F483006

General Info

Members Datasets Scaffolds Average Seq Length
839 596 456 306

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10113723|rootL2_101137232
Length 366
Sequence MPAPLPVGKRPLAVKGPVILFDKSSIIAHISRNWAACATFAWAVLHFNGLDPAIHSQPQEDDMSDNGDLTVQKLAMWGIPLSLGVMGLKMVAWWVTGSVALLSDGLESTVNVVAAFIAFFVIRYAQKPADHDHPFGHHKAEYLSAVTEGVLIVVAALLIVKEAIGYLAEPRMLDAPVLGLAINIAAGLINAVWAQLLIRTGRKHRSAALAADGQHIMSDVVTSVGVLVXXXMALATGYAIFDPVLAILVAINILYQGWKVISQSISGLMDQAVEPQEEEAIKQAIATHAAGSIGVHDLKTRRAGTVTFIDFHMVVPGTMSVRQAHDICDRLEDAIRAVHEGAKIAIHVEPEGEKAHGIRVKVIKEA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
18 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
19 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
20 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
21 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
24 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
25 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
26 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
27 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
28 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
29 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
30 2516143018 Ensifer sp. BR816 Isolate Nodule
31 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
32 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
33 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
34 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
35 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
36 2519899620 Rhizobium sp. Pop5 Isolate Nodule
37 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
38 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
39 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
40 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
41 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
42 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
43 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
44 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
45 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
46 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
47 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
48 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
49 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
50 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
51 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
52 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
53 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
54 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
55 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
56 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
57 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
58 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
59 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
60 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
61 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
62 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
63 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
64 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
65 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
66 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
67 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
68 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
69 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
70 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
71 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
72 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
73 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
74 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
75 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
76 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
77 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
78 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
79 2643221557 Ensifer sp. Root558 Isolate Unclassified
80 2643221558 Rhizobium sp. Root149 Isolate Unclassified
81 2643221568 Rhizobium sp. Root564 Isolate Unclassified
82 2643221582 Rhizobium sp. Root651 Isolate Unclassified
83 2643221599 Rhizobium sp. Root708 Isolate Unclassified
84 2643221607 Rhizobium sp. Root73 Isolate Unclassified
85 2643221610 Ensifer sp. Root74 Isolate Unclassified
86 2643221618 Ensifer sp. Root231 Isolate Unclassified
87 2643221626 Ensifer sp. Root31 Isolate Unclassified
88 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
89 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
90 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
91 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
92 2643221655 Ensifer sp. Root1252 Isolate Unclassified
93 2643221659 Ensifer sp. Root127 Isolate Unclassified
94 2643221668 Ensifer sp. Root423 Isolate Unclassified
95 2643221675 Ensifer sp. Root1298 Isolate Unclassified
96 2643221680 Ensifer sp. Root1312 Isolate Unclassified
97 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
98 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
99 2643221693 Rhizobium sp. Root491 Isolate Unclassified
100 2643221698 Ensifer sp. Root142 Isolate Unclassified
101 2643221712 Ensifer sp. Root258 Isolate Unclassified
102 2643221719 Rhizobium sp. Root274 Isolate Unclassified
103 2643221723 Ensifer sp. Root278 Isolate Unclassified
104 2643221726 Ensifer sp. Root954 Isolate Unclassified
105 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
106 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
107 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
108 2718217882 Rhizobium sp. N741 Isolate Nodule
109 2718217927 Rhizobium sp. N324 Isolate Nodule
110 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
111 2718218009 Rhizobium sp. N561 Isolate Nodule
112 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
113 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
114 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
115 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
116 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
117 2718218363 Rhizobium sp. N113 Isolate Nodule
118 2718218365 Rhizobium sp. N731 Isolate Nodule
119 2718218366 Rhizobium sp. N621 Isolate Nodule
120 2718218423 Rhizobium sp. N941 Isolate Nodule
121 2721755514 Rhizobium sp. N6212 Isolate Nodule
122 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
123 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
124 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
125 2721755809 Rhizobium sp. N541 Isolate Nodule
126 2721755810 Rhizobium sp. N871 Isolate Nodule
127 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
128 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
129 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
130 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
131 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
132 2728369365 Rhizobium sp. N1341 Isolate Nodule
133 2728369397 Rhizobium sp. N1314 Isolate Nodule
134 2738541293 Rhizobium sp. GV031 Isolate Unclassified
135 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
136 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
137 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
138 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
139 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
140 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
141 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
142 2791355256 Rhizobium sp. M10 Isolate Nodule
143 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
144 2791355260 Rhizobium sp. L9 Isolate Nodule
145 2791355261 Rhizobium sp. J15 Isolate Nodule
146 2791355262 Rhizobium sp. M1 Isolate Nodule
147 2791355263 Rhizobium chutanense C5 Isolate Nodule
148 2791355264 Rhizobium sp. S9 Isolate Nodule
149 2791355266 Rhizobium sp. L43 Isolate Nodule
150 2791355267 Rhizobium sp. L18 Isolate Nodule
151 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
152 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
153 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
154 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
155 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
156 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
157 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
158 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
159 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
160 2802429633 Rhizobium anhuiense J3 Isolate Nodule
161 2802429634 Rhizobium anhuiense S10 Isolate Nodule
162 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
163 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
164 2802429637 Rhizobium anhuiense C15 Isolate Nodule
165 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
166 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
167 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
168 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
169 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
170 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
171 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
172 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
173 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
174 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
175 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
176 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
177 2838048938 Rhizobium pisi 27/80 Isolate Nodule
178 2838061910 Rhizobium phaseoli L15 Isolate Nodule
179 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
180 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
181 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
182 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
183 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
184 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
185 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
186 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
187 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
188 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
189 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
190 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
191 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
192 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
193 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
194 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
195 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
196 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
197 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
198 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
199 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
200 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
201 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
202 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
203 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
204 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
205 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
206 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
207 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
208 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
209 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
210 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
211 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
212 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
213 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
214 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
215 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
216 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
217 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
218 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
219 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
220 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
221 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
222 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
223 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
224 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
225 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
226 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
227 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
228 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
229 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
230 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
231 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
232 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
233 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
234 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
235 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
236 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
237 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
238 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
239 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
240 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
241 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
242 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
243 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
244 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
245 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
246 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
247 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
248 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
249 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
250 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
251 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
252 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
253 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
254 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
255 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
256 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
257 2844163670 Ensifer sp. 1H6 Isolate Unclassified
258 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
259 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
260 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
261 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
262 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
