F483094

General Info

Members Datasets Scaffolds Average Seq Length
841 345 1682 300

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1029185|Ga0436364_1029185_97_1179
Length 360
Sequence MLQVFDERNRDLIVNVGGRLTHRDRAAVSPFDSVVQGGDAVWEGLRLYAGKIFRLDEHLARLRASARALAFGQIPSDQEITEQIRRTLEANGMRDGVHIRLTLSRGVKITSGMDPRLNQSGPTLIVLAEFKDPVYDMAGITLITSSVRRPAPDCLDPKIHHNNLLPSILAKIEANVAGADDAVVLDHRGFIAETNATHLFMVTGGTLATPTTVSCPEGITRAAVLGLAASAGIACETGDYTLPQLYNAEEAFVTGTMGGLAPVVSVDGRVIGDRAPGPVTKRLTALYADLTATTGTSVTLRRSPNTNVSTRLHDREDFCTLYDLKVFAIMEMSARQHASPRLVGRTELMGPVGLAGWCAA

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
184 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
206 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
207 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
208 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
209 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
210 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
215 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
231 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
232 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
235 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
236 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
237 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
342 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
343 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
344 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
345 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.24
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 4.16
Rhizosphere 91.68
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1029185 3300037853 Bacteria 2065
2 CNXas_1000106 3300000545 Bacteria 15432
3 JGI24737J22298_10019269 3300001990 Unclassified 2183
4 JGI25406J46586_10033852 3300003203 Bacteria 1882
5 rootL2_10283179 3300003322 Bacteria 1626
6 rootH1_10297839 3300003323 Bacteria 1578
7 JGI25405J52794_10001159 3300003911 Bacteria 4247
8 Ga0065712_10071752 3300005290 Bacteria 5079
9 Ga0065712_10076362 3300005290 Bacteria 3657
10 Ga0065712_10112324 3300005290 Unclassified 1799
11 Ga0065715_10115992 3300005293 Bacteria 2395
12 Ga0065715_10269210 3300005293 Unclassified 1116
13 Ga0065707_10122970 3300005295 Unclassified 2070
14 Ga0070676_10012441 3300005328 Bacteria 4645
15 Ga0070676_10015058 3300005328 Bacteria 4261
16 Ga0070676_10034917 3300005328 Unclassified 2889
17 Ga0070683_100140986 3300005329 Bacteria 2284
18 Ga0070683_100296192 3300005329 Bacteria 1539
19 Ga0070690_100062878 3300005330 Bacteria 2394
20 Ga0070670_100028308 3300005331 Bacteria 4822
21 Ga0070670_100087004 3300005331 Bacteria 2685
22 Ga0070677_10026578 3300005333 Unclassified 2172
23 Ga0068869_100033967 3300005334 Bacteria 3604
24 Ga0070666_10041763 3300005335 Bacteria 3065
25 Ga0068868_100046597 3300005338 Bacteria 3394
26 Ga0068868_100070885 3300005338 Bacteria 2779
27 Ga0068868_100101000 3300005338 Bacteria 2334
28 Ga0070660_100282824 3300005339 Bacteria 1358
29 Ga0070689_100035065 3300005340 Bacteria 3831
30 Ga0070691_10025837 3300005341 Bacteria 2736
31 Ga0070687_100086316 3300005343 Bacteria 1725
32 Ga0070687_100155061 3300005343 Bacteria 1348
33 Ga0070661_100028111 3300005344 Bacteria 4055
34 Ga0070668_100038731 3300005347 Bacteria 3645
35 Ga0070668_100246024 3300005347 Bacteria 1483
36 Ga0070669_100014019 3300005353 Bacteria 5699
37 Ga0070669_100018362 3300005353 Bacteria 4998
38 Ga0070669_100108537 3300005353 Bacteria 2103
39 Ga0070669_100151585 3300005353 Unclassified 1795
40 Ga0070675_100054888 3300005354 Bacteria 3279
41 Ga0070675_100058891 3300005354 Unclassified 3168
42 Ga0070675_100186316 3300005354 Unclassified 1796
43 Ga0070675_100225353 3300005354 Bacteria 1634
44 Ga0070671_100030011 3300005355 Bacteria 4486
45 Ga0070671_100043837 3300005355 Bacteria 3718
46 Ga0070671_100054892 3300005355 Bacteria 3313
47 Ga0070674_100008238 3300005356 Bacteria 6194
48 Ga0070674_100014578 3300005356 Bacteria 4890
49 Ga0070673_100056039 3300005364 Bacteria 3108
50 Ga0070673_100113898 3300005364 Bacteria 2246
51 Ga0070673_100183194 3300005364 Bacteria 1794
52 Ga0070673_100350367 3300005364 Bacteria 1310
53 Ga0070688_100121353 3300005365 Unclassified 1751
54 Ga0070659_100048869 3300005366 Bacteria 3324
55 Ga0070659_100270224 3300005366 Unclassified 1412
56 Ga0070667_100012780 3300005367 Bacteria 6938
57 Ga0070667_100019907 3300005367 Bacteria 5569
58 Ga0070703_10047024 3300005406 Bacteria 1366
59 Ga0070709_10028768 3300005434 Bacteria 3317
60 Ga0070714_100000657 3300005435 Bacteria 24532
61 Ga0070714_100003814 3300005435 Bacteria 11324
62 Ga0070714_100012376 3300005435 Bacteria 6811
63 Ga0070714_100119023 3300005435 Bacteria 2347
64 Ga0070714_100231101 3300005435 Bacteria 1704
65 Ga0070714_100247744 3300005435 Unclassified 1646
66 Ga0070714_100368592 3300005435 Bacteria 1352
67 Ga0070713_100007742 3300005436 Bacteria 7563
68 Ga0070713_100049570 3300005436 Bacteria 3464
69 Ga0070713_100050796 3300005436 Bacteria 3427
70 Ga0070713_100133263 3300005436 Bacteria 2193
71 Ga0070713_100137712 3300005436 Bacteria 2159
72 Ga0070713_100217106 3300005436 Bacteria 1734
73 Ga0070713_100227310 3300005436 Unclassified 1695
74 Ga0070713_100249253 3300005436 Bacteria 1619
75 Ga0070710_10026241 3300005437 Bacteria 3093
76 Ga0070710_10049348 3300005437 Bacteria 2354
77 Ga0070710_10050771 3300005437 Bacteria 2326
78 Ga0070710_10075868 3300005437 Unclassified 1949
79 Ga0070710_10152075 3300005437 Bacteria 1428
80 Ga0070711_100023987 3300005439 Bacteria 3975
81 Ga0070711_100026953 3300005439 Bacteria 3768
82 Ga0070711_100035490 3300005439 Unclassified 3335
83 Ga0070711_100047568 3300005439 Bacteria 2929
84 Ga0070711_100132476 3300005439 Unclassified 1858
85 Ga0070711_100211195 3300005439 Bacteria 1503
86 Ga0070705_100001164 3300005440 Bacteria 14412
87 Ga0070705_100123953 3300005440 Bacteria 1673
88 Ga0070700_100158380 3300005441 Bacteria 1556
89 Ga0070694_100015975 3300005444 Bacteria 4722
90 Ga0070708_100007147 3300005445 Bacteria 8911
91 Ga0070708_100059301 3300005445 Unclassified 3412
92 Ga0070708_100063183 3300005445 Bacteria 3313
93 Ga0070708_100098970 3300005445 Bacteria 2667
94 Ga0070708_100135317 3300005445 Bacteria 2282
95 Ga0070708_100385045 3300005445 Bacteria 1322
96 Ga0070663_100457018 3300005455 Bacteria 1054
97 Ga0070678_100002602 3300005456 Bacteria 9918
98 Ga0070678_100003517 3300005456 Bacteria 8737
99 Ga0070678_100102376 3300005456 Bacteria 2222
100 Ga0070678_100248859 3300005456 Bacteria 1489
101 Ga0070662_100002629 3300005457 Bacteria 11077
102 Ga0070662_100049702 3300005457 Unclassified 3024
103 Ga0070681_10179079 3300005458 Bacteria 2041
104 Ga0068867_100275390 3300005459 Bacteria 1378
105 Ga0070706_100003809 3300005467 Bacteria 14733
106 Ga0070706_100004920 3300005467 Bacteria 12788
107 Ga0070706_100016008 3300005467 Bacteria 6926
108 Ga0070706_100017361 3300005467 Bacteria 6640
109 Ga0070706_100036664 3300005467 Bacteria 4530
110 Ga0070706_100038135 3300005467 Bacteria 4436
111 Ga0070706_100094958 3300005467 Bacteria 2767
112 Ga0070706_100109506 3300005467 Bacteria 2570
113 Ga0070706_100115675 3300005467 Bacteria 2497
114 Ga0070706_100136973 3300005467 Bacteria 2285
115 Ga0070706_100160527 3300005467 Bacteria 2099
116 Ga0070706_100185736 3300005467 Unclassified 1942
117 Ga0070706_100307310 3300005467 Bacteria 1479
118 Ga0070707_100000596 3300005468 Bacteria 36368
119 Ga0070707_100003415 3300005468 Bacteria 15008
120 Ga0070707_100006151 3300005468 Bacteria 11183
121 Ga0070707_100010754 3300005468 Bacteria 8524
122 Ga0070707_100030394 3300005468 Bacteria 5143
123 Ga0070707_100057882 3300005468 Bacteria 3718
124 Ga0070707_100058776 3300005468 Bacteria 3688
125 Ga0070707_100068074 3300005468 Bacteria 3425
126 Ga0070707_100095466 3300005468 Bacteria 2879
127 Ga0070707_100110212 3300005468 Bacteria 2669
128 Ga0070707_100146377 3300005468 Unclassified 2299
129 Ga0070707_100155480 3300005468 Bacteria 2228
130 Ga0070707_100202583 3300005468 Bacteria 1934
