| 1119 | Ga0157375_10071760 | |||
| 1120 | Ga0157375_10113467 | |||
| 1121 | Ga0157375_10159861 | |||
| 1122 | Ga0157375_10275190 | |||
| 1123 | Ga0157375_10432016 | |||
| 1124 | Ga0157380_10176111 | |||
| 1125 | Ga0157380_10316381 | |||
| 1126 | Ga0182008_10059847 | |||
| 1127 | Ga0157377_10011279 | |||
| 1128 | Ga0157376_10005495 | |||
| 1129 | Ga0157376_10072280 | |||
| 1130 | Ga0157376_10096957 | |||
| 1131 | Ga0157376_10167328 | |||
| 1132 | Ga0157376_10215775 | |||
| 1133 | Ga0206353_11242101 | |||
| 1134 | Ga0213875_10000161 | |||
| 1135 | Ga0213875_10000430 | |||
| 1136 | Ga0213875_10008796 | |||
| 1137 | Ga0213875_10011382 | |||
| 1138 | Ga0213875_10052293 | |||
| 1139 | Ga0224712_10065271 | |||
| 1140 | Ga0224572_1001881 | |||
| 1141 | Ga0207697_10003375 | |||
| 1142 | Ga0207697_10009260 | |||
| 1143 | Ga0207653_10020981 | |||
| 1144 | Ga0207682_10005997 | |||
| 1145 | Ga0207692_10011002 | |||
| 1146 | Ga0207692_10092092 | |||
| 1147 | Ga0207642_10005335 | |||
| 1148 | Ga0207642_10010979 | |||
| 1149 | Ga0207642_10011400 | |||
| 1150 | Ga0207688_10019390 | |||
| 1151 | Ga0207688_10068767 | |||
| 1152 | Ga0207688_10092268 | |||
| 1153 | Ga0207647_10102289 | |||
| 1154 | Ga0207685_10067931 | |||
| 1155 | Ga0207699_10003295 | |||
| 1156 | Ga0207699_10018141 | |||
| 1157 | Ga0207699_10096587 | |||
| 1158 | Ga0207699_10101031 | |||
| 1159 | Ga0207699_10101420 | |||
| 1160 | Ga0207699_10230544 | |||
| 1161 | Ga0207645_10001195 | |||
| 1162 | Ga0207645_10008101 | |||
| 1163 | Ga0207645_10133369 | |||
| 1164 | Ga0207684_10001427 | |||
| 1165 | Ga0207684_10003607 | |||
| 1166 | Ga0207684_10003609 | |||
| 1167 | Ga0207684_10018497 | |||
| 1168 | Ga0207684_10021475 | |||
| 1169 | Ga0207684_10029182 | |||
| 1170 | Ga0207684_10031140 | |||
| 1171 | Ga0207684_10042914 | |||
| 1172 | Ga0207684_10055362 | |||
| 1173 | Ga0207684_10071976 | |||
| 1174 | Ga0207684_10073373 | |||
| 1175 | Ga0207684_10096163 | |||
| 1176 | Ga0207684_10170376 | |||
| 1177 | Ga0207684_10411397 | |||
| 1178 | Ga0207654_10266082 | |||
| 1179 | Ga0207654_10297646 | |||
| 1180 | Ga0207695_10000367 | |||
| 1181 | Ga0207693_10019037 | |||
| 1182 | Ga0207693_10032529 | |||
| 1183 | Ga0207693_10032645 | |||
| 1184 | Ga0207693_10034954 | |||
| 1185 | Ga0207693_10040739 | |||
| 1186 | Ga0207693_10045562 | |||
| 1187 | Ga0207693_10073622 | |||
| 1188 | Ga0207693_10158359 | |||
| 1189 | Ga0207693_10306126 | |||
| 1190 | Ga0207693_10437752 | |||
| 1191 | Ga0207663_10013879 | |||
| 1192 | Ga0207663_10022992 | |||
| 1193 | Ga0207663_10035586 | |||
| 1194 | Ga0207663_10043772 | |||