263 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
264 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
265 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
266 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
267 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
268 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
269 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
270 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
271 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
272 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
273 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
274 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
275 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
276 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
277 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
278 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
279 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
280 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
281 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
282 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
283 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
284 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
285 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
286 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
287 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
288 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
289 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
290 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
291 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
292 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
293 2933599457 Rhizobium phaseoli M3 Isolate Nodule
294 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
295 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
296 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
297 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
298 2936381700 Rhizobium chutanense C16 Isolate Unclassified
299 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
300 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
301 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
302 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
303 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
304 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
305 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
306 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
307 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
308 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
309 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
310 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
311 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
312 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
313 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
314 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
315 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
316 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
317 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
318 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
319 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
320 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
321 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
322 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
323 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
324 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
325 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
326 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
327 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
328 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
329 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
330 2996887358 Rhizobium sp. R711 Isolate Nodule
331 2996893221 Rhizobium sp. R635 Isolate Nodule
332 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
333 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
334 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
335 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
336 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
337 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
338 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
339 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
340 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
341 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
342 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
343 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
344 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
345 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
346 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
347 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
348 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
349 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
350 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
351 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
352 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
353 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
354 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
355 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
356 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
357 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
358 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
359 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
360 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
361 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
362 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
363 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
364 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
365 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
366 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
367 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
368 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
369 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
370 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
371 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
372 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
373 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
374 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
375 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
376 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
377 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
378 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
379 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
380 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
381 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
382 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
383 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
384 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
385 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
386 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
387 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
388 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
389 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
390 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
391 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
392 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
393 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
394 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
395 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
396 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
397 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
398 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
399 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
401 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
402 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
403 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
404 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
406 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
407 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
408 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
409 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
410 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
411 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
412 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
413 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
414 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
415 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
416 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
417 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
430 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
431 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
432 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
433 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
435 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
436 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
437 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
438 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
439 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
440 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
441 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
442 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
443 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
444 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
445 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
446 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
447 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
448 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
449 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
450 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
451 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
452 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
453 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
454 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
455 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
456 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
457 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
458 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
459 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
460 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
461 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
462 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
463 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
464 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
465 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
466 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
467 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
468 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
469 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
470 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
471 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
472 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
473 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
474 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
475 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
476 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
477 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
478 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
479 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
480 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
481 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
482 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
483 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
484 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
485 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
486 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
487 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
488 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
489 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
490 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
491 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
492 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
493 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
494 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
495 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
496 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
497 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
498 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
499 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
500 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
501 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
502 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
503 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
504 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
505 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
506 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
509 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
510 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
511 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
512 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
513 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
514 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
515 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
516 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
517 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
518 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
519 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
521 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
522 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
523 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
524 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
525 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
526 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
527 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
528 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
