F482940

General Info

Members Datasets Scaffolds Average Seq Length
837 325 837 250

Family's Representative Sequence

Representative Sequence 3300031824|Ga0307413_10018637|Ga0307413_100186373
Length 265
Sequence MPAAAGLDDMVIPGETLKIAVCIKRVPDTEMRFAIAGDGKSLDQTGLKYDISDFDGYAVEVALRLTEKDGGDVAVICLGPDGVQETIRKAFSMGAARGVQLKADTVPFDGSAIAHALAAELRDGGYDLVLFGRQSADAGNGTVGPMTAHLLGLPCVTAISHLELADGRGTAHRELEGSAESVEFPLPAVLTIDEGIARPRLPSLKGIMAAKKKTIDVRPAQLGEERLTVQTMALPPERAAGRIVGEGPDAVPELVRLLKTEAKVL

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
215 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
265 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
266 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
267 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
292 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
293 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
294 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
295 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
296 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
297 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
298 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
299 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
302 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
303 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
319 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.51
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 0.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10209515 3300005293 Unclassified 1321
2 Ga0070658_10007057 3300005327 Bacteria 9064
3 Ga0070658_10020907 3300005327 Bacteria 5242
4 Ga0070658_10227287 3300005327 Bacteria 1579
5 Ga0070676_10011596 3300005328 Bacteria 4794
6 Ga0070683_100000171 3300005329 Bacteria 42679
7 Ga0070683_100000440 3300005329 Bacteria 28884
8 Ga0070683_100006205 3300005329 Bacteria 10021
9 Ga0070683_100010918 3300005329 Bacteria 7822
10 Ga0070683_100048552 3300005329 Bacteria 3924
11 Ga0070683_100049271 3300005329 Bacteria 3895
12 Ga0070683_100074501 3300005329 Bacteria 3171
13 Ga0070683_100075540 3300005329 Bacteria 3148
14 Ga0070683_100098251 3300005329 Unclassified 2755
15 Ga0070683_100108253 3300005329 Bacteria 2621
16 Ga0070690_100008925 3300005330 Bacteria 5790
17 Ga0070690_100055174 3300005330 Bacteria 2545
18 Ga0070690_100073397 3300005330 Bacteria 2226
19 Ga0070690_100074670 3300005330 Bacteria 2209
20 Ga0070690_100120948 3300005330 Bacteria 1757
21 Ga0070670_100007041 3300005331 Bacteria 9532
22 Ga0070670_100007905 3300005331 Bacteria 9049
23 Ga0070670_100150990 3300005331 Bacteria 2010
24 Ga0070670_100385940 3300005331 Bacteria 1234
25 Ga0070670_100489284 3300005331 Bacteria 1093
26 Ga0068869_100009371 3300005334 Bacteria 6354
27 Ga0068869_100033861 3300005334 Bacteria 3610
28 Ga0070666_10079426 3300005335 Bacteria 2241
29 Ga0070680_100000733 3300005336 Bacteria 22901
30 Ga0070680_100004315 3300005336 Bacteria 10687
31 Ga0070680_100046151 3300005336 Bacteria 3543
32 Ga0070680_100065117 3300005336 Bacteria 2987
33 Ga0068868_100006090 3300005338 Bacteria 8517
34 Ga0070660_100003841 3300005339 Bacteria 10374
35 Ga0070660_100017277 3300005339 Bacteria 5256
36 Ga0070660_100017406 3300005339 Bacteria 5238
37 Ga0070660_100160829 3300005339 Bacteria 1809
38 Ga0070689_100003002 3300005340 Bacteria 11100
39 Ga0070689_100003984 3300005340 Bacteria 9923
40 Ga0070689_100066588 3300005340 Bacteria 2806
41 Ga0070689_100108048 3300005340 Bacteria 2210
42 Ga0070691_10002628 3300005341 Bacteria 8008
43 Ga0070687_100047025 3300005343 Unclassified 2211
44 Ga0070661_100000331 3300005344 Bacteria 37971
45 Ga0070692_10022338 3300005345 Bacteria 3089
46 Ga0070692_10022639 3300005345 Bacteria 3071
47 Ga0070692_10208081 3300005345 Bacteria 1150
48 Ga0070668_100024896 3300005347 Bacteria 4537
49 Ga0070668_100068765 3300005347 Bacteria 2753
50 Ga0070669_100078097 3300005353 Bacteria 2460
51 Ga0070669_100212749 3300005353 Bacteria 1526
52 Ga0070675_100001364 3300005354 Bacteria 17887
53 Ga0070675_100011838 3300005354 Bacteria 6834
54 Ga0070675_100012790 3300005354 Bacteria 6584
55 Ga0070675_100051961 3300005354 Bacteria 3368
56 Ga0070675_100151507 3300005354 Bacteria 1989
57 Ga0070675_100410378 3300005354 Bacteria 1209
58 Ga0070671_100053238 3300005355 Bacteria 3364
59 Ga0070671_100643229 3300005355 Unclassified 918
60 Ga0070674_100143652 3300005356 Bacteria 1794
61 Ga0070674_100207520 3300005356 Bacteria 1516
62 Ga0070674_100219437 3300005356 Bacteria 1478
63 Ga0070674_100475815 3300005356 Bacteria 1036
64 Ga0070673_100201070 3300005364 Bacteria 1716
65 Ga0070673_100275313 3300005364 Bacteria 1474
66 Ga0070688_100011427 3300005365 Bacteria 4933
67 Ga0070688_100083716 3300005365 Bacteria 2071
68 Ga0070659_100003745 3300005366 Bacteria 10847
69 Ga0070659_100019870 3300005366 Bacteria 5098
70 Ga0070659_100035374 3300005366 Bacteria 3890
71 Ga0070659_100092186 3300005366 Unclassified 2429
72 Ga0070667_100027832 3300005367 Bacteria 4704
73 Ga0070667_100387295 3300005367 Bacteria 1271
74 Ga0070667_100396394 3300005367 Bacteria 1256
75 Ga0070703_10000558 3300005406 Bacteria 13685
76 Ga0070703_10039499 3300005406 Bacteria 1463
77 Ga0070709_10001756 3300005434 Bacteria 11789
78 Ga0070709_10009907 3300005434 Bacteria 5268
79 Ga0070709_10032503 3300005434 Bacteria 3147
80 Ga0070714_100003987 3300005435 Bacteria 11099
81 Ga0070714_100096712 3300005435 Bacteria 2595
82 Ga0070713_100000149 3300005436 Bacteria 46694
83 Ga0070713_100010992 3300005436 Bacteria 6567
84 Ga0070713_100029513 3300005436 Bacteria 4345
85 Ga0070713_100046876 3300005436 Bacteria 3549
86 Ga0070713_100331951 3300005436 Bacteria 1407
87 Ga0070710_10124963 3300005437 Bacteria 1562
88 Ga0070701_10002580 3300005438 Bacteria 7020
89 Ga0070701_10010767 3300005438 Bacteria 4058
90 Ga0070711_100143458 3300005439 Bacteria 1793
91 Ga0070711_100151770 3300005439 Bacteria 1748
92 Ga0070705_100017142 3300005440 Bacteria 3777
93 Ga0070705_100027043 3300005440 Bacteria 3128
94 Ga0070705_100042485 3300005440 Bacteria 2599
95 Ga0070700_100057968 3300005441 Bacteria 2432
96 Ga0070694_100019882 3300005444 Bacteria 4276
97 Ga0070694_100106302 3300005444 Bacteria 1993
98 Ga0070694_100125301 3300005444 Bacteria 1848
99 Ga0070708_100000045 3300005445 Bacteria 81076
100 Ga0070708_100021041 3300005445 Bacteria 5508
101 Ga0070708_100058288 3300005445 Bacteria 3440
102 Ga0070708_100084310 3300005445 Bacteria 2882
103 Ga0070708_100181689 3300005445 Bacteria 1966
104 Ga0070708_100377408 3300005445 Bacteria 1337
105 Ga0070663_100071034 3300005455 Bacteria 2533
106 Ga0070678_100388204 3300005456 Bacteria 1210
107 Ga0070662_100015491 3300005457 Bacteria 5108
108 Ga0070662_100208715 3300005457 Bacteria 1553
109 Ga0070681_10001111 3300005458 Bacteria 23026
110 Ga0070681_10001558 3300005458 Bacteria 20324
111 Ga0070681_10003103 3300005458 Bacteria 15433
112 Ga0070681_10044788 3300005458 Bacteria 4430
113 Ga0070681_10068350 3300005458 Bacteria 3520
114 Ga0070681_10107087 3300005458 Bacteria 2737
115 Ga0070681_10168120 3300005458 Bacteria 2115
116 Ga0070681_10221985 3300005458 Bacteria 1805
117 Ga0070681_10690315 3300005458 Bacteria 936
118 Ga0068867_100047606 3300005459 Bacteria 3152
119 Ga0068867_100360046 3300005459 Bacteria 1216
120 Ga0070685_10087902 3300005466 Bacteria 1876
121 Ga0070706_100028449 3300005467 Bacteria 5145
122 Ga0070706_100073302 3300005467 Bacteria 3169
123 Ga0070706_100145381 3300005467 Bacteria 2214
124 Ga0070706_100250384 3300005467 Bacteria 1654
125 Ga0070698_100001280 3300005471 Bacteria 28075
126 Ga0070698_100015560 3300005471 Bacteria 8033
127 Ga0070698_100035195 3300005471 Bacteria 5179
128 Ga0070698_100099490 3300005471 Bacteria 2881
129 Ga0070698_100112996 3300005471 Bacteria 2681
130 Ga0070699_100004498 3300005518 Bacteria 12336
131 Ga0070699_100008858 3300005518 Bacteria 8714
132 Ga0070699_100009323 3300005518 Bacteria 8501
133 Ga0070679_100000772 3300005530 Bacteria 27787
134 Ga0070679_100001050 3300005530 Bacteria 24079
135 Ga0070679_100011589 3300005530 Bacteria 8402
136 Ga0070679_100012412 3300005530 Bacteria 8141
137 Ga0070679_100032305 3300005530 Bacteria 5176
138 Ga0070679_100045263 3300005530 Bacteria 4385
139 Ga0070679_100212162 3300005530 Unclassified 1900
140 Ga0070679_100261040 3300005530 Bacteria 1687
141 Ga0070679_100532564 3300005530 Bacteria 1118
142 Ga0070679_100652642 3300005530 Bacteria 995
143 Ga0070684_100003911 3300005535 Bacteria 11285
144 Ga0070684_100004027 3300005535 Bacteria 11119
145 Ga0070684_100005252 3300005535 Bacteria 9911
146 Ga0070684_100010947 3300005535 Bacteria 7210
147 Ga0070684_100011827 3300005535 Bacteria 6965
148 Ga0070684_100038477 3300005535 Bacteria 4109
149 Ga0070684_100089480 3300005535 Bacteria 2736
150 Ga0070684_100091007 3300005535 Bacteria 2713
151 Ga0070684_100100588 3300005535 Bacteria 2582
152 Ga0070684_100160255 3300005535 Bacteria 2041
153 Ga0070684_100620762 3300005535 Bacteria 1006
154 Ga0070684_100628709 3300005535 Bacteria 999
155 Ga0070697_100003217 3300005536 Bacteria 12532
156 Ga0070697_100026488 3300005536 Bacteria 4633
157 Ga0070697_100045094 3300005536 Bacteria 3573
158 Ga0068853_100008377 3300005539 Bacteria 8302
159 Ga0068853_100184561 3300005539 Bacteria 1893
160 Ga0070672_100027948 3300005543 Bacteria 4213
161 Ga0070672_100030900 3300005543 Bacteria 4028
162 Ga0070672_100049621 3300005543 Bacteria 3266
163 Ga0070672_100052303 3300005543 Bacteria 3188
164 Ga0070672_100519237 3300005543 Bacteria 1032
165 Ga0070672_100843294 3300005543 Bacteria 808
166 Ga0070686_100048541 3300005544 Bacteria 2690
167 Ga0070686_100228275 3300005544 Unclassified 1349
168 Ga0070695_100024915 3300005545 Bacteria 3690
169 Ga0070695_100109486 3300005545 Bacteria 1872
170 Ga0070695_100153888 3300005545 Bacteria 1607
171 Ga0070695_100155628 3300005545 Unclassified 1599
172 Ga0070696_100000113 3300005546 Bacteria 41571
173 Ga0070696_100006443 3300005546 Bacteria 7853
174 Ga0070696_100127985 3300005546 Bacteria 1845
175 Ga0070696_100146867 3300005546 Bacteria 1728
176 Ga0070693_100008367 3300005547 Bacteria 5096
177 Ga0070665_100028248 3300005548 Bacteria 5650
178 Ga0070704_100124498 3300005549 Bacteria 1986
179 Ga0070704_100255778 3300005549 Unclassified 1440
180 Ga0068855_100036976 3300005563 Bacteria 5809
181 Ga0068855_100066073 3300005563 Bacteria 4216
182 Ga0068855_100070607 3300005563 Bacteria 4063
183 Ga0068855_100164028 3300005563 Bacteria 2520
184 Ga0068855_100352241 3300005563 Bacteria 1622
185 Ga0070664_100000995 3300005564 Bacteria 22203
186 Ga0070664_100009674 3300005564 Bacteria 7822
187 Ga0070664_100010051 3300005564 Bacteria 7671
188 Ga0070664_100013873 3300005564 Bacteria 6569
189 Ga0070664_100035511 3300005564 Bacteria 4185
190 Ga0070664_100345046 3300005564 Bacteria 1353
191 Ga0070664_100726061 3300005564 Bacteria 926
192 Ga0068857_100003760 3300005577 Bacteria 12760
193 Ga0068857_100016130 3300005577 Bacteria 6544
194 Ga0068857_100024005 3300005577 Bacteria 5368
195 Ga0068857_100210193 3300005577 Bacteria 1775
196 Ga0068854_100074455 3300005578 Bacteria 2491
197 Ga0068856_100023996 3300005614 Bacteria 5933
198 Ga0068856_100036053 3300005614 Bacteria 4850
199 Ga0068856_100335608 3300005614 Unclassified 1530
200 Ga0070702_100002959 3300005615 Bacteria 7493
201 Ga0070702_100013457 3300005615 Bacteria 4130
202 Ga0068852_100045546 3300005616 Bacteria 3732
203 Ga0068852_100065392 3300005616 Bacteria 3172
204 Ga0068852_100107033 3300005616 Bacteria 2536
205 Ga0068859_100050496 3300005617 Bacteria 4177
206 Ga0068859_100090186 3300005617 Bacteria 3116
207 Ga0068859_100113118 3300005617 Bacteria 2778
208 Ga0068864_100375892 3300005618 Bacteria 1345
209 Ga0068866_10045753 3300005718 Bacteria 2197
210 Ga0068861_100000159 3300005719 Bacteria 35347
211 Ga0068870_10014684 3300005840 Bacteria 3704
212 Ga0068863_100007245 3300005841 Bacteria 10868