| 1195 | Ga0207663_10117928 | |||
| 1196 | Ga0207663_10165100 | |||
| 1197 | Ga0207663_10407972 | |||
| 1198 | Ga0207662_10005631 | |||
| 1199 | Ga0207657_10014926 | |||
| 1200 | Ga0207652_10154099 | |||
| 1201 | Ga0207646_10000500 | |||
| 1202 | Ga0207646_10000720 | |||
| 1203 | Ga0207646_10010409 | |||
| 1204 | Ga0207646_10015896 | |||
| 1205 | Ga0207646_10032704 | |||
| 1206 | Ga0207646_10043933 | |||
| 1207 | Ga0207646_10050681 | |||
| 1208 | Ga0207646_10051406 | |||
| 1209 | Ga0207646_10085444 | |||
| 1210 | Ga0207646_10117312 | |||
| 1211 | Ga0207646_10208214 | |||
| 1212 | Ga0207646_10258714 | |||
| 1213 | Ga0207646_10288605 | |||
| 1214 | Ga0207646_10330786 | |||
| 1215 | Ga0207646_10390498 | |||
| 1216 | Ga0207681_10029936 | |||
| 1217 | Ga0207681_10035546 | |||
| 1218 | Ga0207681_10418013 | |||
| 1219 | Ga0207694_10210860 | |||
| 1220 | Ga0207694_10212939 | |||
| 1221 | Ga0207650_10010520 | |||
| 1222 | Ga0207650_10103744 | |||
| 1223 | Ga0207659_10003972 | |||
| 1224 | Ga0207659_10018978 | |||
| 1225 | Ga0207687_10024492 | |||
| 1226 | Ga0207700_10014837 | |||
| 1227 | Ga0207700_10020475 | |||
| 1228 | Ga0207700_10057736 | |||
| 1229 | Ga0207700_10176627 | |||
| 1230 | Ga0207700_10381027 | |||
| 1231 | Ga0207664_10002054 | |||
| 1232 | Ga0207664_10022236 | |||
| 1233 | Ga0207664_10063960 | |||
| 1234 | Ga0207664_10195071 | |||
| 1235 | Ga0207664_10195275 | |||
| 1236 | Ga0207664_10278881 | |||
| 1237 | Ga0207644_10019425 | |||
| 1238 | Ga0207644_10024337 | |||
| 1239 | Ga0207644_10066061 | |||
| 1240 | Ga0207706_10000385 | |||
| 1241 | Ga0207706_10017316 | |||
| 1242 | Ga0207706_10336880 | |||
| 1243 | Ga0207686_10000813 | |||
| 1244 | Ga0207709_10034174 | |||
| 1245 | Ga0207709_10041983 | |||
| 1246 | Ga0207709_10327176 | |||
| 1247 | Ga0207670_10192061 | |||
| 1248 | Ga0207669_10139019 | |||
| 1249 | Ga0207704_10001474 | |||
| 1250 | Ga0207665_10002532 | |||
| 1251 | Ga0207665_10004802 | |||
| 1252 | Ga0207665_10006521 | |||
| 1253 | Ga0207665_10014471 | |||
| 1254 | Ga0207665_10018068 | |||
| 1255 | Ga0207691_10031070 | |||
| 1256 | Ga0207691_10284165 | |||
| 1257 | Ga0207711_10004715 | |||
| 1258 | Ga0207711_10140475 | |||
| 1259 | Ga0207689_10014360 | |||
| 1260 | Ga0207679_10126238 | |||
| 1261 | Ga0207667_10341663 | |||
| 1262 | Ga0207667_10507860 | |||
| 1263 | Ga0207651_10006405 | |||
| 1264 | Ga0207651_10220093 | |||
| 1265 | Ga0207651_10221975 | |||
| 1266 | Ga0207712_10001825 | |||
| 1267 | Ga0207668_10295859 | |||
| 1268 | Ga0207640_10001949 | |||
| 1269 | Ga0207658_10019791 | |||
| 1270 | Ga0207658_10130347 | |||