529 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
530 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
531 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
532 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
533 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
534 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
535 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
536 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
537 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
538 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
539 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
540 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
541 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
542 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
543 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
544 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
545 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
546 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
547 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
548 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
549 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
550 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
551 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
552 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
553 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
554 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
555 8005258706 Rhizobium sp. R693 Isolate Nodule
556 8005275841 Rhizobium sp. N4311 Isolate Nodule
557 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
558 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
559 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
560 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
561 8005321885 Rhizobium sp. R72 Isolate Nodule
562 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
563 8005382845 Rhizobium sp. R634 Isolate Nodule
564 8005395548 Rhizobium sp. R339 Isolate Nodule
565 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
566 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
567 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
568 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
569 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
570 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
571 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
572 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
573 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
574 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
575 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
576 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
577 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
578 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
579 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
580 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
581 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
582 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
583 8018176218 Rhizobium sp. N122 Isolate Nodule
584 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
585 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
586 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
587 8024501048 Rhizobium sp. H4 Isolate Nodule
588 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
589 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
590 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
591 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
592 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
593 8056382006 Rhizobium croatiense 13T Isolate Nodule
594 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
595 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
596 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.23
Metatranscriptomes 0.12
Isolates 45.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 23.24
Nodule 31.23
Rhizoplane 2.03
Rhizosphere 22.29
Stem 0
Stem Tuber 0
Unclassified 20.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000037 3300002705 Bacteria 109690
2 JGI25156J39149_1000079 3300002705 Bacteria 73408
3 JGI25154J39366_1000052 3300002738 Bacteria 120209
4 JGI25158J39367_1000499 3300002739 Bacteria 7922
5 JGI25158J39367_1003574 3300002739 Bacteria 2389
6 JGI25157J39369_1000040 3300002741 Bacteria 126165
7 JGI25152J39213_1001025 3300002773 Bacteria 13379
8 JGI25152J39213_1002772 3300002773 Bacteria 6349
9 JGI25152J39213_1004429 3300002773 Bacteria 4424
10 JGI25150J39212_1000088 3300002774 Bacteria 53538
11 JGI25150J39212_1005664 3300002774 Bacteria 2648
12 JGI25159J45721_1000004 3300002987 Bacteria 215789
13 JGI25159J45721_1001399 3300002987 Bacteria 10011
14 JGI25159J45721_1006965 3300002987 Bacteria 3304
15 JGI25151J46595_10000215 3300003187 Bacteria 69771
16 JGI25151J46595_10000280 3300003187 Bacteria 58125
17 JGI25151J46595_10005849 3300003187 Bacteria 6291
18 JGI25151J46595_10006069 3300003187 Bacteria 6142
19 JGI25151J46595_10024325 3300003187 Bacteria 2480
20 JGI25151J46595_10024843 3300003187 Bacteria 2445
21 JGI25165J46597_1000462 3300003214 Bacteria 40205
22 JGI25153J46596_10001244 3300003215 Bacteria 15371
23 JGI25153J46596_10007382 3300003215 Bacteria 5419
24 JGI25153J46596_10021503 3300003215 Bacteria 2403
25 rootH2_10230930 3300003320 Bacteria 1810
26 rootL2_10049246 3300003322 Bacteria 3927
27 rootL2_10113723 3300003322 Bacteria 1624
28 JGI25160J50197_1000001 3300003354 Bacteria 782301
29 JGI25160J50197_1000021 3300003354 Bacteria 215789
30 JGI25160J50197_1001207 3300003354 Bacteria 13131
31 JGI25160J50197_1011565 3300003354 Bacteria 3120
32 JGI25161J50226_1000001 3300003374 Bacteria 655036
33 JGI25161J50226_1000283 3300003374 Bacteria 28981
34 JGI25161J50226_1000307 3300003374 Bacteria 27289
35 JGI25161J50226_1009056 3300003374 Bacteria 1461
36 Ga0006562J51391_1040650 3300003578 Bacteria 1045
37 Ga0055526_1001084 3300003771 Bacteria 19838
38 Ga0055526_1002599 3300003771 Bacteria 12069
39 Ga0055526_1004226 3300003771 Bacteria 8720
40 Ga0055526_1013834 3300003771 Bacteria 3374
41 Ga0055524_1002465 3300003775 Bacteria 9507
42 Ga0055524_1004489 3300003775 Bacteria 6431
43 Ga0055524_1004911 3300003775 Bacteria 6069
44 Ga0055524_1009251 3300003775 Bacteria 4029
45 Ga0055524_1011052 3300003775 Bacteria 3553
46 Ga0055536_1023096 3300003781 Bacteria 1838
47 Ga0055528_1000549 3300003790 Bacteria 28640
48 Ga0055528_1001077 3300003790 Bacteria 17996
49 Ga0055528_1009596 3300003790 Bacteria 4028
50 Ga0055528_1010707 3300003790 Bacteria 3706
51 Ga0055528_1013733 3300003790 Bacteria 3049
52 Ga0055530_10007952 3300003791 Bacteria 4340
53 Ga0055530_10031737 3300003791 Bacteria 1383
54 Ga0055540_1000766 3300003792 Bacteria 21853
55 Ga0055540_1005952 3300003792 Bacteria 4961
56 Ga0055540_1014722 3300003792 Bacteria 2314
57 Ga0055531_10002883 3300003794 Bacteria 11200
58 Ga0055531_10028376 3300003794 Bacteria 1932
59 Ga0055531_10034379 3300003794 Bacteria 1609
60 Ga0055543_1000003 3300004625 Bacteria 358656
61 Ga0055543_1000060 3300004625 Bacteria 98330
62 Ga0055543_1000311 3300004625 Bacteria 33798
63 Ga0055543_1000705 3300004625 Bacteria 17007
64 Ga0065165_1000008 3300005262 Bacteria 334429
65 Ga0065165_1000033 3300005262 Bacteria 215827
66 Ga0065165_1004838 3300005262 Bacteria 8007
67 Ga0070668_100140038 3300005347 Bacteria 1949
68 Ga0070668_100292013 3300005347 Bacteria 1365
69 Ga0070663_100067010 3300005455 Bacteria 2603
70 Ga0070665_100002486 3300005548 Bacteria 20302
71 Ga0070665_100156948 3300005548 Bacteria 2277
72 Ga0068854_100069462 3300005578 Bacteria 2572
73 Ga0068851_10068800 3300005834 Bacteria 1828
74 Ga0075365_10000291 3300006038 Bacteria 17391
75 Ga0075365_10002452 3300006038 Bacteria 9106
76 Ga0075365_10017736 3300006038 Bacteria 4364
77 Ga0075368_10027260 3300006042 Bacteria 2202
78 Ga0075363_100077069 3300006048 Bacteria 1819
79 Ga0075364_10002108 3300006051 Bacteria 11108
80 Ga0075364_10099563 3300006051 Bacteria 1935
81 Ga0075362_10000446 3300006177 Bacteria 11962
82 Ga0075362_10099331 3300006177 Bacteria 1359
83 Ga0075367_10005571 3300006178 Bacteria 6272
84 Ga0075367_10047982 3300006178 Bacteria 2514
85 Ga0075366_10003015 3300006195 Bacteria 8787
86 Ga0075366_10081508 3300006195 Bacteria 1933
87 Ga0075366_10131247 3300006195 Bacteria 1512
88 Ga0075370_10023891 3300006353 Bacteria 3371
89 Ga0075370_10045499 3300006353 Bacteria 2482
90 Ga0079104_1000884 3300006946 Bacteria 24591
91 Ga0099826_10010998 3300006948 Bacteria 6799
92 Ga0105251_10006266 3300009011 Bacteria 7622
93 Ga0105240_10000014 3300009093 Bacteria 482033
94 Ga0111539_10111906 3300009094 Unclassified 3203
95 Ga0114129_10098959 3300009147 Bacteria 4037
96 Ga0105243_10012270 3300009148 Bacteria 6481
97 Ga0105248_10019194 3300009177 Bacteria 7563
98 Ga0105237_10003542 3300009545 Bacteria 18502
99 Ga0123342_1010951 3300009766 Bacteria 10166
100 Ga0105239_10000973 3300010375 Bacteria 40196
101 Ga0105239_10054475 3300010375 Bacteria 4388
102 Ga0105246_10261856 3300011119 Bacteria 1378
103 Ga0157373_10018335 3300013100 Bacteria 5098
104 Ga0157373_10062061 3300013100 Bacteria 2647
105 Ga0157371_10000017 3300013102 Bacteria 320830
106 Ga0157371_10029204 3300013102 Bacteria 3991
107 Ga0157370_10000327 3300013104 Bacteria 59705
108 Ga0157370_10000616 3300013104 Bacteria 44220
109 Ga0157370_10140662 3300013104 Bacteria 2249
110 Ga0157369_10234709 3300013105 Bacteria 1917
111 Ga0182008_10017060 3300014497 Bacteria 3768
112 Ga0182007_10002083 3300015262 Bacteria 10267
113 Ga0182005_1001327 3300015265 Bacteria 10109
114 Ga0214544_1000110 3300021320 Bacteria 113143
115 Ga0214542_1000268 3300021321 Bacteria 87082
116 Ga0214542_1013594 3300021321 Bacteria 9673
117 Ga0214543_1000022 3300021327 Bacteria 241930
118 Ga0214543_1000219 3300021327 Bacteria 87102
119 Ga0228711_1000026 3300022739 Bacteria 101497
120 Ga0228710_1000005 3300022740 Bacteria 233531
121 Ga0209435_100027 3300025206 Bacteria 196217
122 Ga0209436_100061 3300025208 Bacteria 58629
123 Ga0209436_100422 3300025208 Bacteria 18988
124 Ga0209436_109886 3300025208 Bacteria 1781
125 Ga0209563_104435 3300025230 Bacteria 2684
126 Ga0209437_100060 3300025233 Bacteria 355034
127 Ga0207425_1000432 3300025245 Bacteria 27708
128 Ga0207425_1011073 3300025245 Bacteria 2169
129 Ga0207425_1019735 3300025245 Bacteria 1448
130 Ga0209646_1000086 3300025246 Bacteria 196217
131 Ga0209646_1012199 3300025246 Bacteria 1322
132 Ga0209026_1000082 3300025250 Bacteria 196315
133 Ga0209677_100273 3300025253 Bacteria 34599
134 Ga0209759_1000063 3300025256 Bacteria 196315
135 Ga0209129_1000029 3300025258 Bacteria 401149
136 Ga0209129_1000307 3300025258 Bacteria 44447
137 Ga0209129_1000433 3300025258 Bacteria 31302
138 Ga0209129_1001238 3300025258 Bacteria 14649
139 Ga0209129_1003217 3300025258 Bacteria 7286
140 Ga0209129_1006305 3300025258 Bacteria 3884
141 Ga0209129_1006840 3300025258 Bacteria 3560
142 Ga0209129_1019492 3300025258 Bacteria 1280
143 Ga0209233_1000095 3300025261 Bacteria 303783
144 Ga0209233_1000228 3300025261 Bacteria 100100
145 Ga0209673_1000010 3300025273 Bacteria 596656
146 Ga0209673_1000025 3300025273 Bacteria 404572
147 Ga0209673_1000112 3300025273 Bacteria 179676
148 Ga0209673_1000858 3300025273 Bacteria 39511
149 Ga0209673_1003176 3300025273 Bacteria 10010
150 Ga0209673_1006098 3300025273 Bacteria 5910
151 Ga0209673_1013587 3300025273 Bacteria 3203
152 Ga0209130_1000003 3300025284 Bacteria 677988
153 Ga0209130_1000017 3300025284 Bacteria 388431
154 Ga0209130_1000020 3300025284 Bacteria 379297
155 Ga0209130_1017463 3300025284 Bacteria 1708
156 Ga0209676_1005472 3300025292 Bacteria 6627
157 Ga0209676_1009017 3300025292 Bacteria 4363
158 Ga0209676_1034629 3300025292 Bacteria 1491
159 Ga0209025_1000070 3300025294 Bacteria 287776
160 Ga0209025_1000091 3300025294 Bacteria 250401
161 Ga0209025_1000154 3300025294 Bacteria 170288
162 Ga0209025_1000161 3300025294 Bacteria 166506
163 Ga0209025_1000171 3300025294 Bacteria 160478
164 Ga0209025_1000927 3300025294 Bacteria 44856
165 Ga0209025_1002842 3300025294 Bacteria 17370
166 Ga0209025_1007846 3300025294 Bacteria 7836
167 Ga0209025_1011929 3300025294 Bacteria 5650
168 Ga0209025_1014918 3300025294 Bacteria 4733
169 Ga0209564_1000013 3300025295 Bacteria 775755
170 Ga0209564_1000265 3300025295 Bacteria 110606
171 Ga0209564_1000607 3300025295 Bacteria 55712
172 Ga0209564_1001968 3300025295 Bacteria 18089
173 Ga0209564_1008091 3300025295 Bacteria 5262
174 Ga0209564_1019072 3300025295 Bacteria 2581
175 Ga0209758_1000058 3300025297 Bacteria 331603
176 Ga0209758_1000094 3300025297 Bacteria 241068
177 Ga0209758_1000671 3300025297 Bacteria 51169
178 Ga0209758_1005284 3300025297 Bacteria 10089
179 Ga0209758_1012944 3300025297 Bacteria 4607
180 Ga0209758_1013086 3300025297 Bacteria 4562
181 Ga0209758_1036138 3300025297 Bacteria 1934
182 Ga0209050_1002996 3300025298 Bacteria 13124
183 Ga0209050_1005559 3300025298 Bacteria 7851
184 Ga0209050_1005667 3300025298 Bacteria 7728
185 Ga0209256_1000153 3300025299 Bacteria 144736
186 Ga0209256_1000381 3300025299 Bacteria 70973
187 Ga0209256_1000655 3300025299 Bacteria 47114
188 Ga0209256_1001163 3300025299 Bacteria 29718
189 Ga0209256_1002016 3300025299 Bacteria 18118
190 Ga0209256_1004610 3300025299 Bacteria 8514
191 Ga0207426_1000006 3300025302 Bacteria 1025969
192 Ga0207426_1000008 3300025302 Bacteria 848730
193 Ga0207426_1000011 3300025302 Bacteria 791203
194 Ga0207426_1000344 3300025302 Bacteria 85912
195 Ga0207426_1001833 3300025302 Bacteria 15687
196 Ga0209051_1001157 3300025303 Bacteria 23986
197 Ga0209051_1005910 3300025303 Bacteria 7025
198 Ga0209051_1013821 3300025303 Bacteria 3811
199 Ga0209051_1014703 3300025303 Bacteria 3637
200 Ga0209257_1002974 3300025304 Bacteria 15474
201 Ga0209257_1008365 3300025304 Bacteria 5906
202 Ga0209257_1013242 3300025304 Bacteria 3696
203 Ga0209257_1015197 3300025304 Bacteria 3228
204 Ga0209257_1045308 3300025304 Bacteria 1278
205 Ga0207713_1047877 3300025735 Bacteria 1726
206 Ga0207695_10000037 3300025913 Bacteria 476303
207 Ga0207671_10000271 3300025914 Bacteria 77228
208 Ga0207644_10071576 3300025931 Bacteria 2537
209 Ga0207709_10157354 3300025935 Bacteria 1581
210 Ga0207711_10231808 3300025941 Bacteria 1691
211 Ga0207640_10052246 3300025981 Bacteria 2661
212 Ga0207678_10060891 3300026067 Bacteria 3246