213 Ga0068863_100190819 3300005841 Bacteria 1969
214 Ga0068863_100227247 3300005841 Bacteria 1799
215 Ga0068863_100401015 3300005841 Bacteria 1341
216 Ga0068858_100012458 3300005842 Bacteria 8019
217 Ga0068858_100056481 3300005842 Bacteria 3628
218 Ga0068860_100022982 3300005843 Bacteria 6030
219 Ga0068860_100038284 3300005843 Bacteria 4587
220 Ga0068862_100011812 3300005844 Bacteria 7212
221 Ga0068862_100198283 3300005844 Unclassified 1809
222 Ga0081538_10030216 3300005981 Bacteria 3683
223 Ga0081539_10000174 3300005985 Bacteria 151265
224 Ga0070717_10034077 3300006028 Bacteria 4113
225 Ga0070716_100087416 3300006173 Unclassified 1878
226 Ga0070712_100014254 3300006175 Bacteria 5103
227 Ga0070712_100018761 3300006175 Bacteria 4498
228 Ga0070712_100118282 3300006175 Bacteria 1990
229 Ga0070712_100219079 3300006175 Bacteria 1506
230 Ga0097621_100047853 3300006237 Bacteria 3466
231 Ga0068871_100092028 3300006358 Bacteria 2529
232 Ga0075430_100003033 3300006846 Bacteria 14045
233 Ga0075430_100116645 3300006846 Bacteria 2225
234 Ga0075430_100286042 3300006846 Bacteria 1364
235 Ga0075431_100005056 3300006847 Bacteria 12976
236 Ga0075431_100013930 3300006847 Bacteria 8122
237 Ga0075431_100236280 3300006847 Bacteria 1861
238 Ga0075431_100302420 3300006847 Bacteria 1616
239 Ga0075431_100504883 3300006847 Bacteria 1200
240 Ga0075433_10149367 3300006852 Bacteria 2078
241 Ga0075433_10300041 3300006852 Bacteria 1422
242 Ga0075434_100077827 3300006871 Bacteria 3312
243 Ga0075434_100296288 3300006871 Bacteria 1637
244 Ga0075429_100009585 3300006880 Bacteria 8399
245 Ga0075429_100024226 3300006880 Bacteria 5265
246 Ga0068865_100031767 3300006881 Bacteria 3523
247 Ga0075436_100005526 3300006914 Bacteria 8687
248 Ga0075436_100015174 3300006914 Bacteria 5277
249 Ga0075436_100071491 3300006914 Bacteria 2399
250 Ga0075436_100188884 3300006914 Bacteria 1457
251 Ga0097620_100050498 3300006931 Bacteria 4177
252 Ga0097620_100090186 3300006931 Bacteria 3116
253 Ga0097620_100113119 3300006931 Bacteria 2778
254 Ga0075435_100012532 3300007076 Bacteria 6282
255 Ga0075435_100130410 3300007076 Bacteria 2103
256 Ga0075435_100284203 3300007076 Bacteria 1413
257 Ga0099794_10000159 3300007265 Bacteria 24881
258 Ga0111539_10078098 3300009094 Bacteria 3895
259 Ga0111539_10187271 3300009094 Bacteria 2416
260 Ga0111539_10215561 3300009094 Bacteria 2236
261 Ga0111539_10330678 3300009094 Bacteria 1774
262 Ga0105245_10001478 3300009098 Bacteria 21218
263 Ga0105245_10049888 3300009098 Bacteria 3750
264 Ga0105245_10111226 3300009098 Bacteria 2547
265 Ga0105245_10195545 3300009098 Bacteria 1940
266 Ga0105245_10289383 3300009098 Unclassified 1604
267 Ga0105245_10302874 3300009098 Bacteria 1569
268 Ga0105245_10558659 3300009098 Bacteria 1167
269 Ga0105245_10584671 3300009098 Bacteria 1141
270 Ga0105245_10862123 3300009098 Bacteria 946
271 Ga0114129_10069432 3300009147 Bacteria 4911
272 Ga0114129_10077699 3300009147 Bacteria 4617
273 Ga0114129_10253321 3300009147 Bacteria 2362
274 Ga0114129_10394119 3300009147 Bacteria 1826
275 Ga0105243_10070943 3300009148 Bacteria 2815
276 Ga0105241_10117056 3300009174 Bacteria 2141
277 Ga0105241_10130184 3300009174 Bacteria 2036
278 Ga0105242_10012697 3300009176 Bacteria 6487
279 Ga0105242_10116505 3300009176 Bacteria 2286
280 Ga0105242_10249134 3300009176 Bacteria 1600
281 Ga0105248_10001272 3300009177 Bacteria 28205
282 Ga0105248_10066259 3300009177 Bacteria 4055
283 Ga0105248_10137998 3300009177 Bacteria 2751
284 Ga0105248_10141219 3300009177 Bacteria 2717
285 Ga0105248_10293326 3300009177 Bacteria 1831
286 Ga0105248_10436503 3300009177 Bacteria 1475
287 Ga0105237_10724320 3300009545 Bacteria 1001
288 Ga0105238_10070208 3300009551 Bacteria 3503
289 Ga0105238_10070936 3300009551 Bacteria 3482
290 Ga0105238_10121138 3300009551 Bacteria 2595
291 Ga0105249_10003084 3300009553 Bacteria 14378
292 Ga0105239_10059094 3300010375 Bacteria 4208
293 Ga0105246_10000522 3300011119 Bacteria 20988
294 Ga0157373_10016038 3300013100 Bacteria 5468
295 Ga0157373_10073716 3300013100 Bacteria 2409
296 Ga0157373_10366933 3300013100 Bacteria 1028
297 Ga0157371_10003449 3300013102 Bacteria 14344
298 Ga0157371_10013563 3300013102 Bacteria 6187
299 Ga0157371_10108983 3300013102 Bacteria 1965
300 Ga0157370_10016785 3300013104 Bacteria 7405
301 Ga0157370_10385153 3300013104 Bacteria 1291
302 Ga0157369_10031048 3300013105 Bacteria 5888
303 Ga0157369_10216558 3300013105 Bacteria 2006
304 Ga0157369_10315757 3300013105 Bacteria 1625
305 Ga0157369_10341386 3300013105 Bacteria 1556
306 Ga0157369_10405202 3300013105 Unclassified 1415
307 Ga0157369_10414241 3300013105 Unclassified 1397
308 Ga0157369_10816155 3300013105 Bacteria 958
309 Ga0157374_10006995 3300013296 Bacteria 9604
310 Ga0157374_10588017 3300013296 Bacteria 1122
311 Ga0157374_10597086 3300013296 Bacteria 1114
312 Ga0157378_10385904 3300013297 Bacteria 1376
313 Ga0157378_10690526 3300013297 Bacteria 1039
314 Ga0163162_10001610 3300013306 Bacteria 21128
315 Ga0163162_10415506 3300013306 Bacteria 1477
316 Ga0157372_10020362 3300013307 Bacteria 7155
317 Ga0157372_10021441 3300013307 Bacteria 6981
318 Ga0157372_10033001 3300013307 Bacteria 5683
319 Ga0157372_10042228 3300013307 Bacteria 5043
320 Ga0157372_10043863 3300013307 Bacteria 4955
321 Ga0157372_10102077 3300013307 Bacteria 3276
322 Ga0157372_10154499 3300013307 Bacteria 2650
323 Ga0157372_10269874 3300013307 Bacteria 1977
324 Ga0157372_10373281 3300013307 Unclassified 1662
325 Ga0157372_10674511 3300013307 Bacteria 1203
326 Ga0157372_10693136 3300013307 Bacteria 1185
327 Ga0157372_11146320 3300013307 Bacteria 899
328 Ga0157375_10030709 3300013308 Bacteria 5070
329 Ga0157375_10055591 3300013308 Bacteria 3903
330 Ga0157375_10094530 3300013308 Bacteria 3058
331 Ga0157375_10127136 3300013308 Bacteria 2665
332 Ga0157375_10649265 3300013308 Bacteria 1211
333 Ga0157375_10850113 3300013308 Bacteria 1059
334 Ga0163163_10004113 3300014325 Bacteria 12404
335 Ga0163163_10057127 3300014325 Bacteria 3858
336 Ga0157380_10263785 3300014326 Unclassified 1566
337 Ga0157377_10000600 3300014745 Bacteria 14949
338 Ga0157377_10000911 3300014745 Bacteria 12337
339 Ga0157379_10003764 3300014968 Bacteria 12911
340 Ga0157376_10022494 3300014969 Bacteria 4917
341 Ga0157376_10317585 3300014969 Bacteria 1480
342 Ga0157376_10440972 3300014969 Bacteria 1268
343 Ga0163161_10106386 3300017792 Bacteria 2093
344 Ga0163161_10145557 3300017792 Bacteria 1797
345 Ga0207653_10000193 3300025885 Bacteria 41936
346 Ga0207653_10078437 3300025885 Bacteria 1139
347 Ga0207682_10036039 3300025893 Bacteria 2001
348 Ga0207692_10203057 3300025898 Bacteria 1166
349 Ga0207642_10057020 3300025899 Bacteria 1795
350 Ga0207710_10159040 3300025900 Bacteria 1099
351 Ga0207688_10051685 3300025901 Bacteria 2302
352 Ga0207647_10247599 3300025904 Bacteria 1023
353 Ga0207685_10030110 3300025905 Bacteria 1929
354 Ga0207699_10005806 3300025906 Bacteria 5939
355 Ga0207699_10123914 3300025906 Bacteria 1675
356 Ga0207699_10217058 3300025906 Bacteria 1304
357 Ga0207645_10000126 3300025907 Bacteria 58037
358 Ga0207645_10042462 3300025907 Bacteria 2909
359 Ga0207643_10016451 3300025908 Bacteria 4035
360 Ga0207643_10035541 3300025908 Bacteria 2794
361 Ga0207705_10011135 3300025909 Bacteria 6519
362 Ga0207705_10026485 3300025909 Bacteria 4135
363 Ga0207705_10279039 3300025909 Bacteria 1279
364 Ga0207684_10124054 3300025910 Bacteria 2216
365 Ga0207684_10241536 3300025910 Bacteria 1558
366 Ga0207684_10317139 3300025910 Bacteria 1344
367 Ga0207654_10131702 3300025911 Bacteria 1583
368 Ga0207707_10001370 3300025912 Bacteria 22592
369 Ga0207707_10006243 3300025912 Bacteria 10409
370 Ga0207707_10006657 3300025912 Bacteria 10079
371 Ga0207707_10047510 3300025912 Bacteria 3738
372 Ga0207707_10111930 3300025912 Bacteria 2387
373 Ga0207707_10293253 3300025912 Unclassified 1407
374 Ga0207693_10039227 3300025915 Bacteria 3729
375 Ga0207693_10070454 3300025915 Bacteria 2736
376 Ga0207663_10052611 3300025916 Bacteria 2541
377 Ga0207663_10125158 3300025916 Bacteria 1767
378 Ga0207663_10188239 3300025916 Bacteria 1480
379 Ga0207660_10001337 3300025917 Bacteria 16493
380 Ga0207660_10040194 3300025917 Bacteria 3273
381 Ga0207660_10224299 3300025917 Bacteria 1476
382 Ga0207660_10510744 3300025917 Unclassified 975
383 Ga0207662_10019471 3300025918 Bacteria 3864
384 Ga0207662_10028340 3300025918 Bacteria 3236
385 Ga0207662_10043404 3300025918 Bacteria 2652
386 Ga0207662_10053677 3300025918 Bacteria 2401
387 Ga0207657_10002485 3300025919 Bacteria 19933
388 Ga0207657_10033132 3300025919 Bacteria 4660
389 Ga0207657_10526036 3300025919 Bacteria 925
390 Ga0207649_10037927 3300025920 Bacteria 2915
391 Ga0207649_10269162 3300025920 Bacteria 1234
392 Ga0207649_10366602 3300025920 Bacteria 1070
393 Ga0207652_10005794 3300025921 Bacteria 10023
394 Ga0207652_10008992 3300025921 Bacteria 8050
395 Ga0207652_10107967 3300025921 Bacteria 2466
396 Ga0207652_10381888 3300025921 Bacteria 1271
397 Ga0207652_10592518 3300025921 Unclassified 994
398 Ga0207646_10027930 3300025922 Bacteria 5143
399 Ga0207646_10074317 3300025922 Bacteria 3036
400 Ga0207681_10012890 3300025923 Bacteria 5169
401 Ga0207681_10453097 3300025923 Bacteria 1044
402 Ga0207650_10148610 3300025925 Bacteria 1847
403 Ga0207650_10190558 3300025925 Bacteria 1638
404 Ga0207650_10193923 3300025925 Bacteria 1624
405 Ga0207650_10230506 3300025925 Bacteria 1494
406 Ga0207659_10023295 3300025926 Bacteria 4131
407 Ga0207687_10026879 3300025927 Bacteria 3856
408 Ga0207687_10124491 3300025927 Unclassified 1933
409 Ga0207687_10127829 3300025927 Bacteria 1911
410 Ga0207687_10214669 3300025927 Bacteria 1511
411 Ga0207700_10000713 3300025928 Bacteria 19212
412 Ga0207700_10012092 3300025928 Bacteria 5546
413 Ga0207700_10157062 3300025928 Bacteria 1886
414 Ga0207700_10166242 3300025928 Bacteria 1836
415 Ga0207700_10199605 3300025928 Bacteria 1685
416 Ga0207700_10321260 3300025928 Unclassified 1341
417 Ga0207664_10003774 3300025929 Bacteria 10178
418 Ga0207664_10120633 3300025929 Bacteria 2193
419 Ga0207644_10492585 3300025931 Bacteria 1010
420 Ga0207644_10628828 3300025931 Bacteria 892
421 Ga0207690_10004856 3300025932 Bacteria 7929
422 Ga0207690_10011490 3300025932 Bacteria 5292
423 Ga0207690_10028632 3300025932 Bacteria 3532
424 Ga0207690_10085243 3300025932 Bacteria 2217
425 Ga0207706_10000360 3300025933 Bacteria 49293
426 Ga0207706_10027041 3300025933 Bacteria 5131
427 Ga0207706_10470777 3300025933 Bacteria 1086
428 Ga0207686_10034664 3300025934 Bacteria 3022
429 Ga0207686_10080842 3300025934 Bacteria 2120
430 Ga0207686_10115623 3300025934 Bacteria 1817
431 Ga0207686_10242766 3300025934 Bacteria 1312
432 Ga0207670_10015237 3300025936 Bacteria 4587
433 Ga0207670_10166131 3300025936 Unclassified 1651
434 Ga0207669_10007595 3300025937 Bacteria 5029
435 Ga0207669_10134138 3300025937 Bacteria 1707
436 Ga0207665_10186041 3300025939 Bacteria 1507
437 Ga0207691_10002534 3300025940 Bacteria 17853
438 Ga0207691_10003202 3300025940 Bacteria 15965
439 Ga0207691_10039995 3300025940 Bacteria 4336
440 Ga0207691_10047980 3300025940 Bacteria 3916
441 Ga0207691_10061922 3300025940 Bacteria 3397
442 Ga0207691_10232467 3300025940 Unclassified 1596
443 Ga0207711_10011146 3300025941 Bacteria 7471
444 Ga0207711_10024832 3300025941 Bacteria 5028
445 Ga0207711_10326655 3300025941 Bacteria 1418
446 Ga0207711_10345965 3300025941 Bacteria 1376
447 Ga0207711_10415405 3300025941 Bacteria 1251
448 Ga0207689_10009951 3300025942 Bacteria 8201
449 Ga0207661_10003744 3300025944 Bacteria 10594
450 Ga0207661_10039887 3300025944 Bacteria 3688
451 Ga0207661_10066666 3300025944 Bacteria 2925
452 Ga0207661_10087859 3300025944 Bacteria 2583
453 Ga0207661_10113031 3300025944 Bacteria 2300
454 Ga0207661_10114042 3300025944 Bacteria 2291
455 Ga0207661_10233346 3300025944 Bacteria 1630