| 1271 | Ga0207677_10023157 | |||
| 1272 | Ga0207677_10079665 | |||
| 1273 | Ga0207677_10271382 | |||
| 1274 | Ga0207703_10042880 | |||
| 1275 | Ga0207703_10080595 | |||
| 1276 | Ga0207639_10077900 | |||
| 1277 | Ga0207678_10022270 | |||
| 1278 | Ga0207678_10065953 | |||
| 1279 | Ga0207678_10334789 | |||
| 1280 | Ga0207708_10009550 | |||
| 1281 | Ga0207708_10082790 | |||
| 1282 | Ga0207702_10090610 | |||
| 1283 | Ga0207702_10552771 | |||
| 1284 | Ga0207641_10195902 | |||
| 1285 | Ga0207648_10000933 | |||
| 1286 | Ga0207648_10420736 | |||
| 1287 | Ga0207676_10117148 | |||
| 1288 | Ga0207676_10262688 | |||
| 1289 | Ga0207674_10016165 | |||
| 1290 | Ga0207674_10024239 | |||
| 1291 | Ga0207674_10389274 | |||
| 1292 | Ga0207674_10551061 | |||
| 1293 | Ga0207675_100004845 | |||
| 1294 | Ga0207675_100019282 | |||
| 1295 | Ga0207683_10008233 | |||
| 1296 | Ga0207683_10008240 | |||
| 1297 | Ga0207683_10111308 | |||
| 1298 | Ga0207698_10200776 | |||
| 1299 | Ga0209966_1017342 | |||
| 1300 | Ga0209974_10005164 | |||
| 1301 | Ga0207428_10025616 | |||
| 1302 | Ga0268266_10023177 | |||
| 1303 | Ga0268265_10032167 | |||
| 1304 | Ga0268264_10003023 | |||
| 1305 | Ga0268264_10049148 | |||
| 1306 | Ga0265338_10004729 | |||
| 1307 | Ga0265338_10076772 | |||
| 1308 | Ga0265320_10096491 | |||
| 1309 | Ga0265325_10056241 | |||
| 1310 | Ga0265327_10000051 | |||
| 1311 | Ga0265316_10041193 | |||
| 1312 | Ga0307408_100025233 | |||
| 1313 | Ga0265313_10017695 | |||
| 1314 | Ga0265313_10092206 | |||
| 1315 | Ga0265314_10032196 | |||
| 1316 | Ga0307413_10081501 | |||
| 1317 | Ga0307410_10019286 | |||
| 1318 | Ga0307406_10321339 | |||
| 1319 | Ga0307412_10034041 | |||
| 1320 | Ga0307409_100061308 | |||
| 1321 | Ga0307416_100034451 | |||
| 1322 | Ga0307416_100059496 | |||
| 1323 | Ga0307416_100075133 | |||
| 1324 | Ga0307414_10096330 | |||
| 1325 | Ga0307411_10059620 | |||
| 1326 | Ga0307415_100005478 | |||
| 1327 | Ga0373926_0004261 | |||
| 1328 | Ga0373926_0023065 | |||
| 1329 | Ga0373934_0016770 | |||
| 1330 | Ga0373934_0035310 | |||
| 1331 | Ga0373944_0002100 | |||
| 1332 | Ga0373944_0023041 | |||
| 1333 | Ga0373944_0072904 | |||
| 1334 | Ga0373923_0002444 | |||
| 1335 | Ga0373923_0020254 | |||
| 1336 | Ga0373936_0000581 | |||
| 1337 | Ga0373936_0001452 | |||
| 1338 | Ga0373936_0002799 | |||
| 1339 | Ga0373936_0017010 | |||
| 1340 | Ga0373936_0028068 | |||
| 1341 | Ga0373945_0001920 | |||
| 1342 | Ga0373954_0004908 | |||
| 1343 | Ga0373954_0029961 | |||
| 1344 | Ga0373954_0158448 | |||
| 1345 | Ga0373956_0005191 | |||
| 1346 | Ga0373956_0008865 | |||
| 1347 | Ga0373956_0033556 | |||
