F482940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 837 | 325 | 837 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300031824|Ga0307413_10018637|Ga0307413_100186373 |
| Length | 265 |
| Sequence | MPAAAGLDDMVIPGETLKIAVCIKRVPDTEMRFAIAGDGKSLDQTGLKYDISDFDGYAVEVALRLTEKDGGDVAVICLGPDGVQETIRKAFSMGAARGVQLKADTVPFDGSAIAHALAAELRDGGYDLVLFGRQSADAGNGTVGPMTAHLLGLPCVTAISHLELADGRGTAHRELEGSAESVEFPLPAVLTIDEGIARPRLPSLKGIMAAKKKTIDVRPAQLGEERLTVQTMALPPERAAGRIVGEGPDAVPELVRLLKTEAKVL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 194 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 213 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 214 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 215 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 278 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 296 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 297 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 298 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 299 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.51 |
| Rhizosphere | 97.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065715_10209515 | 3300005293 | Unclassified | 1321 |
| 2 | Ga0070658_10007057 | 3300005327 | Bacteria | 9064 |
| 3 | Ga0070658_10020907 | 3300005327 | Bacteria | 5242 |
| 4 | Ga0070658_10227287 | 3300005327 | Bacteria | 1579 |
| 5 | Ga0070676_10011596 | 3300005328 | Bacteria | 4794 |
| 6 | Ga0070683_100000171 | 3300005329 | Bacteria | 42679 |
| 7 | Ga0070683_100000440 | 3300005329 | Bacteria | 28884 |
| 8 | Ga0070683_100006205 | 3300005329 | Bacteria | 10021 |
| 9 | Ga0070683_100010918 | 3300005329 | Bacteria | 7822 |
| 10 | Ga0070683_100048552 | 3300005329 | Bacteria | 3924 |
| 11 | Ga0070683_100049271 | 3300005329 | Bacteria | 3895 |
| 12 | Ga0070683_100074501 | 3300005329 | Bacteria | 3171 |
| 13 | Ga0070683_100075540 | 3300005329 | Bacteria | 3148 |
| 14 | Ga0070683_100098251 | 3300005329 | Unclassified | 2755 |
| 15 | Ga0070683_100108253 | 3300005329 | Bacteria | 2621 |
| 16 | Ga0070690_100008925 | 3300005330 | Bacteria | 5790 |
| 17 | Ga0070690_100055174 | 3300005330 | Bacteria | 2545 |
| 18 | Ga0070690_100073397 | 3300005330 | Bacteria | 2226 |
| 19 | Ga0070690_100074670 | 3300005330 | Bacteria | 2209 |
| 20 | Ga0070690_100120948 | 3300005330 | Bacteria | 1757 |
| 21 | Ga0070670_100007041 | 3300005331 | Bacteria | 9532 |
| 22 | Ga0070670_100007905 | 3300005331 | Bacteria | 9049 |
| 23 | Ga0070670_100150990 | 3300005331 | Bacteria | 2010 |
| 24 | Ga0070670_100385940 | 3300005331 | Bacteria | 1234 |
| 25 | Ga0070670_100489284 | 3300005331 | Bacteria | 1093 |
| 26 | Ga0068869_100009371 | 3300005334 | Bacteria | 6354 |
| 27 | Ga0068869_100033861 | 3300005334 | Bacteria | 3610 |
| 28 | Ga0070666_10079426 | 3300005335 | Bacteria | 2241 |
| 29 | Ga0070680_100000733 | 3300005336 | Bacteria | 22901 |
| 30 | Ga0070680_100004315 | 3300005336 | Bacteria | 10687 |
| 31 | Ga0070680_100046151 | 3300005336 | Bacteria | 3543 |
| 32 | Ga0070680_100065117 | 3300005336 | Bacteria | 2987 |
| 33 | Ga0068868_100006090 | 3300005338 | Bacteria | 8517 |
| 34 | Ga0070660_100003841 | 3300005339 | Bacteria | 10374 |
| 35 | Ga0070660_100017277 | 3300005339 | Bacteria | 5256 |
| 36 | Ga0070660_100017406 | 3300005339 | Bacteria | 5238 |
| 37 | Ga0070660_100160829 | 3300005339 | Bacteria | 1809 |
| 38 | Ga0070689_100003002 | 3300005340 | Bacteria | 11100 |
| 39 | Ga0070689_100003984 | 3300005340 | Bacteria | 9923 |
| 40 | Ga0070689_100066588 | 3300005340 | Bacteria | 2806 |
| 41 | Ga0070689_100108048 | 3300005340 | Bacteria | 2210 |
| 42 | Ga0070691_10002628 | 3300005341 | Bacteria | 8008 |
| 43 | Ga0070687_100047025 | 3300005343 | Unclassified | 2211 |
| 44 | Ga0070661_100000331 | 3300005344 | Bacteria | 37971 |
| 45 | Ga0070692_10022338 | 3300005345 | Bacteria | 3089 |
| 46 | Ga0070692_10022639 | 3300005345 | Bacteria | 3071 |
| 47 | Ga0070692_10208081 | 3300005345 | Bacteria | 1150 |
| 48 | Ga0070668_100024896 | 3300005347 | Bacteria | 4537 |
| 49 | Ga0070668_100068765 | 3300005347 | Bacteria | 2753 |
| 50 | Ga0070669_100078097 | 3300005353 | Bacteria | 2460 |
| 51 | Ga0070669_100212749 | 3300005353 | Bacteria | 1526 |
| 52 | Ga0070675_100001364 | 3300005354 | Bacteria | 17887 |
| 53 | Ga0070675_100011838 | 3300005354 | Bacteria | 6834 |
| 54 | Ga0070675_100012790 | 3300005354 | Bacteria | 6584 |