213 Ga0207702_10344263 3300026078 Bacteria 1425
214 Ga0207674_10278512 3300026116 Bacteria 1620
215 Ga0209281_1000034 3300027111 Bacteria 382562
216 Ga0209281_1000082 3300027111 Bacteria 257684
217 Ga0209371_1000022 3300027312 Bacteria 536342
218 Ga0209371_1000892 3300027312 Bacteria 23789
219 Ga0209282_1000006 3300027666 Bacteria 276998
220 Ga0209282_1007756 3300027666 Bacteria 6737
221 Ga0209282_1030375 3300027666 Bacteria 3327
222 Ga0209813_10008682 3300027866 Bacteria 2575
223 Ga0268266_10003866 3300028379 Bacteria 14604
224 Ga0268266_10075098 3300028379 Bacteria 2936
225 Ga0307515_10046209 3300028794 Bacteria 6662
226 Ga0268256_1000019 3300030500 Bacteria 587949
227 Ga0268256_1004440 3300030500 Bacteria 5814
228 Ga0268256_1006062 3300030500 Bacteria 4582
229 Ga0307513_10015439 3300031456 Bacteria 9257
230 Ga0307513_10228324 3300031456 Unclassified 1676
231 Ga0307405_10002746 3300031731 Bacteria 7890
232 Ga0307406_10174446 3300031901 Bacteria 1559
233 Ga0307412_10002363 3300031911 Bacteria 10464
234 Ga0315914_1000003 3300031967 Bacteria 314370
235 Ga0307416_100255445 3300032002 Bacteria 1709
236 Ga0315913_1000001 3300033430 Bacteria 284459
237 Ga0315915_1000008 3300033464 Bacteria 258517
238 Ga0373925_0002516 3300037068 Bacteria 14642
239 Ga0395905_0011510 3300037471 Bacteria 8548
240 Ga0439438_016435 3300041405 Bacteria 2151
241 Ga0451837_0772324 3300041494 Bacteria 1973
242 Ga0451841_1151175 3300041498 Bacteria 2696
243 Ga0451847_0188909 3300041503 Bacteria 3856
244 Ga0451847_0462778 3300041503 Bacteria 1183
245 Ga0451849_0136450 3300041505 Bacteria 1569
246 Ga0451851_0841407 3300041507 Bacteria 3595
247 Ga0451843_0035237 3300041509 Bacteria 2676
248 Ga0451853_2160098 3300041512 Bacteria 1867
249 Ga0439432_023767 3300042006 Bacteria 2017
250 Ga0439449_0004055 3300042007 Bacteria 5671
251 Ga0439449_0017852 3300042007 Bacteria 2663
252 Ga0495629_0204869 3300046459 Bacteria 1363
253 Ga0495638_0001134 3300046460 Bacteria 25773
254 Ga0495585_0060355 3300046492 Bacteria 2087
255 Ga0495585_0082654 3300046492 Bacteria 1738
256 Ga0495596_0027893 3300046500 Bacteria 2268
257 Ga0495607_0010334 3300046501 Bacteria 6279
258 Ga0495607_0046074 3300046501 Bacteria 2563
259 Ga0495606_0004697 3300046507 Bacteria 13488
260 Ga0495606_0007767 3300046507 Bacteria 9492
261 Ga0495610_0003664 3300046512 Bacteria 11821
262 Ga0495610_0031382 3300046512 Bacteria 2772
263 Ga0495610_0074944 3300046512 Bacteria 1568
264 Ga0495616_0022251 3300046513 Bacteria 3424
265 Ga0495620_0012468 3300046515 Bacteria 4388
266 Ga0495631_0001584 3300046518 Bacteria 13671
267 Ga0495631_0042961 3300046518 Bacteria 1995
268 Ga0495631_0055442 3300046518 Bacteria 1727
269 Ga0495632_0009886 3300046519 Bacteria 5703
270 Ga0495632_0041708 3300046519 Bacteria 2304
271 Ga0495632_0183183 3300046519 Bacteria 959
272 Ga0495643_0031297 3300046522 Bacteria 2962
273 Ga0495643_0032218 3300046522 Bacteria 2911
274 Ga0495643_0130604 3300046522 Bacteria 1261
275 Ga0495648_0029469 3300046524 Bacteria 3643
276 Ga0495648_0148184 3300046524 Bacteria 1227
277 Ga0495654_0001572 3300046530 Bacteria 15496
278 Ga0495654_0011933 3300046530 Bacteria 4685
279 Ga0495597_0029591 3300046542 Bacteria 2500
280 Ga0495668_0009467 3300046616 Bacteria 5984
281 Ga0495668_0012948 3300046616 Bacteria 4937
282 Ga0495611_0020130 3300046648 Bacteria 2870
283 Ga0495625_0002255 3300046660 Bacteria 21195
284 Ga0495625_0060018 3300046660 Bacteria 2696
285 Ga0495625_0078863 3300046660 Bacteria 2298
286 Ga0495588_0001571 3300046674 Bacteria 9773
287 Ga0495588_0136732 3300046674 Bacteria 1294
288 Ga0495670_0012039 3300046691 Bacteria 4258
289 Ga0495671_0065310 3300046692 Bacteria 1791
290 Ga0495649_0028150 3300046694 Bacteria 3115
291 Ga0495660_0004669 3300046810 Bacteria 8269
292 Ga0495636_0037530 3300047318 Bacteria 2001
293 Ga0495672_0005525 3300047320 Bacteria 10005
294 Ga0495683_0049570 3300047323 Bacteria 2103
295 Ga0495681_0013102 3300047470 Bacteria 4834
296 Ga0495681_0071488 3300047470 Bacteria 1571
297 Ga0495686_0001486 3300047472 Bacteria 25489
298 Ga0495686_0010881 3300047472 Bacteria 6442
299 Ga0495686_0021709 3300047472 Bacteria 4258
300 Ga0495626_0024583 3300048091 Bacteria 2952
301 Ga0496104_0064380 3300048907 Bacteria 3477
302 Ga0496104_0261275 3300048907 Bacteria 1644
303 Ga0496105_0012566 3300048908 Bacteria 6707
304 Ga0496106_0006078 3300048909 Bacteria 8935
305 Ga0496110_0046395 3300048913 Bacteria 3801
306 Ga0496111_0027182 3300048914 Bacteria 4045
307 Ga0496111_0029761 3300048914 Bacteria 3879
308 Ga0496113_0326733 3300048916 Bacteria 1230
309 Ga0496114_0192351 3300048917 Bacteria 1785
310 Ga0496116_0000105 3300048919 Bacteria 192704
311 Ga0496116_0007168 3300048919 Bacteria 9963
312 Ga0496116_0008842 3300048919 Bacteria 8671
313 Ga0496116_0023634 3300048919 Bacteria 4572
314 Ga0496116_0052894 3300048919 Bacteria 2686
315 Ga0496116_0171745 3300048919 Bacteria 1173
316 Ga0496116_0174376 3300048919 Bacteria 1160
317 Ga0496117_0000002 3300048920 Bacteria 2483758
318 Ga0496117_0005967 3300048920 Bacteria 12557
319 Ga0496117_0010221 3300048920 Bacteria 8599
320 Ga0496117_0017552 3300048920 Bacteria 5971
321 Ga0496117_0030997 3300048920 Bacteria 4091
322 Ga0496117_0031122 3300048920 Bacteria 4080
323 Ga0496118_0000566 3300048921 Bacteria 61208
324 Ga0496118_0001151 3300048921 Bacteria 40832
325 Ga0496118_0008628 3300048921 Bacteria 10486
326 Ga0496118_0017174 3300048921 Bacteria 6601
327 Ga0496118_0031163 3300048921 Bacteria 4429
328 Ga0496118_0034028 3300048921 Bacteria 4168
329 Ga0496118_0104617 3300048921 Bacteria 1899
330 Ga0496119_0022448 3300048922 Bacteria 4517
331 Ga0496119_0035300 3300048922 Bacteria 3278
332 Ga0496120_0000309 3300048923 Bacteria 81375
333 Ga0496120_0044995 3300048923 Bacteria 2560
334 Ga0496120_0070685 3300048923 Bacteria 1919
335 Ga0496121_0000003 3300048924 Bacteria 1191431
336 Ga0496121_0003780 3300048924 Bacteria 21134
337 Ga0496121_0012638 3300048924 Bacteria 9172
338 Ga0496121_0019047 3300048924 Bacteria 6886
339 Ga0496121_0025680 3300048924 Bacteria 5581
340 Ga0496121_0026552 3300048924 Bacteria 5451
341 Ga0496122_0000004 3300048925 Bacteria 645283
342 Ga0496122_0000157 3300048925 Bacteria 159733
343 Ga0496122_0000464 3300048925 Bacteria 84473
344 Ga0496122_0010069 3300048925 Bacteria 9817
345 Ga0496122_0034634 3300048925 Bacteria 4128
346 Ga0496122_0048776 3300048925 Bacteria 3251
347 Ga0496123_0000007 3300048926 Bacteria 645283
348 Ga0496123_0000048 3300048926 Bacteria 244152
349 Ga0496123_0000147 3300048926 Bacteria 143834
350 Ga0496123_0007075 3300048926 Bacteria 10666
351 Ga0496123_0014048 3300048926 Bacteria 6663
352 Ga0496123_0015923 3300048926 Bacteria 6135
353 Ga0496123_0097119 3300048926 Bacteria 1727
354 Ga0496124_0000348 3300048927 Bacteria 84728
355 Ga0496124_0002089 3300048927 Bacteria 26962
356 Ga0496124_0008090 3300048927 Bacteria 11052
357 Ga0496124_0009653 3300048927 Bacteria 9884
358 Ga0496124_0029277 3300048927 Bacteria 4910
359 Ga0496124_0048384 3300048927 Bacteria 3634
360 Ga0496124_0060523 3300048927 Bacteria 3176
361 Ga0496124_0215097 3300048927 Bacteria 1450
362 Ga0496124_0267398 3300048927 Bacteria 1254
363 Ga0496125_0000786 3300048928 Bacteria 51737
364 Ga0496125_0000848 3300048928 Bacteria 49020
365 Ga0496125_0009794 3300048928 Bacteria 9769
366 Ga0496125_0014106 3300048928 Bacteria 7803
367 Ga0496125_0050143 3300048928 Bacteria 3459
368 Ga0496125_0077905 3300048928 Bacteria 2551
369 Ga0496125_0135179 3300048928 Bacteria 1726
370 Ga0496125_0222002 3300048928 Bacteria 1217
371 Ga0496126_0000188 3300048929 Bacteria 139625
372 Ga0496126_0003273 3300048929 Bacteria 20666
373 Ga0496126_0062814 3300048929 Bacteria 3331
374 Ga0496126_0214176 3300048929 Bacteria 1620
375 Ga0496126_0242810 3300048929 Bacteria 1504
376 Ga0496126_0267401 3300048929 Bacteria 1420
377 Ga0501032_0002509 3300049569 Bacteria 14338
378 Ga0501032_0100224 3300049569 Bacteria 1919
379 Ga0501033_0000365 3300049570 Bacteria 43281
380 Ga0501033_0001349 3300049570 Bacteria 21856
381 Ga0501034_0070693 3300049571 Bacteria 3501
382 Ga0501034_0191769 3300049571 Bacteria 2005
383 Ga0501037_0000934 3300049573 Bacteria 21711
384 Ga0501037_0131372 3300049573 Bacteria 1795
385 Ga0501038_0020981 3300049574 Bacteria 5869
386 Ga0501038_0061750 3300049574 Bacteria 3204
387 Ga0501043_0000265 3300049579 Bacteria 47653
388 Ga0501043_0040889 3300049579 Bacteria 3644
389 Ga0501043_0274361 3300049579 Bacteria 1294
390 Ga0501047_0022055 3300049581 Bacteria 6117
391 Ga0501047_0233924 3300049581 Bacteria 1690
392 Ga0501067_0060829 3300049583 Bacteria 2090
393 Ga0501069_0000088 3300049585 Bacteria 44197
394 Ga0501069_0048728 3300049585 Bacteria 2353
395 Ga0501070_0001479 3300049586 Bacteria 21034
396 Ga0501070_0010840 3300049586 Bacteria 7700
397 Ga0501071_0005876 3300049587 Bacteria 7933
398 Ga0501073_0009054 3300049589 Bacteria 7350
399 Ga0501074_0000006 3300049590 Bacteria 112293
400 Ga0501080_0000354 3300049742 Bacteria 35302
401 Ga0501083_0001759 3300049744 Bacteria 14784
402 Ga0501083_0132598 3300049744 Bacteria 1633
403 Ga0501280_001764 3300049776 Bacteria 3799
404 Ga0501035_0000011 3300049822 Bacteria 305794
405 Ga0501035_0001622 3300049822 Bacteria 22762
406 Ga0501035_0021335 3300049822 Bacteria 5954
407 Ga0501035_0059073 3300049822 Bacteria 3415
408 Ga0501035_0064758 3300049822 Bacteria 3248
409 Ga0501044_0000333 3300049823 Bacteria 59546
410 Ga0501044_0043138 3300049823 Bacteria 4687
411 Ga0501044_0201476 3300049823 Bacteria 1948
412 Ga0501044_0213601 3300049823 Bacteria 1882
413 Ga0501044_0324229 3300049823 Bacteria 1464
414 nmdc:mga03683_8607_c2 3300050489 Bacteria 3247
415 nmdc:mga03n38_48518_c1 3300050490 Bacteria 1884
416 nmdc:mga03n38_92350_c1 3300050490 Bacteria 1444
417 nmdc:mga00v17_103159_c1 3300050491 Bacteria 1802
418 nmdc:mga00v17_180_c1 3300050491 Bacteria 37485
419 nmdc:mga00v17_824_c1 3300050491 Bacteria 16830
420 nmdc:mga0yw44_1405_c1 3300050492 Bacteria 9539
421 nmdc:mga0yw44_187606_c1 3300050492 Bacteria 1363
422 nmdc:mga0yw44_865_c1 3300050492 Bacteria 5959
423 nmdc:mga0k408_21083_c1 3300050493 Bacteria 3657
424 nmdc:mga0k408_63710_c1 3300050493 Bacteria 2145
425 nmdc:mga06z11_142821_c1 3300050494 Bacteria 1355
426 nmdc:mga06z11_23682_c1 3300050494 Bacteria 2888
427 nmdc:mga06z11_32099_c1 3300050494 Bacteria 2558
428 nmdc:mga07m45_40428_c1 3300050496 Bacteria 2609
429 nmdc:mga05p37_99212_c1 3300050507 Bacteria 3041
430 nmdc:mga0sz30_4354_c1 3300050516 Bacteria 5112
431 nmdc:mga0sz30_802_c1 3300050516 Bacteria 11359
432 Ga0500651_0155066 3300053093 Bacteria 1373
433 Ga0500557_000501 3300053105 Bacteria 5231
434 Ga0500569_002896 3300053109 Bacteria 3438
435 Ga0500594_0003894 3300053118 Bacteria 3288
436 Ga0500594_0025770 3300053118 Bacteria 1510
437 Ga0500618_000849 3300053125 Bacteria 16428
438 Ga0500618_001483 3300053125 Bacteria 10381
439 Ga0500658_0000206 3300053134 Bacteria 27878
440 Ga0500659_0067210 3300053135 Bacteria 1905
441 Ga0500559_0016256 3300053136 Bacteria 3142
442 Ga0500561_0002494 3300053137 Bacteria 3106
443 Ga0500568_0001714 3300053139 Bacteria 13653
444 Ga0500568_0003195 3300053139 Bacteria 9316
445 Ga0500573_0018797 3300053140 Bacteria 3946
446 Ga0500590_002837 3300053148 Bacteria 7835
447 Ga0500604_0069375 3300053151 Bacteria 1121
448 Ga0500616_0000309 3300053153 Bacteria 70113
449 Ga0500616_0000576 3300053153 Bacteria 44650
450 Ga0500616_0109362 3300053153 Bacteria 1337
451 Ga0500622_0003878 3300053156 Bacteria 9707
452 Ga0500627_0079818 3300053158 Bacteria 1457
453 Ga0500634_0013063 3300053161 Bacteria 4344
454 Ga0500636_0000003 3300053177 Bacteria 240189
455 Ga0500636_0054611 3300053177 Bacteria 2342
456 Ga0501082_0017900 3300060353 Bacteria 6104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0100224 Ga0501032_0100224_401_1312 283
2 3300049571 Ga0501034_0070693 Ga0501034_0070693_755_1693 286
3 3300049573 Ga0501037_0131372 Ga0501037_0131372_385_1323 286
4 3300049579 Ga0501043_0040889 Ga0501043_0040889_889_1827 286
5 3300049822 Ga0501035_0059073 Ga0501035_0059073_1443_2381 286
6 3300049823 Ga0501044_0201476 Ga0501044_0201476_373_1311 286
7 3300005548 Ga0070665_100002486 Ga0070665_10000248619 295
8 3300006177 Ga0075362_10099331 Ga0075362_100993311 295
9 3300009094 Ga0111539_10111906 Ga0111539_101119064 295
10 3300009147 Ga0114129_10098959 Ga0114129_100989591 295
11 3300009148 Ga0105243_10012270 Ga0105243_100122706 295
12 3300011119 Ga0105246_10261856 Ga0105246_102618562 295
13 3300013102 Ga0157371_10000017 Ga0157371_10000017226 295
14 3300013104 Ga0157370_10000616 Ga0157370_1000061620 295
15 3300025935 Ga0207709_10157354 Ga0207709_101573542 295
16 3300028379 Ga0268266_10003866 Ga0268266_100038666 295
17 3300048919 Ga0496116_0171745 Ga0496116_0171745_14_916 295
18 3300048920 Ga0496117_0000002 Ga0496117_0000002_296444_297346 295
19 3300048921 Ga0496118_0000566 Ga0496118_0000566_53827_54729 295
20 3300048923 Ga0496120_0000309 Ga0496120_0000309_75996_76898 295
21 3300048925 Ga0496122_0000004 Ga0496122_0000004_348330_349232 295
22 3300048926 Ga0496123_0000007 Ga0496123_0000007_348330_349232 295
23 3300048927 Ga0496124_0008090 Ga0496124_0008090_8237_9139 295
24 3300048928 Ga0496125_0050143 Ga0496125_0050143_940_1842 295
25 3300048929 Ga0496126_0214176 Ga0496126_0214176_233_1135 295
26 3300050490 nmdc:mga03n38_92350_c1 nmdc:mga03n38_92350_c1_469_1371 295
27 3300050491 nmdc:mga00v17_180_c1 nmdc:mga00v17_180_c1_18626_19528 295
28 3300050492 nmdc:mga0yw44_1405_c1 nmdc:mga0yw44_1405_c1_5807_6709 295
29 3300050493 nmdc:mga0k408_63710_c1 nmdc:mga0k408_63710_c1_39_941 295
30 3300050494 nmdc:mga06z11_142821_c1 nmdc:mga06z11_142821_c1_304_1206 295
31 3300050507 nmdc:mga05p37_99212_c1 nmdc:mga05p37_99212_c1_209_1096 295
32 3300050516 nmdc:mga0sz30_802_c1 nmdc:mga0sz30_802_c1_4919_5821 295
33 3300053137 Ga0500561_0002494 Ga0500561_0002494_2118_3020 295
34 3300002773 JGI25152J39213_1004429 JGI25152J39213_10044293 296
35 3300025284 Ga0209130_1017463 Ga0209130_10174632 296
36 3300025304 Ga0209257_1045308 Ga0209257_10453082 296
37 3300031456 Ga0307513_10228324 Ga0307513_102283243 296
38 3300048924 Ga0496121_0025680 Ga0496121_0025680_1263_2315 296
39 3300048929 Ga0496126_0062814 Ga0496126_0062814_1889_2803 296
40 3300053151 Ga0500604_0069375 Ga0500604_0069375_180_1100 296
41 iso_pu_bacteria 2554235003 2554248394 296
42 iso_pu_bacteria 2558860242 2559295510 296
43 iso_pu_bacteria 2600255279 2601609917 296