| 1348 | Ga0373957_0013147 | |||
| 1349 | Ga0373957_0027339 | |||
| 1350 | Ga0373943_0000150 | |||
| 1351 | Ga0373943_0013539 | |||
| 1352 | Ga0373943_0038374 | |||
| 1353 | Ga0373946_0000289 | |||
| 1354 | Ga0373946_0000522 | |||
| 1355 | Ga0373946_0044171 | |||
| 1356 | Ga0373955_0046416 | |||
| 1357 | Ga0316574_0063221 | |||
| 1358 | Ga0316574_0330092 | |||
| 1359 | Ga0373924_0001686 | |||
| 1360 | Ga0373924_0027279 | |||
| 1361 | Ga0373924_0043036 | |||
| 1362 | Ga0373924_0111743 | |||
| 1363 | Ga0373931_0034787 | |||
| 1364 | Ga0373931_0063176 | |||
| 1365 | Ga0373935_0004988 | |||
| 1366 | Ga0373935_0028214 | |||
| 1367 | Ga0373935_0066842 | |||
| 1368 | Ga0373935_0092436 | |||
| 1369 | Ga0373935_0131996 | |||
| 1370 | Ga0373935_0136007 | |||
| 1371 | Ga0373927_0015021 | |||
| 1372 | Ga0373927_0064527 | |||
| 1373 | Ga0373933_0018855 | |||
| 1374 | Ga0373933_0037900 | |||
| 1375 | Ga0373933_0072989 | |||
| 1376 | Ga0373933_0270824 | |||
| 1377 | Ga0373947_0000012 | |||
| 1378 | Ga0373947_0000160 | |||
| 1379 | Ga0373947_0002086 | |||
| 1380 | Ga0373947_0013982 | |||
| 1381 | Ga0373937_0048253 | |||
| 1382 | Ga0373937_0063380 | |||
| 1383 | Ga0373937_0069210 | |||
| 1384 | Ga0373937_0164610 | |||
| 1385 | Ga0373937_0186686 | |||
| 1386 | Ga0373937_0227613 | |||
| 1387 | Ga0373937_0331458 | |||
| 1388 | Ga0373937_0442724 | |||
| 1389 | Ga0373925_0001574 | |||
| 1390 | Ga0373925_0028061 | |||
| 1391 | Ga0373925_0061501 | |||
| 1392 | Ga0373925_0189938 | |||
| 1393 | Ga0373925_0449967 | |||
| 1394 | Ga0395899_0041455 | |||
| 1395 | Ga0395900_0052844 | |||
| 1396 | Ga0395898_0109542 | |||
| 1397 | Ga0395905_0012512 | |||
| 1398 | Ga0436364_0028100 | |||
| 1399 | Ga0436364_0081322 | |||
| 1400 | Ga0436364_0097537 | |||
| 1401 | Ga0436364_0408959 | |||
| 1402 | Ga0436364_0531667 | |||
| 1403 | Ga0436364_0759698 | |||
| 1404 | Ga0436364_1016447 | |||
| 1405 | Ga0436364_1115616 | |||
| 1406 | Ga0395901_0035108 | |||
| 1407 | Ga0395901_0201684 | |||
| 1408 | Ga0400483_280984 | |||
| 1409 | Ga0436365_1179117 | |||
| 1410 | Ga0436363_0923158 | |||
| 1411 | Ga0436363_1210241 | |||
| 1412 | Ga0439461_0002693 | |||
| 1413 | Ga0451793_0890117 | |||
| 1414 | Ga0451807_0950863 | |||
| 1415 | Ga0451853_1466257 | |||
| 1416 | Ga0439446_0001266 | |||
| 1417 | Ga0450908_007426 | |||
| 1418 | Ga0439435_0000161 | |||
| 1419 | Ga0439460_0021831 | |||
| 1420 | Ga0451577_0474115 | |||
| 1421 | Ga0466963_0045633 | |||
| 1422 | Ga0466963_0167156 | |||
| 1423 | Ga0466959_0057508 | |||
| 1424 | Ga0466967_0178959 | |||
| 1425 | Ga0466967_0408571 | |||