| 55 | Ga0070675_100051961 | 3300005354 | Bacteria | 3368 |
| 56 | Ga0070675_100151507 | 3300005354 | Bacteria | 1989 |
| 57 | Ga0070675_100410378 | 3300005354 | Bacteria | 1209 |
| 58 | Ga0070671_100053238 | 3300005355 | Bacteria | 3364 |
| 59 | Ga0070671_100643229 | 3300005355 | Unclassified | 918 |
| 60 | Ga0070674_100143652 | 3300005356 | Bacteria | 1794 |
| 61 | Ga0070674_100207520 | 3300005356 | Bacteria | 1516 |
| 62 | Ga0070674_100219437 | 3300005356 | Bacteria | 1478 |
| 63 | Ga0070674_100475815 | 3300005356 | Bacteria | 1036 |
| 64 | Ga0070673_100201070 | 3300005364 | Bacteria | 1716 |
| 65 | Ga0070673_100275313 | 3300005364 | Bacteria | 1474 |
| 66 | Ga0070688_100011427 | 3300005365 | Bacteria | 4933 |
| 67 | Ga0070688_100083716 | 3300005365 | Bacteria | 2071 |
| 68 | Ga0070659_100003745 | 3300005366 | Bacteria | 10847 |
| 69 | Ga0070659_100019870 | 3300005366 | Bacteria | 5098 |
| 70 | Ga0070659_100035374 | 3300005366 | Bacteria | 3890 |
| 71 | Ga0070659_100092186 | 3300005366 | Unclassified | 2429 |
| 72 | Ga0070667_100027832 | 3300005367 | Bacteria | 4704 |
| 73 | Ga0070667_100387295 | 3300005367 | Bacteria | 1271 |
| 74 | Ga0070667_100396394 | 3300005367 | Bacteria | 1256 |
| 75 | Ga0070703_10000558 | 3300005406 | Bacteria | 13685 |
| 76 | Ga0070703_10039499 | 3300005406 | Bacteria | 1463 |
| 77 | Ga0070709_10001756 | 3300005434 | Bacteria | 11789 |
| 78 | Ga0070709_10009907 | 3300005434 | Bacteria | 5268 |
| 79 | Ga0070709_10032503 | 3300005434 | Bacteria | 3147 |
| 80 | Ga0070714_100003987 | 3300005435 | Bacteria | 11099 |
| 81 | Ga0070714_100096712 | 3300005435 | Bacteria | 2595 |
| 82 | Ga0070713_100000149 | 3300005436 | Bacteria | 46694 |
| 83 | Ga0070713_100010992 | 3300005436 | Bacteria | 6567 |
| 84 | Ga0070713_100029513 | 3300005436 | Bacteria | 4345 |
| 85 | Ga0070713_100046876 | 3300005436 | Bacteria | 3549 |
| 86 | Ga0070713_100331951 | 3300005436 | Bacteria | 1407 |
| 87 | Ga0070710_10124963 | 3300005437 | Bacteria | 1562 |
| 88 | Ga0070701_10002580 | 3300005438 | Bacteria | 7020 |
| 89 | Ga0070701_10010767 | 3300005438 | Bacteria | 4058 |
| 90 | Ga0070711_100143458 | 3300005439 | Bacteria | 1793 |
| 91 | Ga0070711_100151770 | 3300005439 | Bacteria | 1748 |
| 92 | Ga0070705_100017142 | 3300005440 | Bacteria | 3777 |
| 93 | Ga0070705_100027043 | 3300005440 | Bacteria | 3128 |
| 94 | Ga0070705_100042485 | 3300005440 | Bacteria | 2599 |
| 95 | Ga0070700_100057968 | 3300005441 | Bacteria | 2432 |
| 96 | Ga0070694_100019882 | 3300005444 | Bacteria | 4276 |
| 97 | Ga0070694_100106302 | 3300005444 | Bacteria | 1993 |
| 98 | Ga0070694_100125301 | 3300005444 | Bacteria | 1848 |
| 99 | Ga0070708_100000045 | 3300005445 | Bacteria | 81076 |
| 100 | Ga0070708_100021041 | 3300005445 | Bacteria | 5508 |
| 101 | Ga0070708_100058288 | 3300005445 | Bacteria | 3440 |
| 102 | Ga0070708_100084310 | 3300005445 | Bacteria | 2882 |
| 103 | Ga0070708_100181689 | 3300005445 | Bacteria | 1966 |
| 104 | Ga0070708_100377408 | 3300005445 | Bacteria | 1337 |
| 105 | Ga0070663_100071034 | 3300005455 | Bacteria | 2533 |
| 106 | Ga0070678_100388204 | 3300005456 | Bacteria | 1210 |
| 107 | Ga0070662_100015491 | 3300005457 | Bacteria | 5108 |
| 108 | Ga0070662_100208715 | 3300005457 | Bacteria | 1553 |
| 109 | Ga0070681_10001111 | 3300005458 | Bacteria | 23026 |
| 110 | Ga0070681_10001558 | 3300005458 | Bacteria | 20324 |
| 111 | Ga0070681_10003103 | 3300005458 | Bacteria | 15433 |
| 112 | Ga0070681_10044788 | 3300005458 | Bacteria | 4430 |
| 113 | Ga0070681_10068350 | 3300005458 | Bacteria | 3520 |
| 114 | Ga0070681_10107087 | 3300005458 | Bacteria | 2737 |
| 115 | Ga0070681_10168120 | 3300005458 | Bacteria | 2115 |
| 116 | Ga0070681_10221985 | 3300005458 | Bacteria | 1805 |
| 117 | Ga0070681_10690315 | 3300005458 | Bacteria | 936 |
| 118 | Ga0068867_100047606 | 3300005459 | Bacteria | 3152 |
| 119 | Ga0068867_100360046 | 3300005459 | Bacteria | 1216 |
| 120 | Ga0070685_10087902 | 3300005466 | Bacteria | 1876 |
| 121 | Ga0070706_100028449 | 3300005467 | Bacteria | 5145 |
| 122 | Ga0070706_100073302 | 3300005467 | Bacteria | 3169 |
| 123 | Ga0070706_100145381 | 3300005467 | Bacteria | 2214 |
| 124 | Ga0070706_100250384 | 3300005467 | Bacteria | 1654 |
| 125 | Ga0070698_100001280 | 3300005471 | Bacteria | 28075 |
| 126 | Ga0070698_100015560 | 3300005471 | Bacteria | 8033 |