44 iso_pu_bacteria 2600255308 2601746692 296
45 iso_pu_bacteria 2643221653 2644298896 296
46 iso_pu_bacteria 2643221693 2644521795 296
47 iso_pu_bacteria 2643221719 2644657125 296
48 iso_pu_bacteria 2808606387 2808987755 296
49 iso_pu_bacteria 2818991439 2819559225 296
50 iso_pu_bacteria 2838675328 2838675604 296
51 iso_pu_bacteria 2838714209 2838714486 296
52 iso_pu_bacteria 2838724970 2838725246 296
53 iso_pu_bacteria 2841846520 2841848697 296
54 iso_pu_bacteria 2841859092 2841862295 296
55 iso_pu_bacteria 2842124991 2842125272 296
56 iso_pu_bacteria 2842130223 2842130499 296
57 iso_pu_bacteria 2842152218 2842154331 296
58 iso_pu_bacteria 2842170452 2842170728 296
59 iso_pu_bacteria 2842175837 2842177951 296
60 iso_pu_bacteria 2842187318 2842187595 296
61 iso_pu_bacteria 2842211629 2842211906 296
62 iso_pu_bacteria 2842224351 2842226475 296
63 iso_pu_bacteria 2842515876 2842519079 296
64 iso_pu_bacteria 2899792073 2899794100 296
65 iso_pu_bacteria 2899845264 2899847746 296
66 iso_pu_bacteria 2919114240 2919114522 296
67 iso_pu_bacteria 2926760298 2926762665 296
68 iso_pu_bacteria 2933594066 2933596429 296
69 iso_pu_bacteria 2978969890 2978971892 296
70 iso_pu_bacteria 2979089926 2979092022 296
71 iso_pu_bacteria 2979095461 2979100589 296
72 iso_pu_bacteria 2979100975 2979104079 296
73 iso_pu_bacteria 2984509177 2984511350 296
74 iso_pu_bacteria 2984518228 2984522289 296
75 iso_pu_bacteria 2984537506 2984541591 296
76 iso_pu_bacteria 2984587000 2984590177 296
77 iso_pu_bacteria 2984601300 2984603864 296
78 iso_pu_bacteria 2989776772 2989779455 296
79 iso_pu_bacteria 650716007 650740720 296
80 3300031911 Ga0307412_10002363 Ga0307412_100023633 297
81 3300048919 Ga0496116_0023634 Ga0496116_0023634_3641_4555 297
82 iso_pu_bacteria 2558860983 2561469274 297
83 iso_pu_bacteria 2818991461 2819685146 297
84 3300003187 JGI25151J46595_10005849 JGI25151J46595_100058495 298
85 3300025258 Ga0209129_1000307 Ga0209129_100030748 298
86 3300025294 Ga0209025_1000927 Ga0209025_10009279 298
87 3300046460 Ga0495638_0001134 Ga0495638_0001134_2612_3652 298
88 3300046492 Ga0495585_0060355 Ga0495585_0060355_426_1340 298
89 3300046660 Ga0495625_0060018 Ga0495625_0060018_108_1022 298
90 3300046691 Ga0495670_0012039 Ga0495670_0012039_3050_3964 298
91 3300047318 Ga0495636_0037530 Ga0495636_0037530_279_1319 298
92 3300047320 Ga0495672_0005525 Ga0495672_0005525_4960_6000 298
93 3300048928 Ga0496125_0222002 Ga0496125_0222002_17_913 298
94 3300053139 Ga0500568_0001714 Ga0500568_0001714_4775_5815 298
95 3300053153 Ga0500616_0000576 Ga0500616_0000576_4185_5225 298
96 3300053158 Ga0500627_0079818 Ga0500627_0079818_409_1413 298
97 iso_pu_bacteria 2643221558 2643811319 298
98 iso_pu_bacteria 2657244999 2657681723 298
99 iso_pu_bacteria 2690316117 2692315292 298
100 iso_pu_bacteria 2791355082 2792581435 298
101 iso_pu_bacteria 2791355091 2792620587 298
102 iso_pu_bacteria 2791355092 2792625946 298
103 iso_pu_bacteria 2802429268 2804752910 298
104 iso_pu_bacteria 2818991272 2819241097 298
105 iso_pu_bacteria 2838074704 2838079796 298
106 iso_pu_bacteria 2847417321 2847419649 298
107 iso_pu_bacteria 2848992105 2848994651 298
108 iso_pu_bacteria 2913295892 2913296102 298
109 iso_pu_bacteria 643692032 643826546 298
110 iso_pu_bacteria 8005246636 8005249936 298
111 iso_pu_bacteria 8049293176 8049295516 298
112 3300006051 Ga0075364_10002108 Ga0075364_100021089 299
113 3300006195 Ga0075366_10081508 Ga0075366_100815083 299
114 3300028794 Ga0307515_10046209 Ga0307515_100462094 299
115 3300031456 Ga0307513_10015439 Ga0307513_100154398 299
116 3300048919 Ga0496116_0000105 Ga0496116_0000105_186592_187509 299
117 3300050491 nmdc:mga00v17_824_c1 nmdc:mga00v17_824_c1_8865_9785 299
118 3300053125 Ga0500618_001483 Ga0500618_001483_203_1165 299
119 iso_pu_bacteria 2510461069 2510841356 299
120 iso_pu_bacteria 2512875026 2512970416 299
121 iso_pu_bacteria 2513237089 2513601480 299
122 iso_pu_bacteria 2513237156 2513983677 299
123 iso_pu_bacteria 2513237160 2514003074 299
124 iso_pu_bacteria 2516143018 2516206196 299
125 iso_pu_bacteria 2517487022 2517570546 299
126 iso_pu_bacteria 2582581283 2585167433 299
127 iso_pu_bacteria 2599185352 2600194839 299
128 iso_pu_bacteria 2643221607 2644050244 299
129 iso_pu_bacteria 2643221618 2644105270 299
130 iso_pu_bacteria 2643221626 2644145654 299
131 iso_pu_bacteria 2643221636 2644204694 299
132 iso_pu_bacteria 2643221655 2644309683 299
133 iso_pu_bacteria 2643221659 2644331149 299
134 iso_pu_bacteria 2643221686 2644483164 299
135 iso_pu_bacteria 2643221698 2644543412 299
136 iso_pu_bacteria 2643221712 2644616207 299
137 iso_pu_bacteria 2643221723 2644675830 299
138 iso_pu_bacteria 2751185821 2753462351 299
139 iso_pu_bacteria 2802428858 2802716772 299
140 iso_pu_bacteria 2802428859 2802725584 299
141 iso_pu_bacteria 2802428860 2802730325 299
142 iso_pu_bacteria 2802428861 2802737704 299
143 iso_pu_bacteria 2802428862 2802742907 299
144 iso_pu_bacteria 2802428863 2802750331 299
145 iso_pu_bacteria 2844163670 2844164032 299
146 iso_pu_bacteria 2854896431 2854901336 299
147 iso_pu_bacteria 2855872281 2855877166 299
148 iso_pu_bacteria 2891373044 2891373573 299
149 iso_pu_bacteria 2915980308 2915982885 299
150 iso_pu_bacteria 2916061851 2916065459 299
151 iso_pu_bacteria 2920760137 2920761318 299
152 iso_pu_bacteria 2921250672 2921253733 299
153 iso_pu_bacteria 2929138655 2929141019 299
154 iso_pu_bacteria 2936996657 2937002714 299
155 iso_pu_bacteria 2937029754 2937033391 299
156 iso_pu_bacteria 2937036028 2937038431 299
157 iso_pu_bacteria 2937078374 2937080639 299
158 iso_pu_bacteria 2937084907 2937091301 299
159 iso_pu_bacteria 2941499720 2941504742 299
160 iso_pu_bacteria 2957375807 2957380748 299
161 iso_pu_bacteria 2957437181 2957439499 299
162 iso_pu_bacteria 2960591022 2960594072 299
163 iso_pu_bacteria 2960631154 2960635575 299
164 iso_pu_bacteria 2960680706 2960680864 299
165 iso_pu_bacteria 2960693952 2960697322 299
166 iso_pu_bacteria 2967686174 2967689273 299
167 iso_pu_bacteria 2967728569 2967729440 299
168 iso_pu_bacteria 2970026789 2970028069 299
169 iso_pu_bacteria 2970122695 2970126100 299
170 iso_pu_bacteria 2970143518 2970147265 299
171 iso_pu_bacteria 2970156795 2970158652 299
172 iso_pu_bacteria 2977530762 2977536453 299
173 iso_pu_bacteria 2977544691 2977550415 299
174 iso_pu_bacteria 2989349275 2989350048 299
175 iso_pu_bacteria 8003999396 8004002082 299
176 iso_pu_bacteria 8018150411 8018151343 299
177 iso_pu_bacteria 8055431914 8055432392 299
178 iso_pu_bacteria 8056875544 8056875762 299
179 3300003187 JGI25151J46595_10024325 JGI25151J46595_100243252 300
180 3300003320 rootH2_10230930 rootH2_102309302 300
181 3300006948 Ga0099826_10010998 Ga0099826_100109985 300
182 3300010375 Ga0105239_10054475 Ga0105239_100544756 300
183 3300025294 Ga0209025_1000154 Ga0209025_1000154141 300
184 3300027312 Ga0209371_1000022 Ga0209371_1000022252 300
185 3300027312 Ga0209371_1000892 Ga0209371_100089213 300
186 3300027666 Ga0209282_1007756 Ga0209282_10077565 300
187 3300027666 Ga0209282_1030375 Ga0209282_10303753 300
188 3300030500 Ga0268256_1000019 Ga0268256_1000019268 300
189 3300030500 Ga0268256_1004440 Ga0268256_10044401 300
190 3300037471 Ga0395905_0011510 Ga0395905_0011510_3217_4119 300
191 3300046674 Ga0495588_0001571 Ga0495588_0001571_6559_7461 300
192 3300046692 Ga0495671_0065310 Ga0495671_0065310_688_1680 300
193 3300047470 Ga0495681_0013102 Ga0495681_0013102_3871_4773 300
194 3300048907 Ga0496104_0261275 Ga0496104_0261275_688_1590 300
195 3300048921 Ga0496118_0104617 Ga0496118_0104617_88_990 300
196 3300048922 Ga0496119_0035300 Ga0496119_0035300_54_956 300
197 3300048923 Ga0496120_0070685 Ga0496120_0070685_990_1892 300
198 3300048927 Ga0496124_0000348 Ga0496124_0000348_2368_3303 300
199 3300048928 Ga0496125_0135179 Ga0496125_0135179_83_985 300
200 3300048929 Ga0496126_0003273 Ga0496126_0003273_2371_3306 300
201 3300053136 Ga0500559_0016256 Ga0500559_0016256_250_1152 300
202 iso_pu_bacteria 2508501122 2509108156 300
203 iso_pu_bacteria 2509276019 2509376668 300
204 iso_pu_bacteria 2509276021 2509391815 300
205 iso_pu_bacteria 2509276033 2509447330 300
206 iso_pu_bacteria 2510065019 2510134168 300
207 iso_pu_bacteria 2510461076 2510895605 300
208 iso_pu_bacteria 2510917022 2511133229 300
209 iso_pu_bacteria 2510917028 2511182483 300
210 iso_pu_bacteria 2510917030 2511199241 300
211 iso_pu_bacteria 2513237084 2513567752 300
212 iso_pu_bacteria 2513237085 2513577165 300
213 iso_pu_bacteria 2513237088 2513597681 300
214 iso_pu_bacteria 2513237093 2513633164 300
215 iso_pu_bacteria 2513237103 2513707839 300
216 iso_pu_bacteria 2513237146 2513925192 300
217 iso_pu_bacteria 2513237162 2514018083 300
218 iso_pu_bacteria 2515075009 2515113333 300
219 iso_pu_bacteria 2515154113 2515636774 300
220 iso_pu_bacteria 2515154114 2515646360 300
221 iso_pu_bacteria 2515154116 2515655124 300
222 iso_pu_bacteria 2515154134 2515739699 300
223 iso_pu_bacteria 2516653077 2517036938 300
224 iso_pu_bacteria 2516653085 2517077295 300
225 iso_pu_bacteria 2517093000 2517096053 300
226 iso_pu_bacteria 2517287029 2517407673 300
227 iso_pu_bacteria 2519899620 2520377041 300
228 iso_pu_bacteria 2524023209 2524458844 300
229 iso_pu_bacteria 2529292951 2530646584 300
230 iso_pu_bacteria 2534681796 2535517093 300
231 iso_pu_bacteria 2537561587 2537876324 300
232 iso_pu_bacteria 2558860100 2558863970 300
233 iso_pu_bacteria 2582581294 2585202004 300
234 iso_pu_bacteria 2582581298 2585223071 300
235 iso_pu_bacteria 2582581304 2585258283 300
236 iso_pu_bacteria 2582581307 2585271340 300
237 iso_pu_bacteria 2582581308 2585279279 300
238 iso_pu_bacteria 2582581315 2585323116 300
239 iso_pu_bacteria 2585427526 2585524723 300
240 iso_pu_bacteria 2585427527 2585531236 300
241 iso_pu_bacteria 2585427528 2585538410 300
242 iso_pu_bacteria 2585427529 2585545654 300
243 iso_pu_bacteria 2585427530 2585552841 300
244 iso_pu_bacteria 2585427531 2585559083 300
245 iso_pu_bacteria 2585427593 2585836363 300
246 iso_pu_bacteria 2585427594 2585843455 300
247 iso_pu_bacteria 2585427608 2585898464 300
248 iso_pu_bacteria 2585427609 2585903971 300
249 iso_pu_bacteria 2585428125 2587980911 300
250 iso_pu_bacteria 2599185170 2599417099 300
251 iso_pu_bacteria 2599185210 2599601827 300
252 iso_pu_bacteria 2615840624 2616293148 300
253 iso_pu_bacteria 2615840626 2616311446 300
254 iso_pu_bacteria 2615840698 2616554457 300
255 iso_pu_bacteria 2617270742 2617384821 300
256 iso_pu_bacteria 2643221557 2643804207 300
257 iso_pu_bacteria 2643221568 2643856584 300
258 iso_pu_bacteria 2643221582 2643920174 300
259 iso_pu_bacteria 2643221599 2644007050 300
260 iso_pu_bacteria 2643221610 2644065019 300
261 iso_pu_bacteria 2643221634 2644191829 300
262 iso_pu_bacteria 2643221643 2644242554 300
263 iso_pu_bacteria 2643221668 2644376572 300
264 iso_pu_bacteria 2643221675 2644416692 300
265 iso_pu_bacteria 2643221680 2644449732 300
266 iso_pu_bacteria 2643221689 2644497811 300
267 iso_pu_bacteria 2643221726 2644689864 300
268 iso_pu_bacteria 2667528174 2671111223 300
269 iso_pu_bacteria 2718217882 2719182009 300
270 iso_pu_bacteria 2718217927 2719386620 300
271 iso_pu_bacteria 2718217997 2719666369 300
272 iso_pu_bacteria 2718218009 2719732726 300
273 iso_pu_bacteria 2718218199 2720492789 300
274 iso_pu_bacteria 2718218232 2720614257 300
275 iso_pu_bacteria 2718218233 2720621025 300
276 iso_pu_bacteria 2718218235 2720632349 300
277 iso_pu_bacteria 2718218269 2720776077 300
278 iso_pu_bacteria 2718218363 2721148100 300
279 iso_pu_bacteria 2718218365 2721159551 300
280 iso_pu_bacteria 2718218366 2721164936 300
281 iso_pu_bacteria 2718218423 2721400324 300
282 iso_pu_bacteria 2721755514 2722841106 300
283 iso_pu_bacteria 2721755556 2723027676 300
284 iso_pu_bacteria 2721755684 2723561304 300
285 iso_pu_bacteria 2721755685 2723567927 300
286 iso_pu_bacteria 2721755809 2724039137 300
287 iso_pu_bacteria 2721755810 2724045482 300
288 iso_pu_bacteria 2721755819 2724090684 300
289 iso_pu_bacteria 2721755822 2724105192 300
290 iso_pu_bacteria 2721755823 2724111019 300
291 iso_pu_bacteria 2724679232 2725951384 300
292 iso_pu_bacteria 2728369352 2730108612 300
293 iso_pu_bacteria 2728369365 2730165244 300
294 iso_pu_bacteria 2728369397 2730299183 300
295 iso_pu_bacteria 2738541293 2738800310 300
296 iso_pu_bacteria 2738541333 2739033051 300
297 iso_pu_bacteria 2765235942 2766066094 300
298 iso_pu_bacteria 2775507049 2776914178 300
299 iso_pu_bacteria 2791355256 2793294222 300
300 iso_pu_bacteria 2791355259 2793315877 300
301 iso_pu_bacteria 2791355261 2793328476 300
302 iso_pu_bacteria 2791355262 2793335434 300
303 iso_pu_bacteria 2791355263 2793339486 300
304 iso_pu_bacteria 2791355264 2793347037 300
305 iso_pu_bacteria 2791355266 2793361925 300
306 iso_pu_bacteria 2802429605 2805926860 300
307 iso_pu_bacteria 2802429606 2805932775 300
308 iso_pu_bacteria 2802429633 2806045190 300
309 iso_pu_bacteria 2802429634 2806050015 300
310 iso_pu_bacteria 2802429635 2806056853 300
311 iso_pu_bacteria 2802429636 2806064234 300
312 iso_pu_bacteria 2802429637 2806071502 300
313 iso_pu_bacteria 2818991448 2819609348 300
314 iso_pu_bacteria 2818991453 2819641340 300
315 iso_pu_bacteria 2838016132 2838021667 300
316 iso_pu_bacteria 2838022645 2838023640 300
317 iso_pu_bacteria 2838029111 2838033395 300
318 iso_pu_bacteria 2838035591 2838038694 300
319 iso_pu_bacteria 2838042994 2838045180 300
320 iso_pu_bacteria 2838048938 2838053339 300
321 iso_pu_bacteria 2838061910 2838065459 300
322 iso_pu_bacteria 2838068647 2838069938 300
323 iso_pu_bacteria 2838668709 2838670572 300
324 iso_pu_bacteria 2838680041 2838683237 300
325 iso_pu_bacteria 2838686498 2838686832 300
326 iso_pu_bacteria 2838694306 2838697819 300
327 iso_pu_bacteria 2838701080 2838702943 300
328 iso_pu_bacteria 2838707686 2838710934 300
329 iso_pu_bacteria 2838719591 2838721713 300
330 iso_pu_bacteria 2838729681 2838730210 300
331 iso_pu_bacteria 2838742623 2838742775 300
332 iso_pu_bacteria 2841851746 2841852278 300
333 iso_pu_bacteria 2841864319 2841867169 300
334 iso_pu_bacteria 2842077413 2842079108 300
335 iso_pu_bacteria 2842110456 2842113044 300
336 iso_pu_bacteria 2842118031 2842118382 300
337 iso_pu_bacteria 2842146304 2842147799 300
338 iso_pu_bacteria 2842156927 2842158320 300
339 iso_pu_bacteria 2842163707 2842168577 300
340 iso_pu_bacteria 2842180545 2842181940 300
341 iso_pu_bacteria 2842192696 2842195847 300