131 Ga0070707_100242917 3300005468 Bacteria 1752
132 Ga0070707_100249724 3300005468 Bacteria 1726
133 Ga0070698_100000272 3300005471 Bacteria 52507
134 Ga0070698_100000415 3300005471 Bacteria 45479
135 Ga0070698_100043551 3300005471 Bacteria 4601
136 Ga0070698_100048934 3300005471 Unclassified 4318
137 Ga0070698_100093507 3300005471 Bacteria 2986
138 Ga0070698_100130972 3300005471 Bacteria 2463
139 Ga0070699_100002396 3300005518 Bacteria 16820
140 Ga0070699_100018135 3300005518 Bacteria 6047
141 Ga0070699_100053079 3300005518 Bacteria 3509
142 Ga0070699_100081547 3300005518 Bacteria 2820
143 Ga0070699_100571562 3300005518 Bacteria 1030
144 Ga0070697_100000864 3300005536 Bacteria 22790
145 Ga0070697_100014825 3300005536 Bacteria 6117
146 Ga0070697_100034248 3300005536 Bacteria 4094
147 Ga0070697_100059774 3300005536 Bacteria 3105
148 Ga0070697_100106012 3300005536 Bacteria 2338
149 Ga0070697_100125384 3300005536 Bacteria 2151
150 Ga0070672_100257353 3300005543 Unclassified 1471
151 Ga0070686_100365828 3300005544 Bacteria 1088
152 Ga0070695_100247210 3300005545 Bacteria 1297
153 Ga0070696_100019431 3300005546 Bacteria 4600
154 Ga0070693_100032597 3300005547 Bacteria 2867
155 Ga0070693_100065965 3300005547 Bacteria 2117
156 Ga0070665_100015082 3300005548 Bacteria 7758
157 Ga0070665_100082041 3300005548 Bacteria 3230
158 Ga0070665_100534849 3300005548 Bacteria 1184
159 Ga0070704_100104116 3300005549 Bacteria 2145
160 Ga0070704_100590672 3300005549 Bacteria 975
161 Ga0068855_100284817 3300005563 Bacteria 1834
162 Ga0070664_100034729 3300005564 Bacteria 4230
163 Ga0070664_100121132 3300005564 Bacteria 2291
164 Ga0068857_100024479 3300005577 Bacteria 5315
165 Ga0068857_100045416 3300005577 Bacteria 3897
166 Ga0068856_100098320 3300005614 Bacteria 2917
167 Ga0068864_100004008 3300005618 Bacteria 12122
168 Ga0068864_100136132 3300005618 Bacteria 2212
169 Ga0068866_10001325 3300005718 Bacteria 10735
170 Ga0068866_10020991 3300005718 Unclassified 3001
171 Ga0068861_100365955 3300005719 Bacteria 1269
172 Ga0068851_10162477 3300005834 Bacteria 1228
173 Ga0068863_100355700 3300005841 Bacteria 1427
174 Ga0068858_100326799 3300005842 Bacteria 1466
175 Ga0068860_100034420 3300005843 Bacteria 4858
176 Ga0068860_100045927 3300005843 Bacteria 4165
177 Ga0068860_100210927 3300005843 Bacteria 1884
178 Ga0068860_100237405 3300005843 Bacteria 1773
179 Ga0068862_100164337 3300005844 Bacteria 1983
180 Ga0081540_1000680 3300005983 Bacteria 31845
181 Ga0081540_1010594 3300005983 Bacteria 6227
182 Ga0081540_1017919 3300005983 Bacteria 4363
183 Ga0081540_1054101 3300005983 Bacteria 1963
184 Ga0081539_10001803 3300005985 Bacteria 33905
185 Ga0081539_10010323 3300005985 Bacteria 7603
186 Ga0070717_10000276 3300006028 Bacteria 35106
187 Ga0070717_10011143 3300006028 Bacteria 6814
188 Ga0070717_10014925 3300006028 Bacteria 5983
189 Ga0070717_10049437 3300006028 Bacteria 3452
190 Ga0070717_10062190 3300006028 Bacteria 3096
191 Ga0070717_10067865 3300006028 Bacteria 2968
192 Ga0070717_10108306 3300006028 Bacteria 2367
193 Ga0070717_10131270 3300006028 Bacteria 2154
194 Ga0070717_10132137 3300006028 Bacteria 2147
195 Ga0070717_10302874 3300006028 Unclassified 1421
196 Ga0075363_100129953 3300006048 Bacteria 1412
197 Ga0075364_10225877 3300006051 Bacteria 1271
198 Ga0070715_10051077 3300006163 Unclassified 1777
199 Ga0070715_10092803 3300006163 Bacteria 1392
200 Ga0070716_100008462 3300006173 Bacteria 5103
201 Ga0070716_100012164 3300006173 Bacteria 4355
202 Ga0070716_100183860 3300006173 Bacteria 1375
203 Ga0070712_100106005 3300006175 Unclassified 2088
204 Ga0070712_100110158 3300006175 Viruses 2053
205 Ga0070712_100133950 3300006175 Bacteria 1882
206 Ga0070712_100147462 3300006175 Bacteria 1802
207 Ga0070712_100244290 3300006175 Unclassified 1431
208 Ga0075366_10029620 3300006195 Bacteria 3216
209 Ga0097621_100056546 3300006237 Bacteria 3205
210 Ga0097621_100075706 3300006237 Bacteria 2790
211 Ga0097621_100139634 3300006237 Bacteria 2070
212 Ga0097621_100345426 3300006237 Bacteria 1322
213 Ga0075370_10006364 3300006353 Bacteria 5930
214 Ga0075428_100001399 3300006844 Bacteria 25667
215 Ga0075431_100577188 3300006847 Bacteria 1110
216 Ga0075433_10059120 3300006852 Bacteria 3354
217 Ga0075434_100000027 3300006871 Bacteria 66092
218 Ga0075434_100017778 3300006871 Bacteria 6857
219 Ga0075434_100576153 3300006871 Unclassified 1145
220 Ga0068865_100093779 3300006881 Bacteria 2183
221 Ga0068865_100103873 3300006881 Unclassified 2085
222 Ga0068865_100312584 3300006881 Unclassified 1261
223 Ga0068865_100440655 3300006881 Bacteria 1075
224 Ga0075436_100023957 3300006914 Bacteria 4194
225 Ga0075436_100034118 3300006914 Unclassified 3508
226 Ga0075436_100128712 3300006914 Bacteria 1775
227 Ga0075435_100002921 3300007076 Bacteria 11474
228 Ga0105240_10032931 3300009093 Bacteria 6702
229 Ga0111539_10000142 3300009094 Bacteria 82331
230 Ga0111539_10001188 3300009094 Bacteria 34610
231 Ga0105245_10009889 3300009098 Bacteria 8306
232 Ga0105245_10091781 3300009098 Bacteria 2796
233 Ga0105247_10053586 3300009101 Bacteria 2488
234 Ga0105247_10123989 3300009101 Bacteria 1677
235 Ga0105247_10355902 3300009101 Bacteria 1031
236 Ga0105247_10382436 3300009101 Unclassified 998
237 Ga0114129_10025353 3300009147 Bacteria 8402
238 Ga0114129_11093987 3300009147 Bacteria 998
239 Ga0105243_10002948 3300009148 Bacteria 14067
240 Ga0105243_10041231 3300009148 Bacteria 3610
241 Ga0105243_10293924 3300009148 Bacteria 1469
242 Ga0105241_10059964 3300009174 Bacteria 2927
243 Ga0105241_10305350 3300009174 Bacteria 1367
244 Ga0105242_10091768 3300009176 Bacteria 2557
245 Ga0105242_10306136 3300009176 Bacteria 1452
246 Ga0105248_10369954 3300009177 Bacteria 1614
247 Ga0105248_10811596 3300009177 Bacteria 1056
248 Ga0105237_10259734 3300009545 Bacteria 1739
249 Ga0105249_10042633 3300009553 Bacteria 4129
250 Ga0105249_10155919 3300009553 Bacteria 2202
251 Ga0105239_10169553 3300010375 Bacteria 2441
252 Ga0105246_10010181 3300011119 Bacteria 5807
253 Ga0105246_10085605 3300011119 Bacteria 2258
254 Ga0105246_10122293 3300011119 Bacteria 1931
255 Ga0105246_10211544 3300011119 Bacteria 1514
256 Ga0157339_1005559 3300012505 Bacteria 999
257 Ga0157371_10023899 3300013102 Bacteria 4466
258 Ga0157370_10077577 3300013104 Bacteria 3129
259 Ga0157369_10062753 3300013105 Bacteria 4003
260 Ga0157369_10145981 3300013105 Bacteria 2501
261 Ga0157374_10021611 3300013296 Bacteria 5729
262 Ga0157374_10051903 3300013296 Bacteria 3817
263 Ga0157374_10187787 3300013296 Unclassified 2021
264 Ga0157374_10209596 3300013296 Bacteria 1910
265 Ga0157374_10382633 3300013296 Unclassified 1402
266 Ga0157378_10066130 3300013297 Bacteria 3237
267 Ga0157378_10204054 3300013297 Bacteria 1871
268 Ga0157378_10289776 3300013297 Unclassified 1581
269 Ga0157378_10290230 3300013297 Bacteria 1580
270 Ga0157378_10364266 3300013297 Unclassified 1415
271 Ga0163162_10006856 3300013306 Bacteria 11053
272 Ga0163162_10120156 3300013306 Unclassified 2731
273 Ga0163162_10182340 3300013306 Unclassified 2226
274 Ga0157372_10109884 3300013307 Bacteria 3158
275 Ga0157372_10173533 3300013307 Unclassified 2495
276 Ga0157375_10009570 3300013308 Bacteria 8509
277 Ga0157375_10020888 3300013308 Bacteria 5993
278 Ga0157375_10071760 3300013308 Bacteria 3477
279 Ga0157375_10113467 3300013308 Bacteria 2811
280 Ga0157375_10159861 3300013308 Bacteria 2394
281 Ga0157375_10275190 3300013308 Bacteria 1846
282 Ga0157375_10432016 3300013308 Bacteria 1483
283 Ga0157380_10176111 3300014326 Bacteria 1874
284 Ga0157380_10316381 3300014326 Bacteria 1445
285 Ga0182008_10059847 3300014497 Bacteria 1879
286 Ga0157377_10011279 3300014745 Bacteria 4454
287 Ga0157376_10005495 3300014969 Bacteria 8863
288 Ga0157376_10072280 3300014969 Bacteria 2934
289 Ga0157376_10096957 3300014969 Unclassified 2567
290 Ga0157376_10167328 3300014969 Bacteria 1998
291 Ga0157376_10215775 3300014969 Bacteria 1774
292 Ga0206353_11242101 3300020082 Bacteria 1106
293 Ga0213875_10000161 3300021388 Bacteria 70921