| 127 | Ga0070698_100035195 | 3300005471 | Bacteria | 5179 |
| 128 | Ga0070698_100099490 | 3300005471 | Bacteria | 2881 |
| 129 | Ga0070698_100112996 | 3300005471 | Bacteria | 2681 |
| 130 | Ga0070699_100004498 | 3300005518 | Bacteria | 12336 |
| 131 | Ga0070699_100008858 | 3300005518 | Bacteria | 8714 |
| 132 | Ga0070699_100009323 | 3300005518 | Bacteria | 8501 |
| 133 | Ga0070679_100000772 | 3300005530 | Bacteria | 27787 |
| 134 | Ga0070679_100001050 | 3300005530 | Bacteria | 24079 |
| 135 | Ga0070679_100011589 | 3300005530 | Bacteria | 8402 |
| 136 | Ga0070679_100012412 | 3300005530 | Bacteria | 8141 |
| 137 | Ga0070679_100032305 | 3300005530 | Bacteria | 5176 |
| 138 | Ga0070679_100045263 | 3300005530 | Bacteria | 4385 |
| 139 | Ga0070679_100212162 | 3300005530 | Unclassified | 1900 |
| 140 | Ga0070679_100261040 | 3300005530 | Bacteria | 1687 |
| 141 | Ga0070679_100532564 | 3300005530 | Bacteria | 1118 |
| 142 | Ga0070679_100652642 | 3300005530 | Bacteria | 995 |
| 143 | Ga0070684_100003911 | 3300005535 | Bacteria | 11285 |
| 144 | Ga0070684_100004027 | 3300005535 | Bacteria | 11119 |
| 145 | Ga0070684_100005252 | 3300005535 | Bacteria | 9911 |
| 146 | Ga0070684_100010947 | 3300005535 | Bacteria | 7210 |
| 147 | Ga0070684_100011827 | 3300005535 | Bacteria | 6965 |
| 148 | Ga0070684_100038477 | 3300005535 | Bacteria | 4109 |
| 149 | Ga0070684_100089480 | 3300005535 | Bacteria | 2736 |
| 150 | Ga0070684_100091007 | 3300005535 | Bacteria | 2713 |
| 151 | Ga0070684_100100588 | 3300005535 | Bacteria | 2582 |
| 152 | Ga0070684_100160255 | 3300005535 | Bacteria | 2041 |
| 153 | Ga0070684_100620762 | 3300005535 | Bacteria | 1006 |
| 154 | Ga0070684_100628709 | 3300005535 | Bacteria | 999 |
| 155 | Ga0070697_100003217 | 3300005536 | Bacteria | 12532 |
| 156 | Ga0070697_100026488 | 3300005536 | Bacteria | 4633 |
| 157 | Ga0070697_100045094 | 3300005536 | Bacteria | 3573 |
| 158 | Ga0068853_100008377 | 3300005539 | Bacteria | 8302 |
| 159 | Ga0068853_100184561 | 3300005539 | Bacteria | 1893 |
| 160 | Ga0070672_100027948 | 3300005543 | Bacteria | 4213 |
| 161 | Ga0070672_100030900 | 3300005543 | Bacteria | 4028 |
| 162 | Ga0070672_100049621 | 3300005543 | Bacteria | 3266 |
| 163 | Ga0070672_100052303 | 3300005543 | Bacteria | 3188 |
| 164 | Ga0070672_100519237 | 3300005543 | Bacteria | 1032 |
| 165 | Ga0070672_100843294 | 3300005543 | Bacteria | 808 |
| 166 | Ga0070686_100048541 | 3300005544 | Bacteria | 2690 |
| 167 | Ga0070686_100228275 | 3300005544 | Unclassified | 1349 |
| 168 | Ga0070695_100024915 | 3300005545 | Bacteria | 3690 |
| 169 | Ga0070695_100109486 | 3300005545 | Bacteria | 1872 |
| 170 | Ga0070695_100153888 | 3300005545 | Bacteria | 1607 |
| 171 | Ga0070695_100155628 | 3300005545 | Unclassified | 1599 |
| 172 | Ga0070696_100000113 | 3300005546 | Bacteria | 41571 |
| 173 | Ga0070696_100006443 | 3300005546 | Bacteria | 7853 |
| 174 | Ga0070696_100127985 | 3300005546 | Bacteria | 1845 |
| 175 | Ga0070696_100146867 | 3300005546 | Bacteria | 1728 |
| 176 | Ga0070693_100008367 | 3300005547 | Bacteria | 5096 |
| 177 | Ga0070665_100028248 | 3300005548 | Bacteria | 5650 |
| 178 | Ga0070704_100124498 | 3300005549 | Bacteria | 1986 |
| 179 | Ga0070704_100255778 | 3300005549 | Unclassified | 1440 |
| 180 | Ga0068855_100036976 | 3300005563 | Bacteria | 5809 |
| 181 | Ga0068855_100066073 | 3300005563 | Bacteria | 4216 |
| 182 | Ga0068855_100070607 | 3300005563 | Bacteria | 4063 |
| 183 | Ga0068855_100164028 | 3300005563 | Bacteria | 2520 |
| 184 | Ga0068855_100352241 | 3300005563 | Bacteria | 1622 |
| 185 | Ga0070664_100000995 | 3300005564 | Bacteria | 22203 |
| 186 | Ga0070664_100009674 | 3300005564 | Bacteria | 7822 |
| 187 | Ga0070664_100010051 | 3300005564 | Bacteria | 7671 |
| 188 | Ga0070664_100013873 | 3300005564 | Bacteria | 6569 |
| 189 | Ga0070664_100035511 | 3300005564 | Bacteria | 4185 |
| 190 | Ga0070664_100345046 | 3300005564 | Bacteria | 1353 |
| 191 | Ga0070664_100726061 | 3300005564 | Bacteria | 926 |
| 192 | Ga0068857_100003760 | 3300005577 | Bacteria | 12760 |
| 193 | Ga0068857_100016130 | 3300005577 | Bacteria | 6544 |
| 194 | Ga0068857_100024005 | 3300005577 | Bacteria | 5368 |
| 195 | Ga0068857_100210193 | 3300005577 | Bacteria | 1775 |
| 196 | Ga0068854_100074455 | 3300005578 | Bacteria | 2491 |
| 197 | Ga0068856_100023996 | 3300005614 | Bacteria | 5933 |