342 iso_pu_bacteria 2842198810 2842199154 300
343 iso_pu_bacteria 2842205361 2842209604 300
344 iso_pu_bacteria 2842217011 2842218163 300
345 iso_pu_bacteria 2842229732 2842230065 300
346 iso_pu_bacteria 2842237096 2842240294 300
347 iso_pu_bacteria 2842243621 2842243954 300
348 iso_pu_bacteria 2842250916 2842252865 300
349 iso_pu_bacteria 2842257432 2842257961 300
350 iso_pu_bacteria 2842264693 2842269497 300
351 iso_pu_bacteria 2842271015 2842271630 300
352 iso_pu_bacteria 2842278818 2842283058 300
353 iso_pu_bacteria 2842285085 2842285392 300
354 iso_pu_bacteria 2842291075 2842292770 300
355 iso_pu_bacteria 2842298080 2842298193 300
356 iso_pu_bacteria 2842304105 2842305261 300
357 iso_pu_bacteria 2842311132 2842314009 300
358 iso_pu_bacteria 2842317721 2842319750 300
359 iso_pu_bacteria 2842341865 2842348472 300
360 iso_pu_bacteria 2842357229 2842360207 300
361 iso_pu_bacteria 2842363717 2842370251 300
362 iso_pu_bacteria 2842370503 2842373868 300
363 iso_pu_bacteria 2842377471 2842379167 300
364 iso_pu_bacteria 2842384541 2842384892 300
365 iso_pu_bacteria 2842395702 2842400131 300
366 iso_pu_bacteria 2842402390 2842402752 300
367 iso_pu_bacteria 2842409023 2842409877 300
368 iso_pu_bacteria 2842415677 2842416525 300
369 iso_pu_bacteria 2842422224 2842423552 300
370 iso_pu_bacteria 2842428310 2842430501 300
371 iso_pu_bacteria 2842434925 2842436687 300
372 iso_pu_bacteria 2842441272 2842443471 300
373 iso_pu_bacteria 2842447887 2842449341 300
374 iso_pu_bacteria 2842462802 2842466755 300
375 iso_pu_bacteria 2842469257 2842471443 300
376 iso_pu_bacteria 2842475841 2842479939 300
377 iso_pu_bacteria 2842489311 2842492280 300
378 iso_pu_bacteria 2842495871 2842497860 300
379 iso_pu_bacteria 2842502639 2842505276 300
380 iso_pu_bacteria 2842509118 2842514283 300
381 iso_pu_bacteria 2844454524 2844458129 300
382 iso_pu_bacteria 2850079185 2850081668 300
383 iso_pu_bacteria 2852387548 2852390470 300
384 iso_pu_bacteria 2857516855 2857517204 300
385 iso_pu_bacteria 2899803654 2899806800 300
386 iso_pu_bacteria 2913308742 2913313571 300
387 iso_pu_bacteria 2919100787 2919106243 300
388 iso_pu_bacteria 2919166419 2919169493 300
389 iso_pu_bacteria 2919408235 2919410208 300
390 iso_pu_bacteria 2920822456 2920825476 300
391 iso_pu_bacteria 2923556063 2923561084 300
392 iso_pu_bacteria 2926754445 2926755537 300
393 iso_pu_bacteria 2933006813 2933008976 300
394 iso_pu_bacteria 2933011516 2933014748 300
395 iso_pu_bacteria 2933570622 2933571068 300
396 iso_pu_bacteria 2933586486 2933588899 300
397 iso_pu_bacteria 2933599457 2933600744 300
398 iso_pu_bacteria 2935894831 2935896796 300
399 iso_pu_bacteria 2935901341 2935901738 300
400 iso_pu_bacteria 2936367885 2936371824 300
401 iso_pu_bacteria 2936375103 2936379658 300
402 iso_pu_bacteria 2936381700 2936387828 300
403 iso_pu_bacteria 2996893221 2996894928 300
404 iso_pu_bacteria 3005416602 3005418972 300
405 iso_pu_bacteria 3005445848 3005448664 300
406 iso_pu_bacteria 3005452660 3005454902 300
407 iso_pu_bacteria 639633055 639649393 300
408 iso_pu_bacteria 8003570095 8003571794 300
409 iso_pu_bacteria 8005275841 8005281427 300
410 iso_pu_bacteria 8005282627 8005284603 300
411 iso_pu_bacteria 8005301065 8005303340 300
412 iso_pu_bacteria 8005307578 8005309609 300
413 iso_pu_bacteria 8005314921 8005318136 300
414 iso_pu_bacteria 8005376324 8005381144 300
415 iso_pu_bacteria 8005382845 8005388902 300
416 iso_pu_bacteria 8005395548 8005395886 300
417 iso_pu_bacteria 8005430974 8005437495 300
418 iso_pu_bacteria 8005460587 8005464015 300
419 iso_pu_bacteria 8005484373 8005488987 300
420 iso_pu_bacteria 8005497431 8005501109 300
421 iso_pu_bacteria 8005542996 8005545907 300
422 iso_pu_bacteria 8005556819 8005561436 300
423 iso_pu_bacteria 8005563573 8005568214 300
424 iso_pu_bacteria 8005570704 8005573246 300
425 iso_pu_bacteria 8005619151 8005622476 300
426 iso_pu_bacteria 8005626139 8005629978 300
427 iso_pu_bacteria 8005645114 8005646066 300
428 iso_pu_bacteria 8005668836 8005672527 300
429 iso_pu_bacteria 8005682033 8005682680 300
430 iso_pu_bacteria 8005688590 8005691888 300
431 iso_pu_bacteria 8005695170 8005697624 300
432 iso_pu_bacteria 8018127388 8018127989 300
433 iso_pu_bacteria 8018163183 8018164354 300
434 iso_pu_bacteria 8018176218 8018176839 300
435 iso_pu_bacteria 8023680758 8023682951 300
436 iso_pu_bacteria 8024479707 8024482646 300
437 iso_pu_bacteria 8024486573 8024488253 300
438 iso_pu_bacteria 8024501048 8024504647 300
439 iso_pu_bacteria 8046767195 8046771733 300
440 iso_pu_bacteria 8054460903 8054463142 300
441 iso_pu_bacteria 8056382006 8056384205 300
442 iso_pu_bacteria 8057575449 8057575487 300
443 iso_pu_bacteria 8057874678 8057879874 300
444 3300049569 Ga0501032_0002509 Ga0501032_0002509_12562_13470 301
445 3300049570 Ga0501033_0001349 Ga0501033_0001349_9827_10735 301
446 3300049573 Ga0501037_0000934 Ga0501037_0000934_4526_5434 301
447 3300049574 Ga0501038_0061750 Ga0501038_0061750_530_1438 301
448 3300049579 Ga0501043_0000265 Ga0501043_0000265_36060_36968 301
449 3300049579 Ga0501043_0274361 Ga0501043_0274361_52_960 301
450 3300049583 Ga0501067_0060829 Ga0501067_0060829_406_1314 301
451 3300049585 Ga0501069_0000088 Ga0501069_0000088_10567_11475 301
452 3300049586 Ga0501070_0001479 Ga0501070_0001479_10606_11514 301
453 3300049587 Ga0501071_0005876 Ga0501071_0005876_6851_7759 301
454 3300049589 Ga0501073_0009054 Ga0501073_0009054_252_1160 301
455 3300049590 Ga0501074_0000006 Ga0501074_0000006_5248_6156 301
456 3300049742 Ga0501080_0000354 Ga0501080_0000354_25400_26308 301
457 3300049744 Ga0501083_0001759 Ga0501083_0001759_857_1765 301
458 3300049822 Ga0501035_0000011 Ga0501035_0000011_294202_295110 301
459 3300049823 Ga0501044_0000333 Ga0501044_0000333_10606_11514 301
460 3300049823 Ga0501044_0324229 Ga0501044_0324229_539_1447 301
461 3300060353 Ga0501082_0017900 Ga0501082_0017900_1564_2472 301
462 3300005262 Ga0065165_1004838 Ga0065165_10048385 302
463 3300005548 Ga0070665_100156948 Ga0070665_1001569483 302
464 3300006038 Ga0075365_10017736 Ga0075365_100177364 302
465 3300006946 Ga0079104_1000884 Ga0079104_10008846 302
466 3300013100 Ga0157373_10062061 Ga0157373_100620613 302
467 3300013104 Ga0157370_10140662 Ga0157370_101406623 302
468 3300013105 Ga0157369_10234709 Ga0157369_102347093 302
469 3300021320 Ga0214544_1000110 Ga0214544_100011095 302
470 3300021321 Ga0214542_1000268 Ga0214542_100026869 302
471 3300021327 Ga0214543_1000219 Ga0214543_100021970 302
472 3300027111 Ga0209281_1000034 Ga0209281_1000034258 302
473 3300028379 Ga0268266_10075098 Ga0268266_100750983 302
474 3300046530 Ga0495654_0001572 Ga0495654_0001572_2688_3632 302
475 3300048914 Ga0496111_0029761 Ga0496111_0029761_2228_3172 302
476 3300048924 Ga0496121_0019047 Ga0496121_0019047_3183_4199 302
477 3300048925 Ga0496122_0000157 Ga0496122_0000157_123786_124808 302
478 3300048926 Ga0496123_0000048 Ga0496123_0000048_119345_120367 302
479 3300048926 Ga0496123_0015923 Ga0496123_0015923_3569_4513 302
480 3300048927 Ga0496124_0048384 Ga0496124_0048384_227_1243 302
481 3300048927 Ga0496124_0267398 Ga0496124_0267398_116_1138 302
482 3300048929 Ga0496126_0267401 Ga0496126_0267401_237_1151 302
483 3300049776 Ga0501280_001764 Ga0501280_001764_1664_2572 302
484 3300050492 nmdc:mga0yw44_865_c1 nmdc:mga0yw44_865_c1_1800_2783 302
485 3300053125 Ga0500618_000849 Ga0500618_000849_14791_15729 302
486 3300053140 Ga0500573_0018797 Ga0500573_0018797_2971_3888 302
487 iso_pu_bacteria 2599185236 2599721595 302
488 iso_pu_bacteria 2600254933 2600374118 302
489 iso_pu_bacteria 2821123053 2821125723 302
490 iso_pu_bacteria 2838736955 2838737826 302
491 iso_pu_bacteria 2841840854 2841841805 302
492 iso_pu_bacteria 2842140634 2842141583 302
493 iso_pu_bacteria 2857531043 2857532284 302
494 3300002739 JGI25158J39367_1003574 JGI25158J39367_10035742 303
495 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000472 303
496 3300003187 JGI25151J46595_10006069 JGI25151J46595_100060692 303
497 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021137 303
498 3300003374 JGI25161J50226_1000307 JGI25161J50226_100030713 303
499 3300003771 Ga0055526_1002599 Ga0055526_100259915 303
500 3300003775 Ga0055524_1002465 Ga0055524_10024655 303
501 3300003781 Ga0055536_1023096 Ga0055536_10230962 303
502 3300003791 Ga0055530_10007952 Ga0055530_100079523 303
503 3300003794 Ga0055531_10034379 Ga0055531_100343792 303
504 3300004625 Ga0055543_1000705 Ga0055543_10007054 303
505 3300005262 Ga0065165_1000033 Ga0065165_1000033137 303
506 3300005347 Ga0070668_100292013 Ga0070668_1002920131 303
507 3300022739 Ga0228711_1000026 Ga0228711_100002626 303
508 3300022740 Ga0228710_1000005 Ga0228710_1000005102 303
509 3300025208 Ga0209436_100422 Ga0209436_10042212 303
510 3300025284 Ga0209130_1000017 Ga0209130_1000017246 303
511 3300025292 Ga0209676_1005472 Ga0209676_10054726 303
512 3300025294 Ga0209025_1000161 Ga0209025_100016172 303
513 3300025294 Ga0209025_1000171 Ga0209025_100017151 303
514 3300025295 Ga0209564_1000013 Ga0209564_1000013693 303
515 3300025298 Ga0209050_1005559 Ga0209050_10055595 303
516 3300025299 Ga0209256_1000153 Ga0209256_100015369 303
517 3300025299 Ga0209256_1001163 Ga0209256_100116322 303
518 3300025302 Ga0207426_1000006 Ga0207426_1000006245 303
519 3300025304 Ga0209257_1015197 Ga0209257_10151974 303
520 3300027111 Ga0209281_1000082 Ga0209281_100008250 303
521 3300027666 Ga0209282_1000006 Ga0209282_100000672 303
522 3300031967 Ga0315914_1000003 Ga0315914_1000003127 303
523 3300032002 Ga0307416_100255445 Ga0307416_1002554452 303
524 3300033430 Ga0315913_1000001 Ga0315913_100000178 303
525 3300033464 Ga0315915_1000008 Ga0315915_1000008209 303
526 3300037068 Ga0373925_0002516 Ga0373925_0002516_1807_2721 303
527 3300041405 Ga0439438_016435 Ga0439438_016435_853_1779 303
528 3300042007 Ga0439449_0004055 Ga0439449_0004055_3136_4062 303
529 3300048920 Ga0496117_0031122 Ga0496117_0031122_1766_2701 303
530 3300048924 Ga0496121_0000003 Ga0496121_0000003_554363_555379 303
531 3300048925 Ga0496122_0000464 Ga0496122_0000464_80187_81122 303
532 3300048926 Ga0496123_0000147 Ga0496123_0000147_72111_73046 303
533 3300048927 Ga0496124_0215097 Ga0496124_0215097_338_1354 303
534 3300048928 Ga0496125_0000786 Ga0496125_0000786_36689_37705 303
535 3300048928 Ga0496125_0000848 Ga0496125_0000848_23325_24260 303
536 3300002705 JGI25156J39149_1000037 JGI25156J39149_100003733 304
537 3300002705 JGI25156J39149_1000079 JGI25156J39149_100007952 304
538 3300002738 JGI25154J39366_1000052 JGI25154J39366_100005286 304
539 3300002739 JGI25158J39367_1000499 JGI25158J39367_10004995 304
540 3300002741 JGI25157J39369_1000040 JGI25157J39369_100004076 304
541 3300002773 JGI25152J39213_1001025 JGI25152J39213_10010254 304
542 3300002773 JGI25152J39213_1002772 JGI25152J39213_10027723 304
543 3300002774 JGI25150J39212_1000088 JGI25150J39212_10000884 304
544 3300002774 JGI25150J39212_1005664 JGI25150J39212_10056643 304
545 3300002987 JGI25159J45721_1001399 JGI25159J45721_10013993 304
546 3300002987 JGI25159J45721_1006965 JGI25159J45721_10069654 304
547 3300003187 JGI25151J46595_10000215 JGI25151J46595_1000021548 304
548 3300003187 JGI25151J46595_10000280 JGI25151J46595_1000028057 304
549 3300003187 JGI25151J46595_10024843 JGI25151J46595_100248431 304
550 3300003214 JGI25165J46597_1000462 JGI25165J46597_10004629 304
551 3300003215 JGI25153J46596_10001244 JGI25153J46596_1000124416 304
552 3300003215 JGI25153J46596_10007382 JGI25153J46596_100073824 304
553 3300003215 JGI25153J46596_10021503 JGI25153J46596_100215033 304
554 3300003322 rootL2_10049246 rootL2_100492465 304
555 3300003322 rootL2_10113723 rootL2_101137232 304
556 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001406 304
557 3300003354 JGI25160J50197_1001207 JGI25160J50197_10012074 304
558 3300003354 JGI25160J50197_1011565 JGI25160J50197_10115653 304
559 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001352 304
560 3300003374 JGI25161J50226_1000283 JGI25161J50226_100028322 304
561 3300003374 JGI25161J50226_1009056 JGI25161J50226_10090561 304
562 3300003578 Ga0006562J51391_1040650 Ga0006562J51391_10406501 304
563 3300003771 Ga0055526_1001084 Ga0055526_100108413 304
564 3300003771 Ga0055526_1004226 Ga0055526_10042265 304
565 3300003771 Ga0055526_1013834 Ga0055526_10138343 304
566 3300003775 Ga0055524_1004489 Ga0055524_10044894 304
567 3300003775 Ga0055524_1004911 Ga0055524_10049115 304
568 3300003775 Ga0055524_1009251 Ga0055524_10092514 304
569 3300003775 Ga0055524_1011052 Ga0055524_10110524 304
570 3300003790 Ga0055528_1000549 Ga0055528_10005496 304
571 3300003790 Ga0055528_1001077 Ga0055528_100107712 304
572 3300003790 Ga0055528_1009596 Ga0055528_10095964 304
573 3300003790 Ga0055528_1010707 Ga0055528_10107074 304
574 3300003790 Ga0055528_1013733 Ga0055528_10137332 304
575 3300003791 Ga0055530_10031737 Ga0055530_100317372 304
576 3300003792 Ga0055540_1000766 Ga0055540_10007663 304
577 3300003792 Ga0055540_1005952 Ga0055540_10059524 304
578 3300003792 Ga0055540_1014722 Ga0055540_10147222 304
579 3300003794 Ga0055531_10002883 Ga0055531_100028836 304
580 3300003794 Ga0055531_10028376 Ga0055531_100283762 304
581 3300004625 Ga0055543_1000003 Ga0055543_1000003368 304
582 3300004625 Ga0055543_1000060 Ga0055543_100006091 304
583 3300004625 Ga0055543_1000311 Ga0055543_10003116 304
584 3300005262 Ga0065165_1000008 Ga0065165_100000847 304
585 3300005347 Ga0070668_100140038 Ga0070668_1001400382 304
586 3300005455 Ga0070663_100067010 Ga0070663_1000670102 304
587 3300005578 Ga0068854_100069462 Ga0068854_1000694623 304
588 3300005834 Ga0068851_10068800 Ga0068851_100688003 304
589 3300006038 Ga0075365_10000291 Ga0075365_100002912 304
590 3300006038 Ga0075365_10002452 Ga0075365_100024523 304
591 3300006042 Ga0075368_10027260 Ga0075368_100272602 304
592 3300006048 Ga0075363_100077069 Ga0075363_1000770692 304
593 3300006051 Ga0075364_10099563 Ga0075364_100995632 304
594 3300006177 Ga0075362_10000446 Ga0075362_1000044611 304
595 3300006178 Ga0075367_10005571 Ga0075367_100055714 304
596 3300006178 Ga0075367_10047982 Ga0075367_100479822 304
597 3300006195 Ga0075366_10003015 Ga0075366_100030153 304
598 3300006195 Ga0075366_10131247 Ga0075366_101312472 304
599 3300006353 Ga0075370_10023891 Ga0075370_100238914 304
600 3300006353 Ga0075370_10045499 Ga0075370_100454992 304
601 3300009011 Ga0105251_10006266 Ga0105251_100062664 304
602 3300009093 Ga0105240_10000014 Ga0105240_10000014305 304