294 Ga0213875_10000430 3300021388 Bacteria 36686
295 Ga0213875_10008796 3300021388 Bacteria 5154
296 Ga0213875_10011382 3300021388 Bacteria 4425
297 Ga0213875_10052293 3300021388 Bacteria 1913
298 Ga0224712_10065271 3300022467 Bacteria 1462
299 Ga0224572_1001881 3300024225 Bacteria 3247
300 Ga0207697_10003375 3300025315 Bacteria 7928
301 Ga0207697_10009260 3300025315 Unclassified 4260
302 Ga0207653_10020981 3300025885 Bacteria 2070
303 Ga0207682_10005997 3300025893 Bacteria 4913
304 Ga0207692_10011002 3300025898 Bacteria 3830
305 Ga0207692_10092092 3300025898 Bacteria 1646
306 Ga0207642_10005335 3300025899 Bacteria 4188
307 Ga0207642_10010979 3300025899 Bacteria 3215
308 Ga0207642_10011400 3300025899 Bacteria 3170
309 Ga0207688_10019390 3300025901 Bacteria 3705
310 Ga0207688_10068767 3300025901 Bacteria 2006
311 Ga0207688_10092268 3300025901 Bacteria 1740
312 Ga0207647_10102289 3300025904 Bacteria 1699
313 Ga0207685_10067931 3300025905 Bacteria 1435
314 Ga0207699_10003295 3300025906 Bacteria 7696
315 Ga0207699_10018141 3300025906 Bacteria 3724
316 Ga0207699_10096587 3300025906 Bacteria 1866
317 Ga0207699_10101031 3300025906 Bacteria 1830
318 Ga0207699_10101420 3300025906 Bacteria 1827
319 Ga0207699_10230544 3300025906 Bacteria 1268
320 Ga0207645_10001195 3300025907 Bacteria 21426
321 Ga0207645_10008101 3300025907 Bacteria 7364
322 Ga0207645_10133369 3300025907 Bacteria 1617
323 Ga0207684_10001427 3300025910 Bacteria 25824
324 Ga0207684_10003607 3300025910 Bacteria 15065
325 Ga0207684_10003609 3300025910 Bacteria 15062
326 Ga0207684_10018497 3300025910 Bacteria 5965
327 Ga0207684_10021475 3300025910 Bacteria 5513
328 Ga0207684_10029182 3300025910 Bacteria 4699
329 Ga0207684_10031140 3300025910 Bacteria 4540
330 Ga0207684_10042914 3300025910 Bacteria 3834
331 Ga0207684_10055362 3300025910 Bacteria 3365
332 Ga0207684_10071976 3300025910 Bacteria 2937
333 Ga0207684_10073373 3300025910 Bacteria 2906
334 Ga0207684_10096163 3300025910 Bacteria 2528
335 Ga0207684_10170376 3300025910 Bacteria 1877
336 Ga0207684_10411397 3300025910 Bacteria 1162
337 Ga0207654_10266082 3300025911 Bacteria 1155
338 Ga0207654_10297646 3300025911 Bacteria 1096
339 Ga0207695_10000367 3300025913 Bacteria 103313
340 Ga0207693_10019037 3300025915 Bacteria 5465
341 Ga0207693_10032529 3300025915 Bacteria 4116
342 Ga0207693_10032645 3300025915 Bacteria 4108
343 Ga0207693_10034954 3300025915 Bacteria 3964
344 Ga0207693_10040739 3300025915 Bacteria 3658
345 Ga0207693_10045562 3300025915 Bacteria 3446
346 Ga0207693_10073622 3300025915 Bacteria 2674
347 Ga0207693_10158359 3300025915 Bacteria 1781
348 Ga0207693_10306126 3300025915 Bacteria 1244
349 Ga0207693_10437752 3300025915 Bacteria 1022
350 Ga0207663_10013879 3300025916 Unclassified 4394
351 Ga0207663_10022992 3300025916 Bacteria 3571
352 Ga0207663_10035586 3300025916 Bacteria 2989
353 Ga0207663_10043772 3300025916 Bacteria 2744
354 Ga0207663_10117928 3300025916 Bacteria 1812
355 Ga0207663_10165100 3300025916 Bacteria 1567
356 Ga0207663_10407972 3300025916 Bacteria 1040
357 Ga0207662_10005631 3300025918 Bacteria 6698
358 Ga0207657_10014926 3300025919 Bacteria 7552
359 Ga0207652_10154099 3300025921 Bacteria 2058
360 Ga0207646_10000500 3300025922 Bacteria 52535
361 Ga0207646_10000720 3300025922 Bacteria 42935
362 Ga0207646_10010409 3300025922 Bacteria 9094
363 Ga0207646_10015896 3300025922 Bacteria 7078
364 Ga0207646_10032704 3300025922 Bacteria 4706
365 Ga0207646_10043933 3300025922 Bacteria 4011
366 Ga0207646_10050681 3300025922 Unclassified 3714
367 Ga0207646_10051406 3300025922 Bacteria 3688
368 Ga0207646_10085444 3300025922 Bacteria 2823
369 Ga0207646_10117312 3300025922 Bacteria 2390
370 Ga0207646_10208214 3300025922 Bacteria 1766
371 Ga0207646_10258714 3300025922 Bacteria 1573
372 Ga0207646_10288605 3300025922 Bacteria 1482
373 Ga0207646_10330786 3300025922 Unclassified 1376
374 Ga0207646_10390498 3300025922 Bacteria 1257
375 Ga0207681_10029936 3300025923 Bacteria 3544
376 Ga0207681_10035546 3300025923 Bacteria 3283
377 Ga0207681_10418013 3300025923 Bacteria 1086
378 Ga0207694_10210860 3300025924 Bacteria 1582
379 Ga0207694_10212939 3300025924 Bacteria 1574
380 Ga0207650_10010520 3300025925 Bacteria 6346
381 Ga0207650_10103744 3300025925 Bacteria 2193
382 Ga0207659_10003972 3300025926 Bacteria 8924
383 Ga0207659_10018978 3300025926 Bacteria 4517
384 Ga0207687_10024492 3300025927 Bacteria 4033
385 Ga0207700_10014837 3300025928 Bacteria 5118
386 Ga0207700_10020475 3300025928 Bacteria 4494
387 Ga0207700_10057736 3300025928 Bacteria 2928
388 Ga0207700_10176627 3300025928 Bacteria 1785
389 Ga0207700_10381027 3300025928 Bacteria 1233
390 Ga0207664_10002054 3300025929 Bacteria 13257
391 Ga0207664_10022236 3300025929 Bacteria 4732
392 Ga0207664_10063960 3300025929 Bacteria 2941
393 Ga0207664_10195071 3300025929 Bacteria 1745
394 Ga0207664_10195275 3300025929 Bacteria 1744
395 Ga0207664_10278881 3300025929 Bacteria 1466
396 Ga0207644_10019425 3300025931 Bacteria 4610
397 Ga0207644_10024337 3300025931 Bacteria 4155
398 Ga0207644_10066061 3300025931 Bacteria 2632
399 Ga0207706_10000385 3300025933 Bacteria 48316
400 Ga0207706_10017316 3300025933 Bacteria 6491
401 Ga0207706_10336880 3300025933 Bacteria 1312
402 Ga0207686_10000813 3300025934 Bacteria 19071
403 Ga0207709_10034174 3300025935 Bacteria 2994
404 Ga0207709_10041983 3300025935 Bacteria 2748
405 Ga0207709_10327176 3300025935 Bacteria 1149
406 Ga0207670_10192061 3300025936 Unclassified 1546
407 Ga0207669_10139019 3300025937 Unclassified 1683
408 Ga0207704_10001474 3300025938 Bacteria 10534
409 Ga0207665_10002532 3300025939 Bacteria 12296
410 Ga0207665_10004802 3300025939 Bacteria 9000
411 Ga0207665_10006521 3300025939 Bacteria 7739
412 Ga0207665_10014471 3300025939 Bacteria 5195
413 Ga0207665_10018068 3300025939 Bacteria 4633
414 Ga0207691_10031070 3300025940 Bacteria 4989
415 Ga0207691_10284165 3300025940 Bacteria 1423
416 Ga0207711_10004715 3300025941 Bacteria 11588
417 Ga0207711_10140475 3300025941 Bacteria 2172
418 Ga0207689_10014360 3300025942 Bacteria 6737
419 Ga0207679_10126238 3300025945 Bacteria 2045
420 Ga0207667_10341663 3300025949 Bacteria 1528
421 Ga0207667_10507860 3300025949 Bacteria 1222
422 Ga0207651_10006405 3300025960 Bacteria 6159
423 Ga0207651_10220093 3300025960 Unclassified 1534
424 Ga0207651_10221975 3300025960 Bacteria 1528
425 Ga0207712_10001825 3300025961 Bacteria 14058
426 Ga0207668_10295859 3300025972 Bacteria 1334
427 Ga0207640_10001949 3300025981 Bacteria 11104
428 Ga0207658_10019791 3300025986 Bacteria 4657
429 Ga0207658_10130347 3300025986 Bacteria 2019
430 Ga0207677_10023157 3300026023 Bacteria 3830
431 Ga0207677_10079665 3300026023 Bacteria 2343
432 Ga0207677_10271382 3300026023 Bacteria 1388
433 Ga0207703_10042880 3300026035 Bacteria 3630
434 Ga0207703_10080595 3300026035 Bacteria 2711
435 Ga0207639_10077900 3300026041 Bacteria 2614
436 Ga0207678_10022270 3300026067 Bacteria 5551
437 Ga0207678_10065953 3300026067 Bacteria 3108
438 Ga0207678_10334789 3300026067 Bacteria 1303
439 Ga0207708_10009550 3300026075 Bacteria 7192
440 Ga0207708_10082790 3300026075 Bacteria 2467
441 Ga0207702_10090610 3300026078 Bacteria 2676
442 Ga0207702_10552771 3300026078 Bacteria 1126
443 Ga0207641_10195902 3300026088 Bacteria 1860
444 Ga0207648_10000933 3300026089 Bacteria 32938
445 Ga0207648_10420736 3300026089 Bacteria 1213
446 Ga0207676_10117148 3300026095 Bacteria 2240
447 Ga0207676_10262688 3300026095 Bacteria 1559
448 Ga0207674_10016165 3300026116 Bacteria 8174
449 Ga0207674_10024239 3300026116 Bacteria 6486
450 Ga0207674_10389274 3300026116 Bacteria 1348
451 Ga0207674_10551061 3300026116 Bacteria 1114
452 Ga0207675_100004845 3300026118 Bacteria 12964
453 Ga0207675_100019282 3300026118 Bacteria 6363
454 Ga0207683_10008233 3300026121 Bacteria 8921
455 Ga0207683_10008240 3300026121 Bacteria 8914
456 Ga0207683_10111308 3300026121 Bacteria 2452
457 Ga0207698_10200776 3300026142 Bacteria 1785
458 Ga0209966_1017342 3300027695 Bacteria 1372