| 198 | Ga0068856_100036053 | 3300005614 | Bacteria | 4850 |
| 199 | Ga0068856_100335608 | 3300005614 | Unclassified | 1530 |
| 200 | Ga0070702_100002959 | 3300005615 | Bacteria | 7493 |
| 201 | Ga0070702_100013457 | 3300005615 | Bacteria | 4130 |
| 202 | Ga0068852_100045546 | 3300005616 | Bacteria | 3732 |
| 203 | Ga0068852_100065392 | 3300005616 | Bacteria | 3172 |
| 204 | Ga0068852_100107033 | 3300005616 | Bacteria | 2536 |
| 205 | Ga0068859_100050496 | 3300005617 | Bacteria | 4177 |
| 206 | Ga0068859_100090186 | 3300005617 | Bacteria | 3116 |
| 207 | Ga0068859_100113118 | 3300005617 | Bacteria | 2778 |
| 208 | Ga0068864_100375892 | 3300005618 | Bacteria | 1345 |
| 209 | Ga0068866_10045753 | 3300005718 | Bacteria | 2197 |
| 210 | Ga0068861_100000159 | 3300005719 | Bacteria | 35347 |
| 211 | Ga0068870_10014684 | 3300005840 | Bacteria | 3704 |
| 212 | Ga0068863_100007245 | 3300005841 | Bacteria | 10868 |
| 213 | Ga0068863_100190819 | 3300005841 | Bacteria | 1969 |
| 214 | Ga0068863_100227247 | 3300005841 | Bacteria | 1799 |
| 215 | Ga0068863_100401015 | 3300005841 | Bacteria | 1341 |
| 216 | Ga0068858_100012458 | 3300005842 | Bacteria | 8019 |
| 217 | Ga0068858_100056481 | 3300005842 | Bacteria | 3628 |
| 218 | Ga0068860_100022982 | 3300005843 | Bacteria | 6030 |
| 219 | Ga0068860_100038284 | 3300005843 | Bacteria | 4587 |
| 220 | Ga0068862_100011812 | 3300005844 | Bacteria | 7212 |
| 221 | Ga0068862_100198283 | 3300005844 | Unclassified | 1809 |
| 222 | Ga0081538_10030216 | 3300005981 | Bacteria | 3683 |
| 223 | Ga0081539_10000174 | 3300005985 | Bacteria | 151265 |
| 224 | Ga0070717_10034077 | 3300006028 | Bacteria | 4113 |
| 225 | Ga0070716_100087416 | 3300006173 | Unclassified | 1878 |
| 226 | Ga0070712_100014254 | 3300006175 | Bacteria | 5103 |
| 227 | Ga0070712_100018761 | 3300006175 | Bacteria | 4498 |
| 228 | Ga0070712_100118282 | 3300006175 | Bacteria | 1990 |
| 229 | Ga0070712_100219079 | 3300006175 | Bacteria | 1506 |
| 230 | Ga0097621_100047853 | 3300006237 | Bacteria | 3466 |
| 231 | Ga0068871_100092028 | 3300006358 | Bacteria | 2529 |
| 232 | Ga0075430_100003033 | 3300006846 | Bacteria | 14045 |
| 233 | Ga0075430_100116645 | 3300006846 | Bacteria | 2225 |
| 234 | Ga0075430_100286042 | 3300006846 | Bacteria | 1364 |
| 235 | Ga0075431_100005056 | 3300006847 | Bacteria | 12976 |
| 236 | Ga0075431_100013930 | 3300006847 | Bacteria | 8122 |
| 237 | Ga0075431_100236280 | 3300006847 | Bacteria | 1861 |
| 238 | Ga0075431_100302420 | 3300006847 | Bacteria | 1616 |
| 239 | Ga0075431_100504883 | 3300006847 | Bacteria | 1200 |
| 240 | Ga0075433_10149367 | 3300006852 | Bacteria | 2078 |
| 241 | Ga0075433_10300041 | 3300006852 | Bacteria | 1422 |
| 242 | Ga0075434_100077827 | 3300006871 | Bacteria | 3312 |
| 243 | Ga0075434_100296288 | 3300006871 | Bacteria | 1637 |
| 244 | Ga0075429_100009585 | 3300006880 | Bacteria | 8399 |
| 245 | Ga0075429_100024226 | 3300006880 | Bacteria | 5265 |
| 246 | Ga0068865_100031767 | 3300006881 | Bacteria | 3523 |
| 247 | Ga0075436_100005526 | 3300006914 | Bacteria | 8687 |
| 248 | Ga0075436_100015174 | 3300006914 | Bacteria | 5277 |
| 249 | Ga0075436_100071491 | 3300006914 | Bacteria | 2399 |
| 250 | Ga0075436_100188884 | 3300006914 | Bacteria | 1457 |
| 251 | Ga0097620_100050498 | 3300006931 | Bacteria | 4177 |
| 252 | Ga0097620_100090186 | 3300006931 | Bacteria | 3116 |
| 253 | Ga0097620_100113119 | 3300006931 | Bacteria | 2778 |
| 254 | Ga0075435_100012532 | 3300007076 | Bacteria | 6282 |
| 255 | Ga0075435_100130410 | 3300007076 | Bacteria | 2103 |
| 256 | Ga0075435_100284203 | 3300007076 | Bacteria | 1413 |
| 257 | Ga0099794_10000159 | 3300007265 | Bacteria | 24881 |
| 258 | Ga0111539_10078098 | 3300009094 | Bacteria | 3895 |
| 259 | Ga0111539_10187271 | 3300009094 | Bacteria | 2416 |
| 260 | Ga0111539_10215561 | 3300009094 | Bacteria | 2236 |
| 261 | Ga0111539_10330678 | 3300009094 | Bacteria | 1774 |
| 262 | Ga0105245_10001478 | 3300009098 | Bacteria | 21218 |
| 263 | Ga0105245_10049888 | 3300009098 | Bacteria | 3750 |
| 264 | Ga0105245_10111226 | 3300009098 | Bacteria | 2547 |
| 265 | Ga0105245_10195545 | 3300009098 | Bacteria | 1940 |
| 266 | Ga0105245_10289383 | 3300009098 | Unclassified | 1604 |
| 267 | Ga0105245_10302874 | 3300009098 | Bacteria | 1569 |
| 268 | Ga0105245_10558659 | 3300009098 | Bacteria | 1167 |