456 Ga0207661_10535090 3300025944 Bacteria 1072
457 Ga0207661_10537887 3300025944 Bacteria 1069
458 Ga0207661_10761917 3300025944 Bacteria 891
459 Ga0207679_10004676 3300025945 Bacteria 8527
460 Ga0207679_10018528 3300025945 Bacteria 4666
461 Ga0207679_10034869 3300025945 Bacteria 3555
462 Ga0207679_10090522 3300025945 Unclassified 2365
463 Ga0207679_10242268 3300025945 Bacteria 1528
464 Ga0207679_10308582 3300025945 Bacteria 1366
465 Ga0207679_10570648 3300025945 Bacteria 1017
466 Ga0207667_10035867 3300025949 Bacteria 5320
467 Ga0207667_10114539 3300025949 Bacteria 2779
468 Ga0207667_10278142 3300025949 Bacteria 1711
469 Ga0207667_10306688 3300025949 Bacteria 1622
470 Ga0207651_10256972 3300025960 Bacteria 1432
471 Ga0207712_10002205 3300025961 Bacteria 12685
472 Ga0207712_10118982 3300025961 Bacteria 1995
473 Ga0207668_10014847 3300025972 Bacteria 4828
474 Ga0207668_10098453 3300025972 Bacteria 2167
475 Ga0207640_10150065 3300025981 Unclassified 1711
476 Ga0207640_10782756 3300025981 Bacteria 825
477 Ga0207658_10045091 3300025986 Bacteria 3213
478 Ga0207658_10085411 3300025986 Bacteria 2431
479 Ga0207658_10194708 3300025986 Bacteria 1688
480 Ga0207658_10805954 3300025986 Bacteria 853
481 Ga0207703_10276924 3300026035 Unclassified 1522
482 Ga0207703_10719194 3300026035 Bacteria 950
483 Ga0207703_10751796 3300026035 Bacteria 929
484 Ga0207639_10163108 3300026041 Bacteria 1880
485 Ga0207639_10538486 3300026041 Bacteria 1071
486 Ga0207678_10008055 3300026067 Bacteria 9293
487 Ga0207708_10048846 3300026075 Bacteria 3221
488 Ga0207708_10245980 3300026075 Bacteria 1440
489 Ga0207708_10383521 3300026075 Bacteria 1159
490 Ga0207702_10011688 3300026078 Bacteria 7310
491 Ga0207702_10026823 3300026078 Bacteria 4784
492 Ga0207702_10274081 3300026078 Unclassified 1592
493 Ga0207702_10374263 3300026078 Bacteria 1368
494 Ga0207702_10544182 3300026078 Bacteria 1135
495 Ga0207641_10038720 3300026088 Bacteria 3986
496 Ga0207641_10046937 3300026088 Bacteria 3641
497 Ga0207648_10027761 3300026089 Bacteria 5023
498 Ga0207648_10434164 3300026089 Bacteria 1194
499 Ga0207676_10023859 3300026095 Bacteria 4520
500 Ga0207676_10079204 3300026095 Bacteria 2664
501 Ga0207676_10450954 3300026095 Bacteria 1212
502 Ga0207674_10000528 3300026116 Bacteria 50247
503 Ga0207674_10002884 3300026116 Bacteria 21373
504 Ga0207674_10013853 3300026116 Bacteria 8922
505 Ga0207674_10043791 3300026116 Bacteria 4613
506 Ga0207674_10045491 3300026116 Bacteria 4514
507 Ga0207674_10117375 3300026116 Bacteria 2631
508 Ga0207674_10420867 3300026116 Bacteria 1291
509 Ga0207675_100004288 3300026118 Bacteria 13789
510 Ga0207675_100410485 3300026118 Bacteria 1336
511 Ga0207683_10555822 3300026121 Bacteria 1061
512 Ga0207698_10027527 3300026142 Bacteria 4037
513 Ga0207698_10179487 3300026142 Bacteria 1874
514 Ga0207698_10201083 3300026142 Bacteria 1784
515 Ga0207698_10217355 3300026142 Bacteria 1724
516 Ga0268266_10072508 3300028379 Unclassified 2987
517 Ga0268265_10046502 3300028380 Bacteria 3244
518 Ga0268265_10209093 3300028380 Bacteria 1699
519 Ga0268264_10269800 3300028381 Bacteria 1589
520 Ga0268264_10343149 3300028381 Unclassified 1419
521 Ga0265332_10011303 3300031238 Bacteria 3970
522 Ga0265327_10021313 3300031251 Bacteria 3914
523 Ga0307408_100003736 3300031548 Bacteria 10364
524 Ga0265314_10029359 3300031711 Bacteria 4088
525 Ga0307405_10155051 3300031731 Bacteria 1615
526 Ga0307413_10018637 3300031824 Bacteria 3647
527 Ga0307413_10099106 3300031824 Bacteria 1920
528 Ga0307410_10034418 3300031852 Bacteria 3281
529 Ga0307410_10049062 3300031852 Bacteria 2832
530 Ga0307410_10064954 3300031852 Bacteria 2509
531 Ga0307410_10093351 3300031852 Bacteria 2141
532 Ga0307410_10203856 3300031852 Bacteria 1512
533 Ga0307406_10015818 3300031901 Bacteria 4373
534 Ga0307406_10411980 3300031901 Bacteria 1074
535 Ga0307406_10541330 3300031901 Unclassified 951
536 Ga0307407_10033836 3300031903 Bacteria 2792
537 Ga0307407_10089403 3300031903 Bacteria 1884
538 Ga0307409_100030031 3300031995 Bacteria 3899
539 Ga0307409_100041124 3300031995 Bacteria 3449
540 Ga0307409_100266064 3300031995 Bacteria 1576
541 Ga0307416_100014279 3300032002 Bacteria 5434
542 Ga0307416_100061123 3300032002 Bacteria 3072
543 Ga0307416_100278572 3300032002 Bacteria 1647
544 Ga0307414_10104544 3300032004 Bacteria 2139
545 Ga0307414_10120693 3300032004 Bacteria 2015
546 Ga0307414_10180513 3300032004 Bacteria 1697
547 Ga0307411_10022852 3300032005 Bacteria 3692
548 Ga0307411_10024423 3300032005 Bacteria 3603
549 Ga0307411_10030446 3300032005 Bacteria 3308
550 Ga0307411_10144154 3300032005 Bacteria 1760
551 Ga0307415_100034660 3300032126 Bacteria 3289
552 Ga0373926_0013037 3300035083 Bacteria 2815
553 Ga0373934_0000378 3300035086 Bacteria 15598
554 Ga0373934_0005214 3300035086 Bacteria 4807
555 Ga0373940_0064287 3300035088 Bacteria 1056
556 Ga0373944_0049828 3300035089 Bacteria 1317
557 Ga0373949_0022087 3300035090 Bacteria 1465
558 Ga0373945_0087275 3300035116 Bacteria 1203
559 Ga0373954_0022269 3300035118 Bacteria 2873
560 Ga0373954_0133729 3300035118 Bacteria 1208
561 Ga0373956_0001784 3300035119 Bacteria 8872
562 Ga0373957_0002283 3300035120 Bacteria 5437
563 Ga0373943_0017013 3300035170 Bacteria 3325
564 Ga0373943_0084416 3300035170 Bacteria 1634
565 Ga0373955_0000478 3300035172 Bacteria 16904
566 Ga0373955_0011131 3300035172 Bacteria 4275
567 Ga0373955_0051117 3300035172 Unclassified 2250
568 Ga0373931_0113494 3300035691 Bacteria 1540
569 Ga0373931_0200410 3300035691 Bacteria 1192
570 Ga0373935_0000974 3300035692 Bacteria 15538
571 Ga0373935_0184745 3300035692 Unclassified 1433
572 Ga0373935_0325947 3300035692 Bacteria 1091
573 Ga0373927_0008745 3300035695 Bacteria 6801
574 Ga0373927_0039757 3300035695 Bacteria 3053
575 Ga0373927_0061501 3300035695 Bacteria 2429
576 Ga0373933_0000033 3300035724 Bacteria 84415
577 Ga0373933_0053316 3300035724 Bacteria 2422
578 Ga0373947_0005801 3300035725 Bacteria 7198
579 Ga0373947_0174908 3300035725 Bacteria 1395
580 Ga0373937_0000158 3300036401 Bacteria 65505
581 Ga0373937_0023307 3300036401 Bacteria 5572
582 Ga0373937_0032620 3300036401 Bacteria 4724
583 Ga0373937_0056784 3300036401 Bacteria 3596
584 Ga0373937_0347028 3300036401 Unclassified 1406
585 Ga0373925_0002081 3300037068 Bacteria 16453
586 Ga0373925_0203206 3300037068 Bacteria 1576
587 Ga0436365_0597434 3300039437 Bacteria 3269
588 Ga0439439_0003899 3300041406 Bacteria 3322
589 Ga0439439_0077261 3300041406 Bacteria 897
590 Ga0439448_0021568 3300042005 Unclassified 1997
591 Ga0439446_0072234 3300042156 Bacteria 1057
592 Ga0439434_0030838 3300042435 Bacteria 1629
593 Ga0451577_0000005 3300042876 Bacteria 712599
594 Ga0451577_0753318 3300042876 Unclassified 881
595 Ga0466969_0115206 3300044656 Bacteria 1255
596 Ga0466963_0170513 3300044694 Bacteria 1517
597 Ga0466959_0015951 3300045049 Bacteria 5482
598 Ga0451576_0072473 3300045051 Bacteria 3584
599 Ga0451576_0973722 3300045051 Bacteria 889
600 Ga0466958_0353868 3300045836 Bacteria 946
601 Ga0466967_0023654 3300045976 Bacteria 5039
602 Ga0466967_0113180 3300045976 Bacteria 2496
603 Ga0466967_0274661 3300045976 Bacteria 1616
604 Ga0495592_0000976 3300046454 Bacteria 19849
605 Ga0495603_0035019 3300046455 Bacteria 3017
606 Ga0495629_0008985 3300046459 Bacteria 7334
607 Ga0495629_0025272 3300046459 Bacteria 4224
608 Ga0495629_0071754 3300046459 Bacteria 2417
609 Ga0495629_0083200 3300046459 Bacteria 2234
610 Ga0495629_0094913 3300046459 Bacteria 2081
611 Ga0495629_0294261 3300046459 Bacteria 1112
612 Ga0495651_0000893 3300046462 Bacteria 23203
613 Ga0495651_0023586 3300046462 Bacteria 4784
614 Ga0495651_0106142 3300046462 Bacteria 2082
615 Ga0495653_0000173 3300046463 Bacteria 53365
616 Ga0495653_0089320 3300046463 Bacteria 2258
617 Ga0495580_0004972 3300046472 Bacteria 11106
618 Ga0495580_0088355 3300046472 Bacteria 2158
619 Ga0495582_0006104 3300046473 Bacteria 6709
620 Ga0495582_0039838 3300046473 Bacteria 2586
621 Ga0495582_0078363 3300046473 Bacteria 1833
622 Ga0495639_0017395 3300046475 Bacteria 3122
623 Ga0495639_0025008 3300046475 Bacteria 2631
624 Ga0495662_0090359 3300046476 Bacteria 1493
625 Ga0495662_0099135 3300046476 Unclassified 1425
626 Ga0495664_0004103 3300046477 Bacteria 7951
627 Ga0495664_0088709 3300046477 Unclassified 1859
628 Ga0495594_0009845 3300046499 Bacteria 4953
629 Ga0495594_0048806 3300046499 Bacteria 2326
630 Ga0495594_0053371 3300046499 Bacteria 2226
631 Ga0495594_0074959 3300046499 Bacteria 1886
632 Ga0495608_0000763 3300046511 Bacteria 22518
633 Ga0495608_0033340 3300046511 Bacteria 3481
634 Ga0495618_0158090 3300046514 Bacteria 1446
635 Ga0495628_0012681 3300046516 Bacteria 7099
636 Ga0495628_0033195 3300046516 Bacteria 4162
637 Ga0495628_0059929 3300046516 Bacteria 2987
638 Ga0495628_0452550 3300046516 Bacteria 932
639 Ga0495630_0007289 3300046517 Bacteria 7892
640 Ga0495666_0033841 3300046526 Bacteria 2495
641 Ga0495652_0003926 3300046529 Bacteria 14444
642 Ga0495652_0008068 3300046529 Bacteria 9641
643 Ga0495652_0024917 3300046529 Bacteria 5293
644 Ga0495652_0260051 3300046529 Bacteria 1282
645 Ga0495665_0000452 3300046531 Bacteria 20675
646 Ga0495665_0010101 3300046531 Bacteria 5116
647 Ga0495665_0011227 3300046531 Bacteria 4850
648 Ga0495665_0037241 3300046531 Bacteria 2597
649 Ga0495640_0037223 3300046533 Bacteria 3434
650 Ga0495640_0098890 3300046533 Unclassified 1917
651 Ga0495640_0337397 3300046533 Bacteria 932
652 Ga0495586_0023036 3300046535 Unclassified 3325
653 Ga0495586_0044200 3300046535 Bacteria 2399
654 Ga0495586_0358524 3300046535 Bacteria 838
655 Ga0495587_0001531 3300046536 Bacteria 15375
656 Ga0495587_0001904 3300046536 Bacteria 13904
657 Ga0495587_0002015 3300046536 Bacteria 13534
658 Ga0495587_0015466 3300046536 Bacteria 4765
659 Ga0495587_0138655 3300046536 Bacteria 1389
660 Ga0495598_0018359 3300046537 Bacteria 1818
661 Ga0495621_0065986 3300046539 Bacteria 1323
662 Ga0495645_0000383 3300046543 Bacteria 30698
663 Ga0495645_0000497 3300046543 Bacteria 27195
664 Ga0495645_0061136 3300046543 Bacteria 2729
665 Ga0495667_0000495 3300046559 Bacteria 25140
666 Ga0495667_0001594 3300046559 Bacteria 15037
667 Ga0495667_0015720 3300046559 Bacteria 5117
668 Ga0495667_0212523 3300046559 Bacteria 1236
669 Ga0495634_0156662 3300046642 Unclassified 1438
670 Ga0495634_0391155 3300046642 Bacteria 827
671 Ga0495635_0000120 3300046663 Bacteria 47330
672 Ga0495635_0071741 3300046663 Bacteria 2374
673 Ga0495635_0287120 3300046663 Bacteria 1105
674 Ga0495635_0461804 3300046663 Bacteria 839
675 Ga0495588_0002798 3300046674 Bacteria 7497
676 Ga0495657_0000371 3300046675 Bacteria 41627
677 Ga0495657_0040167 3300046675 Bacteria 3211
678 Ga0495599_0000065 3300046678 Bacteria 72906
679 Ga0495599_0002260 3300046678 Bacteria 11204
680 Ga0495599_0108192 3300046678 Bacteria 1732
681 Ga0495623_0000014 3300046679 Bacteria 119814
682 Ga0495623_0004186 3300046679 Bacteria 9508
683 Ga0495623_0062494 3300046679 Bacteria 2334
684 Ga0495623_0140445 3300046679 Bacteria 1438
685 Ga0495623_0165003 3300046679 Bacteria 1298
686 Ga0495646_0000129 3300046680 Bacteria 38041
687 Ga0495658_0000262 3300046683 Bacteria 29829
688 Ga0495658_0031519 3300046683 Bacteria 2888
689 Ga0495658_0191925 3300046683 Bacteria 1270
690 Ga0495613_0006325 3300046689 Bacteria 8858
691 Ga0495600_0000105 3300046809 Bacteria 46401
692 Ga0495600_0020264 3300046809 Bacteria 4254
693 Ga0495600_0026688 3300046809 Bacteria 3729
694 Ga0495600_0271260 3300046809 Bacteria 1076
695 Ga0495600_0350812 3300046809 Bacteria 924
696 Ga0495581_0022559 3300047315 Bacteria 3648
697 Ga0495581_0111186 3300047315 Bacteria 1593
698 Ga0495604_0000359 3300047317 Bacteria 40820
699 Ga0495604_0051132 3300047317 Bacteria 3205
700 Ga0495674_0000362 3300047319 Bacteria 40383
701 Ga0495674_0041917 3300047319 Bacteria 4086
702 Ga0495672_0023597 3300047320 Bacteria 3980