459 Ga0209974_10005164 3300027876 Bacteria 4609
460 Ga0207428_10025616 3300027907 Bacteria 4935
461 Ga0268266_10023177 3300028379 Bacteria 5286
462 Ga0268265_10032167 3300028380 Bacteria 3797
463 Ga0268264_10003023 3300028381 Bacteria 14581
464 Ga0268264_10049148 3300028381 Bacteria 3508
465 Ga0265338_10004729 3300028800 Bacteria 18217
466 Ga0265338_10076772 3300028800 Bacteria 2827
467 Ga0265320_10096491 3300031240 Bacteria 1365
468 Ga0265325_10056241 3300031241 Bacteria 2010
469 Ga0265327_10000051 3300031251 Bacteria 257963
470 Ga0265316_10041193 3300031344 Bacteria 3698
471 Ga0307408_100025233 3300031548 Bacteria 4070
472 Ga0265313_10017695 3300031595 Bacteria 4034
473 Ga0265313_10092206 3300031595 Bacteria 1358
474 Ga0265314_10032196 3300031711 Bacteria 3859
475 Ga0307413_10081501 3300031824 Bacteria 2075
476 Ga0307410_10019286 3300031852 Bacteria 4144
477 Ga0307406_10321339 3300031901 Bacteria 1197
478 Ga0307412_10034041 3300031911 Bacteria 3244
479 Ga0307409_100061308 3300031995 Bacteria 2939
480 Ga0307416_100034451 3300032002 Bacteria 3853
481 Ga0307416_100059496 3300032002 Bacteria 3105
482 Ga0307416_100075133 3300032002 Bacteria 2827
483 Ga0307414_10096330 3300032004 Bacteria 2214
484 Ga0307411_10059620 3300032005 Bacteria 2531
485 Ga0307415_100005478 3300032126 Bacteria 6744
486 Ga0373926_0004261 3300035083 Bacteria 4678
487 Ga0373926_0023065 3300035083 Bacteria 2159
488 Ga0373934_0016770 3300035086 Bacteria 2787
489 Ga0373934_0035310 3300035086 Bacteria 1966
490 Ga0373944_0002100 3300035089 Bacteria 5061
491 Ga0373944_0023041 3300035089 Bacteria 1813
492 Ga0373944_0072904 3300035089 Bacteria 1122
493 Ga0373923_0002444 3300035111 Bacteria 5721
494 Ga0373923_0020254 3300035111 Bacteria 2582
495 Ga0373936_0000581 3300035113 Bacteria 12597
496 Ga0373936_0001452 3300035113 Bacteria 8601
497 Ga0373936_0002799 3300035113 Bacteria 6500
498 Ga0373936_0017010 3300035113 Bacteria 2797
499 Ga0373936_0028068 3300035113 Bacteria 2211
500 Ga0373945_0001920 3300035116 Bacteria 6448
501 Ga0373954_0004908 3300035118 Bacteria 5774
502 Ga0373954_0029961 3300035118 Bacteria 2509
503 Ga0373954_0158448 3300035118 Bacteria 1107
504 Ga0373956_0005191 3300035119 Bacteria 5216
505 Ga0373956_0008865 3300035119 Bacteria 4076
506 Ga0373956_0033556 3300035119 Bacteria 2257
507 Ga0373957_0013147 3300035120 Bacteria 2802
508 Ga0373957_0027339 3300035120 Bacteria 2072
509 Ga0373943_0000150 3300035170 Bacteria 26925
510 Ga0373943_0013539 3300035170 Bacteria 3684
511 Ga0373943_0038374 3300035170 Bacteria 2302
512 Ga0373946_0000289 3300035171 Bacteria 16200
513 Ga0373946_0000522 3300035171 Bacteria 12736
514 Ga0373946_0044171 3300035171 Bacteria 1839
515 Ga0373955_0046416 3300035172 Bacteria 2348
516 Ga0316574_0063221 3300035398 Bacteria 2327
517 Ga0316574_0330092 3300035398 Unclassified 967
518 Ga0373924_0001686 3300035410 Bacteria 7277
519 Ga0373924_0027279 3300035410 Bacteria 2270
520 Ga0373924_0043036 3300035410 Bacteria 1854
521 Ga0373924_0111743 3300035410 Bacteria 1181
522 Ga0373931_0034787 3300035691 Bacteria 2616
523 Ga0373931_0063176 3300035691 Bacteria 2001
524 Ga0373935_0004988 3300035692 Bacteria 7812
525 Ga0373935_0028214 3300035692 Bacteria 3469
526 Ga0373935_0066842 3300035692 Bacteria 2310
527 Ga0373935_0092436 3300035692 Bacteria 1982
528 Ga0373935_0131996 3300035692 Bacteria 1679
529 Ga0373935_0136007 3300035692 Bacteria 1656
530 Ga0373927_0015021 3300035695 Bacteria 5121
531 Ga0373927_0064527 3300035695 Bacteria 2369
532 Ga0373933_0018855 3300035724 Bacteria 3886
533 Ga0373933_0037900 3300035724 Bacteria 2830
534 Ga0373933_0072989 3300035724 Bacteria 2090
535 Ga0373933_0270824 3300035724 Bacteria 1096
536 Ga0373947_0000012 3300035725 Bacteria 155188
537 Ga0373947_0000160 3300035725 Bacteria 35837
538 Ga0373947_0002086 3300035725 Bacteria 12203
539 Ga0373947_0013982 3300035725 Bacteria 4601
540 Ga0373937_0048253 3300036401 Bacteria 3897
541 Ga0373937_0063380 3300036401 Bacteria 3399
542 Ga0373937_0069210 3300036401 Bacteria 3253
543 Ga0373937_0164610 3300036401 Bacteria 2079
544 Ga0373937_0186686 3300036401 Bacteria 1947
545 Ga0373937_0227613 3300036401 Bacteria 1755
546 Ga0373937_0331458 3300036401 Bacteria 1440
547 Ga0373937_0442724 3300036401 Bacteria 1233
548 Ga0373925_0001574 3300037068 Bacteria 19299
549 Ga0373925_0028061 3300037068 Bacteria 4122
550 Ga0373925_0061501 3300037068 Bacteria 2821
551 Ga0373925_0189938 3300037068 Bacteria 1629
552 Ga0373925_0449967 3300037068 Bacteria 1054
553 Ga0395899_0041455 3300037312 Bacteria 3440
554 Ga0395900_0052844 3300037418 Bacteria 4182
555 Ga0395898_0109542 3300037466 Bacteria 2647
556 Ga0395905_0012512 3300037471 Bacteria 8166
557 Ga0436364_0028100 3300037853 Bacteria 1757
558 Ga0436364_0081322 3300037853 Bacteria 2253
559 Ga0436364_0097537 3300037853 Bacteria 2370
560 Ga0436364_0408959 3300037853 Unclassified 1464
561 Ga0436364_0531667 3300037853 Bacteria 70971
562 Ga0436364_0759698 3300037853 Bacteria 12534
563 Ga0436364_1016447 3300037853 Bacteria 3760
564 Ga0436364_1115616 3300037853 Bacteria 49992
565 Ga0395901_0035108 3300038443 Bacteria 5181
566 Ga0395901_0201684 3300038443 Bacteria 2085
567 Ga0400483_280984 3300039062 Bacteria 1256
568 Ga0436365_1179117 3300039437 Unclassified 1160
569 Ga0436363_0923158 3300039450 Bacteria 1723
570 Ga0436363_1210241 3300039450 Bacteria 1850
571 Ga0439461_0002693 3300041410 Bacteria 2866
572 Ga0451793_0890117 3300041452 Bacteria 1476
573 Ga0451807_0950863 3300041486 Bacteria 2780
574 Ga0451853_1466257 3300041512 Bacteria 1915
575 Ga0439446_0001266 3300042156 Bacteria 5678
576 Ga0450908_007426 3300042184 Bacteria 2067
577 Ga0439435_0000161 3300042436 Bacteria 9250
578 Ga0439460_0021831 3300042461 Bacteria 1753
579 Ga0451577_0474115 3300042876 Bacteria 1136
580 Ga0466963_0045633 3300044694 Bacteria 2887
581 Ga0466963_0167156 3300044694 Bacteria 1532
582 Ga0466959_0057508 3300045049 Bacteria 2835
583 Ga0466967_0178959 3300045976 Bacteria 1999
584 Ga0466967_0408571 3300045976 Bacteria 1322
585 Ga0495629_0001182 3300046459 Bacteria 20585
586 Ga0495641_0028650 3300046461 Bacteria 2693
587 Ga0495651_0024565 3300046462 Bacteria 4687
588 Ga0495651_0056420 3300046462 Bacteria 3017
589 Ga0495651_0076431 3300046462 Bacteria 2536
590 Ga0495651_0080578 3300046462 Bacteria 2459
591 Ga0495651_0098444 3300046462 Bacteria 2182
592 Ga0495653_0008105 3300046463 Bacteria 8605
593 Ga0495653_0039315 3300046463 Bacteria 3706
594 Ga0495653_0080401 3300046463 Bacteria 2411
595 Ga0495653_0109356 3300046463 Bacteria 1989
596 Ga0495580_0025359 3300046472 Bacteria 4333
597 Ga0495580_0072201 3300046472 Unclassified 2411
598 Ga0495582_0010080 3300046473 Bacteria 5203
599 Ga0495582_0020077 3300046473 Bacteria 3655
600 Ga0495639_0004804 3300046475 Bacteria 5812
601 Ga0495639_0035329 3300046475 Bacteria 2236
602 Ga0495662_0001276 3300046476 Bacteria 12448
603 Ga0495662_0025573 3300046476 Bacteria 2851
604 Ga0495662_0053965 3300046476 Bacteria 1941
605 Ga0495662_0164852 3300046476 Bacteria 1092
606 Ga0495664_0001966 3300046477 Bacteria 10940
607 Ga0495664_0007753 3300046477 Bacteria 5974
608 Ga0495664_0028847 3300046477 Bacteria 3242
609 Ga0495664_0037052 3300046477 Bacteria 2877
610 Ga0495664_0043928 3300046477 Bacteria 2648
611 Ga0495664_0076643 3300046477 Bacteria 2001
612 Ga0495594_0012580 3300046499 Bacteria 4411
613 Ga0495594_0037179 3300046499 Bacteria 2656
614 Ga0495608_0003378 3300046511 Bacteria 11423
615 Ga0495608_0007260 3300046511 Bacteria 7835
616 Ga0495608_0048190 3300046511 Bacteria 2832
617 Ga0495618_0038398 3300046514 Bacteria 3009
618 Ga0495618_0107852 3300046514 Bacteria 1783
619 Ga0495628_0042516 3300046516 Bacteria 3624
620 Ga0495628_0087740 3300046516 Bacteria 2411
621 Ga0495628_0145986 3300046516 Bacteria 1803
622 Ga0495628_0285313 3300046516 Bacteria 1225
623 Ga0495630_0003286 3300046517 Bacteria 11276
624 Ga0495630_0018691 3300046517 Bacteria 5091
625 Ga0495630_0074214 3300046517 Bacteria 2561
626 Ga0495630_0111012 3300046517 Bacteria 2077