| 1426 | Ga0495629_0001182 | |||
| 1427 | Ga0495641_0028650 | |||
| 1428 | Ga0495651_0024565 | |||
| 1429 | Ga0495651_0056420 | |||
| 1430 | Ga0495651_0076431 | |||
| 1431 | Ga0495651_0080578 | |||
| 1432 | Ga0495651_0098444 | |||
| 1433 | Ga0495653_0008105 | |||
| 1434 | Ga0495653_0039315 | |||
| 1435 | Ga0495653_0080401 | |||
| 1436 | Ga0495653_0109356 | |||
| 1437 | Ga0495580_0025359 | |||
| 1438 | Ga0495580_0072201 | |||
| 1439 | Ga0495582_0010080 | |||
| 1440 | Ga0495582_0020077 | |||
| 1441 | Ga0495639_0004804 | |||
| 1442 | Ga0495639_0035329 | |||
| 1443 | Ga0495662_0001276 | |||
| 1444 | Ga0495662_0025573 | |||
| 1445 | Ga0495662_0053965 | |||
| 1446 | Ga0495662_0164852 | |||
| 1447 | Ga0495664_0001966 | |||
| 1448 | Ga0495664_0007753 | |||
| 1449 | Ga0495664_0028847 | |||
| 1450 | Ga0495664_0037052 | |||
| 1451 | Ga0495664_0043928 | |||
| 1452 | Ga0495664_0076643 | |||
| 1453 | Ga0495594_0012580 | |||
| 1454 | Ga0495594_0037179 | |||
| 1455 | Ga0495608_0003378 | |||
| 1456 | Ga0495608_0007260 | |||
| 1457 | Ga0495608_0048190 | |||
| 1458 | Ga0495618_0038398 | |||
| 1459 | Ga0495618_0107852 | |||
| 1460 | Ga0495628_0042516 | |||
| 1461 | Ga0495628_0087740 | |||
| 1462 | Ga0495628_0145986 | |||
| 1463 | Ga0495628_0285313 | |||
| 1464 | Ga0495630_0003286 | |||
| 1465 | Ga0495630_0018691 | |||
| 1466 | Ga0495630_0074214 | |||
| 1467 | Ga0495630_0111012 | |||
| 1468 | Ga0495666_0034932 | |||
| 1469 | Ga0495652_0038810 | |||
| 1470 | Ga0495652_0046702 | |||
| 1471 | Ga0495652_0120352 | |||
| 1472 | Ga0495665_0000971 | |||
| 1473 | Ga0495665_0015574 | |||
| 1474 | Ga0495640_0066423 | |||
| 1475 | Ga0495586_0011182 | |||
| 1476 | Ga0495586_0082643 | |||
| 1477 | Ga0495587_0005283 | |||
| 1478 | Ga0495587_0023248 | |||
| 1479 | Ga0495587_0166405 | |||
| 1480 | Ga0495645_0003389 | |||
| 1481 | Ga0495645_0005262 | |||
| 1482 | Ga0495645_0019749 | |||
| 1483 | Ga0495622_0040376 | |||
| 1484 | Ga0495667_0022054 | |||
| 1485 | Ga0495667_0040674 | |||
| 1486 | Ga0495667_0049039 | |||
| 1487 | Ga0495667_0087178 | |||
| 1488 | Ga0495634_0002841 | |||
| 1489 | Ga0495634_0024139 | |||
| 1490 | Ga0495634_0087272 | |||
| 1491 | Ga0495634_0170350 | |||
| 1492 | Ga0495635_0000234 | |||
| 1493 | Ga0495635_0014109 | |||
| 1494 | Ga0495635_0052965 | |||
| 1495 | Ga0495657_0004127 | |||
| 1496 | Ga0495657_0004224 | |||
| 1497 | Ga0495657_0036570 | |||
| 1498 | Ga0495657_0088375 | |||
| 1499 | Ga0495657_0096475 | |||
| 1500 | Ga0495599_0011242 | |||
| 1501 | Ga0495599_0023984 | |||
| 1502 | Ga0495599_0114113 | |||
| 1503 | Ga0495623_0022232 | |||
| 1504 | Ga0495623_0057174 | |||