703 Ga0495680_0003175 3300047322 Bacteria 16358
704 Ga0495680_0011402 3300047322 Bacteria 7868
705 Ga0495680_0046385 3300047322 Bacteria 3427
706 Ga0495680_0403211 3300047322 Bacteria 944
707 Ga0495675_0000748 3300047444 Bacteria 20293
708 Ga0495675_0023504 3300047444 Bacteria 3927
709 Ga0495675_0045490 3300047444 Bacteria 2795
710 Ga0495675_0098788 3300047444 Bacteria 1828
711 Ga0495675_0334239 3300047444 Bacteria 894
712 Ga0495684_0000288 3300047471 Bacteria 40827
713 Ga0495684_0005125 3300047471 Bacteria 10225
714 Ga0495684_0018431 3300047471 Bacteria 5378
715 Ga0495593_0010392 3300047673 Bacteria 5381
716 Ga0495602_0002905 3300048088 Bacteria 17568
717 Ga0495602_0030782 3300048088 Bacteria 5085
718 Ga0495602_0199776 3300048088 Unclassified 1526
719 Ga0495602_0231674 3300048088 Unclassified 1387
720 Ga0495614_0007574 3300048089 Bacteria 4831
721 Ga0496101_0127898 3300048904 Bacteria 1927
722 Ga0496102_0040439 3300048905 Bacteria 4218
723 Ga0496102_0320942 3300048905 Bacteria 1459
724 Ga0496104_0102392 3300048907 Bacteria 2743
725 Ga0496104_0116285 3300048907 Bacteria 2566
726 Ga0496104_0365743 3300048907 Bacteria 1355
727 Ga0496104_0582615 3300048907 Bacteria 1029
728 Ga0496105_0313801 3300048908 Bacteria 1258
729 Ga0496105_0350510 3300048908 Bacteria 1179
730 Ga0496108_0101549 3300048911 Bacteria 2454
731 Ga0496108_0139713 3300048911 Bacteria 2087
732 Ga0496108_0156687 3300048911 Bacteria 1967
733 Ga0496108_0336327 3300048911 Bacteria 1317
734 Ga0496109_0118555 3300048912 Bacteria 2464
735 Ga0496109_0121547 3300048912 Bacteria 2433
736 Ga0496112_0015971 3300048915 Bacteria 7019
737 Ga0496112_0129628 3300048915 Bacteria 2493
738 Ga0496112_0350850 3300048915 Unclassified 1418
739 Ga0496113_0033639 3300048916 Bacteria 3735
740 Ga0496113_0091728 3300048916 Bacteria 2342
741 Ga0496114_0077847 3300048917 Bacteria 2797
742 Ga0501299_013580 3300049522 Bacteria 1407
743 Ga0501032_0219301 3300049569 Bacteria 1238
744 Ga0501033_0004626 3300049570 Bacteria 11015
745 Ga0501034_0098870 3300049571 Bacteria 2913
746 Ga0501036_0123895 3300049572 Bacteria 2183
747 Ga0501038_0045327 3300049574 Bacteria 3818
748 Ga0501038_0364306 3300049574 Bacteria 1124
749 Ga0501039_0123640 3300049575 Bacteria 2029
750 Ga0501039_0190987 3300049575 Bacteria 1610
751 Ga0501040_0035689 3300049576 Bacteria 3373
752 Ga0501040_0173680 3300049576 Bacteria 1526
753 Ga0501040_0190484 3300049576 Bacteria 1455
754 Ga0501041_0100478 3300049577 Bacteria 1790
755 Ga0501043_0013304 3300049579 Bacteria 6435
756 Ga0501047_0011463 3300049581 Bacteria 8390
757 Ga0501047_0092525 3300049581 Bacteria 2902
758 Ga0501047_0348014 3300049581 Bacteria 1319
759 Ga0501048_0056808 3300049582 Bacteria 2777
760 Ga0501048_0058107 3300049582 Bacteria 2742
761 Ga0501048_0117578 3300049582 Bacteria 1878
762 Ga0501070_0061189 3300049586 Bacteria 3120
763 Ga0501070_0311122 3300049586 Bacteria 1282
764 Ga0501071_0349316 3300049587 Bacteria 1125
765 Ga0501074_0343817 3300049590 Bacteria 1059
766 Ga0501075_0201423 3300049591 Bacteria 1518
767 Ga0501076_0030374 3300049592 Bacteria 4209
768 Ga0501076_0489775 3300049592 Bacteria 1013
769 Ga0501077_0003877 3300049593 Bacteria 9010
770 Ga0501077_0187994 3300049593 Bacteria 1312
771 Ga0501209_068075 3300049656 Bacteria 1008
772 Ga0501239_005348 3300049672 Bacteria 1291
773 Ga0501257_050280 3300049686 Bacteria 1038
774 Ga0501260_011818 3300049689 Bacteria 887
775 Ga0501221_005288 3300049704 Bacteria 2154
776 Ga0501079_0083353 3300049741 Bacteria 2473
777 Ga0501080_0038756 3300049742 Bacteria 4448
778 Ga0501080_0059324 3300049742 Bacteria 3561
779 Ga0501080_0146207 3300049742 Bacteria 2185
780 Ga0501080_0333320 3300049742 Bacteria 1372
781 Ga0501081_0052927 3300049743 Bacteria 2802
782 Ga0501081_0186813 3300049743 Bacteria 1500
783 Ga0501272_001698 3300049769 Bacteria 2118
784 Ga0501035_0216551 3300049822 Bacteria 1637
785 Ga0501035_0349158 3300049822 Bacteria 1238
786 Ga0501044_0072931 3300049823 Bacteria 3490
787 Ga0501044_0356941 3300049823 Bacteria 1380
788 Ga0501045_0003041 3300049824 Bacteria 11472
789 Ga0501045_0106883 3300049824 Bacteria 2074
790 nmdc:mga05p37_132137_c1 3300050507 Bacteria 3062
791 nmdc:mga05p37_155826_c1 3300050507 Bacteria 2791
792 nmdc:mga05p37_165045_c1 3300050507 Bacteria 2703
793 nmdc:mga05p37_326868_c1 3300050507 Bacteria 1813
794 nmdc:mga09592_99531_c1 3300050508 Bacteria 2489
795 nmdc:mga0qj67_3500_c1 3300050509 Bacteria 11323
796 nmdc:mga06r32_120099_c1 3300050510 Bacteria 2592
797 nmdc:mga06r32_157808_c1 3300050510 Bacteria 2251
798 nmdc:mga06r32_447519_c1 3300050510 Bacteria 1271
799 nmdc:mga06r32_46765_c1 3300050510 Bacteria 4129
800 nmdc:mga06r32_580153_c1 3300050510 Bacteria 1093
801 nmdc:mga08y16_284411_c1 3300050511 Bacteria 1705
802 nmdc:mga08y16_390941_c1 3300050511 Unclassified 1425
803 nmdc:mga08y16_663077_c1 3300050511 Unclassified 1046
804 nmdc:mga0n895_140891_c1 3300050512 Bacteria 2440
805 nmdc:mga0n895_166893_c1 3300050512 Bacteria 2233
806 nmdc:mga0n895_34022_c1 3300050512 Bacteria 4902
807 nmdc:mga0n895_4228_c1 3300050512 Bacteria 11738
808 nmdc:mga0n895_48315_c1 3300050512 Bacteria 4164
809 nmdc:mga0n895_7448_c1 3300050512 Bacteria 9394
810 nmdc:mga0rr50_18724_c1 3300050513 Bacteria 4658
811 nmdc:mga0rr50_1947_c1 3300050513 Bacteria 11457
812 nmdc:mga0rr50_219465_c1 3300050513 Bacteria 1570
813 nmdc:mga0rr50_241941_c1 3300050513 Bacteria 1496
814 nmdc:mga0rr50_63277_c1 3300050513 Bacteria 2794
815 nmdc:mga08x19_11135_c1 3300050514 Bacteria 5414
816 nmdc:mga08x19_352268_c1 3300050514 Bacteria 1028
817 nmdc:mga0a205_111874_c1 3300050515 Bacteria 2630
818 nmdc:mga0a205_545693_c1 3300050515 Eukaryota 1015
819 Ga0495601_0001013 3300053077 Bacteria 15368
820 Ga0495612_0000636 3300053078 Bacteria 14100
821 Ga0495595_0026591 3300053084 Bacteria 2572
822 Ga0495595_0069728 3300053084 Bacteria 1660
823 Ga0495595_0190320 3300053084 Bacteria 1020
824 Ga0495619_0001764 3300053085 Bacteria 14393
825 Ga0495619_0234348 3300053085 Bacteria 1272
826 Ga0501084_0006948 3300054114 Bacteria 9322
827 Ga0501084_0016560 3300054114 Bacteria 6121
828 Ga0501084_0066227 3300054114 Bacteria 3022
829 Ga0501084_0211651 3300054114 Bacteria 1636
830 Ga0590074_025282 3300059423 Bacteria 1034
831 Ga0590075_010266 3300059424 Bacteria 2253
832 Ga0590077_033794 3300059426 Bacteria 1123
833 Ga0501082_0012266 3300060353 Bacteria 7366
834 Ga0501082_0052736 3300060353 Bacteria 3506
835 Ga0501082_0074105 3300060353 Bacteria 2932
836 Ga0501082_0679953 3300060353 Unclassified 901
837 Ga0466962_0251786 3300061719 Bacteria 868

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005330 Ga0070690_100074670 Ga0070690_1000746702 232
2 3300005345 Ga0070692_10208081 Ga0070692_102080812 232
3 3300005438 Ga0070701_10002580 Ga0070701_100025803 232
4 3300005459 Ga0068867_100047606 Ga0068867_1000476063 232
5 3300005544 Ga0070686_100048541 Ga0070686_1000485412 232
6 3300005546 Ga0070696_100146867 Ga0070696_1001468672 232
7 3300005549 Ga0070704_100124498 Ga0070704_1001244982 232
8 3300005615 Ga0070702_100013457 Ga0070702_1000134571 232
9 3300009094 Ga0111539_10330678 Ga0111539_103306782 232
10 3300009098 Ga0105245_10584671 Ga0105245_105846712 232
11 3300049591 Ga0501075_0201423 Ga0501075_0201423_469_1221 232
12 3300054114 Ga0501084_0211651 Ga0501084_0211651_234_986 232
13 3300005406 Ga0070703_10039499 Ga0070703_100394992 235
14 3300005440 Ga0070705_100027043 Ga0070705_1000270432 235
15 3300005444 Ga0070694_100125301 Ga0070694_1001253012 235
16 3300005445 Ga0070708_100084310 Ga0070708_1000843102 235
17 3300005467 Ga0070706_100028449 Ga0070706_1000284494 235
18 3300005471 Ga0070698_100015560 Ga0070698_1000155606 235
19 3300005545 Ga0070695_100109486 Ga0070695_1001094862 235
20 3300005549 Ga0070704_100255778 Ga0070704_1002557782 235
21 3300006175 Ga0070712_100118282 Ga0070712_1001182822 235
22 3300025885 Ga0207653_10078437 Ga0207653_100784372 235
23 3300025905 Ga0207685_10030110 Ga0207685_100301103 235
24 3300025910 Ga0207684_10241536 Ga0207684_102415362 235
25 3300025922 Ga0207646_10027930 Ga0207646_100279303 235
26 3300049575 Ga0501039_0190987 Ga0501039_0190987_827_1579 235
27 3300006871 Ga0075434_100077827 Ga0075434_1000778273 236
28 3300006914 Ga0075436_100005526 Ga0075436_1000055266 236
29 3300050512 nmdc:mga0n895_4228_c1 nmdc:mga0n895_4228_c1_4604_5356 236
30 3300050513 nmdc:mga0rr50_18724_c1 nmdc:mga0rr50_18724_c1_388_1140 236
31 3300050514 nmdc:mga08x19_11135_c1 nmdc:mga08x19_11135_c1_1222_1974 236
32 3300005546 Ga0070696_100127985 Ga0070696_1001279851 237
33 3300032002 Ga0307416_100014279 Ga0307416_1000142795 237
34 3300049656 Ga0501209_068075 Ga0501209_068075_169_882 237
35 3300049672 Ga0501239_005348 Ga0501239_005348_340_1053 237
36 3300049686 Ga0501257_050280 Ga0501257_050280_30_743 237
37 3300049704 Ga0501221_005288 Ga0501221_005288_105_818 237
38 3300049769 Ga0501272_001698 Ga0501272_001698_1130_1843 237
39 3300006847 Ga0075431_100236280 Ga0075431_1002362802 238
40 3300041406 Ga0439439_0077261 Ga0439439_0077261_29_745 238
41 3300046476 Ga0495662_0090359 Ga0495662_0090359_749_1465 238
42 3300049576 Ga0501040_0035689 Ga0501040_0035689_2647_3363 238
43 3300049582 Ga0501048_0056808 Ga0501048_0056808_96_812 238
44 3300049582 Ga0501048_0058107 Ga0501048_0058107_1095_1811 238
45 3300049587 Ga0501071_0349316 Ga0501071_0349316_281_997 238
46 3300049592 Ga0501076_0489775 Ga0501076_0489775_65_781 238
47 3300049689 Ga0501260_011818 Ga0501260_011818_116_832 238
48 3300049741 Ga0501079_0083353 Ga0501079_0083353_18_734 238
49 3300049742 Ga0501080_0059324 Ga0501080_0059324_250_966 238
50 3300049742 Ga0501080_0146207 Ga0501080_0146207_1275_1991 238
51 3300049824 Ga0501045_0003041 Ga0501045_0003041_3020_3736 238
52 3300050510 nmdc:mga06r32_447519_c1 nmdc:mga06r32_447519_c1_509_1225 238
53 3300050512 nmdc:mga0n895_140891_c1 nmdc:mga0n895_140891_c1_11_727 238
54 3300054114 Ga0501084_0006948 Ga0501084_0006948_939_1655 238
55 3300060353 Ga0501082_0012266 Ga0501082_0012266_5869_6585 238
56 3300009176 Ga0105242_10249134 Ga0105242_102491342 239
57 3300005518 Ga0070699_100008858 Ga0070699_1000088589 241
58 3300005445 Ga0070708_100058288 Ga0070708_1000582882 242
59 3300005471 Ga0070698_100001280 Ga0070698_1000012803 244
60 3300005518 Ga0070699_100004498 Ga0070699_1000044982 244
61 3300025922 Ga0207646_10074317 Ga0207646_100743172 244
62 3300026075 Ga0207708_10383521 Ga0207708_103835211 244
63 3300060353 Ga0501082_0679953 Ga0501082_0679953_82_822 245
64 3300005471 Ga0070698_100112996 Ga0070698_1001129962 249
65 3300009147 Ga0114129_10394119 Ga0114129_103941192 249
66 3300031824 Ga0307413_10018637 Ga0307413_100186373 249
67 3300031852 Ga0307410_10034418 Ga0307410_100344182 249
68 3300031852 Ga0307410_10049062 Ga0307410_100490623 249
69 3300031852 Ga0307410_10064954 Ga0307410_100649542 249
70 3300031903 Ga0307407_10033836 Ga0307407_100338363 249
71 3300031903 Ga0307407_10089403 Ga0307407_100894032 249
72 3300031995 Ga0307409_100030031 Ga0307409_1000300314 249
73 3300031995 Ga0307409_100041124 Ga0307409_1000411243 249
74 3300032002 Ga0307416_100061123 Ga0307416_1000611232 249
75 3300032004 Ga0307414_10104544 Ga0307414_101045442 249
76 3300032005 Ga0307411_10022852 Ga0307411_100228524 249
77 3300032005 Ga0307411_10030446 Ga0307411_100304462 249
78 3300032005 Ga0307411_10144154 Ga0307411_101441542 249
79 3300032126 Ga0307415_100034660 Ga0307415_1000346603 249
80 3300035088 Ga0373940_0064287 Ga0373940_0064287_122_871 249
81 3300035090 Ga0373949_0022087 Ga0373949_0022087_195_944 249
82 3300035691 Ga0373931_0113494 Ga0373931_0113494_781_1530 249
83 3300042156 Ga0439446_0072234 Ga0439446_0072234_272_1042 249
84 3300048917 Ga0496114_0077847 Ga0496114_0077847_507_1256 249
85 3300005293 Ga0065715_10209515 Ga0065715_102095152 250
86 3300005327 Ga0070658_10007057 Ga0070658_100070573 250
87 3300005327 Ga0070658_10020907 Ga0070658_100209072 250