| 269 | Ga0105245_10584671 | 3300009098 | Bacteria | 1141 |
| 270 | Ga0105245_10862123 | 3300009098 | Bacteria | 946 |
| 271 | Ga0114129_10069432 | 3300009147 | Bacteria | 4911 |
| 272 | Ga0114129_10077699 | 3300009147 | Bacteria | 4617 |
| 273 | Ga0114129_10253321 | 3300009147 | Bacteria | 2362 |
| 274 | Ga0114129_10394119 | 3300009147 | Bacteria | 1826 |
| 275 | Ga0105243_10070943 | 3300009148 | Bacteria | 2815 |
| 276 | Ga0105241_10117056 | 3300009174 | Bacteria | 2141 |
| 277 | Ga0105241_10130184 | 3300009174 | Bacteria | 2036 |
| 278 | Ga0105242_10012697 | 3300009176 | Bacteria | 6487 |
| 279 | Ga0105242_10116505 | 3300009176 | Bacteria | 2286 |
| 280 | Ga0105242_10249134 | 3300009176 | Bacteria | 1600 |
| 281 | Ga0105248_10001272 | 3300009177 | Bacteria | 28205 |
| 282 | Ga0105248_10066259 | 3300009177 | Bacteria | 4055 |
| 283 | Ga0105248_10137998 | 3300009177 | Bacteria | 2751 |
| 284 | Ga0105248_10141219 | 3300009177 | Bacteria | 2717 |
| 285 | Ga0105248_10293326 | 3300009177 | Bacteria | 1831 |
| 286 | Ga0105248_10436503 | 3300009177 | Bacteria | 1475 |
| 287 | Ga0105237_10724320 | 3300009545 | Bacteria | 1001 |
| 288 | Ga0105238_10070208 | 3300009551 | Bacteria | 3503 |
| 289 | Ga0105238_10070936 | 3300009551 | Bacteria | 3482 |
| 290 | Ga0105238_10121138 | 3300009551 | Bacteria | 2595 |
| 291 | Ga0105249_10003084 | 3300009553 | Bacteria | 14378 |
| 292 | Ga0105239_10059094 | 3300010375 | Bacteria | 4208 |
| 293 | Ga0105246_10000522 | 3300011119 | Bacteria | 20988 |
| 294 | Ga0157373_10016038 | 3300013100 | Bacteria | 5468 |
| 295 | Ga0157373_10073716 | 3300013100 | Bacteria | 2409 |
| 296 | Ga0157373_10366933 | 3300013100 | Bacteria | 1028 |
| 297 | Ga0157371_10003449 | 3300013102 | Bacteria | 14344 |
| 298 | Ga0157371_10013563 | 3300013102 | Bacteria | 6187 |
| 299 | Ga0157371_10108983 | 3300013102 | Bacteria | 1965 |
| 300 | Ga0157370_10016785 | 3300013104 | Bacteria | 7405 |
| 301 | Ga0157370_10385153 | 3300013104 | Bacteria | 1291 |
| 302 | Ga0157369_10031048 | 3300013105 | Bacteria | 5888 |
| 303 | Ga0157369_10216558 | 3300013105 | Bacteria | 2006 |
| 304 | Ga0157369_10315757 | 3300013105 | Bacteria | 1625 |
| 305 | Ga0157369_10341386 | 3300013105 | Bacteria | 1556 |
| 306 | Ga0157369_10405202 | 3300013105 | Unclassified | 1415 |
| 307 | Ga0157369_10414241 | 3300013105 | Unclassified | 1397 |
| 308 | Ga0157369_10816155 | 3300013105 | Bacteria | 958 |
| 309 | Ga0157374_10006995 | 3300013296 | Bacteria | 9604 |
| 310 | Ga0157374_10588017 | 3300013296 | Bacteria | 1122 |
| 311 | Ga0157374_10597086 | 3300013296 | Bacteria | 1114 |
| 312 | Ga0157378_10385904 | 3300013297 | Bacteria | 1376 |
| 313 | Ga0157378_10690526 | 3300013297 | Bacteria | 1039 |
| 314 | Ga0163162_10001610 | 3300013306 | Bacteria | 21128 |
| 315 | Ga0163162_10415506 | 3300013306 | Bacteria | 1477 |
| 316 | Ga0157372_10020362 | 3300013307 | Bacteria | 7155 |
| 317 | Ga0157372_10021441 | 3300013307 | Bacteria | 6981 |
| 318 | Ga0157372_10033001 | 3300013307 | Bacteria | 5683 |
| 319 | Ga0157372_10042228 | 3300013307 | Bacteria | 5043 |
| 320 | Ga0157372_10043863 | 3300013307 | Bacteria | 4955 |
| 321 | Ga0157372_10102077 | 3300013307 | Bacteria | 3276 |
| 322 | Ga0157372_10154499 | 3300013307 | Bacteria | 2650 |
| 323 | Ga0157372_10269874 | 3300013307 | Bacteria | 1977 |
| 324 | Ga0157372_10373281 | 3300013307 | Unclassified | 1662 |
| 325 | Ga0157372_10674511 | 3300013307 | Bacteria | 1203 |
| 326 | Ga0157372_10693136 | 3300013307 | Bacteria | 1185 |
| 327 | Ga0157372_11146320 | 3300013307 | Bacteria | 899 |
| 328 | Ga0157375_10030709 | 3300013308 | Bacteria | 5070 |
| 329 | Ga0157375_10055591 | 3300013308 | Bacteria | 3903 |
| 330 | Ga0157375_10094530 | 3300013308 | Bacteria | 3058 |
| 331 | Ga0157375_10127136 | 3300013308 | Bacteria | 2665 |
| 332 | Ga0157375_10649265 | 3300013308 | Bacteria | 1211 |
| 333 | Ga0157375_10850113 | 3300013308 | Bacteria | 1059 |
| 334 | Ga0163163_10004113 | 3300014325 | Bacteria | 12404 |
| 335 | Ga0163163_10057127 | 3300014325 | Bacteria | 3858 |
| 336 | Ga0157380_10263785 | 3300014326 | Unclassified | 1566 |
| 337 | Ga0157377_10000600 | 3300014745 | Bacteria | 14949 |
| 338 | Ga0157377_10000911 | 3300014745 | Bacteria | 12337 |
| 339 | Ga0157379_10003764 | 3300014968 | Bacteria | 12911 |
| 340 | Ga0157376_10022494 | 3300014969 | Bacteria | 4917 |