| 1505 | Ga0495623_0059077 | |||
| 1506 | Ga0495623_0061613 | |||
| 1507 | Ga0495646_0046354 | |||
| 1508 | Ga0495658_0002304 | |||
| 1509 | Ga0495669_0034846 | |||
| 1510 | Ga0495613_0043505 | |||
| 1511 | Ga0495613_0130947 | |||
| 1512 | Ga0495613_0325770 | |||
| 1513 | Ga0495624_0004504 | |||
| 1514 | Ga0495624_0049419 | |||
| 1515 | Ga0495624_0100323 | |||
| 1516 | Ga0495600_0005859 | |||
| 1517 | Ga0495600_0030554 | |||
| 1518 | Ga0495600_0042658 | |||
| 1519 | Ga0495600_0128366 | |||
| 1520 | Ga0495581_0000013 | |||
| 1521 | Ga0495581_0003282 | |||
| 1522 | Ga0495604_0011038 | |||
| 1523 | Ga0495604_0126754 | |||
| 1524 | Ga0495604_0275061 | |||
| 1525 | Ga0495604_0372785 | |||
| 1526 | Ga0495674_0001144 | |||
| 1527 | Ga0495674_0010460 | |||
| 1528 | Ga0495674_0038127 | |||
| 1529 | Ga0495674_0094207 | |||
| 1530 | Ga0495674_0116372 | |||
| 1531 | Ga0495674_0193679 | |||
| 1532 | Ga0495674_0321871 | |||
| 1533 | Ga0495676_0003561 | |||
| 1534 | Ga0495676_0007271 | |||
| 1535 | Ga0495676_0172416 | |||
| 1536 | Ga0495680_0011975 | |||
| 1537 | Ga0495680_0173038 | |||
| 1538 | Ga0495680_0194998 | |||
| 1539 | Ga0495675_0037486 | |||
| 1540 | Ga0495675_0095252 | |||
| 1541 | Ga0495675_0109780 | |||
| 1542 | Ga0495684_0006947 | |||
| 1543 | Ga0495684_0026233 | |||
| 1544 | Ga0495684_0041957 | |||
| 1545 | Ga0495684_0066890 | |||
| 1546 | Ga0495684_0095581 | |||
| 1547 | Ga0495593_0015001 | |||
| 1548 | Ga0495593_0039215 | |||
| 1549 | Ga0495602_0095181 | |||
| 1550 | Ga0495602_0110350 | |||
| 1551 | Ga0495602_0172308 | |||
| 1552 | Ga0495602_0275589 | |||
| 1553 | Ga0496100_0009792 | |||
| 1554 | Ga0496100_0317204 | |||
| 1555 | Ga0496101_0063697 | |||
| 1556 | Ga0496102_0067335 | |||
| 1557 | Ga0496104_0001838 | |||
| 1558 | Ga0496104_0115934 | |||
| 1559 | Ga0496104_0116854 | |||
| 1560 | Ga0496104_0354787 | |||
| 1561 | Ga0496105_0001913 | |||
| 1562 | Ga0496105_0130143 | |||
| 1563 | Ga0496106_0002885 | |||
| 1564 | Ga0496106_0106899 | |||
| 1565 | Ga0496106_0295254 | |||
| 1566 | Ga0496107_0029197 | |||
| 1567 | Ga0496108_0525131 | |||
| 1568 | Ga0496109_0031624 | |||
| 1569 | Ga0496109_0121911 | |||
| 1570 | Ga0496109_0324416 | |||
| 1571 | Ga0496109_0725368 | |||
| 1572 | Ga0496110_0020391 | |||
| 1573 | Ga0496110_0159663 | |||
| 1574 | Ga0496110_0326692 | |||
| 1575 | Ga0496111_0293977 | |||
| 1576 | Ga0496112_0003625 | |||
| 1577 | Ga0496112_0190304 | |||
| 1578 | Ga0496112_0231524 | |||
| 1579 | Ga0496113_0032340 | |||
| 1580 | Ga0496113_0139942 | |||
| 1581 | Ga0496113_0197999 | |||
| 1582 | Ga0496115_0025042 | |||