627 Ga0495666_0034932 3300046526 Bacteria 2452
628 Ga0495652_0038810 3300046529 Bacteria 4122
629 Ga0495652_0046702 3300046529 Bacteria 3716
630 Ga0495652_0120352 3300046529 Bacteria 2095
631 Ga0495665_0000971 3300046531 Bacteria 15188
632 Ga0495665_0015574 3300046531 Bacteria 4092
633 Ga0495640_0066423 3300046533 Bacteria 2432
634 Ga0495586_0011182 3300046535 Bacteria 4769
635 Ga0495586_0082643 3300046535 Bacteria 1766
636 Ga0495587_0005283 3300046536 Bacteria 8443
637 Ga0495587_0023248 3300046536 Bacteria 3809
638 Ga0495587_0166405 3300046536 Bacteria 1253
639 Ga0495645_0003389 3300046543 Bacteria 10802
640 Ga0495645_0005262 3300046543 Bacteria 8862
641 Ga0495645_0019749 3300046543 Bacteria 4854
642 Ga0495622_0040376 3300046557 Bacteria 2172
643 Ga0495667_0022054 3300046559 Bacteria 4292
644 Ga0495667_0040674 3300046559 Bacteria 3085
645 Ga0495667_0049039 3300046559 Bacteria 2787
646 Ga0495667_0087178 3300046559 Bacteria 2024
647 Ga0495634_0002841 3300046642 Bacteria 14224
648 Ga0495634_0024139 3300046642 Bacteria 4269
649 Ga0495634_0087272 3300046642 Bacteria 2030
650 Ga0495634_0170350 3300046642 Bacteria 1368
651 Ga0495635_0000234 3300046663 Bacteria 35181
652 Ga0495635_0014109 3300046663 Bacteria 5591
653 Ga0495635_0052965 3300046663 Bacteria 2795
654 Ga0495657_0004127 3300046675 Bacteria 11635
655 Ga0495657_0004224 3300046675 Bacteria 11492
656 Ga0495657_0036570 3300046675 Bacteria 3392
657 Ga0495657_0088375 3300046675 Bacteria 1992
658 Ga0495657_0096475 3300046675 Bacteria 1889
659 Ga0495599_0011242 3300046678 Bacteria 5497
660 Ga0495599_0023984 3300046678 Bacteria 3815
661 Ga0495599_0114113 3300046678 Bacteria 1681
662 Ga0495623_0022232 3300046679 Bacteria 4096
663 Ga0495623_0057174 3300046679 Bacteria 2454
664 Ga0495623_0059077 3300046679 Bacteria 2409
665 Ga0495623_0061613 3300046679 Bacteria 2352
666 Ga0495646_0046354 3300046680 Bacteria 2650
667 Ga0495658_0002304 3300046683 Bacteria 9630
668 Ga0495669_0034846 3300046684 Bacteria 2220
669 Ga0495613_0043505 3300046689 Bacteria 3322
670 Ga0495613_0130947 3300046689 Bacteria 1796
671 Ga0495613_0325770 3300046689 Bacteria 1060
672 Ga0495624_0004504 3300046690 Bacteria 10191
673 Ga0495624_0049419 3300046690 Bacteria 2667
674 Ga0495624_0100323 3300046690 Bacteria 1783
675 Ga0495600_0005859 3300046809 Bacteria 7432
676 Ga0495600_0030554 3300046809 Bacteria 3489
677 Ga0495600_0042658 3300046809 Bacteria 2957
678 Ga0495600_0128366 3300046809 Bacteria 1648
679 Ga0495581_0000013 3300047315 Bacteria 62822
680 Ga0495581_0003282 3300047315 Bacteria 9283
681 Ga0495604_0011038 3300047317 Bacteria 7169
682 Ga0495604_0126754 3300047317 Bacteria 1839
683 Ga0495604_0275061 3300047317 Bacteria 1139
684 Ga0495604_0372785 3300047317 Bacteria 944
685 Ga0495674_0001144 3300047319 Bacteria 25572
686 Ga0495674_0010460 3300047319 Bacteria 8783
687 Ga0495674_0038127 3300047319 Bacteria 4315
688 Ga0495674_0094207 3300047319 Bacteria 2554
689 Ga0495674_0116372 3300047319 Bacteria 2261
690 Ga0495674_0193679 3300047319 Bacteria 1688
691 Ga0495674_0321871 3300047319 Bacteria 1260
692 Ga0495676_0003561 3300047321 Bacteria 14122
693 Ga0495676_0007271 3300047321 Bacteria 10155
694 Ga0495676_0172416 3300047321 Bacteria 1522
695 Ga0495680_0011975 3300047322 Bacteria 7655
696 Ga0495680_0173038 3300047322 Bacteria 1562
697 Ga0495680_0194998 3300047322 Bacteria 1456
698 Ga0495675_0037486 3300047444 Bacteria 3087
699 Ga0495675_0095252 3300047444 Bacteria 1866
700 Ga0495675_0109780 3300047444 Bacteria 1722
701 Ga0495684_0006947 3300047471 Bacteria 8789
702 Ga0495684_0026233 3300047471 Bacteria 4477
703 Ga0495684_0041957 3300047471 Bacteria 3506
704 Ga0495684_0066890 3300047471 Bacteria 2732
705 Ga0495684_0095581 3300047471 Bacteria 2249
706 Ga0495593_0015001 3300047673 Bacteria 4400
707 Ga0495593_0039215 3300047673 Bacteria 2554
708 Ga0495602_0095181 3300048088 Bacteria 2459
709 Ga0495602_0110350 3300048088 Bacteria 2236
710 Ga0495602_0172308 3300048088 Bacteria 1678
711 Ga0495602_0275589 3300048088 Bacteria 1242
712 Ga0496100_0009792 3300048903 Bacteria 5398
713 Ga0496100_0317204 3300048903 Bacteria 1170
714 Ga0496101_0063697 3300048904 Bacteria 2684
715 Ga0496102_0067335 3300048905 Bacteria 3284
716 Ga0496104_0001838 3300048907 Bacteria 18348
717 Ga0496104_0115934 3300048907 Unclassified 2571
718 Ga0496104_0116854 3300048907 Bacteria 2560
719 Ga0496104_0354787 3300048907 Unclassified 1379
720 Ga0496105_0001913 3300048908 Bacteria 14958
721 Ga0496105_0130143 3300048908 Bacteria 2075
722 Ga0496106_0002885 3300048909 Bacteria 12770
723 Ga0496106_0106899 3300048909 Bacteria 2175
724 Ga0496106_0295254 3300048909 Bacteria 1299
725 Ga0496107_0029197 3300048910 Bacteria 3922
726 Ga0496108_0525131 3300048911 Bacteria 1033
727 Ga0496109_0031624 3300048912 Bacteria 4752
728 Ga0496109_0121911 3300048912 Bacteria 2429
729 Ga0496109_0324416 3300048912 Bacteria 1453
730 Ga0496109_0725368 3300048912 Unclassified 932
731 Ga0496110_0020391 3300048913 Bacteria 5598
732 Ga0496110_0159663 3300048913 Bacteria 2043
733 Ga0496110_0326692 3300048913 Bacteria 1397
734 Ga0496111_0293977 3300048914 Bacteria 1204
735 Ga0496112_0003625 3300048915 Bacteria 12860
736 Ga0496112_0190304 3300048915 Bacteria 2014
737 Ga0496112_0231524 3300048915 Unclassified 1802
738 Ga0496113_0032340 3300048916 Bacteria 3803
739 Ga0496113_0139942 3300048916 Bacteria 1904
740 Ga0496113_0197999 3300048916 Bacteria 1596
741 Ga0496115_0025042 3300048918 Bacteria 4642
742 Ga0496115_0054421 3300048918 Unclassified 3213
743 Ga0496115_0070274 3300048918 Bacteria 2838
744 Ga0496115_0115264 3300048918 Bacteria 2209
745 Ga0501031_0074436 3300049568 Unclassified 2211
746 Ga0501032_0052967 3300049569 Bacteria 2734
747 Ga0501036_0120493 3300049572 Bacteria 2216
748 Ga0501036_0151804 3300049572 Bacteria 1954
749 Ga0501037_0137181 3300049573 Bacteria 1752
750 Ga0501038_0129078 3300049574 Bacteria 2078
751 Ga0501039_0090032 3300049575 Bacteria 2391
752 Ga0501039_0141358 3300049575 Bacteria 1891
753 Ga0501039_0240205 3300049575 Bacteria 1424
754 Ga0501040_0028026 3300049576 Bacteria 3795
755 Ga0501040_0049786 3300049576 Bacteria 2865
756 Ga0501040_0102316 3300049576 Unclassified 1999
757 Ga0501040_0130261 3300049576 Bacteria 1768
758 Ga0501041_0015340 3300049577 Bacteria 4549
759 Ga0501041_0051568 3300049577 Bacteria 2507
760 Ga0501041_0066129 3300049577 Bacteria 2215
761 Ga0501041_0241080 3300049577 Bacteria 1136
762 Ga0501041_0244941 3300049577 Bacteria 1127
763 Ga0501042_0005975 3300049578 Bacteria 7883
764 Ga0501042_0049279 3300049578 Bacteria 3004
765 Ga0501042_0069743 3300049578 Bacteria 2514
766 Ga0501042_0153125 3300049578 Bacteria 1663
767 Ga0501046_0274232 3300049580 Unclassified 1237
768 Ga0501048_0044652 3300049582 Bacteria 3167
769 Ga0501068_0040021 3300049584 Bacteria 2813
770 Ga0501068_0123134 3300049584 Bacteria 1618
771 Ga0501068_0210324 3300049584 Bacteria 1235
772 Ga0501071_0007500 3300049587 Bacteria 7170
773 Ga0501071_0037943 3300049587 Bacteria 3442
774 Ga0501071_0126447 3300049587 Bacteria 1897
775 Ga0501072_0014475 3300049588 Bacteria 6045
776 Ga0501072_0036715 3300049588 Bacteria 3842
777 Ga0501073_0037014 3300049589 Bacteria 3466
778 Ga0501073_0069706 3300049589 Bacteria 2450
779 Ga0501074_0291000 3300049590 Bacteria 1161
780 Ga0501075_0008308 3300049591 Bacteria 7238
781 Ga0501075_0025473 3300049591 Bacteria 4345
782 Ga0501075_0124864 3300049591 Bacteria 1959
783 Ga0501076_0018946 3300049592 Bacteria 5252
784 Ga0501076_0091888 3300049592 Bacteria 2441
785 Ga0501076_0134280 3300049592 Bacteria 2009
786 Ga0501077_0059636 3300049593 Bacteria 2422
787 Ga0501077_0216147 3300049593 Unclassified 1218
788 Ga0501079_0215609 3300049741 Unclassified 1499
789 Ga0501080_0012874 3300049742 Bacteria 7676
790 Ga0501080_0224955 3300049742 Bacteria 1716
791 Ga0501080_0410869 3300049742 Unclassified 1217
792 Ga0501081_0005774 3300049743 Bacteria 8013
793 Ga0501081_0015932 3300049743 Bacteria 4963
794 Ga0501081_0117699 3300049743 Unclassified 1890