| 341 | Ga0157376_10317585 | 3300014969 | Bacteria | 1480 |
| 342 | Ga0157376_10440972 | 3300014969 | Bacteria | 1268 |
| 343 | Ga0163161_10106386 | 3300017792 | Bacteria | 2093 |
| 344 | Ga0163161_10145557 | 3300017792 | Bacteria | 1797 |
| 345 | Ga0207653_10000193 | 3300025885 | Bacteria | 41936 |
| 346 | Ga0207653_10078437 | 3300025885 | Bacteria | 1139 |
| 347 | Ga0207682_10036039 | 3300025893 | Bacteria | 2001 |
| 348 | Ga0207692_10203057 | 3300025898 | Bacteria | 1166 |
| 349 | Ga0207642_10057020 | 3300025899 | Bacteria | 1795 |
| 350 | Ga0207710_10159040 | 3300025900 | Bacteria | 1099 |
| 351 | Ga0207688_10051685 | 3300025901 | Bacteria | 2302 |
| 352 | Ga0207647_10247599 | 3300025904 | Bacteria | 1023 |
| 353 | Ga0207685_10030110 | 3300025905 | Bacteria | 1929 |
| 354 | Ga0207699_10005806 | 3300025906 | Bacteria | 5939 |
| 355 | Ga0207699_10123914 | 3300025906 | Bacteria | 1675 |
| 356 | Ga0207699_10217058 | 3300025906 | Bacteria | 1304 |
| 357 | Ga0207645_10000126 | 3300025907 | Bacteria | 58037 |
| 358 | Ga0207645_10042462 | 3300025907 | Bacteria | 2909 |
| 359 | Ga0207643_10016451 | 3300025908 | Bacteria | 4035 |
| 360 | Ga0207643_10035541 | 3300025908 | Bacteria | 2794 |
| 361 | Ga0207705_10011135 | 3300025909 | Bacteria | 6519 |
| 362 | Ga0207705_10026485 | 3300025909 | Bacteria | 4135 |
| 363 | Ga0207705_10279039 | 3300025909 | Bacteria | 1279 |
| 364 | Ga0207684_10124054 | 3300025910 | Bacteria | 2216 |
| 365 | Ga0207684_10241536 | 3300025910 | Bacteria | 1558 |
| 366 | Ga0207684_10317139 | 3300025910 | Bacteria | 1344 |
| 367 | Ga0207654_10131702 | 3300025911 | Bacteria | 1583 |
| 368 | Ga0207707_10001370 | 3300025912 | Bacteria | 22592 |
| 369 | Ga0207707_10006243 | 3300025912 | Bacteria | 10409 |
| 370 | Ga0207707_10006657 | 3300025912 | Bacteria | 10079 |
| 371 | Ga0207707_10047510 | 3300025912 | Bacteria | 3738 |
| 372 | Ga0207707_10111930 | 3300025912 | Bacteria | 2387 |
| 373 | Ga0207707_10293253 | 3300025912 | Unclassified | 1407 |
| 374 | Ga0207693_10039227 | 3300025915 | Bacteria | 3729 |
| 375 | Ga0207693_10070454 | 3300025915 | Bacteria | 2736 |
| 376 | Ga0207663_10052611 | 3300025916 | Bacteria | 2541 |
| 377 | Ga0207663_10125158 | 3300025916 | Bacteria | 1767 |
| 378 | Ga0207663_10188239 | 3300025916 | Bacteria | 1480 |
| 379 | Ga0207660_10001337 | 3300025917 | Bacteria | 16493 |
| 380 | Ga0207660_10040194 | 3300025917 | Bacteria | 3273 |
| 381 | Ga0207660_10224299 | 3300025917 | Bacteria | 1476 |
| 382 | Ga0207660_10510744 | 3300025917 | Unclassified | 975 |
| 383 | Ga0207662_10019471 | 3300025918 | Bacteria | 3864 |
| 384 | Ga0207662_10028340 | 3300025918 | Bacteria | 3236 |
| 385 | Ga0207662_10043404 | 3300025918 | Bacteria | 2652 |
| 386 | Ga0207662_10053677 | 3300025918 | Bacteria | 2401 |
| 387 | Ga0207657_10002485 | 3300025919 | Bacteria | 19933 |
| 388 | Ga0207657_10033132 | 3300025919 | Bacteria | 4660 |
| 389 | Ga0207657_10526036 | 3300025919 | Bacteria | 925 |
| 390 | Ga0207649_10037927 | 3300025920 | Bacteria | 2915 |
| 391 | Ga0207649_10269162 | 3300025920 | Bacteria | 1234 |
| 392 | Ga0207649_10366602 | 3300025920 | Bacteria | 1070 |
| 393 | Ga0207652_10005794 | 3300025921 | Bacteria | 10023 |
| 394 | Ga0207652_10008992 | 3300025921 | Bacteria | 8050 |
| 395 | Ga0207652_10107967 | 3300025921 | Bacteria | 2466 |
| 396 | Ga0207652_10381888 | 3300025921 | Bacteria | 1271 |
| 397 | Ga0207652_10592518 | 3300025921 | Unclassified | 994 |
| 398 | Ga0207646_10027930 | 3300025922 | Bacteria | 5143 |
| 399 | Ga0207646_10074317 | 3300025922 | Bacteria | 3036 |
| 400 | Ga0207681_10012890 | 3300025923 | Bacteria | 5169 |
| 401 | Ga0207681_10453097 | 3300025923 | Bacteria | 1044 |
| 402 | Ga0207650_10148610 | 3300025925 | Bacteria | 1847 |
| 403 | Ga0207650_10190558 | 3300025925 | Bacteria | 1638 |
| 404 | Ga0207650_10193923 | 3300025925 | Bacteria | 1624 |
| 405 | Ga0207650_10230506 | 3300025925 | Bacteria | 1494 |
| 406 | Ga0207659_10023295 | 3300025926 | Bacteria | 4131 |
| 407 | Ga0207687_10026879 | 3300025927 | Bacteria | 3856 |
| 408 | Ga0207687_10124491 | 3300025927 | Unclassified | 1933 |
| 409 | Ga0207687_10127829 | 3300025927 | Bacteria | 1911 |
| 410 | Ga0207687_10214669 | 3300025927 | Bacteria | 1511 |
| 411 | Ga0207700_10000713 | 3300025928 | Bacteria | 19212 |
| 412 | Ga0207700_10012092 | 3300025928 | Bacteria | 5546 |