| 1583 | Ga0496115_0054421 | |||
| 1584 | Ga0496115_0070274 | |||
| 1585 | Ga0496115_0115264 | |||
| 1586 | Ga0501031_0074436 | |||
| 1587 | Ga0501032_0052967 | |||
| 1588 | Ga0501036_0120493 | |||
| 1589 | Ga0501036_0151804 | |||
| 1590 | Ga0501037_0137181 | |||
| 1591 | Ga0501038_0129078 | |||
| 1592 | Ga0501039_0090032 | |||
| 1593 | Ga0501039_0141358 | |||
| 1594 | Ga0501039_0240205 | |||
| 1595 | Ga0501040_0028026 | |||
| 1596 | Ga0501040_0049786 | |||
| 1597 | Ga0501040_0102316 | |||
| 1598 | Ga0501040_0130261 | |||
| 1599 | Ga0501041_0015340 | |||
| 1600 | Ga0501041_0051568 | |||
| 1601 | Ga0501041_0066129 | |||
| 1602 | Ga0501041_0241080 | |||
| 1603 | Ga0501041_0244941 | |||
| 1604 | Ga0501042_0005975 | |||
| 1605 | Ga0501042_0049279 | |||
| 1606 | Ga0501042_0069743 | |||
| 1607 | Ga0501042_0153125 | |||
| 1608 | Ga0501046_0274232 | |||
| 1609 | Ga0501048_0044652 | |||
| 1610 | Ga0501068_0040021 | |||
| 1611 | Ga0501068_0123134 | |||
| 1612 | Ga0501068_0210324 | |||
| 1613 | Ga0501071_0007500 | |||
| 1614 | Ga0501071_0037943 | |||
| 1615 | Ga0501071_0126447 | |||
| 1616 | Ga0501072_0014475 | |||
| 1617 | Ga0501072_0036715 | |||
| 1618 | Ga0501073_0037014 | |||
| 1619 | Ga0501073_0069706 | |||
| 1620 | Ga0501074_0291000 | |||
| 1621 | Ga0501075_0008308 | |||
| 1622 | Ga0501075_0025473 | |||
| 1623 | Ga0501075_0124864 | |||
| 1624 | Ga0501076_0018946 | |||
| 1625 | Ga0501076_0091888 | |||
| 1626 | Ga0501076_0134280 | |||
| 1627 | Ga0501077_0059636 | |||
| 1628 | Ga0501077_0216147 | |||
| 1629 | Ga0501079_0215609 | |||
| 1630 | Ga0501080_0012874 | |||
| 1631 | Ga0501080_0224955 | |||
| 1632 | Ga0501080_0410869 | |||
| 1633 | Ga0501081_0005774 | |||
| 1634 | Ga0501081_0015932 | |||
| 1635 | Ga0501081_0117699 | |||
| 1636 | Ga0501081_0124568 | |||
| 1637 | Ga0501081_0187320 | |||
| 1638 | Ga0501083_0025889 | |||
| 1639 | Ga0501035_0088523 | |||
| 1640 | Ga0501045_0005233 | |||
| 1641 | Ga0501045_0048797 | |||
| 1642 | Ga0501045_0083577 | |||
| 1643 | Ga0501045_0116220 | |||
| 1644 | nmdc:mga03n38_49469_c1 | |||
| 1645 | nmdc:mga00v17_189712_c1 | |||
| 1646 | nmdc:mga00v17_64195_c1 | |||
| 1647 | nmdc:mga06z11_29511_c1 | |||
| 1648 | nmdc:mga04h51_65147_c1 | |||
| 1649 | nmdc:mga07m45_4370_c1 | |||
| 1650 | nmdc:mga0qj67_74332_c1 | |||
| 1651 | nmdc:mga06r32_354652_c1 | |||
| 1652 | nmdc:mga06r32_478516_c1 | |||
| 1653 | nmdc:mga06r32_555225_c1 | |||
| 1654 | nmdc:mga08y16_10065_c1 | |||
| 1655 | nmdc:mga08y16_13733_c1 | |||
| 1656 | nmdc:mga08y16_456047_c1 | |||
| 1657 | nmdc:mga0n895_143_c1 | |||
| 1658 | nmdc:mga0n895_17132_c1 | |||