603 3300009177 Ga0105248_10019194 Ga0105248_100191944 304
604 3300009545 Ga0105237_10003542 Ga0105237_1000354216 304
605 3300009766 Ga0123342_1010951 Ga0123342_10109513 304
606 3300010375 Ga0105239_10000973 Ga0105239_1000097337 304
607 3300013100 Ga0157373_10018335 Ga0157373_100183351 304
608 3300013102 Ga0157371_10029204 Ga0157371_100292044 304
609 3300013104 Ga0157370_10000327 Ga0157370_1000032715 304
610 3300014497 Ga0182008_10017060 Ga0182008_100170602 304
611 3300015262 Ga0182007_10002083 Ga0182007_100020835 304
612 3300015265 Ga0182005_1001327 Ga0182005_10013275 304
613 3300021321 Ga0214542_1013594 Ga0214542_101359410 304
614 3300021327 Ga0214543_1000022 Ga0214543_100002293 304
615 3300025206 Ga0209435_100027 Ga0209435_10002776 304
616 3300025208 Ga0209436_100061 Ga0209436_10006132 304
617 3300025208 Ga0209436_109886 Ga0209436_1098861 304
618 3300025230 Ga0209563_104435 Ga0209563_1044353 304
619 3300025233 Ga0209437_100060 Ga0209437_100060306 304
620 3300025245 Ga0207425_1000432 Ga0207425_10004325 304
621 3300025245 Ga0207425_1011073 Ga0207425_10110732 304
622 3300025245 Ga0207425_1019735 Ga0207425_10197352 304
623 3300025246 Ga0209646_1000086 Ga0209646_100008676 304
624 3300025246 Ga0209646_1012199 Ga0209646_10121992 304
625 3300025250 Ga0209026_1000082 Ga0209026_100008276 304
626 3300025253 Ga0209677_100273 Ga0209677_10027325 304
627 3300025256 Ga0209759_1000063 Ga0209759_1000063125 304
628 3300025258 Ga0209129_1000029 Ga0209129_1000029376 304
629 3300025258 Ga0209129_1000433 Ga0209129_100043320 304
630 3300025258 Ga0209129_1001238 Ga0209129_100123816 304
631 3300025258 Ga0209129_1003217 Ga0209129_10032174 304
632 3300025258 Ga0209129_1006305 Ga0209129_10063054 304
633 3300025258 Ga0209129_1006840 Ga0209129_10068405 304
634 3300025258 Ga0209129_1019492 Ga0209129_10194921 304
635 3300025261 Ga0209233_1000095 Ga0209233_100009578 304
636 3300025261 Ga0209233_1000228 Ga0209233_10002285 304
637 3300025273 Ga0209673_1000010 Ga0209673_1000010472 304
638 3300025273 Ga0209673_1000025 Ga0209673_1000025216 304
639 3300025273 Ga0209673_1000112 Ga0209673_10001123 304
640 3300025273 Ga0209673_1000858 Ga0209673_100085836 304
641 3300025273 Ga0209673_1003176 Ga0209673_10031767 304
642 3300025273 Ga0209673_1006098 Ga0209673_10060986 304
643 3300025273 Ga0209673_1013587 Ga0209673_10135873 304
644 3300025284 Ga0209130_1000003 Ga0209130_1000003368 304
645 3300025284 Ga0209130_1000020 Ga0209130_100002036 304
646 3300025292 Ga0209676_1009017 Ga0209676_10090175 304
647 3300025292 Ga0209676_1034629 Ga0209676_10346292 304
648 3300025294 Ga0209025_1000070 Ga0209025_10000705 304
649 3300025294 Ga0209025_1000091 Ga0209025_1000091117 304
650 3300025294 Ga0209025_1002842 Ga0209025_100284213 304
651 3300025294 Ga0209025_1007846 Ga0209025_10078465 304
652 3300025294 Ga0209025_1011929 Ga0209025_10119292 304
653 3300025294 Ga0209025_1014918 Ga0209025_10149184 304
654 3300025295 Ga0209564_1000265 Ga0209564_100026549 304
655 3300025295 Ga0209564_1000607 Ga0209564_100060720 304
656 3300025295 Ga0209564_1001968 Ga0209564_10019686 304
657 3300025295 Ga0209564_1008091 Ga0209564_10080913 304
658 3300025295 Ga0209564_1019072 Ga0209564_10190722 304
659 3300025297 Ga0209758_1000058 Ga0209758_100005849 304
660 3300025297 Ga0209758_1000094 Ga0209758_1000094229 304
661 3300025297 Ga0209758_1000671 Ga0209758_100067118 304
662 3300025297 Ga0209758_1005284 Ga0209758_10052846 304
663 3300025297 Ga0209758_1012944 Ga0209758_10129444 304
664 3300025297 Ga0209758_1013086 Ga0209758_10130864 304
665 3300025297 Ga0209758_1036138 Ga0209758_10361383 304
666 3300025298 Ga0209050_1002996 Ga0209050_10029967 304
667 3300025298 Ga0209050_1005667 Ga0209050_10056672 304
668 3300025299 Ga0209256_1000381 Ga0209256_100038142 304
669 3300025299 Ga0209256_1000655 Ga0209256_100065546 304
670 3300025299 Ga0209256_1002016 Ga0209256_100201612 304
671 3300025299 Ga0209256_1004610 Ga0209256_10046102 304
672 3300025302 Ga0207426_1000008 Ga0207426_1000008105 304
673 3300025302 Ga0207426_1000011 Ga0207426_1000011407 304
674 3300025302 Ga0207426_1000344 Ga0207426_10003446 304
675 3300025302 Ga0207426_1001833 Ga0207426_10018335 304
676 3300025303 Ga0209051_1001157 Ga0209051_10011576 304
677 3300025303 Ga0209051_1005910 Ga0209051_10059102 304
678 3300025303 Ga0209051_1013821 Ga0209051_10138214 304
679 3300025303 Ga0209051_1014703 Ga0209051_10147034 304
680 3300025304 Ga0209257_1002974 Ga0209257_100297411 304
681 3300025304 Ga0209257_1008365 Ga0209257_10083656 304
682 3300025304 Ga0209257_1013242 Ga0209257_10132424 304
683 3300025735 Ga0207713_1047877 Ga0207713_10478773 304
684 3300025913 Ga0207695_10000037 Ga0207695_10000037307 304
685 3300025914 Ga0207671_10000271 Ga0207671_1000027129 304
686 3300025931 Ga0207644_10071576 Ga0207644_100715763 304
687 3300025941 Ga0207711_10231808 Ga0207711_102318081 304
688 3300025981 Ga0207640_10052246 Ga0207640_100522462 304
689 3300026067 Ga0207678_10060891 Ga0207678_100608911 304
690 3300026078 Ga0207702_10344263 Ga0207702_103442632 304
691 3300026116 Ga0207674_10278512 Ga0207674_102785122 304
692 3300027866 Ga0209813_10008682 Ga0209813_100086824 304
693 3300030500 Ga0268256_1006062 Ga0268256_10060623 304
694 3300031731 Ga0307405_10002746 Ga0307405_100027466 304
695 3300031901 Ga0307406_10174446 Ga0307406_101744461 304
696 3300041494 Ga0451837_0772324 Ga0451837_0772324_972_1886 304
697 3300041498 Ga0451841_1151175 Ga0451841_1151175_1675_2589 304
698 3300041503 Ga0451847_0188909 Ga0451847_0188909_1408_2322 304
699 3300041503 Ga0451847_0462778 Ga0451847_0462778_182_1150 304
700 3300041505 Ga0451849_0136450 Ga0451849_0136450_474_1388 304
701 3300041507 Ga0451851_0841407 Ga0451851_0841407_2644_3558 304
702 3300041509 Ga0451843_0035237 Ga0451843_0035237_1711_2625 304
703 3300041512 Ga0451853_2160098 Ga0451853_2160098_838_1752 304
704 3300042006 Ga0439432_023767 Ga0439432_023767_161_1132 304
705 3300042007 Ga0439449_0017852 Ga0439449_0017852_1536_2507 304
706 3300046459 Ga0495629_0204869 Ga0495629_0204869_50_964 304
707 3300046492 Ga0495585_0082654 Ga0495585_0082654_561_1475 304
708 3300046500 Ga0495596_0027893 Ga0495596_0027893_769_1683 304
709 3300046501 Ga0495607_0010334 Ga0495607_0010334_2864_3778 304
710 3300046501 Ga0495607_0046074 Ga0495607_0046074_1493_2497 304
711 3300046507 Ga0495606_0004697 Ga0495606_0004697_7840_8766 304
712 3300046507 Ga0495606_0007767 Ga0495606_0007767_1181_2095 304
713 3300046512 Ga0495610_0003664 Ga0495610_0003664_7907_8821 304
714 3300046512 Ga0495610_0031382 Ga0495610_0031382_1093_2007 304
715 3300046512 Ga0495610_0074944 Ga0495610_0074944_110_1024 304
716 3300046513 Ga0495616_0022251 Ga0495616_0022251_1178_2092 304
717 3300046515 Ga0495620_0012468 Ga0495620_0012468_3163_4077 304
718 3300046518 Ga0495631_0001584 Ga0495631_0001584_7912_8826 304
719 3300046518 Ga0495631_0042961 Ga0495631_0042961_248_1162 304
720 3300046518 Ga0495631_0055442 Ga0495631_0055442_773_1687 304
721 3300046519 Ga0495632_0009886 Ga0495632_0009886_60_1064 304
722 3300046519 Ga0495632_0041708 Ga0495632_0041708_541_1455 304
723 3300046519 Ga0495632_0183183 Ga0495632_0183183_24_938 304
724 3300046522 Ga0495643_0031297 Ga0495643_0031297_1617_2531 304
725 3300046522 Ga0495643_0032218 Ga0495643_0032218_442_1443 304
726 3300046522 Ga0495643_0130604 Ga0495643_0130604_185_1099 304
727 3300046524 Ga0495648_0029469 Ga0495648_0029469_1519_2433 304
728 3300046524 Ga0495648_0148184 Ga0495648_0148184_237_1151 304
729 3300046530 Ga0495654_0011933 Ga0495654_0011933_3261_4175 304
730 3300046542 Ga0495597_0029591 Ga0495597_0029591_524_1438 304
731 3300046616 Ga0495668_0009467 Ga0495668_0009467_2553_3467 304
732 3300046616 Ga0495668_0012948 Ga0495668_0012948_1305_2219 304
733 3300046648 Ga0495611_0020130 Ga0495611_0020130_285_1199 304
734 3300046660 Ga0495625_0002255 Ga0495625_0002255_4359_5273 304
735 3300046660 Ga0495625_0078863 Ga0495625_0078863_918_1832 304
736 3300046674 Ga0495588_0136732 Ga0495588_0136732_312_1226 304
737 3300046694 Ga0495649_0028150 Ga0495649_0028150_1999_2913 304
738 3300046810 Ga0495660_0004669 Ga0495660_0004669_1221_2135 304
739 3300047323 Ga0495683_0049570 Ga0495683_0049570_975_1889 304
740 3300047470 Ga0495681_0071488 Ga0495681_0071488_519_1433 304
741 3300047472 Ga0495686_0001486 Ga0495686_0001486_15863_16789 304
742 3300047472 Ga0495686_0010881 Ga0495686_0010881_2656_3582 304
743 3300047472 Ga0495686_0021709 Ga0495686_0021709_924_1838 304
744 3300048091 Ga0495626_0024583 Ga0495626_0024583_1551_2465 304
745 3300048907 Ga0496104_0064380 Ga0496104_0064380_2362_3297 304
746 3300048908 Ga0496105_0012566 Ga0496105_0012566_5644_6579 304
747 3300048909 Ga0496106_0006078 Ga0496106_0006078_2910_3824 304
748 3300048913 Ga0496110_0046395 Ga0496110_0046395_2270_3205 304
749 3300048914 Ga0496111_0027182 Ga0496111_0027182_2964_3899 304
750 3300048916 Ga0496113_0326733 Ga0496113_0326733_21_935 304
751 3300048917 Ga0496114_0192351 Ga0496114_0192351_65_979 304
752 3300048919 Ga0496116_0007168 Ga0496116_0007168_6107_7042 304
753 3300048919 Ga0496116_0008842 Ga0496116_0008842_4012_4926 304
754 3300048919 Ga0496116_0052894 Ga0496116_0052894_655_1656 304
755 3300048919 Ga0496116_0174376 Ga0496116_0174376_40_1023 304
756 3300048920 Ga0496117_0005967 Ga0496117_0005967_8946_9890 304
757 3300048920 Ga0496117_0010221 Ga0496117_0010221_3746_4660 304
758 3300048920 Ga0496117_0017552 Ga0496117_0017552_2401_3315 304
759 3300048920 Ga0496117_0030997 Ga0496117_0030997_2927_3928 304
760 3300048921 Ga0496118_0001151 Ga0496118_0001151_8899_9843 304
761 3300048921 Ga0496118_0008628 Ga0496118_0008628_7173_8087 304
762 3300048921 Ga0496118_0017174 Ga0496118_0017174_2584_3498 304
763 3300048921 Ga0496118_0031163 Ga0496118_0031163_3502_4416 304
764 3300048921 Ga0496118_0034028 Ga0496118_0034028_712_1713 304
765 3300048922 Ga0496119_0022448 Ga0496119_0022448_68_1003 304
766 3300048923 Ga0496120_0044995 Ga0496120_0044995_1223_2167 304
767 3300048924 Ga0496121_0003780 Ga0496121_0003780_10794_11738 304
768 3300048924 Ga0496121_0012638 Ga0496121_0012638_2408_3322 304
769 3300048924 Ga0496121_0026552 Ga0496121_0026552_4440_5375 304
770 3300048925 Ga0496122_0010069 Ga0496122_0010069_4066_5067 304
771 3300048925 Ga0496122_0034634 Ga0496122_0034634_1935_2849 304
772 3300048925 Ga0496122_0048776 Ga0496122_0048776_84_1001 304
773 3300048926 Ga0496123_0007075 Ga0496123_0007075_2116_3030 304
774 3300048926 Ga0496123_0014048 Ga0496123_0014048_5067_6068 304
775 3300048926 Ga0496123_0097119 Ga0496123_0097119_213_1127 304
776 3300048927 Ga0496124_0002089 Ga0496124_0002089_7370_8284 304
777 3300048927 Ga0496124_0009653 Ga0496124_0009653_2408_3322 304
778 3300048927 Ga0496124_0029277 Ga0496124_0029277_3418_4362 304
779 3300048927 Ga0496124_0060523 Ga0496124_0060523_1271_2206 304
780 3300048928 Ga0496125_0009794 Ga0496125_0009794_6448_7362 304
781 3300048928 Ga0496125_0014106 Ga0496125_0014106_2823_3824 304
782 3300048928 Ga0496125_0077905 Ga0496125_0077905_1445_2380 304
783 3300048929 Ga0496126_0000188 Ga0496126_0000188_133065_133982 304
784 3300048929 Ga0496126_0242810 Ga0496126_0242810_360_1274 304
785 3300049570 Ga0501033_0000365 Ga0501033_0000365_40061_41035 304
786 3300049571 Ga0501034_0191769 Ga0501034_0191769_509_1423 304
787 3300049574 Ga0501038_0020981 Ga0501038_0020981_2986_3900 304
788 3300049581 Ga0501047_0022055 Ga0501047_0022055_3923_4849 304
789 3300049581 Ga0501047_0233924 Ga0501047_0233924_598_1512 304
790 3300049585 Ga0501069_0048728 Ga0501069_0048728_1085_2011 304
791 3300049586 Ga0501070_0010840 Ga0501070_0010840_2854_3780 304
792 3300049744 Ga0501083_0132598 Ga0501083_0132598_460_1374 304
793 3300049822 Ga0501035_0001622 Ga0501035_0001622_14759_15733 304
794 3300049822 Ga0501035_0021335 Ga0501035_0021335_2770_3696 304
795 3300049822 Ga0501035_0064758 Ga0501035_0064758_799_1725 304
796 3300049823 Ga0501044_0043138 Ga0501044_0043138_987_1913 304
797 3300049823 Ga0501044_0213601 Ga0501044_0213601_909_1835 304
798 3300050489 nmdc:mga03683_8607_c2 nmdc:mga03683_8607_c2_496_1410 304
799 3300050490 nmdc:mga03n38_48518_c1 nmdc:mga03n38_48518_c1_62_976 304
800 3300050491 nmdc:mga00v17_103159_c1 nmdc:mga00v17_103159_c1_357_1271 304
801 3300050492 nmdc:mga0yw44_187606_c1 nmdc:mga0yw44_187606_c1_287_1201 304
802 3300050493 nmdc:mga0k408_21083_c1 nmdc:mga0k408_21083_c1_2584_3498 304
803 3300050494 nmdc:mga06z11_23682_c1 nmdc:mga06z11_23682_c1_1837_2877 304
804 3300050494 nmdc:mga06z11_32099_c1 nmdc:mga06z11_32099_c1_206_1120 304
805 3300050496 nmdc:mga07m45_40428_c1 nmdc:mga07m45_40428_c1_730_1644 304
806 3300050516 nmdc:mga0sz30_4354_c1 nmdc:mga0sz30_4354_c1_1426_2340 304
807 3300053093 Ga0500651_0155066 Ga0500651_0155066_383_1297 304
808 3300053105 Ga0500557_000501 Ga0500557_000501_1922_2836 304
809 3300053109 Ga0500569_002896 Ga0500569_002896_15_929 304
810 3300053118 Ga0500594_0003894 Ga0500594_0003894_1688_2602 304
811 3300053118 Ga0500594_0025770 Ga0500594_0025770_345_1259 304
812 3300053134 Ga0500658_0000206 Ga0500658_0000206_1950_2864 304
813 3300053135 Ga0500659_0067210 Ga0500659_0067210_355_1269 304
814 3300053139 Ga0500568_0003195 Ga0500568_0003195_5002_5916 304
815 3300053148 Ga0500590_002837 Ga0500590_002837_4582_5586 304
816 3300053153 Ga0500616_0000309 Ga0500616_0000309_39923_40945 304
817 3300053153 Ga0500616_0109362 Ga0500616_0109362_24_938 304
818 3300053156 Ga0500622_0003878 Ga0500622_0003878_3052_4053 304
819 3300053161 Ga0500634_0013063 Ga0500634_0013063_47_967 304
820 3300053177 Ga0500636_0000003 Ga0500636_0000003_73683_74600 304
821 3300053177 Ga0500636_0054611 Ga0500636_0054611_316_1320 304
822 iso_pu_bacteria 2510917026 2511172875 304
823 iso_pu_bacteria 2513237138 2513865914 304
824 iso_pu_bacteria 2513237144 2513908554 304
825 iso_pu_bacteria 2582581299 2585228508 304
826 iso_pu_bacteria 2582581867 2585400946 304
827 iso_pu_bacteria 2585427590 2585822151 304
828 iso_pu_bacteria 2585427633 2585996667 304
829 iso_pu_bacteria 2585427634 2586001189 304
830 iso_pu_bacteria 2791355260 2793319390 304
831 iso_pu_bacteria 2791355267 2793367682 304
832 iso_pu_bacteria 2838661181 2838661384 304
833 iso_pu_bacteria 2919171160 2919172956 304
834 iso_pu_bacteria 2933016740 2933018203 304
835 iso_pu_bacteria 2996887358 2996892825 304
836 iso_pu_bacteria 3005409236 3005414348 304
837 iso_pu_bacteria 8005258706 8005259408 304
838 iso_pu_bacteria 8005321885 8005327352 304
839 iso_pu_bacteria 8056375014 8056378353 304