795 Ga0501081_0124568 3300049743 Bacteria 1838
796 Ga0501081_0187320 3300049743 Bacteria 1498
797 Ga0501083_0025889 3300049744 Bacteria 4060
798 Ga0501035_0088523 3300049822 Bacteria 2728
799 Ga0501045_0005233 3300049824 Bacteria 8976
800 Ga0501045_0048797 3300049824 Bacteria 3086
801 Ga0501045_0083577 3300049824 Bacteria 2355
802 Ga0501045_0116220 3300049824 Bacteria 1985
803 nmdc:mga03n38_49469_c1 3300050490 Bacteria 1869
804 nmdc:mga00v17_189712_c1 3300050491 Bacteria 1327
805 nmdc:mga00v17_64195_c1 3300050491 Bacteria 2263
806 nmdc:mga06z11_29511_c1 3300050494 Bacteria 2643
807 nmdc:mga04h51_65147_c1 3300050495 Bacteria 1259
808 nmdc:mga07m45_4370_c1 3300050496 Bacteria 6915
809 nmdc:mga0qj67_74332_c1 3300050509 Bacteria 2716
810 nmdc:mga06r32_354652_c1 3300050510 Bacteria 1451
811 nmdc:mga06r32_478516_c1 3300050510 Bacteria 1223
812 nmdc:mga06r32_555225_c1 3300050510 Bacteria 1122
813 nmdc:mga08y16_10065_c1 3300050511 Bacteria 9926
814 nmdc:mga08y16_13733_c1 3300050511 Bacteria 8526
815 nmdc:mga08y16_456047_c1 3300050511 Bacteria 1303
816 nmdc:mga0n895_143_c1 3300050512 Bacteria 43481
817 nmdc:mga0n895_17132_c1 3300050512 Bacteria 6675
818 nmdc:mga0rr50_287088_c1 3300050513 Unclassified 1374
819 nmdc:mga0rr50_45206_c1 3300050513 Bacteria 3235
820 nmdc:mga08x19_21134_c1 3300050514 Bacteria 4014
821 nmdc:mga0a205_69390_c1 3300050515 Bacteria 3403
822 nmdc:mga0a205_87_c1 3300050515 Bacteria 51120
823 Ga0495601_0019368 3300053077 Bacteria 4151
824 Ga0495601_0041515 3300053077 Bacteria 2884
825 Ga0495601_0047877 3300053077 Bacteria 2692
826 Ga0495612_0002015 3300053078 Bacteria 8365
827 Ga0495612_0007405 3300053078 Bacteria 4486
828 Ga0495612_0012708 3300053078 Bacteria 3393
829 Ga0495612_0126289 3300053078 Bacteria 1103
830 Ga0495595_0166859 3300053084 Bacteria 1088
831 Ga0495595_0202937 3300053084 Bacteria 987
832 Ga0495619_0005076 3300053085 Bacteria 8362
833 Ga0501084_0035052 3300054114 Bacteria 4195
834 Ga0501084_0095641 3300054114 Bacteria 2495
835 Ga0501082_0010210 3300060353 Bacteria 8083
836 Ga0501082_0060586 3300060353 Bacteria 3258
837 Ga0530510_0077072 3300061734 Bacteria 2423
838 2774396473 2773857762 Bacteria 5971770
839 2809198129 2808606439 Bacteria 5952208
840 2812353183 2811994878 Bacteria 5992952
841 2891969194 2891968417 Bacteria 5821697
842 Ga0436364_1029185
843 CNXas_1000106
844 JGI24737J22298_10019269
845 JGI25406J46586_10033852
846 rootL2_10283179
847 rootH1_10297839
848 JGI25405J52794_10001159
849 Ga0065712_10071752
850 Ga0065712_10076362
851 Ga0065712_10112324
852 Ga0065715_10115992
853 Ga0065715_10269210
854 Ga0065707_10122970
855 Ga0070676_10012441
856 Ga0070676_10015058
857 Ga0070676_10034917
858 Ga0070683_100140986
859 Ga0070683_100296192
860 Ga0070690_100062878
861 Ga0070670_100028308
862 Ga0070670_100087004
863 Ga0070677_10026578
864 Ga0068869_100033967
865 Ga0070666_10041763
866 Ga0068868_100046597
867 Ga0068868_100070885
868 Ga0068868_100101000
869 Ga0070660_100282824
870 Ga0070689_100035065
871 Ga0070691_10025837
872 Ga0070687_100086316
873 Ga0070687_100155061
874 Ga0070661_100028111
875 Ga0070668_100038731
876 Ga0070668_100246024
877 Ga0070669_100014019
878 Ga0070669_100018362
879 Ga0070669_100108537
880 Ga0070669_100151585
881 Ga0070675_100054888
882 Ga0070675_100058891
883 Ga0070675_100186316
884 Ga0070675_100225353
885 Ga0070671_100030011
886 Ga0070671_100043837
887 Ga0070671_100054892
888 Ga0070674_100008238
889 Ga0070674_100014578
890 Ga0070673_100056039
891 Ga0070673_100113898
892 Ga0070673_100183194
893 Ga0070673_100350367
894 Ga0070688_100121353
895 Ga0070659_100048869
896 Ga0070659_100270224
897 Ga0070667_100012780
898 Ga0070667_100019907
899 Ga0070703_10047024
900 Ga0070709_10028768
901 Ga0070714_100000657
902 Ga0070714_100003814
903 Ga0070714_100012376
904 Ga0070714_100119023
905 Ga0070714_100231101
906 Ga0070714_100247744
907 Ga0070714_100368592
908 Ga0070713_100007742
909 Ga0070713_100049570
910 Ga0070713_100050796
911 Ga0070713_100133263
912 Ga0070713_100137712
913 Ga0070713_100217106
914 Ga0070713_100227310
915 Ga0070713_100249253
916 Ga0070710_10026241
917 Ga0070710_10049348
918 Ga0070710_10050771
919 Ga0070710_10075868
920 Ga0070710_10152075
921 Ga0070711_100023987
922 Ga0070711_100026953
923 Ga0070711_100035490
924 Ga0070711_100047568
925 Ga0070711_100132476
926 Ga0070711_100211195
927 Ga0070705_100001164
928 Ga0070705_100123953
929 Ga0070700_100158380
930 Ga0070694_100015975
931 Ga0070708_100007147
932 Ga0070708_100059301
933 Ga0070708_100063183
934 Ga0070708_100098970
935 Ga0070708_100135317
936 Ga0070708_100385045
937 Ga0070663_100457018
938 Ga0070678_100002602
939 Ga0070678_100003517
940 Ga0070678_100102376
941 Ga0070678_100248859
942 Ga0070662_100002629
943 Ga0070662_100049702
944 Ga0070681_10179079
945 Ga0068867_100275390
946 Ga0070706_100003809
947 Ga0070706_100004920
948 Ga0070706_100016008
949 Ga0070706_100017361
950 Ga0070706_100036664
951 Ga0070706_100038135
952 Ga0070706_100094958
953 Ga0070706_100109506
954 Ga0070706_100115675
955 Ga0070706_100136973
956 Ga0070706_100160527
957 Ga0070706_100185736
958 Ga0070706_100307310
959 Ga0070707_100000596
960 Ga0070707_100003415
961 Ga0070707_100006151
962 Ga0070707_100010754
963 Ga0070707_100030394
964 Ga0070707_100057882
965 Ga0070707_100058776
966 Ga0070707_100068074
967 Ga0070707_100095466
968 Ga0070707_100110212
969 Ga0070707_100146377
970 Ga0070707_100155480
971 Ga0070707_100202583
972 Ga0070707_100242917
973 Ga0070707_100249724
974 Ga0070698_100000272
975 Ga0070698_100000415
976 Ga0070698_100043551
977 Ga0070698_100048934
978 Ga0070698_100093507
979 Ga0070698_100130972
980 Ga0070699_100002396
981 Ga0070699_100018135
982 Ga0070699_100053079
983 Ga0070699_100081547
984 Ga0070699_100571562
985 Ga0070697_100000864
986 Ga0070697_100014825
987 Ga0070697_100034248
988 Ga0070697_100059774
989 Ga0070697_100106012
990 Ga0070697_100125384
991 Ga0070672_100257353
992 Ga0070686_100365828
993 Ga0070695_100247210
994 Ga0070696_100019431
995 Ga0070693_100032597
996 Ga0070693_100065965
997 Ga0070665_100015082
998 Ga0070665_100082041
999 Ga0070665_100534849
1000 Ga0070704_100104116
1001 Ga0070704_100590672
1002 Ga0068855_100284817
1003 Ga0070664_100034729
1004 Ga0070664_100121132
1005 Ga0068857_100024479
1006 Ga0068857_100045416
1007 Ga0068856_100098320
1008 Ga0068864_100004008
1009 Ga0068864_100136132
1010 Ga0068866_10001325
1011 Ga0068866_10020991
1012 Ga0068861_100365955
1013 Ga0068851_10162477
1014 Ga0068863_100355700
1015 Ga0068858_100326799
1016 Ga0068860_100034420
1017 Ga0068860_100045927
1018 Ga0068860_100210927
1019 Ga0068860_100237405
1020 Ga0068862_100164337
1021 Ga0081540_1000680
1022 Ga0081540_1010594
1023 Ga0081540_1017919
1024 Ga0081540_1054101
1025 Ga0081539_10001803
1026 Ga0081539_10010323
1027 Ga0070717_10000276
1028 Ga0070717_10011143
1029 Ga0070717_10014925
1030 Ga0070717_10049437
1031 Ga0070717_10062190
1032 Ga0070717_10067865
1033 Ga0070717_10108306
1034 Ga0070717_10131270
1035 Ga0070717_10132137
1036 Ga0070717_10302874
1037 Ga0075363_100129953
1038 Ga0075364_10225877
1039 Ga0070715_10051077
1040 Ga0070715_10092803
1041 Ga0070716_100008462
1042 Ga0070716_100012164
1043 Ga0070716_100183860
1044 Ga0070712_100106005
1045 Ga0070712_100110158
1046 Ga0070712_100133950
1047 Ga0070712_100147462
1048 Ga0070712_100244290
1049 Ga0075366_10029620
1050 Ga0097621_100056546
1051 Ga0097621_100075706
1052 Ga0097621_100139634
1053 Ga0097621_100345426
1054 Ga0075370_10006364
1055 Ga0075428_100001399
1056 Ga0075431_100577188
1057 Ga0075433_10059120
1058 Ga0075434_100000027
1059 Ga0075434_100017778
1060 Ga0075434_100576153
1061 Ga0068865_100093779
1062 Ga0068865_100103873
1063 Ga0068865_100312584
1064 Ga0068865_100440655
1065 Ga0075436_100023957
1066 Ga0075436_100034118
1067 Ga0075436_100128712
1068 Ga0075435_100002921
1069 Ga0105240_10032931
1070 Ga0111539_10000142
1071 Ga0111539_10001188
1072 Ga0105245_10009889
1073 Ga0105245_10091781
1074 Ga0105247_10053586
1075 Ga0105247_10123989
1076 Ga0105247_10355902
1077 Ga0105247_10382436