| 413 | Ga0207700_10157062 | 3300025928 | Bacteria | 1886 |
| 414 | Ga0207700_10166242 | 3300025928 | Bacteria | 1836 |
| 415 | Ga0207700_10199605 | 3300025928 | Bacteria | 1685 |
| 416 | Ga0207700_10321260 | 3300025928 | Unclassified | 1341 |
| 417 | Ga0207664_10003774 | 3300025929 | Bacteria | 10178 |
| 418 | Ga0207664_10120633 | 3300025929 | Bacteria | 2193 |
| 419 | Ga0207644_10492585 | 3300025931 | Bacteria | 1010 |
| 420 | Ga0207644_10628828 | 3300025931 | Bacteria | 892 |
| 421 | Ga0207690_10004856 | 3300025932 | Bacteria | 7929 |
| 422 | Ga0207690_10011490 | 3300025932 | Bacteria | 5292 |
| 423 | Ga0207690_10028632 | 3300025932 | Bacteria | 3532 |
| 424 | Ga0207690_10085243 | 3300025932 | Bacteria | 2217 |
| 425 | Ga0207706_10000360 | 3300025933 | Bacteria | 49293 |
| 426 | Ga0207706_10027041 | 3300025933 | Bacteria | 5131 |
| 427 | Ga0207706_10470777 | 3300025933 | Bacteria | 1086 |
| 428 | Ga0207686_10034664 | 3300025934 | Bacteria | 3022 |
| 429 | Ga0207686_10080842 | 3300025934 | Bacteria | 2120 |
| 430 | Ga0207686_10115623 | 3300025934 | Bacteria | 1817 |
| 431 | Ga0207686_10242766 | 3300025934 | Bacteria | 1312 |
| 432 | Ga0207670_10015237 | 3300025936 | Bacteria | 4587 |
| 433 | Ga0207670_10166131 | 3300025936 | Unclassified | 1651 |
| 434 | Ga0207669_10007595 | 3300025937 | Bacteria | 5029 |
| 435 | Ga0207669_10134138 | 3300025937 | Bacteria | 1707 |
| 436 | Ga0207665_10186041 | 3300025939 | Bacteria | 1507 |
| 437 | Ga0207691_10002534 | 3300025940 | Bacteria | 17853 |
| 438 | Ga0207691_10003202 | 3300025940 | Bacteria | 15965 |
| 439 | Ga0207691_10039995 | 3300025940 | Bacteria | 4336 |
| 440 | Ga0207691_10047980 | 3300025940 | Bacteria | 3916 |
| 441 | Ga0207691_10061922 | 3300025940 | Bacteria | 3397 |
| 442 | Ga0207691_10232467 | 3300025940 | Unclassified | 1596 |
| 443 | Ga0207711_10011146 | 3300025941 | Bacteria | 7471 |
| 444 | Ga0207711_10024832 | 3300025941 | Bacteria | 5028 |
| 445 | Ga0207711_10326655 | 3300025941 | Bacteria | 1418 |
| 446 | Ga0207711_10345965 | 3300025941 | Bacteria | 1376 |
| 447 | Ga0207711_10415405 | 3300025941 | Bacteria | 1251 |
| 448 | Ga0207689_10009951 | 3300025942 | Bacteria | 8201 |
| 449 | Ga0207661_10003744 | 3300025944 | Bacteria | 10594 |
| 450 | Ga0207661_10039887 | 3300025944 | Bacteria | 3688 |
| 451 | Ga0207661_10066666 | 3300025944 | Bacteria | 2925 |
| 452 | Ga0207661_10087859 | 3300025944 | Bacteria | 2583 |
| 453 | Ga0207661_10113031 | 3300025944 | Bacteria | 2300 |
| 454 | Ga0207661_10114042 | 3300025944 | Bacteria | 2291 |
| 455 | Ga0207661_10233346 | 3300025944 | Bacteria | 1630 |
| 456 | Ga0207661_10535090 | 3300025944 | Bacteria | 1072 |
| 457 | Ga0207661_10537887 | 3300025944 | Bacteria | 1069 |
| 458 | Ga0207661_10761917 | 3300025944 | Bacteria | 891 |
| 459 | Ga0207679_10004676 | 3300025945 | Bacteria | 8527 |
| 460 | Ga0207679_10018528 | 3300025945 | Bacteria | 4666 |
| 461 | Ga0207679_10034869 | 3300025945 | Bacteria | 3555 |
| 462 | Ga0207679_10090522 | 3300025945 | Unclassified | 2365 |
| 463 | Ga0207679_10242268 | 3300025945 | Bacteria | 1528 |
| 464 | Ga0207679_10308582 | 3300025945 | Bacteria | 1366 |
| 465 | Ga0207679_10570648 | 3300025945 | Bacteria | 1017 |
| 466 | Ga0207667_10035867 | 3300025949 | Bacteria | 5320 |
| 467 | Ga0207667_10114539 | 3300025949 | Bacteria | 2779 |
| 468 | Ga0207667_10278142 | 3300025949 | Bacteria | 1711 |
| 469 | Ga0207667_10306688 | 3300025949 | Bacteria | 1622 |
| 470 | Ga0207651_10256972 | 3300025960 | Bacteria | 1432 |
| 471 | Ga0207712_10002205 | 3300025961 | Bacteria | 12685 |
| 472 | Ga0207712_10118982 | 3300025961 | Bacteria | 1995 |
| 473 | Ga0207668_10014847 | 3300025972 | Bacteria | 4828 |
| 474 | Ga0207668_10098453 | 3300025972 | Bacteria | 2167 |
| 475 | Ga0207640_10150065 | 3300025981 | Unclassified | 1711 |
| 476 | Ga0207640_10782756 | 3300025981 | Bacteria | 825 |
| 477 | Ga0207658_10045091 | 3300025986 | Bacteria | 3213 |
| 478 | Ga0207658_10085411 | 3300025986 | Bacteria | 2431 |
| 479 | Ga0207658_10194708 | 3300025986 | Bacteria | 1688 |
| 480 | Ga0207658_10805954 | 3300025986 | Bacteria | 853 |
| 481 | Ga0207703_10276924 | 3300026035 | Unclassified | 1522 |
| 482 | Ga0207703_10719194 | 3300026035 | Bacteria | 950 |
| 483 | Ga0207703_10751796 | 3300026035 | Bacteria | 929 |
| 484 | Ga0207639_10163108 | 3300026041 | Bacteria | 1880 |