88 3300005327 Ga0070658_10227287 Ga0070658_102272871 250
89 3300005328 Ga0070676_10011596 Ga0070676_100115962 250
90 3300005329 Ga0070683_100000171 Ga0070683_10000017124 250
91 3300005329 Ga0070683_100000440 Ga0070683_10000044023 250
92 3300005329 Ga0070683_100006205 Ga0070683_1000062053 250
93 3300005329 Ga0070683_100010918 Ga0070683_1000109183 250
94 3300005329 Ga0070683_100048552 Ga0070683_1000485524 250
95 3300005329 Ga0070683_100049271 Ga0070683_1000492711 250
96 3300005329 Ga0070683_100074501 Ga0070683_1000745013 250
97 3300005329 Ga0070683_100075540 Ga0070683_1000755403 250
98 3300005329 Ga0070683_100098251 Ga0070683_1000982513 250
99 3300005329 Ga0070683_100108253 Ga0070683_1001082532 250
100 3300005330 Ga0070690_100008925 Ga0070690_1000089253 250
101 3300005330 Ga0070690_100055174 Ga0070690_1000551741 250
102 3300005330 Ga0070690_100073397 Ga0070690_1000733972 250
103 3300005330 Ga0070690_100120948 Ga0070690_1001209482 250
104 3300005331 Ga0070670_100007041 Ga0070670_1000070419 250
105 3300005331 Ga0070670_100007905 Ga0070670_1000079057 250
106 3300005331 Ga0070670_100150990 Ga0070670_1001509902 250
107 3300005331 Ga0070670_100385940 Ga0070670_1003859402 250
108 3300005331 Ga0070670_100489284 Ga0070670_1004892842 250
109 3300005334 Ga0068869_100009371 Ga0068869_1000093713 250
110 3300005334 Ga0068869_100033861 Ga0068869_1000338612 250
111 3300005335 Ga0070666_10079426 Ga0070666_100794262 250
112 3300005336 Ga0070680_100000733 Ga0070680_10000073317 250
113 3300005336 Ga0070680_100004315 Ga0070680_1000043153 250
114 3300005336 Ga0070680_100046151 Ga0070680_1000461513 250
115 3300005336 Ga0070680_100065117 Ga0070680_1000651172 250
116 3300005338 Ga0068868_100006090 Ga0068868_1000060903 250
117 3300005339 Ga0070660_100003841 Ga0070660_1000038416 250
118 3300005339 Ga0070660_100017277 Ga0070660_1000172772 250
119 3300005339 Ga0070660_100017406 Ga0070660_1000174062 250
120 3300005339 Ga0070660_100160829 Ga0070660_1001608291 250
121 3300005340 Ga0070689_100003002 Ga0070689_1000030023 250
122 3300005340 Ga0070689_100003984 Ga0070689_1000039842 250
123 3300005340 Ga0070689_100066588 Ga0070689_1000665882 250
124 3300005340 Ga0070689_100108048 Ga0070689_1001080482 250
125 3300005341 Ga0070691_10002628 Ga0070691_100026286 250
126 3300005343 Ga0070687_100047025 Ga0070687_1000470252 250
127 3300005344 Ga0070661_100000331 Ga0070661_10000033117 250
128 3300005345 Ga0070692_10022338 Ga0070692_100223383 250
129 3300005345 Ga0070692_10022639 Ga0070692_100226391 250
130 3300005347 Ga0070668_100024896 Ga0070668_1000248964 250
131 3300005347 Ga0070668_100068765 Ga0070668_1000687652 250
132 3300005353 Ga0070669_100078097 Ga0070669_1000780972 250
133 3300005353 Ga0070669_100212749 Ga0070669_1002127492 250
134 3300005354 Ga0070675_100001364 Ga0070675_1000013645 250
135 3300005354 Ga0070675_100011838 Ga0070675_1000118386 250
136 3300005354 Ga0070675_100012790 Ga0070675_1000127902 250
137 3300005354 Ga0070675_100051961 Ga0070675_1000519612 250
138 3300005354 Ga0070675_100151507 Ga0070675_1001515072 250
139 3300005354 Ga0070675_100410378 Ga0070675_1004103782 250
140 3300005355 Ga0070671_100053238 Ga0070671_1000532384 250
141 3300005355 Ga0070671_100643229 Ga0070671_1006432291 250
142 3300005356 Ga0070674_100143652 Ga0070674_1001436522 250
143 3300005356 Ga0070674_100207520 Ga0070674_1002075202 250
144 3300005356 Ga0070674_100219437 Ga0070674_1002194372 250
145 3300005356 Ga0070674_100475815 Ga0070674_1004758151 250
146 3300005364 Ga0070673_100201070 Ga0070673_1002010701 250
147 3300005364 Ga0070673_100275313 Ga0070673_1002753132 250
148 3300005365 Ga0070688_100011427 Ga0070688_1000114273 250
149 3300005365 Ga0070688_100083716 Ga0070688_1000837163 250
150 3300005366 Ga0070659_100003745 Ga0070659_10000374510 250
151 3300005366 Ga0070659_100019870 Ga0070659_1000198702 250
152 3300005366 Ga0070659_100035374 Ga0070659_1000353743 250
153 3300005366 Ga0070659_100092186 Ga0070659_1000921862 250
154 3300005367 Ga0070667_100027832 Ga0070667_1000278324 250
155 3300005367 Ga0070667_100387295 Ga0070667_1003872952 250
156 3300005367 Ga0070667_100396394 Ga0070667_1003963942 250
157 3300005406 Ga0070703_10000558 Ga0070703_100005582 250
158 3300005434 Ga0070709_10001756 Ga0070709_100017563 250
159 3300005434 Ga0070709_10009907 Ga0070709_100099073 250
160 3300005434 Ga0070709_10032503 Ga0070709_100325032 250
161 3300005435 Ga0070714_100003987 Ga0070714_1000039874 250
162 3300005435 Ga0070714_100096712 Ga0070714_1000967122 250
163 3300005436 Ga0070713_100000149 Ga0070713_10000014926 250
164 3300005436 Ga0070713_100010992 Ga0070713_1000109924 250
165 3300005436 Ga0070713_100029513 Ga0070713_1000295135 250
166 3300005436 Ga0070713_100046876 Ga0070713_1000468762 250
167 3300005436 Ga0070713_100331951 Ga0070713_1003319511 250
168 3300005437 Ga0070710_10124963 Ga0070710_101249632 250
169 3300005438 Ga0070701_10010767 Ga0070701_100107672 250
170 3300005439 Ga0070711_100143458 Ga0070711_1001434582 250
171 3300005439 Ga0070711_100151770 Ga0070711_1001517702 250
172 3300005440 Ga0070705_100017142 Ga0070705_1000171422 250
173 3300005440 Ga0070705_100042485 Ga0070705_1000424852 250
174 3300005441 Ga0070700_100057968 Ga0070700_1000579682 250
175 3300005444 Ga0070694_100019882 Ga0070694_1000198823 250
176 3300005444 Ga0070694_100106302 Ga0070694_1001063022 250
177 3300005445 Ga0070708_100000045 Ga0070708_10000004570 250
178 3300005445 Ga0070708_100021041 Ga0070708_1000210412 250
179 3300005445 Ga0070708_100181689 Ga0070708_1001816892 250
180 3300005445 Ga0070708_100377408 Ga0070708_1003774082 250
181 3300005455 Ga0070663_100071034 Ga0070663_1000710342 250
182 3300005456 Ga0070678_100388204 Ga0070678_1003882041 250
183 3300005457 Ga0070662_100015491 Ga0070662_1000154912 250
184 3300005457 Ga0070662_100208715 Ga0070662_1002087152 250
185 3300005458 Ga0070681_10001111 Ga0070681_1000111119 250
186 3300005458 Ga0070681_10001558 Ga0070681_100015583 250
187 3300005458 Ga0070681_10003103 Ga0070681_100031032 250
188 3300005458 Ga0070681_10044788 Ga0070681_100447883 250
189 3300005458 Ga0070681_10068350 Ga0070681_100683502 250
190 3300005458 Ga0070681_10107087 Ga0070681_101070872 250
191 3300005458 Ga0070681_10168120 Ga0070681_101681201 250
192 3300005458 Ga0070681_10221985 Ga0070681_102219852 250
193 3300005458 Ga0070681_10690315 Ga0070681_106903151 250
194 3300005459 Ga0068867_100360046 Ga0068867_1003600462 250
195 3300005466 Ga0070685_10087902 Ga0070685_100879022 250
196 3300005467 Ga0070706_100073302 Ga0070706_1000733022 250
197 3300005467 Ga0070706_100145381 Ga0070706_1001453812 250
198 3300005467 Ga0070706_100250384 Ga0070706_1002503842 250
199 3300005471 Ga0070698_100035195 Ga0070698_1000351953 250
200 3300005471 Ga0070698_100099490 Ga0070698_1000994903 250
201 3300005518 Ga0070699_100009323 Ga0070699_1000093234 250
202 3300005530 Ga0070679_100000772 Ga0070679_1000007724 250
203 3300005530 Ga0070679_100001050 Ga0070679_1000010501 250
204 3300005530 Ga0070679_100011589 Ga0070679_1000115895 250
205 3300005530 Ga0070679_100012412 Ga0070679_1000124122 250
206 3300005530 Ga0070679_100032305 Ga0070679_1000323053 250
207 3300005530 Ga0070679_100045263 Ga0070679_1000452635 250
208 3300005530 Ga0070679_100212162 Ga0070679_1002121621 250
209 3300005530 Ga0070679_100261040 Ga0070679_1002610403 250
210 3300005530 Ga0070679_100532564 Ga0070679_1005325641 250
211 3300005530 Ga0070679_100652642 Ga0070679_1006526421 250
212 3300005535 Ga0070684_100003911 Ga0070684_10000391111 250
213 3300005535 Ga0070684_100004027 Ga0070684_1000040273 250
214 3300005535 Ga0070684_100005252 Ga0070684_1000052525 250
215 3300005535 Ga0070684_100010947 Ga0070684_1000109476 250
216 3300005535 Ga0070684_100011827 Ga0070684_1000118273 250
217 3300005535 Ga0070684_100038477 Ga0070684_1000384774 250
218 3300005535 Ga0070684_100089480 Ga0070684_1000894802 250
219 3300005535 Ga0070684_100091007 Ga0070684_1000910072 250
220 3300005535 Ga0070684_100100588 Ga0070684_1001005883 250
221 3300005535 Ga0070684_100160255 Ga0070684_1001602552 250
222 3300005535 Ga0070684_100620762 Ga0070684_1006207621 250
223 3300005535 Ga0070684_100628709 Ga0070684_1006287092 250
224 3300005536 Ga0070697_100003217 Ga0070697_10000321715 250
225 3300005536 Ga0070697_100026488 Ga0070697_1000264882 250
226 3300005536 Ga0070697_100045094 Ga0070697_1000450943 250
227 3300005539 Ga0068853_100008377 Ga0068853_1000083773 250
228 3300005539 Ga0068853_100184561 Ga0068853_1001845612 250
229 3300005543 Ga0070672_100027948 Ga0070672_1000279483 250
230 3300005543 Ga0070672_100030900 Ga0070672_1000309003 250
231 3300005543 Ga0070672_100049621 Ga0070672_1000496213 250
232 3300005543 Ga0070672_100052303 Ga0070672_1000523032 250
233 3300005543 Ga0070672_100519237 Ga0070672_1005192371 250
234 3300005543 Ga0070672_100843294 Ga0070672_1008432941 250
235 3300005544 Ga0070686_100228275 Ga0070686_1002282752 250
236 3300005545 Ga0070695_100024915 Ga0070695_1000249152 250
237 3300005545 Ga0070695_100153888 Ga0070695_1001538882 250
238 3300005545 Ga0070695_100155628 Ga0070695_1001556282 250
239 3300005546 Ga0070696_100000113 Ga0070696_10000011336 250
240 3300005546 Ga0070696_100006443 Ga0070696_1000064432 250
241 3300005547 Ga0070693_100008367 Ga0070693_1000083673 250
242 3300005548 Ga0070665_100028248 Ga0070665_1000282483 250
243 3300005563 Ga0068855_100036976 Ga0068855_1000369764 250
244 3300005563 Ga0068855_100066073 Ga0068855_1000660733 250
245 3300005563 Ga0068855_100070607 Ga0068855_1000706072 250
246 3300005563 Ga0068855_100164028 Ga0068855_1001640283 250
247 3300005563 Ga0068855_100352241 Ga0068855_1003522412 250
248 3300005564 Ga0070664_100000995 Ga0070664_10000099520 250
249 3300005564 Ga0070664_100009674 Ga0070664_1000096747 250
250 3300005564 Ga0070664_100010051 Ga0070664_1000100515 250
251 3300005564 Ga0070664_100013873 Ga0070664_1000138734 250
252 3300005564 Ga0070664_100035511 Ga0070664_1000355114 250
253 3300005564 Ga0070664_100345046 Ga0070664_1003450462 250
254 3300005564 Ga0070664_100726061 Ga0070664_1007260612 250
255 3300005577 Ga0068857_100003760 Ga0068857_1000037603 250
256 3300005577 Ga0068857_100016130 Ga0068857_1000161305 250
257 3300005577 Ga0068857_100024005 Ga0068857_1000240053 250
258 3300005577 Ga0068857_100210193 Ga0068857_1002101932 250
259 3300005578 Ga0068854_100074455 Ga0068854_1000744553 250
260 3300005614 Ga0068856_100023996 Ga0068856_1000239965 250
261 3300005614 Ga0068856_100036053 Ga0068856_1000360531 250
262 3300005614 Ga0068856_100335608 Ga0068856_1003356082 250
263 3300005615 Ga0070702_100002959 Ga0070702_1000029593 250
264 3300005616 Ga0068852_100045546 Ga0068852_1000455464 250
265 3300005616 Ga0068852_100065392 Ga0068852_1000653922 250
266 3300005616 Ga0068852_100107033 Ga0068852_1001070332 250
267 3300005617 Ga0068859_100050496 Ga0068859_1000504964 250
268 3300005617 Ga0068859_100090186 Ga0068859_1000901863 250
269 3300005617 Ga0068859_100113118 Ga0068859_1001131182 250
270 3300005618 Ga0068864_100375892 Ga0068864_1003758922 250
271 3300005718 Ga0068866_10045753 Ga0068866_100457533 250
272 3300005719 Ga0068861_100000159 Ga0068861_10000015924 250
273 3300005840 Ga0068870_10014684 Ga0068870_100146843 250
274 3300005841 Ga0068863_100007245 Ga0068863_1000072454 250
275 3300005841 Ga0068863_100190819 Ga0068863_1001908192 250
276 3300005841 Ga0068863_100227247 Ga0068863_1002272472 250
277 3300005841 Ga0068863_100401015 Ga0068863_1004010152 250
278 3300005842 Ga0068858_100012458 Ga0068858_1000124587 250
279 3300005842 Ga0068858_100056481 Ga0068858_1000564812 250
280 3300005843 Ga0068860_100022982 Ga0068860_1000229824 250
281 3300005843 Ga0068860_100038284 Ga0068860_1000382844 250
282 3300005844 Ga0068862_100011812 Ga0068862_1000118124 250
283 3300005844 Ga0068862_100198283 Ga0068862_1001982832 250
284 3300005981 Ga0081538_10030216 Ga0081538_100302162 250