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

77

269

0.97

PF16916

ZT_dimer

Dimerisation domain of Zinc Transporter

273

351

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3byp-assembly1.cif.gz_B mode of action of a putative zinc transporter czrb 0.9097 211 290
3byp-assembly1.cif.gz_B mode of action of a putative zinc transporter czrb 0.8795 211 290
3byr-assembly1.cif.gz_A-2 mode of action of a putative zinc transporter czrb (zn form) 0.8641 207 294
6qfj-assembly4.cif.gz_D mamb ctd magnetosome protein [desulfamplus magnetovallimortis bw-1] 0.8491 214 292
3byr-assembly1.cif.gz_A-2 mode of action of a putative zinc transporter czrb (zn form) 0.8479 207 294
ID Description Score Start End Superfamily
af_D3ZWW5_236_448_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9307 11 206 1.20.1510.10
3bypB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9097 211 290 3.30.70.1350
3h90D02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9079 208 290 3.30.70.1350
af_Q3V5J4_162_375_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9076 10 206 1.20.1510.10
af_Q21304_258_344_3.30.70.1350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Cation efflux protein, cytoplasmic domain 0.9031 205 287 3.30.70.1350
ID Description Score Start End GO Terms
AF-A0A327JEH3-F1-model_v4 deleted 0.9911 207 284
AF-A0A327JEH3-F1-model_v4 deleted 0.9787 207 284
AF-W6W195-F1-model_v4 Cation diffusion facilitator family transporter 0.9568 3 304 GO:0005886
GO:0006882
GO:0015086
GO:0015093
GO:0015341
AF-W6W195-F1-model_v4 Cation diffusion facilitator family transporter 0.9477 3 304 GO:0005886
GO:0006882
GO:0015086
GO:0015093
GO:0015341
AF-A0A519Z9W3-F1-model_v4 Cation transporter 0.9469 9 177 GO:0005886
GO:0006882
GO:0015086
GO:0015093
GO:0015341

Feature Viewer

pLDDT pTM Quality
86.3 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map