1078 Ga0114129_10025353
1079 Ga0114129_11093987
1080 Ga0105243_10002948
1081 Ga0105243_10041231
1082 Ga0105243_10293924
1083 Ga0105241_10059964
1084 Ga0105241_10305350
1085 Ga0105242_10091768
1086 Ga0105242_10306136
1087 Ga0105248_10369954
1088 Ga0105248_10811596
1089 Ga0105237_10259734
1090 Ga0105249_10042633
1091 Ga0105249_10155919
1092 Ga0105239_10169553
1093 Ga0105246_10010181
1094 Ga0105246_10085605
1095 Ga0105246_10122293
1096 Ga0105246_10211544
1097 Ga0157339_1005559
1098 Ga0157371_10023899
1099 Ga0157370_10077577
1100 Ga0157369_10062753
1101 Ga0157369_10145981
1102 Ga0157374_10021611
1103 Ga0157374_10051903
1104 Ga0157374_10187787
1105 Ga0157374_10209596
1106 Ga0157374_10382633
1107 Ga0157378_10066130
1108 Ga0157378_10204054
1109 Ga0157378_10289776
1110 Ga0157378_10290230
1111 Ga0157378_10364266
1112 Ga0163162_10006856
1113 Ga0163162_10120156
1114 Ga0163162_10182340
1115 Ga0157372_10109884
1116 Ga0157372_10173533
1117 Ga0157375_10009570
1118 Ga0157375_10020888
1119 Ga0157375_10071760
1120 Ga0157375_10113467
1121 Ga0157375_10159861
1122 Ga0157375_10275190
1123 Ga0157375_10432016
1124 Ga0157380_10176111
1125 Ga0157380_10316381
1126 Ga0182008_10059847
1127 Ga0157377_10011279
1128 Ga0157376_10005495
1129 Ga0157376_10072280
1130 Ga0157376_10096957
1131 Ga0157376_10167328
1132 Ga0157376_10215775
1133 Ga0206353_11242101
1134 Ga0213875_10000161
1135 Ga0213875_10000430
1136 Ga0213875_10008796
1137 Ga0213875_10011382
1138 Ga0213875_10052293
1139 Ga0224712_10065271
1140 Ga0224572_1001881
1141 Ga0207697_10003375
1142 Ga0207697_10009260
1143 Ga0207653_10020981
1144 Ga0207682_10005997
1145 Ga0207692_10011002
1146 Ga0207692_10092092
1147 Ga0207642_10005335
1148 Ga0207642_10010979
1149 Ga0207642_10011400
1150 Ga0207688_10019390
1151 Ga0207688_10068767
1152 Ga0207688_10092268
1153 Ga0207647_10102289
1154 Ga0207685_10067931
1155 Ga0207699_10003295
1156 Ga0207699_10018141
1157 Ga0207699_10096587
1158 Ga0207699_10101031
1159 Ga0207699_10101420
1160 Ga0207699_10230544
1161 Ga0207645_10001195
1162 Ga0207645_10008101
1163 Ga0207645_10133369
1164 Ga0207684_10001427
1165 Ga0207684_10003607
1166 Ga0207684_10003609
1167 Ga0207684_10018497
1168 Ga0207684_10021475
1169 Ga0207684_10029182
1170 Ga0207684_10031140
1171 Ga0207684_10042914
1172 Ga0207684_10055362
1173 Ga0207684_10071976
1174 Ga0207684_10073373
1175 Ga0207684_10096163
1176 Ga0207684_10170376
1177 Ga0207684_10411397
1178 Ga0207654_10266082
1179 Ga0207654_10297646
1180 Ga0207695_10000367
1181 Ga0207693_10019037
1182 Ga0207693_10032529
1183 Ga0207693_10032645
1184 Ga0207693_10034954
1185 Ga0207693_10040739
1186 Ga0207693_10045562
1187 Ga0207693_10073622
1188 Ga0207693_10158359
1189 Ga0207693_10306126
1190 Ga0207693_10437752
1191 Ga0207663_10013879
1192 Ga0207663_10022992
1193 Ga0207663_10035586
1194 Ga0207663_10043772
1195 Ga0207663_10117928
1196 Ga0207663_10165100
1197 Ga0207663_10407972
1198 Ga0207662_10005631
1199 Ga0207657_10014926
1200 Ga0207652_10154099
1201 Ga0207646_10000500
1202 Ga0207646_10000720
1203 Ga0207646_10010409
1204 Ga0207646_10015896
1205 Ga0207646_10032704
1206 Ga0207646_10043933
1207 Ga0207646_10050681
1208 Ga0207646_10051406
1209 Ga0207646_10085444
1210 Ga0207646_10117312
1211 Ga0207646_10208214
1212 Ga0207646_10258714
1213 Ga0207646_10288605
1214 Ga0207646_10330786
1215 Ga0207646_10390498
1216 Ga0207681_10029936
1217 Ga0207681_10035546
1218 Ga0207681_10418013
1219 Ga0207694_10210860
1220 Ga0207694_10212939
1221 Ga0207650_10010520
1222 Ga0207650_10103744
1223 Ga0207659_10003972
1224 Ga0207659_10018978
1225 Ga0207687_10024492
1226 Ga0207700_10014837
1227 Ga0207700_10020475
1228 Ga0207700_10057736
1229 Ga0207700_10176627
1230 Ga0207700_10381027
1231 Ga0207664_10002054
1232 Ga0207664_10022236
1233 Ga0207664_10063960
1234 Ga0207664_10195071
1235 Ga0207664_10195275
1236 Ga0207664_10278881
1237 Ga0207644_10019425
1238 Ga0207644_10024337
1239 Ga0207644_10066061
1240 Ga0207706_10000385
1241 Ga0207706_10017316
1242 Ga0207706_10336880
1243 Ga0207686_10000813
1244 Ga0207709_10034174
1245 Ga0207709_10041983
1246 Ga0207709_10327176
1247 Ga0207670_10192061
1248 Ga0207669_10139019
1249 Ga0207704_10001474
1250 Ga0207665_10002532
1251 Ga0207665_10004802
1252 Ga0207665_10006521
1253 Ga0207665_10014471
1254 Ga0207665_10018068
1255 Ga0207691_10031070
1256 Ga0207691_10284165
1257 Ga0207711_10004715
1258 Ga0207711_10140475
1259 Ga0207689_10014360
1260 Ga0207679_10126238
1261 Ga0207667_10341663
1262 Ga0207667_10507860
1263 Ga0207651_10006405
1264 Ga0207651_10220093
1265 Ga0207651_10221975
1266 Ga0207712_10001825
1267 Ga0207668_10295859
1268 Ga0207640_10001949
1269 Ga0207658_10019791
1270 Ga0207658_10130347
1271 Ga0207677_10023157
1272 Ga0207677_10079665
1273 Ga0207677_10271382
1274 Ga0207703_10042880
1275 Ga0207703_10080595
1276 Ga0207639_10077900
1277 Ga0207678_10022270
1278 Ga0207678_10065953
1279 Ga0207678_10334789
1280 Ga0207708_10009550
1281 Ga0207708_10082790
1282 Ga0207702_10090610
1283 Ga0207702_10552771
1284 Ga0207641_10195902
1285 Ga0207648_10000933
1286 Ga0207648_10420736
1287 Ga0207676_10117148
1288 Ga0207676_10262688
1289 Ga0207674_10016165
1290 Ga0207674_10024239
1291 Ga0207674_10389274
1292 Ga0207674_10551061
1293 Ga0207675_100004845
1294 Ga0207675_100019282
1295 Ga0207683_10008233
1296 Ga0207683_10008240
1297 Ga0207683_10111308
1298 Ga0207698_10200776
1299 Ga0209966_1017342
1300 Ga0209974_10005164
1301 Ga0207428_10025616
1302 Ga0268266_10023177
1303 Ga0268265_10032167
1304 Ga0268264_10003023
1305 Ga0268264_10049148
1306 Ga0265338_10004729
1307 Ga0265338_10076772
1308 Ga0265320_10096491
1309 Ga0265325_10056241
1310 Ga0265327_10000051
1311 Ga0265316_10041193
1312 Ga0307408_100025233
1313 Ga0265313_10017695
1314 Ga0265313_10092206
1315 Ga0265314_10032196
1316 Ga0307413_10081501
1317 Ga0307410_10019286
1318 Ga0307406_10321339
1319 Ga0307412_10034041
1320 Ga0307409_100061308
1321 Ga0307416_100034451
1322 Ga0307416_100059496
1323 Ga0307416_100075133
1324 Ga0307414_10096330
1325 Ga0307411_10059620
1326 Ga0307415_100005478
1327 Ga0373926_0004261
1328 Ga0373926_0023065
1329 Ga0373934_0016770
1330 Ga0373934_0035310
1331 Ga0373944_0002100
1332 Ga0373944_0023041
1333 Ga0373944_0072904
1334 Ga0373923_0002444
1335 Ga0373923_0020254
1336 Ga0373936_0000581
1337 Ga0373936_0001452
1338 Ga0373936_0002799
1339 Ga0373936_0017010
1340 Ga0373936_0028068
1341 Ga0373945_0001920
1342 Ga0373954_0004908
1343 Ga0373954_0029961
1344 Ga0373954_0158448
1345 Ga0373956_0005191
1346 Ga0373956_0008865
1347 Ga0373956_0033556
1348 Ga0373957_0013147
1349 Ga0373957_0027339
1350 Ga0373943_0000150
1351 Ga0373943_0013539
1352 Ga0373943_0038374
1353 Ga0373946_0000289
1354 Ga0373946_0000522
1355 Ga0373946_0044171
1356 Ga0373955_0046416
1357 Ga0316574_0063221
1358 Ga0316574_0330092
1359 Ga0373924_0001686
1360 Ga0373924_0027279
1361 Ga0373924_0043036
1362 Ga0373924_0111743
1363 Ga0373931_0034787
1364 Ga0373931_0063176
1365 Ga0373935_0004988
1366 Ga0373935_0028214
1367 Ga0373935_0066842
1368 Ga0373935_0092436
1369 Ga0373935_0131996
1370 Ga0373935_0136007
1371 Ga0373927_0015021
1372 Ga0373927_0064527
1373 Ga0373933_0018855
1374 Ga0373933_0037900
1375 Ga0373933_0072989
1376 Ga0373933_0270824
1377 Ga0373947_0000012
1378 Ga0373947_0000160
1379 Ga0373947_0002086
1380 Ga0373947_0013982
1381 Ga0373937_0048253
1382 Ga0373937_0063380
1383 Ga0373937_0069210
1384 Ga0373937_0164610
1385 Ga0373937_0186686
1386 Ga0373937_0227613
1387 Ga0373937_0331458
1388 Ga0373937_0442724
1389 Ga0373925_0001574
1390 Ga0373925_0028061
1391 Ga0373925_0061501
1392 Ga0373925_0189938
1393 Ga0373925_0449967
1394 Ga0395899_0041455
1395 Ga0395900_0052844
1396 Ga0395898_0109542
1397 Ga0395905_0012512
1398 Ga0436364_0028100
1399 Ga0436364_0081322
1400 Ga0436364_0097537
1401 Ga0436364_0408959
1402 Ga0436364_0531667
1403 Ga0436364_0759698
1404 Ga0436364_1016447
1405 Ga0436364_1115616
1406 Ga0395901_0035108
1407 Ga0395901_0201684
1408 Ga0400483_280984
1409 Ga0436365_1179117
1410 Ga0436363_0923158
1411 Ga0436363_1210241
1412 Ga0439461_0002693
1413 Ga0451793_0890117