285 3300005985 Ga0081539_10000174 Ga0081539_1000017487 250
286 3300006028 Ga0070717_10034077 Ga0070717_100340773 250
287 3300006173 Ga0070716_100087416 Ga0070716_1000874162 250
288 3300006175 Ga0070712_100014254 Ga0070712_1000142543 250
289 3300006175 Ga0070712_100018761 Ga0070712_1000187612 250
290 3300006175 Ga0070712_100219079 Ga0070712_1002190792 250
291 3300006237 Ga0097621_100047853 Ga0097621_1000478531 250
292 3300006358 Ga0068871_100092028 Ga0068871_1000920283 250
293 3300006846 Ga0075430_100003033 Ga0075430_1000030338 250
294 3300006846 Ga0075430_100116645 Ga0075430_1001166452 250
295 3300006846 Ga0075430_100286042 Ga0075430_1002860422 250
296 3300006847 Ga0075431_100005056 Ga0075431_10000505611 250
297 3300006847 Ga0075431_100013930 Ga0075431_1000139302 250
298 3300006847 Ga0075431_100302420 Ga0075431_1003024202 250
299 3300006847 Ga0075431_100504883 Ga0075431_1005048831 250
300 3300006852 Ga0075433_10149367 Ga0075433_101493672 250
301 3300006852 Ga0075433_10300041 Ga0075433_103000412 250
302 3300006871 Ga0075434_100296288 Ga0075434_1002962882 250
303 3300006880 Ga0075429_100009585 Ga0075429_1000095855 250
304 3300006880 Ga0075429_100024226 Ga0075429_1000242264 250
305 3300006881 Ga0068865_100031767 Ga0068865_1000317672 250
306 3300006914 Ga0075436_100015174 Ga0075436_1000151742 250
307 3300006914 Ga0075436_100071491 Ga0075436_1000714912 250
308 3300006914 Ga0075436_100188884 Ga0075436_1001888842 250
309 3300006931 Ga0097620_100050498 Ga0097620_1000504984 250
310 3300006931 Ga0097620_100090186 Ga0097620_1000901863 250
311 3300006931 Ga0097620_100113119 Ga0097620_1001131192 250
312 3300007076 Ga0075435_100012532 Ga0075435_1000125323 250
313 3300007076 Ga0075435_100130410 Ga0075435_1001304102 250
314 3300007076 Ga0075435_100284203 Ga0075435_1002842032 250
315 3300007265 Ga0099794_10000159 Ga0099794_1000015911 250
316 3300009094 Ga0111539_10078098 Ga0111539_100780983 250
317 3300009094 Ga0111539_10187271 Ga0111539_101872713 250
318 3300009094 Ga0111539_10215561 Ga0111539_102155613 250
319 3300009098 Ga0105245_10001478 Ga0105245_1000147811 250
320 3300009098 Ga0105245_10049888 Ga0105245_100498883 250
321 3300009098 Ga0105245_10111226 Ga0105245_101112263 250
322 3300009098 Ga0105245_10195545 Ga0105245_101955453 250
323 3300009098 Ga0105245_10289383 Ga0105245_102893832 250
324 3300009098 Ga0105245_10302874 Ga0105245_103028742 250
325 3300009098 Ga0105245_10558659 Ga0105245_105586592 250
326 3300009098 Ga0105245_10862123 Ga0105245_108621231 250
327 3300009147 Ga0114129_10069432 Ga0114129_100694325 250
328 3300009147 Ga0114129_10077699 Ga0114129_100776992 250
329 3300009147 Ga0114129_10253321 Ga0114129_102533212 250
330 3300009148 Ga0105243_10070943 Ga0105243_100709432 250
331 3300009174 Ga0105241_10117056 Ga0105241_101170563 250
332 3300009174 Ga0105241_10130184 Ga0105241_101301843 250
333 3300009176 Ga0105242_10012697 Ga0105242_100126973 250
334 3300009176 Ga0105242_10116505 Ga0105242_101165052 250
335 3300009177 Ga0105248_10001272 Ga0105248_1000127219 250
336 3300009177 Ga0105248_10066259 Ga0105248_100662594 250
337 3300009177 Ga0105248_10137998 Ga0105248_101379983 250
338 3300009177 Ga0105248_10141219 Ga0105248_101412191 250
339 3300009177 Ga0105248_10293326 Ga0105248_102933262 250
340 3300009177 Ga0105248_10436503 Ga0105248_104365032 250
341 3300009545 Ga0105237_10724320 Ga0105237_107243202 250
342 3300009551 Ga0105238_10070208 Ga0105238_100702084 250
343 3300009551 Ga0105238_10070936 Ga0105238_100709363 250
344 3300009551 Ga0105238_10121138 Ga0105238_101211382 250
345 3300009553 Ga0105249_10003084 Ga0105249_100030843 250
346 3300010375 Ga0105239_10059094 Ga0105239_100590943 250
347 3300011119 Ga0105246_10000522 Ga0105246_1000052218 250
348 3300013100 Ga0157373_10016038 Ga0157373_100160382 250
349 3300013100 Ga0157373_10073716 Ga0157373_100737162 250
350 3300013100 Ga0157373_10366933 Ga0157373_103669332 250
351 3300013102 Ga0157371_10003449 Ga0157371_1000344912 250
352 3300013102 Ga0157371_10013563 Ga0157371_100135633 250
353 3300013102 Ga0157371_10108983 Ga0157371_101089832 250
354 3300013104 Ga0157370_10016785 Ga0157370_100167857 250
355 3300013104 Ga0157370_10385153 Ga0157370_103851532 250
356 3300013105 Ga0157369_10031048 Ga0157369_100310482 250
357 3300013105 Ga0157369_10216558 Ga0157369_102165582 250
358 3300013105 Ga0157369_10315757 Ga0157369_103157572 250
359 3300013105 Ga0157369_10341386 Ga0157369_103413862 250
360 3300013105 Ga0157369_10405202 Ga0157369_104052022 250
361 3300013105 Ga0157369_10414241 Ga0157369_104142412 250
362 3300013105 Ga0157369_10816155 Ga0157369_108161551 250
363 3300013296 Ga0157374_10006995 Ga0157374_100069957 250
364 3300013296 Ga0157374_10588017 Ga0157374_105880171 250
365 3300013296 Ga0157374_10597086 Ga0157374_105970862 250
366 3300013297 Ga0157378_10385904 Ga0157378_103859042 250
367 3300013297 Ga0157378_10690526 Ga0157378_106905261 250
368 3300013306 Ga0163162_10001610 Ga0163162_1000161010 250
369 3300013306 Ga0163162_10415506 Ga0163162_104155062 250
370 3300013307 Ga0157372_10020362 Ga0157372_100203626 250
371 3300013307 Ga0157372_10021441 Ga0157372_100214415 250
372 3300013307 Ga0157372_10033001 Ga0157372_100330014 250
373 3300013307 Ga0157372_10042228 Ga0157372_100422285 250
374 3300013307 Ga0157372_10043863 Ga0157372_100438632 250
375 3300013307 Ga0157372_10102077 Ga0157372_101020773 250
376 3300013307 Ga0157372_10154499 Ga0157372_101544993 250
377 3300013307 Ga0157372_10269874 Ga0157372_102698742 250
378 3300013307 Ga0157372_10373281 Ga0157372_103732812 250
379 3300013307 Ga0157372_10674511 Ga0157372_106745112 250
380 3300013307 Ga0157372_10693136 Ga0157372_106931362 250
381 3300013307 Ga0157372_11146320 Ga0157372_111463202 250
382 3300013308 Ga0157375_10030709 Ga0157375_100307093 250
383 3300013308 Ga0157375_10055591 Ga0157375_100555914 250
384 3300013308 Ga0157375_10094530 Ga0157375_100945303 250
385 3300013308 Ga0157375_10127136 Ga0157375_101271362 250
386 3300013308 Ga0157375_10649265 Ga0157375_106492651 250
387 3300013308 Ga0157375_10850113 Ga0157375_108501132 250
388 3300014325 Ga0163163_10004113 Ga0163163_100041137 250
389 3300014325 Ga0163163_10057127 Ga0163163_100571272 250
390 3300014326 Ga0157380_10263785 Ga0157380_102637852 250
391 3300014745 Ga0157377_10000600 Ga0157377_100006004 250
392 3300014745 Ga0157377_10000911 Ga0157377_100009117 250
393 3300014968 Ga0157379_10003764 Ga0157379_100037649 250
394 3300014969 Ga0157376_10022494 Ga0157376_100224944 250
395 3300014969 Ga0157376_10317585 Ga0157376_103175851 250
396 3300014969 Ga0157376_10440972 Ga0157376_104409722 250
397 3300017792 Ga0163161_10106386 Ga0163161_101063861 250
398 3300017792 Ga0163161_10145557 Ga0163161_101455572 250
399 3300025885 Ga0207653_10000193 Ga0207653_1000019319 250
400 3300025893 Ga0207682_10036039 Ga0207682_100360393 250
401 3300025898 Ga0207692_10203057 Ga0207692_102030572 250
402 3300025899 Ga0207642_10057020 Ga0207642_100570203 250
403 3300025900 Ga0207710_10159040 Ga0207710_101590402 250
404 3300025901 Ga0207688_10051685 Ga0207688_100516852 250
405 3300025904 Ga0207647_10247599 Ga0207647_102475992 250
406 3300025906 Ga0207699_10005806 Ga0207699_100058064 250
407 3300025906 Ga0207699_10123914 Ga0207699_101239142 250
408 3300025906 Ga0207699_10217058 Ga0207699_102170582 250
409 3300025907 Ga0207645_10000126 Ga0207645_1000012637 250
410 3300025907 Ga0207645_10042462 Ga0207645_100424622 250
411 3300025908 Ga0207643_10016451 Ga0207643_100164512 250
412 3300025908 Ga0207643_10035541 Ga0207643_100355413 250
413 3300025909 Ga0207705_10011135 Ga0207705_100111351 250
414 3300025909 Ga0207705_10026485 Ga0207705_100264851 250
415 3300025909 Ga0207705_10279039 Ga0207705_102790392 250
416 3300025910 Ga0207684_10124054 Ga0207684_101240542 250
417 3300025910 Ga0207684_10317139 Ga0207684_103171391 250
418 3300025911 Ga0207654_10131702 Ga0207654_101317022 250
419 3300025912 Ga0207707_10001370 Ga0207707_1000137015 250
420 3300025912 Ga0207707_10006243 Ga0207707_100062432 250
421 3300025912 Ga0207707_10006657 Ga0207707_1000665711 250
422 3300025912 Ga0207707_10047510 Ga0207707_100475103 250
423 3300025912 Ga0207707_10111930 Ga0207707_101119302 250
424 3300025912 Ga0207707_10293253 Ga0207707_102932531 250
425 3300025915 Ga0207693_10039227 Ga0207693_100392273 250
426 3300025915 Ga0207693_10070454 Ga0207693_100704543 250
427 3300025916 Ga0207663_10052611 Ga0207663_100526112 250
428 3300025916 Ga0207663_10125158 Ga0207663_101251582 250
429 3300025916 Ga0207663_10188239 Ga0207663_101882392 250
430 3300025917 Ga0207660_10001337 Ga0207660_100013375 250
431 3300025917 Ga0207660_10040194 Ga0207660_100401943 250
432 3300025917 Ga0207660_10224299 Ga0207660_102242992 250
433 3300025917 Ga0207660_10510744 Ga0207660_105107441 250
434 3300025918 Ga0207662_10019471 Ga0207662_100194713 250
435 3300025918 Ga0207662_10028340 Ga0207662_100283403 250
436 3300025918 Ga0207662_10043404 Ga0207662_100434043 250
437 3300025918 Ga0207662_10053677 Ga0207662_100536772 250
438 3300025919 Ga0207657_10002485 Ga0207657_100024852 250
439 3300025919 Ga0207657_10033132 Ga0207657_100331323 250
440 3300025919 Ga0207657_10526036 Ga0207657_105260361 250
441 3300025920 Ga0207649_10037927 Ga0207649_100379272 250
442 3300025920 Ga0207649_10269162 Ga0207649_102691622 250
443 3300025920 Ga0207649_10366602 Ga0207649_103666021 250
444 3300025921 Ga0207652_10005794 Ga0207652_100057942 250
445 3300025921 Ga0207652_10008992 Ga0207652_100089927 250
446 3300025921 Ga0207652_10107967 Ga0207652_101079672 250
447 3300025921 Ga0207652_10381888 Ga0207652_103818882 250
448 3300025921 Ga0207652_10592518 Ga0207652_105925181 250
449 3300025923 Ga0207681_10012890 Ga0207681_100128904 250
450 3300025923 Ga0207681_10453097 Ga0207681_104530972 250
451 3300025925 Ga0207650_10148610 Ga0207650_101486102 250
452 3300025925 Ga0207650_10190558 Ga0207650_101905582 250
453 3300025925 Ga0207650_10193923 Ga0207650_101939232 250
454 3300025925 Ga0207650_10230506 Ga0207650_102305062 250
455 3300025926 Ga0207659_10023295 Ga0207659_100232953 250
456 3300025927 Ga0207687_10026879 Ga0207687_100268794 250
457 3300025927 Ga0207687_10124491 Ga0207687_101244913 250
458 3300025927 Ga0207687_10127829 Ga0207687_101278292 250
459 3300025927 Ga0207687_10214669 Ga0207687_102146691 250
460 3300025928 Ga0207700_10000713 Ga0207700_1000071314 250
461 3300025928 Ga0207700_10012092 Ga0207700_100120923 250
462 3300025928 Ga0207700_10157062 Ga0207700_101570622 250
463 3300025928 Ga0207700_10166242 Ga0207700_101662422 250
464 3300025928 Ga0207700_10199605 Ga0207700_101996052 250
465 3300025928 Ga0207700_10321260 Ga0207700_103212602 250
466 3300025929 Ga0207664_10003774 Ga0207664_100037747 250
467 3300025929 Ga0207664_10120633 Ga0207664_101206331 250
468 3300025931 Ga0207644_10492585 Ga0207644_104925851 250
469 3300025931 Ga0207644_10628828 Ga0207644_106288281 250
470 3300025932 Ga0207690_10004856 Ga0207690_100048564 250
471 3300025932 Ga0207690_10011490 Ga0207690_100114903 250
472 3300025932 Ga0207690_10028632 Ga0207690_100286321 250
473 3300025932 Ga0207690_10085243 Ga0207690_100852432 250
474 3300025933 Ga0207706_10000360 Ga0207706_1000036021 250
475 3300025933 Ga0207706_10027041 Ga0207706_100270412 250
476 3300025933 Ga0207706_10470777 Ga0207706_104707772 250
477 3300025934 Ga0207686_10034664 Ga0207686_100346641 250
478 3300025934 Ga0207686_10080842 Ga0207686_100808423 250
479 3300025934 Ga0207686_10115623 Ga0207686_101156233 250
480 3300025934 Ga0207686_10242766 Ga0207686_102427662 250
481 3300025936 Ga0207670_10015237 Ga0207670_100152372 250
482 3300025936 Ga0207670_10166131 Ga0207670_101661312 250
483 3300025937 Ga0207669_10007595 Ga0207669_100075952 250
484 3300025937 Ga0207669_10134138 Ga0207669_101341382 250
485 3300025939 Ga0207665_10186041 Ga0207665_101860412 250
486 3300025940 Ga0207691_10002534 Ga0207691_100025343 250
487 3300025940 Ga0207691_10003202 Ga0207691_100032023 250