| 1659 | nmdc:mga0rr50_287088_c1 | |||
| 1660 | nmdc:mga0rr50_45206_c1 | |||
| 1661 | nmdc:mga08x19_21134_c1 | |||
| 1662 | nmdc:mga0a205_69390_c1 | |||
| 1663 | nmdc:mga0a205_87_c1 | |||
| 1664 | Ga0495601_0019368 | |||
| 1665 | Ga0495601_0041515 | |||
| 1666 | Ga0495601_0047877 | |||
| 1667 | Ga0495612_0002015 | |||
| 1668 | Ga0495612_0007405 | |||
| 1669 | Ga0495612_0012708 | |||
| 1670 | Ga0495612_0126289 | |||
| 1671 | Ga0495595_0166859 | |||
| 1672 | Ga0495595_0202937 | |||
| 1673 | Ga0495619_0005076 | |||
| 1674 | Ga0501084_0035052 | |||
| 1675 | Ga0501084_0095641 | |||
| 1676 | Ga0501082_0010210 | |||
| 1677 | Ga0501082_0060586 | |||
| 1678 | Ga0530510_0077072 | |||
| 1679 | 2774396473 | |||
| 1680 | 2809198129 | |||
| 1681 | 2812353183 | |||
| 1682 | 2891969194 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5cm0-assembly1.cif.gz_C-2 | crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans | 0.9481 | 11 | 299 |
| 5cm0-assembly1.cif.gz_A-2 | crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans | 0.9472 | 11 | 298 |
| 5cm0-assembly1.cif.gz_C-2 | crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans | 0.9448 | 11 | 299 |
| 5e25-assembly1.cif.gz_C | crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate | 0.9444 | 11 | 298 |
| 5mqz-assembly1.cif.gz_B | archaeal branched-chain amino acid aminotransferase from archaeoglobus fulgidus; holoform | 0.9434 | 12 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JRF2_257_378_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9765 | 6 | 125 | 3.30.470.10 |
| 3u0gF02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9596 | 137 | 289 | 3.20.10.10 |
| af_I1JRF2_385_551_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9582 | 133 | 296 | 3.20.10.10 |
| 5mr0A02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.954 | 139 | 289 | 3.20.10.10 |
| af_I1JRF2_257_378_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.953 | 6 | 125 | 3.30.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2H014-F1-model_v4 | Aminotransferase IV | 0.9722 | 198 | 299 |
GO:0008483
GO:0046394 |
| AF-A0A068VAT3-F1-model_v4 | Branched-chain-amino-acid aminotransferase-like protein 1 | 0.971 | 3 | 298 |
GO:0003824
GO:0046394 |
| AF-A0A2V5XN59-F1-model_v4 | Aminotransferase IV | 0.971 | 1 | 255 |
GO:0008483
GO:0046394 |
| AF-I1JRF2-F1-model_v4 | Branched-chain-amino-acid aminotransferase-like protein 1 | 0.9705 | 3 | 298 |
GO:0003824
GO:0019752 GO:0046394 |
| AF-A0A1U8BBX5-F1-model_v4 | Branched-chain-amino-acid aminotransferase-like protein 1 isoform X1 | 0.9699 | 3 | 298 |
GO:0008483
GO:0019752 GO:0046394 |