1414 Ga0451807_0950863
1415 Ga0451853_1466257
1416 Ga0439446_0001266
1417 Ga0450908_007426
1418 Ga0439435_0000161
1419 Ga0439460_0021831
1420 Ga0451577_0474115
1421 Ga0466963_0045633
1422 Ga0466963_0167156
1423 Ga0466959_0057508
1424 Ga0466967_0178959
1425 Ga0466967_0408571
1426 Ga0495629_0001182
1427 Ga0495641_0028650
1428 Ga0495651_0024565
1429 Ga0495651_0056420
1430 Ga0495651_0076431
1431 Ga0495651_0080578
1432 Ga0495651_0098444
1433 Ga0495653_0008105
1434 Ga0495653_0039315
1435 Ga0495653_0080401
1436 Ga0495653_0109356
1437 Ga0495580_0025359
1438 Ga0495580_0072201
1439 Ga0495582_0010080
1440 Ga0495582_0020077
1441 Ga0495639_0004804
1442 Ga0495639_0035329
1443 Ga0495662_0001276
1444 Ga0495662_0025573
1445 Ga0495662_0053965
1446 Ga0495662_0164852
1447 Ga0495664_0001966
1448 Ga0495664_0007753
1449 Ga0495664_0028847
1450 Ga0495664_0037052
1451 Ga0495664_0043928
1452 Ga0495664_0076643
1453 Ga0495594_0012580
1454 Ga0495594_0037179
1455 Ga0495608_0003378
1456 Ga0495608_0007260
1457 Ga0495608_0048190
1458 Ga0495618_0038398
1459 Ga0495618_0107852
1460 Ga0495628_0042516
1461 Ga0495628_0087740
1462 Ga0495628_0145986
1463 Ga0495628_0285313
1464 Ga0495630_0003286
1465 Ga0495630_0018691
1466 Ga0495630_0074214
1467 Ga0495630_0111012
1468 Ga0495666_0034932
1469 Ga0495652_0038810
1470 Ga0495652_0046702
1471 Ga0495652_0120352
1472 Ga0495665_0000971
1473 Ga0495665_0015574
1474 Ga0495640_0066423
1475 Ga0495586_0011182
1476 Ga0495586_0082643
1477 Ga0495587_0005283
1478 Ga0495587_0023248
1479 Ga0495587_0166405
1480 Ga0495645_0003389
1481 Ga0495645_0005262
1482 Ga0495645_0019749
1483 Ga0495622_0040376
1484 Ga0495667_0022054
1485 Ga0495667_0040674
1486 Ga0495667_0049039
1487 Ga0495667_0087178
1488 Ga0495634_0002841
1489 Ga0495634_0024139
1490 Ga0495634_0087272
1491 Ga0495634_0170350
1492 Ga0495635_0000234
1493 Ga0495635_0014109
1494 Ga0495635_0052965
1495 Ga0495657_0004127
1496 Ga0495657_0004224
1497 Ga0495657_0036570
1498 Ga0495657_0088375
1499 Ga0495657_0096475
1500 Ga0495599_0011242
1501 Ga0495599_0023984
1502 Ga0495599_0114113
1503 Ga0495623_0022232
1504 Ga0495623_0057174
1505 Ga0495623_0059077
1506 Ga0495623_0061613
1507 Ga0495646_0046354
1508 Ga0495658_0002304
1509 Ga0495669_0034846
1510 Ga0495613_0043505
1511 Ga0495613_0130947
1512 Ga0495613_0325770
1513 Ga0495624_0004504
1514 Ga0495624_0049419
1515 Ga0495624_0100323
1516 Ga0495600_0005859
1517 Ga0495600_0030554
1518 Ga0495600_0042658
1519 Ga0495600_0128366
1520 Ga0495581_0000013
1521 Ga0495581_0003282
1522 Ga0495604_0011038
1523 Ga0495604_0126754
1524 Ga0495604_0275061
1525 Ga0495604_0372785
1526 Ga0495674_0001144
1527 Ga0495674_0010460
1528 Ga0495674_0038127
1529 Ga0495674_0094207
1530 Ga0495674_0116372
1531 Ga0495674_0193679
1532 Ga0495674_0321871
1533 Ga0495676_0003561
1534 Ga0495676_0007271
1535 Ga0495676_0172416
1536 Ga0495680_0011975
1537 Ga0495680_0173038
1538 Ga0495680_0194998
1539 Ga0495675_0037486
1540 Ga0495675_0095252
1541 Ga0495675_0109780
1542 Ga0495684_0006947
1543 Ga0495684_0026233
1544 Ga0495684_0041957
1545 Ga0495684_0066890
1546 Ga0495684_0095581
1547 Ga0495593_0015001
1548 Ga0495593_0039215
1549 Ga0495602_0095181
1550 Ga0495602_0110350
1551 Ga0495602_0172308
1552 Ga0495602_0275589
1553 Ga0496100_0009792
1554 Ga0496100_0317204
1555 Ga0496101_0063697
1556 Ga0496102_0067335
1557 Ga0496104_0001838
1558 Ga0496104_0115934
1559 Ga0496104_0116854
1560 Ga0496104_0354787
1561 Ga0496105_0001913
1562 Ga0496105_0130143
1563 Ga0496106_0002885
1564 Ga0496106_0106899
1565 Ga0496106_0295254
1566 Ga0496107_0029197
1567 Ga0496108_0525131
1568 Ga0496109_0031624
1569 Ga0496109_0121911
1570 Ga0496109_0324416
1571 Ga0496109_0725368
1572 Ga0496110_0020391
1573 Ga0496110_0159663
1574 Ga0496110_0326692
1575 Ga0496111_0293977
1576 Ga0496112_0003625
1577 Ga0496112_0190304
1578 Ga0496112_0231524
1579 Ga0496113_0032340
1580 Ga0496113_0139942
1581 Ga0496113_0197999
1582 Ga0496115_0025042
1583 Ga0496115_0054421
1584 Ga0496115_0070274
1585 Ga0496115_0115264
1586 Ga0501031_0074436
1587 Ga0501032_0052967
1588 Ga0501036_0120493
1589 Ga0501036_0151804
1590 Ga0501037_0137181
1591 Ga0501038_0129078
1592 Ga0501039_0090032
1593 Ga0501039_0141358
1594 Ga0501039_0240205
1595 Ga0501040_0028026
1596 Ga0501040_0049786
1597 Ga0501040_0102316
1598 Ga0501040_0130261
1599 Ga0501041_0015340
1600 Ga0501041_0051568
1601 Ga0501041_0066129
1602 Ga0501041_0241080
1603 Ga0501041_0244941
1604 Ga0501042_0005975
1605 Ga0501042_0049279
1606 Ga0501042_0069743
1607 Ga0501042_0153125
1608 Ga0501046_0274232
1609 Ga0501048_0044652
1610 Ga0501068_0040021
1611 Ga0501068_0123134
1612 Ga0501068_0210324
1613 Ga0501071_0007500
1614 Ga0501071_0037943
1615 Ga0501071_0126447
1616 Ga0501072_0014475
1617 Ga0501072_0036715
1618 Ga0501073_0037014
1619 Ga0501073_0069706
1620 Ga0501074_0291000
1621 Ga0501075_0008308
1622 Ga0501075_0025473
1623 Ga0501075_0124864
1624 Ga0501076_0018946
1625 Ga0501076_0091888
1626 Ga0501076_0134280
1627 Ga0501077_0059636
1628 Ga0501077_0216147
1629 Ga0501079_0215609
1630 Ga0501080_0012874
1631 Ga0501080_0224955
1632 Ga0501080_0410869
1633 Ga0501081_0005774
1634 Ga0501081_0015932
1635 Ga0501081_0117699
1636 Ga0501081_0124568
1637 Ga0501081_0187320
1638 Ga0501083_0025889
1639 Ga0501035_0088523
1640 Ga0501045_0005233
1641 Ga0501045_0048797
1642 Ga0501045_0083577
1643 Ga0501045_0116220
1644 nmdc:mga03n38_49469_c1
1645 nmdc:mga00v17_189712_c1
1646 nmdc:mga00v17_64195_c1
1647 nmdc:mga06z11_29511_c1
1648 nmdc:mga04h51_65147_c1
1649 nmdc:mga07m45_4370_c1
1650 nmdc:mga0qj67_74332_c1
1651 nmdc:mga06r32_354652_c1
1652 nmdc:mga06r32_478516_c1
1653 nmdc:mga06r32_555225_c1
1654 nmdc:mga08y16_10065_c1
1655 nmdc:mga08y16_13733_c1
1656 nmdc:mga08y16_456047_c1
1657 nmdc:mga0n895_143_c1
1658 nmdc:mga0n895_17132_c1
1659 nmdc:mga0rr50_287088_c1
1660 nmdc:mga0rr50_45206_c1
1661 nmdc:mga08x19_21134_c1
1662 nmdc:mga0a205_69390_c1
1663 nmdc:mga0a205_87_c1
1664 Ga0495601_0019368
1665 Ga0495601_0041515
1666 Ga0495601_0047877
1667 Ga0495612_0002015
1668 Ga0495612_0007405
1669 Ga0495612_0012708
1670 Ga0495612_0126289
1671 Ga0495595_0166859
1672 Ga0495595_0202937
1673 Ga0495619_0005076
1674 Ga0501084_0035052
1675 Ga0501084_0095641
1676 Ga0501082_0010210
1677 Ga0501082_0060586
1678 Ga0530510_0077072
1679 2774396473
1680 2809198129
1681 2812353183
1682 2891969194

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

40

266

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cm0-assembly1.cif.gz_C-2 crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans 0.9481 11 299
5cm0-assembly1.cif.gz_A-2 crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans 0.9472 11 298
5cm0-assembly1.cif.gz_C-2 crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans 0.9448 11 299
5e25-assembly1.cif.gz_C crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate 0.9444 11 298
5mqz-assembly1.cif.gz_B archaeal branched-chain amino acid aminotransferase from archaeoglobus fulgidus; holoform 0.9434 12 298
ID Description Score Start End Superfamily
af_I1JRF2_257_378_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9765 6 125 3.30.470.10
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9596 137 289 3.20.10.10
af_I1JRF2_385_551_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9582 133 296 3.20.10.10
5mr0A02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.954 139 289 3.20.10.10
af_I1JRF2_257_378_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.953 6 125 3.30.470.10
ID Description Score Start End GO Terms
AF-A0A7Y2H014-F1-model_v4 Aminotransferase IV 0.9722 198 299 GO:0008483
GO:0046394
AF-A0A068VAT3-F1-model_v4 Branched-chain-amino-acid aminotransferase-like protein 1 0.971 3 298 GO:0003824
GO:0046394
AF-A0A2V5XN59-F1-model_v4 Aminotransferase IV 0.971 1 255 GO:0008483
GO:0046394
AF-I1JRF2-F1-model_v4 Branched-chain-amino-acid aminotransferase-like protein 1 0.9705 3 298 GO:0003824
GO:0019752
GO:0046394
AF-A0A1U8BBX5-F1-model_v4 Branched-chain-amino-acid aminotransferase-like protein 1 isoform X1 0.9699 3 298 GO:0008483
GO:0019752
GO:0046394

Map