488 3300025940 Ga0207691_10039995 Ga0207691_100399955 250
489 3300025940 Ga0207691_10047980 Ga0207691_100479802 250
490 3300025940 Ga0207691_10061922 Ga0207691_100619224 250
491 3300025940 Ga0207691_10232467 Ga0207691_102324672 250
492 3300025941 Ga0207711_10011146 Ga0207711_100111466 250
493 3300025941 Ga0207711_10024832 Ga0207711_100248323 250
494 3300025941 Ga0207711_10326655 Ga0207711_103266552 250
495 3300025941 Ga0207711_10345965 Ga0207711_103459652 250
496 3300025941 Ga0207711_10415405 Ga0207711_104154051 250
497 3300025942 Ga0207689_10009951 Ga0207689_100099516 250
498 3300025944 Ga0207661_10003744 Ga0207661_1000374411 250
499 3300025944 Ga0207661_10039887 Ga0207661_100398873 250
500 3300025944 Ga0207661_10066666 Ga0207661_100666663 250
501 3300025944 Ga0207661_10087859 Ga0207661_100878592 250
502 3300025944 Ga0207661_10113031 Ga0207661_101130312 250
503 3300025944 Ga0207661_10114042 Ga0207661_101140422 250
504 3300025944 Ga0207661_10233346 Ga0207661_102333462 250
505 3300025944 Ga0207661_10535090 Ga0207661_105350901 250
506 3300025944 Ga0207661_10537887 Ga0207661_105378871 250
507 3300025944 Ga0207661_10761917 Ga0207661_107619171 250
508 3300025945 Ga0207679_10004676 Ga0207679_100046762 250
509 3300025945 Ga0207679_10018528 Ga0207679_100185283 250
510 3300025945 Ga0207679_10034869 Ga0207679_100348693 250
511 3300025945 Ga0207679_10090522 Ga0207679_100905222 250
512 3300025945 Ga0207679_10242268 Ga0207679_102422682 250
513 3300025945 Ga0207679_10308582 Ga0207679_103085822 250
514 3300025945 Ga0207679_10570648 Ga0207679_105706481 250
515 3300025949 Ga0207667_10035867 Ga0207667_100358673 250
516 3300025949 Ga0207667_10114539 Ga0207667_101145393 250
517 3300025949 Ga0207667_10278142 Ga0207667_102781422 250
518 3300025949 Ga0207667_10306688 Ga0207667_103066882 250
519 3300025960 Ga0207651_10256972 Ga0207651_102569722 250
520 3300025961 Ga0207712_10002205 Ga0207712_100022052 250
521 3300025961 Ga0207712_10118982 Ga0207712_101189822 250
522 3300025972 Ga0207668_10014847 Ga0207668_100148474 250
523 3300025972 Ga0207668_10098453 Ga0207668_100984532 250
524 3300025981 Ga0207640_10150065 Ga0207640_101500652 250
525 3300025981 Ga0207640_10782756 Ga0207640_107827561 250
526 3300025986 Ga0207658_10045091 Ga0207658_100450914 250
527 3300025986 Ga0207658_10085411 Ga0207658_100854112 250
528 3300025986 Ga0207658_10194708 Ga0207658_101947083 250
529 3300025986 Ga0207658_10805954 Ga0207658_108059541 250
530 3300026035 Ga0207703_10276924 Ga0207703_102769242 250
531 3300026035 Ga0207703_10719194 Ga0207703_107191942 250
532 3300026035 Ga0207703_10751796 Ga0207703_107517961 250
533 3300026041 Ga0207639_10163108 Ga0207639_101631082 250
534 3300026041 Ga0207639_10538486 Ga0207639_105384862 250
535 3300026067 Ga0207678_10008055 Ga0207678_100080553 250
536 3300026075 Ga0207708_10048846 Ga0207708_100488462 250
537 3300026075 Ga0207708_10245980 Ga0207708_102459802 250
538 3300026078 Ga0207702_10011688 Ga0207702_100116882 250
539 3300026078 Ga0207702_10026823 Ga0207702_100268233 250
540 3300026078 Ga0207702_10274081 Ga0207702_102740811 250
541 3300026078 Ga0207702_10374263 Ga0207702_103742631 250
542 3300026078 Ga0207702_10544182 Ga0207702_105441822 250
543 3300026088 Ga0207641_10038720 Ga0207641_100387202 250
544 3300026088 Ga0207641_10046937 Ga0207641_100469374 250
545 3300026089 Ga0207648_10027761 Ga0207648_100277612 250
546 3300026089 Ga0207648_10434164 Ga0207648_104341642 250
547 3300026095 Ga0207676_10023859 Ga0207676_100238592 250
548 3300026095 Ga0207676_10079204 Ga0207676_100792042 250
549 3300026095 Ga0207676_10450954 Ga0207676_104509542 250
550 3300026116 Ga0207674_10000528 Ga0207674_1000052821 250
551 3300026116 Ga0207674_10002884 Ga0207674_1000288421 250
552 3300026116 Ga0207674_10013853 Ga0207674_100138537 250
553 3300026116 Ga0207674_10043791 Ga0207674_100437913 250
554 3300026116 Ga0207674_10045491 Ga0207674_100454912 250
555 3300026116 Ga0207674_10117375 Ga0207674_101173753 250
556 3300026116 Ga0207674_10420867 Ga0207674_104208672 250
557 3300026118 Ga0207675_100004288 Ga0207675_1000042883 250
558 3300026118 Ga0207675_100410485 Ga0207675_1004104852 250
559 3300026121 Ga0207683_10555822 Ga0207683_105558222 250
560 3300026142 Ga0207698_10027527 Ga0207698_100275275 250
561 3300026142 Ga0207698_10179487 Ga0207698_101794872 250
562 3300026142 Ga0207698_10201083 Ga0207698_102010832 250
563 3300026142 Ga0207698_10217355 Ga0207698_102173552 250
564 3300028379 Ga0268266_10072508 Ga0268266_100725083 250
565 3300028380 Ga0268265_10046502 Ga0268265_100465023 250
566 3300028380 Ga0268265_10209093 Ga0268265_102090932 250
567 3300028381 Ga0268264_10269800 Ga0268264_102698002 250
568 3300028381 Ga0268264_10343149 Ga0268264_103431492 250
569 3300031238 Ga0265332_10011303 Ga0265332_100113033 250
570 3300031251 Ga0265327_10021313 Ga0265327_100213133 250
571 3300031548 Ga0307408_100003736 Ga0307408_1000037366 250
572 3300031711 Ga0265314_10029359 Ga0265314_100293592 250
573 3300031731 Ga0307405_10155051 Ga0307405_101550512 250
574 3300031824 Ga0307413_10099106 Ga0307413_100991062 250
575 3300031852 Ga0307410_10093351 Ga0307410_100933512 250
576 3300031852 Ga0307410_10203856 Ga0307410_102038562 250
577 3300031901 Ga0307406_10015818 Ga0307406_100158182 250
578 3300031901 Ga0307406_10411980 Ga0307406_104119802 250
579 3300031901 Ga0307406_10541330 Ga0307406_105413301 250
580 3300031995 Ga0307409_100266064 Ga0307409_1002660642 250
581 3300032002 Ga0307416_100278572 Ga0307416_1002785722 250
582 3300032004 Ga0307414_10120693 Ga0307414_101206931 250
583 3300032004 Ga0307414_10180513 Ga0307414_101805132 250
584 3300032005 Ga0307411_10024423 Ga0307411_100244233 250
585 3300035083 Ga0373926_0013037 Ga0373926_0013037_1720_2472 250
586 3300035086 Ga0373934_0000378 Ga0373934_0000378_10691_11443 250
587 3300035086 Ga0373934_0005214 Ga0373934_0005214_2530_3282 250
588 3300035089 Ga0373944_0049828 Ga0373944_0049828_346_1098 250
589 3300035116 Ga0373945_0087275 Ga0373945_0087275_359_1111 250
590 3300035118 Ga0373954_0022269 Ga0373954_0022269_1241_1993 250
591 3300035118 Ga0373954_0133729 Ga0373954_0133729_189_941 250
592 3300035119 Ga0373956_0001784 Ga0373956_0001784_1304_2056 250
593 3300035120 Ga0373957_0002283 Ga0373957_0002283_4170_4922 250
594 3300035170 Ga0373943_0017013 Ga0373943_0017013_2549_3301 250
595 3300035170 Ga0373943_0084416 Ga0373943_0084416_26_778 250
596 3300035172 Ga0373955_0000478 Ga0373955_0000478_6904_7656 250
597 3300035172 Ga0373955_0011131 Ga0373955_0011131_1450_2202 250
598 3300035172 Ga0373955_0051117 Ga0373955_0051117_908_1660 250
599 3300035691 Ga0373931_0200410 Ga0373931_0200410_308_1060 250
600 3300035692 Ga0373935_0000974 Ga0373935_0000974_6123_6875 250
601 3300035692 Ga0373935_0184745 Ga0373935_0184745_139_891 250
602 3300035692 Ga0373935_0325947 Ga0373935_0325947_284_1036 250
603 3300035695 Ga0373927_0008745 Ga0373927_0008745_975_1727 250
604 3300035695 Ga0373927_0039757 Ga0373927_0039757_806_1558 250
605 3300035695 Ga0373927_0061501 Ga0373927_0061501_1621_2379 250
606 3300035724 Ga0373933_0000033 Ga0373933_0000033_9306_10058 250
607 3300035724 Ga0373933_0053316 Ga0373933_0053316_817_1569 250
608 3300035725 Ga0373947_0005801 Ga0373947_0005801_6330_7082 250
609 3300035725 Ga0373947_0174908 Ga0373947_0174908_347_1099 250
610 3300036401 Ga0373937_0000158 Ga0373937_0000158_14042_14794 250
611 3300036401 Ga0373937_0023307 Ga0373937_0023307_837_1589 250
612 3300036401 Ga0373937_0032620 Ga0373937_0032620_2822_3574 250
613 3300036401 Ga0373937_0056784 Ga0373937_0056784_49_801 250
614 3300036401 Ga0373937_0347028 Ga0373937_0347028_309_1061 250
615 3300037068 Ga0373925_0002081 Ga0373925_0002081_3779_4531 250
616 3300037068 Ga0373925_0203206 Ga0373925_0203206_156_908 250
617 3300039437 Ga0436365_0597434 Ga0436365_0597434_112_864 250
618 3300041406 Ga0439439_0003899 Ga0439439_0003899_2535_3287 250
619 3300042005 Ga0439448_0021568 Ga0439448_0021568_754_1506 250
620 3300042435 Ga0439434_0030838 Ga0439434_0030838_795_1547 250
621 3300042876 Ga0451577_0000005 Ga0451577_0000005_20085_20837 250
622 3300042876 Ga0451577_0753318 Ga0451577_0753318_17_772 250
623 3300044656 Ga0466969_0115206 Ga0466969_0115206_427_1179 250
624 3300044694 Ga0466963_0170513 Ga0466963_0170513_128_880 250
625 3300045049 Ga0466959_0015951 Ga0466959_0015951_1146_1898 250
626 3300045051 Ga0451576_0072473 Ga0451576_0072473_1017_1769 250
627 3300045051 Ga0451576_0973722 Ga0451576_0973722_53_805 250
628 3300045836 Ga0466958_0353868 Ga0466958_0353868_80_832 250
629 3300045976 Ga0466967_0023654 Ga0466967_0023654_3996_4748 250
630 3300045976 Ga0466967_0113180 Ga0466967_0113180_339_1097 250
631 3300045976 Ga0466967_0274661 Ga0466967_0274661_779_1531 250
632 3300046454 Ga0495592_0000976 Ga0495592_0000976_16023_16775 250
633 3300046455 Ga0495603_0035019 Ga0495603_0035019_205_957 250
634 3300046459 Ga0495629_0008985 Ga0495629_0008985_5596_6348 250
635 3300046459 Ga0495629_0025272 Ga0495629_0025272_1825_2577 250
636 3300046459 Ga0495629_0071754 Ga0495629_0071754_1382_2134 250
637 3300046459 Ga0495629_0083200 Ga0495629_0083200_1400_2152 250
638 3300046459 Ga0495629_0094913 Ga0495629_0094913_103_855 250
639 3300046459 Ga0495629_0294261 Ga0495629_0294261_136_888 250
640 3300046462 Ga0495651_0000893 Ga0495651_0000893_12872_13624 250
641 3300046462 Ga0495651_0023586 Ga0495651_0023586_2786_3538 250
642 3300046462 Ga0495651_0106142 Ga0495651_0106142_1042_1794 250
643 3300046463 Ga0495653_0000173 Ga0495653_0000173_12666_13418 250
644 3300046463 Ga0495653_0089320 Ga0495653_0089320_95_847 250
645 3300046472 Ga0495580_0004972 Ga0495580_0004972_604_1356 250
646 3300046472 Ga0495580_0088355 Ga0495580_0088355_1154_1906 250
647 3300046473 Ga0495582_0006104 Ga0495582_0006104_3638_4390 250
648 3300046473 Ga0495582_0039838 Ga0495582_0039838_597_1349 250
649 3300046473 Ga0495582_0078363 Ga0495582_0078363_759_1511 250
650 3300046475 Ga0495639_0017395 Ga0495639_0017395_772_1524 250
651 3300046475 Ga0495639_0025008 Ga0495639_0025008_1264_2016 250
652 3300046476 Ga0495662_0099135 Ga0495662_0099135_593_1345 250
653 3300046477 Ga0495664_0004103 Ga0495664_0004103_5800_6552 250
654 3300046477 Ga0495664_0088709 Ga0495664_0088709_968_1720 250
655 3300046499 Ga0495594_0009845 Ga0495594_0009845_3832_4584 250
656 3300046499 Ga0495594_0048806 Ga0495594_0048806_380_1132 250
657 3300046499 Ga0495594_0053371 Ga0495594_0053371_750_1502 250
658 3300046499 Ga0495594_0074959 Ga0495594_0074959_935_1687 250
659 3300046511 Ga0495608_0000763 Ga0495608_0000763_9984_10736 250
660 3300046511 Ga0495608_0033340 Ga0495608_0033340_1681_2433 250
661 3300046514 Ga0495618_0158090 Ga0495618_0158090_622_1374 250
662 3300046516 Ga0495628_0012681 Ga0495628_0012681_4573_5325 250
663 3300046516 Ga0495628_0033195 Ga0495628_0033195_376_1128 250
664 3300046516 Ga0495628_0059929 Ga0495628_0059929_170_922 250
665 3300046516 Ga0495628_0452550 Ga0495628_0452550_159_911 250
666 3300046517 Ga0495630_0007289 Ga0495630_0007289_1163_1915 250
667 3300046526 Ga0495666_0033841 Ga0495666_0033841_728_1480 250
668 3300046529 Ga0495652_0003926 Ga0495652_0003926_12442_13194 250
669 3300046529 Ga0495652_0008068 Ga0495652_0008068_2716_3468 250
670 3300046529 Ga0495652_0024917 Ga0495652_0024917_643_1395 250
671 3300046529 Ga0495652_0260051 Ga0495652_0260051_81_833 250
672 3300046531 Ga0495665_0000452 Ga0495665_0000452_15077_15829 250
673 3300046531 Ga0495665_0010101 Ga0495665_0010101_3437_4189 250
674 3300046531 Ga0495665_0011227 Ga0495665_0011227_2511_3263 250
675 3300046531 Ga0495665_0037241 Ga0495665_0037241_815_1567 250
676 3300046533 Ga0495640_0037223 Ga0495640_0037223_250_1002 250
677 3300046533 Ga0495640_0098890 Ga0495640_0098890_160_912 250
678 3300046533 Ga0495640_0337397 Ga0495640_0337397_108_860 250
679 3300046535 Ga0495586_0023036 Ga0495586_0023036_151_903 250
680 3300046535 Ga0495586_0044200 Ga0495586_0044200_906_1658 250
681 3300046535 Ga0495586_0358524 Ga0495586_0358524_25_777 250
682 3300046536 Ga0495587_0001531 Ga0495587_0001531_14544_15296 250
683 3300046536 Ga0495587_0001904 Ga0495587_0001904_9001_9753 250
684 3300046536 Ga0495587_0002015 Ga0495587_0002015_12436_13188 250
685 3300046536 Ga0495587_0015466 Ga0495587_0015466_1678_2430 250
686 3300046536 Ga0495587_0138655 Ga0495587_0138655_112_864 250
687 3300046537 Ga0495598_0018359 Ga0495598_0018359_300_1067 250
688 3300046539 Ga0495621_0065986 Ga0495621_0065986_458_1225 250
689 3300046543 Ga0495645_0000383 Ga0495645_0000383_25900_26652 250
690 3300046543 Ga0495645_0000497 Ga0495645_0000497_15818_16570 250
691 3300046543 Ga0495645_0061136 Ga0495645_0061136_881_1633 250
692 3300046559 Ga0495667_0000495 Ga0495667_0000495_10626_11378 250
693 3300046559 Ga0495667_0001594 Ga0495667_0001594_9712_10464 250
694 3300046559 Ga0495667_0015720 Ga0495667_0015720_2152_2904 250
695 3300046559 Ga0495667_0212523 Ga0495667_0212523_38_790 250
696 3300046642 Ga0495634_0156662 Ga0495634_0156662_127_879 250
697 3300046642 Ga0495634_0391155 Ga0495634_0391155_15_767 250
698 3300046663 Ga0495635_0000120 Ga0495635_0000120_1017_1769 250
699 3300046663 Ga0495635_0071741 Ga0495635_0071741_20_772 250
700 3300046663 Ga0495635_0287120 Ga0495635_0287120_279_1031 250
701 3300046663 Ga0495635_0461804 Ga0495635_0461804_76_828 250
702 3300046674 Ga0495588_0002798 Ga0495588_0002798_962_1714 250
703 3300046675 Ga0495657_0000371 Ga0495657_0000371_12108_12860 250
704 3300046675 Ga0495657_0040167 Ga0495657_0040167_1894_2646 250
705 3300046678 Ga0495599_0000065 Ga0495599_0000065_47974_48726 250
706 3300046678 Ga0495599_0002260 Ga0495599_0002260_1779_2531 250
707 3300046678 Ga0495599_0108192 Ga0495599_0108192_652_1404 250
708 3300046679 Ga0495623_0000014 Ga0495623_0000014_73058_73810 250
709 3300046679 Ga0495623_0004186 Ga0495623_0004186_6503_7255 250
710 3300046679 Ga0495623_0062494 Ga0495623_0062494_981_1751 250
711 3300046679 Ga0495623_0140445 Ga0495623_0140445_661_1413 250
712 3300046679 Ga0495623_0165003 Ga0495623_0165003_105_857 250
713 3300046680 Ga0495646_0000129 Ga0495646_0000129_12996_13748 250
714 3300046683 Ga0495658_0000262 Ga0495658_0000262_10221_10973 250
715 3300046683 Ga0495658_0031519 Ga0495658_0031519_1809_2561 250
716 3300046683 Ga0495658_0191925 Ga0495658_0191925_297_1049 250
717 3300046689 Ga0495613_0006325 Ga0495613_0006325_6166_6918 250
718 3300046809 Ga0495600_0000105 Ga0495600_0000105_41345_42097 250
719 3300046809 Ga0495600_0020264 Ga0495600_0020264_620_1372 250
720 3300046809 Ga0495600_0026688 Ga0495600_0026688_2636_3388 250
721 3300046809 Ga0495600_0271260 Ga0495600_0271260_216_968 250
722 3300046809 Ga0495600_0350812 Ga0495600_0350812_18_770 250
723 3300047315 Ga0495581_0022559 Ga0495581_0022559_1106_1858 250
724 3300047315 Ga0495581_0111186 Ga0495581_0111186_725_1477 250
725 3300047317 Ga0495604_0000359 Ga0495604_0000359_1648_2400 250
726 3300047317 Ga0495604_0051132 Ga0495604_0051132_1523_2275 250
727 3300047319 Ga0495674_0000362 Ga0495674_0000362_27933_28685 250
728 3300047319 Ga0495674_0041917 Ga0495674_0041917_348_1100 250
729 3300047320 Ga0495672_0023597 Ga0495672_0023597_2176_2928 250
730 3300047322 Ga0495680_0003175 Ga0495680_0003175_12964_13716 250
731 3300047322 Ga0495680_0011402 Ga0495680_0011402_5580_6332 250
732 3300047322 Ga0495680_0046385 Ga0495680_0046385_560_1312 250
733 3300047322 Ga0495680_0403211 Ga0495680_0403211_161_931 250
734 3300047444 Ga0495675_0000748 Ga0495675_0000748_13393_14145 250
735 3300047444 Ga0495675_0023504 Ga0495675_0023504_2166_2918 250
736 3300047444 Ga0495675_0045490 Ga0495675_0045490_1091_1861 250
737 3300047444 Ga0495675_0098788 Ga0495675_0098788_716_1468 250
738 3300047444 Ga0495675_0334239 Ga0495675_0334239_40_792 250
739 3300047471 Ga0495684_0000288 Ga0495684_0000288_38428_39180 250
740 3300047471 Ga0495684_0005125 Ga0495684_0005125_7875_8627 250
741 3300047471 Ga0495684_0018431 Ga0495684_0018431_159_911 250
742 3300047673 Ga0495593_0010392 Ga0495593_0010392_1096_1848 250
743 3300048088 Ga0495602_0002905 Ga0495602_0002905_15052_15804 250
744 3300048088 Ga0495602_0030782 Ga0495602_0030782_4039_4791 250
745 3300048088 Ga0495602_0199776 Ga0495602_0199776_105_857 250
746 3300048088 Ga0495602_0231674 Ga0495602_0231674_45_797 250
747 3300048089 Ga0495614_0007574 Ga0495614_0007574_1237_1989 250
748 3300048904 Ga0496101_0127898 Ga0496101_0127898_1099_1869 250
749 3300048905 Ga0496102_0040439 Ga0496102_0040439_1290_2042 250
750 3300048905 Ga0496102_0320942 Ga0496102_0320942_431_1183 250
751 3300048907 Ga0496104_0102392 Ga0496104_0102392_1836_2588 250
752 3300048907 Ga0496104_0116285 Ga0496104_0116285_1236_1988 250
753 3300048907 Ga0496104_0365743 Ga0496104_0365743_448_1218 250
754 3300048907 Ga0496104_0582615 Ga0496104_0582615_50_820 250
755 3300048908 Ga0496105_0313801 Ga0496105_0313801_358_1110 250
756 3300048908 Ga0496105_0350510 Ga0496105_0350510_302_1072 250
757 3300048911 Ga0496108_0101549 Ga0496108_0101549_897_1649 250
758 3300048911 Ga0496108_0139713 Ga0496108_0139713_835_1587 250
759 3300048911 Ga0496108_0156687 Ga0496108_0156687_716_1486 250
760 3300048911 Ga0496108_0336327 Ga0496108_0336327_55_825 250
761 3300048912 Ga0496109_0118555 Ga0496109_0118555_1662_2432 250
762 3300048912 Ga0496109_0121547 Ga0496109_0121547_56_808 250
763 3300048915 Ga0496112_0015971 Ga0496112_0015971_4887_5657 250
764 3300048915 Ga0496112_0129628 Ga0496112_0129628_730_1500 250
765 3300048915 Ga0496112_0350850 Ga0496112_0350850_345_1097 250
766 3300048916 Ga0496113_0033639 Ga0496113_0033639_2913_3683 250
767 3300048916 Ga0496113_0091728 Ga0496113_0091728_1508_2260 250
768 3300049522 Ga0501299_013580 Ga0501299_013580_215_973 250
769 3300049569 Ga0501032_0219301 Ga0501032_0219301_419_1171 250
770 3300049570 Ga0501033_0004626 Ga0501033_0004626_5507_6259 250
771 3300049571 Ga0501034_0098870 Ga0501034_0098870_1656_2408 250
772 3300049572 Ga0501036_0123895 Ga0501036_0123895_823_1575 250
773 3300049574 Ga0501038_0045327 Ga0501038_0045327_519_1271 250
774 3300049574 Ga0501038_0364306 Ga0501038_0364306_276_1028 250
775 3300049575 Ga0501039_0123640 Ga0501039_0123640_379_1131 250
776 3300049576 Ga0501040_0173680 Ga0501040_0173680_123_878 250
777 3300049576 Ga0501040_0190484 Ga0501040_0190484_623_1375 250
778 3300049577 Ga0501041_0100478 Ga0501041_0100478_579_1334 250
779 3300049579 Ga0501043_0013304 Ga0501043_0013304_2757_3509 250
780 3300049581 Ga0501047_0011463 Ga0501047_0011463_1949_2701 250
781 3300049581 Ga0501047_0092525 Ga0501047_0092525_912_1664 250
782 3300049581 Ga0501047_0348014 Ga0501047_0348014_530_1282 250
783 3300049582 Ga0501048_0117578 Ga0501048_0117578_1107_1859 250
784 3300049586 Ga0501070_0061189 Ga0501070_0061189_1883_2635 250
785 3300049586 Ga0501070_0311122 Ga0501070_0311122_48_800 250
786 3300049590 Ga0501074_0343817 Ga0501074_0343817_270_1022 250
787 3300049592 Ga0501076_0030374 Ga0501076_0030374_1884_2639 250
788 3300049593 Ga0501077_0003877 Ga0501077_0003877_2148_2900 250
789 3300049593 Ga0501077_0187994 Ga0501077_0187994_411_1166 250
790 3300049742 Ga0501080_0038756 Ga0501080_0038756_3538_4293 250
791 3300049742 Ga0501080_0333320 Ga0501080_0333320_510_1262 250
792 3300049743 Ga0501081_0052927 Ga0501081_0052927_1102_1857 250
793 3300049743 Ga0501081_0186813 Ga0501081_0186813_490_1242 250
794 3300049822 Ga0501035_0216551 Ga0501035_0216551_837_1604 250
795 3300049822 Ga0501035_0349158 Ga0501035_0349158_233_985 250
796 3300049823 Ga0501044_0072931 Ga0501044_0072931_164_931 250
797 3300049823 Ga0501044_0356941 Ga0501044_0356941_220_972 250
798 3300049824 Ga0501045_0106883 Ga0501045_0106883_1185_1940 250
799 3300050507 nmdc:mga05p37_132137_c1 nmdc:mga05p37_132137_c1_2210_2962 250
800 3300050507 nmdc:mga05p37_155826_c1 nmdc:mga05p37_155826_c1_834_1586 250
801 3300050507 nmdc:mga05p37_165045_c1 nmdc:mga05p37_165045_c1_1139_1891 250
802 3300050507 nmdc:mga05p37_326868_c1 nmdc:mga05p37_326868_c1_690_1442 250
803 3300050508 nmdc:mga09592_99531_c1 nmdc:mga09592_99531_c1_1027_1779 250
804 3300050509 nmdc:mga0qj67_3500_c1 nmdc:mga0qj67_3500_c1_8035_8787 250
805 3300050510 nmdc:mga06r32_120099_c1 nmdc:mga06r32_120099_c1_450_1202 250
806 3300050510 nmdc:mga06r32_157808_c1 nmdc:mga06r32_157808_c1_1015_1767 250
807 3300050510 nmdc:mga06r32_46765_c1 nmdc:mga06r32_46765_c1_655_1407 250
808 3300050510 nmdc:mga06r32_580153_c1 nmdc:mga06r32_580153_c1_306_1058 250
809 3300050511 nmdc:mga08y16_284411_c1 nmdc:mga08y16_284411_c1_876_1643 250
810 3300050511 nmdc:mga08y16_390941_c1 nmdc:mga08y16_390941_c1_606_1358 250
811 3300050511 nmdc:mga08y16_663077_c1 nmdc:mga08y16_663077_c1_28_780 250
812 3300050512 nmdc:mga0n895_166893_c1 nmdc:mga0n895_166893_c1_571_1323 250
813 3300050512 nmdc:mga0n895_34022_c1 nmdc:mga0n895_34022_c1_2993_3745 250
814 3300050512 nmdc:mga0n895_48315_c1 nmdc:mga0n895_48315_c1_2321_3088 250
815 3300050512 nmdc:mga0n895_7448_c1 nmdc:mga0n895_7448_c1_2279_3034 250
816 3300050513 nmdc:mga0rr50_1947_c1 nmdc:mga0rr50_1947_c1_8721_9476 250
817 3300050513 nmdc:mga0rr50_219465_c1 nmdc:mga0rr50_219465_c1_246_1001 250
818 3300050513 nmdc:mga0rr50_241941_c1 nmdc:mga0rr50_241941_c1_677_1429 250
819 3300050513 nmdc:mga0rr50_63277_c1 nmdc:mga0rr50_63277_c1_1728_2483 250
820 3300050514 nmdc:mga08x19_352268_c1 nmdc:mga08x19_352268_c1_136_888 250
821 3300050515 nmdc:mga0a205_111874_c1 nmdc:mga0a205_111874_c1_1389_2141 250
822 3300050515 nmdc:mga0a205_545693_c1 nmdc:mga0a205_545693_c1_204_959 250
823 3300053077 Ga0495601_0001013 Ga0495601_0001013_11672_12424 250
824 3300053078 Ga0495612_0000636 Ga0495612_0000636_10185_10937 250
825 3300053084 Ga0495595_0026591 Ga0495595_0026591_1382_2134 250
826 3300053084 Ga0495595_0069728 Ga0495595_0069728_597_1349 250
827 3300053084 Ga0495595_0190320 Ga0495595_0190320_75_827 250
828 3300053085 Ga0495619_0001764 Ga0495619_0001764_11972_12724 250
829 3300053085 Ga0495619_0234348 Ga0495619_0234348_207_959 250
830 3300054114 Ga0501084_0016560 Ga0501084_0016560_3718_4473 250
831 3300054114 Ga0501084_0066227 Ga0501084_0066227_2228_2980 250
832 3300059423 Ga0590074_025282 Ga0590074_025282_252_1004 250
833 3300059424 Ga0590075_010266 Ga0590075_010266_1051_1803 250
834 3300059426 Ga0590077_033794 Ga0590077_033794_50_802 250
835 3300060353 Ga0501082_0052736 Ga0501082_0052736_1335_2090 250
836 3300060353 Ga0501082_0074105 Ga0501082_0074105_1859_2611 250
837 3300061719 Ga0466962_0251786 Ga0466962_0251786_27_779 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

40

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9366 1 221
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9163 1 221
1o95-assembly1.cif.gz_C ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9128 1 220
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9051 1 221
1efp-assembly2.cif.gz_D electron transfer flavoprotein (etf) from paracoccus denitrificans 0.8852 1 241
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9366 1 221 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9091 1 220 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9051 1 221 3.40.50.620
af_Q9CAE9_66_360_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8881 144 170 2.120.10.80
4o2dB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8773 144 169 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7X5VRZ0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9792 32 173 GO:0009055
AF-A0A800K6X5-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.974 1 220 GO:0009055
AF-A0A7C5RDI6-F1-model_v4 Electron transfer flavoprotein beta subunit/FixA family protein 0.9724 1 204 GO:0009055
AF-A0A7V5IFK9-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9719 1 133 GO:0009055
AF-A0A4R0BDJ9-F1-model_v4 deleted 0.9694 27 204

Feature Viewer

pLDDT pTM Quality
89.76 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map