| 485 | Ga0207639_10538486 | 3300026041 | Bacteria | 1071 |
| 486 | Ga0207678_10008055 | 3300026067 | Bacteria | 9293 |
| 487 | Ga0207708_10048846 | 3300026075 | Bacteria | 3221 |
| 488 | Ga0207708_10245980 | 3300026075 | Bacteria | 1440 |
| 489 | Ga0207708_10383521 | 3300026075 | Bacteria | 1159 |
| 490 | Ga0207702_10011688 | 3300026078 | Bacteria | 7310 |
| 491 | Ga0207702_10026823 | 3300026078 | Bacteria | 4784 |
| 492 | Ga0207702_10274081 | 3300026078 | Unclassified | 1592 |
| 493 | Ga0207702_10374263 | 3300026078 | Bacteria | 1368 |
| 494 | Ga0207702_10544182 | 3300026078 | Bacteria | 1135 |
| 495 | Ga0207641_10038720 | 3300026088 | Bacteria | 3986 |
| 496 | Ga0207641_10046937 | 3300026088 | Bacteria | 3641 |
| 497 | Ga0207648_10027761 | 3300026089 | Bacteria | 5023 |
| 498 | Ga0207648_10434164 | 3300026089 | Bacteria | 1194 |
| 499 | Ga0207676_10023859 | 3300026095 | Bacteria | 4520 |
| 500 | Ga0207676_10079204 | 3300026095 | Bacteria | 2664 |
| 501 | Ga0207676_10450954 | 3300026095 | Bacteria | 1212 |
| 502 | Ga0207674_10000528 | 3300026116 | Bacteria | 50247 |
| 503 | Ga0207674_10002884 | 3300026116 | Bacteria | 21373 |
| 504 | Ga0207674_10013853 | 3300026116 | Bacteria | 8922 |
| 505 | Ga0207674_10043791 | 3300026116 | Bacteria | 4613 |
| 506 | Ga0207674_10045491 | 3300026116 | Bacteria | 4514 |
| 507 | Ga0207674_10117375 | 3300026116 | Bacteria | 2631 |
| 508 | Ga0207674_10420867 | 3300026116 | Bacteria | 1291 |
| 509 | Ga0207675_100004288 | 3300026118 | Bacteria | 13789 |
| 510 | Ga0207675_100410485 | 3300026118 | Bacteria | 1336 |
| 511 | Ga0207683_10555822 | 3300026121 | Bacteria | 1061 |
| 512 | Ga0207698_10027527 | 3300026142 | Bacteria | 4037 |
| 513 | Ga0207698_10179487 | 3300026142 | Bacteria | 1874 |
| 514 | Ga0207698_10201083 | 3300026142 | Bacteria | 1784 |
| 515 | Ga0207698_10217355 | 3300026142 | Bacteria | 1724 |
| 516 | Ga0268266_10072508 | 3300028379 | Unclassified | 2987 |
| 517 | Ga0268265_10046502 | 3300028380 | Bacteria | 3244 |
| 518 | Ga0268265_10209093 | 3300028380 | Bacteria | 1699 |
| 519 | Ga0268264_10269800 | 3300028381 | Bacteria | 1589 |
| 520 | Ga0268264_10343149 | 3300028381 | Unclassified | 1419 |
| 521 | Ga0265332_10011303 | 3300031238 | Bacteria | 3970 |
| 522 | Ga0265327_10021313 | 3300031251 | Bacteria | 3914 |
| 523 | Ga0307408_100003736 | 3300031548 | Bacteria | 10364 |
| 524 | Ga0265314_10029359 | 3300031711 | Bacteria | 4088 |
| 525 | Ga0307405_10155051 | 3300031731 | Bacteria | 1615 |
| 526 | Ga0307413_10018637 | 3300031824 | Bacteria | 3647 |
| 527 | Ga0307413_10099106 | 3300031824 | Bacteria | 1920 |
| 528 | Ga0307410_10034418 | 3300031852 | Bacteria | 3281 |
| 529 | Ga0307410_10049062 | 3300031852 | Bacteria | 2832 |
| 530 | Ga0307410_10064954 | 3300031852 | Bacteria | 2509 |
| 531 | Ga0307410_10093351 | 3300031852 | Bacteria | 2141 |
| 532 | Ga0307410_10203856 | 3300031852 | Bacteria | 1512 |
| 533 | Ga0307406_10015818 | 3300031901 | Bacteria | 4373 |
| 534 | Ga0307406_10411980 | 3300031901 | Bacteria | 1074 |
| 535 | Ga0307406_10541330 | 3300031901 | Unclassified | 951 |
| 536 | Ga0307407_10033836 | 3300031903 | Bacteria | 2792 |
| 537 | Ga0307407_10089403 | 3300031903 | Bacteria | 1884 |
| 538 | Ga0307409_100030031 | 3300031995 | Bacteria | 3899 |
| 539 | Ga0307409_100041124 | 3300031995 | Bacteria | 3449 |
| 540 | Ga0307409_100266064 | 3300031995 | Bacteria | 1576 |
| 541 | Ga0307416_100014279 | 3300032002 | Bacteria | 5434 |
| 542 | Ga0307416_100061123 | 3300032002 | Bacteria | 3072 |
| 543 | Ga0307416_100278572 | 3300032002 | Bacteria | 1647 |
| 544 | Ga0307414_10104544 | 3300032004 | Bacteria | 2139 |
| 545 | Ga0307414_10120693 | 3300032004 | Bacteria | 2015 |
| 546 | Ga0307414_10180513 | 3300032004 | Bacteria | 1697 |
| 547 | Ga0307411_10022852 | 3300032005 | Bacteria | 3692 |
| 548 | Ga0307411_10024423 | 3300032005 | Bacteria | 3603 |
| 549 | Ga0307411_10030446 | 3300032005 | Bacteria | 3308 |
| 550 | Ga0307411_10144154 | 3300032005 | Bacteria | 1760 |
| 551 | Ga0307415_100034660 | 3300032126 | Bacteria | 3289 |
| 552 | Ga0373926_0013037 | 3300035083 | Bacteria | 2815 |
| 553 | Ga0373934_0000378 | 3300035086 | Bacteria | 15598 |
| 554 | Ga0373934_0005214 | 3300035086 | Bacteria | 4807 |
| 555 | Ga0373940_0064287 | 3300035088 | Bacteria | 1056 |
| 556 | Ga0373944_0049828 | 3300035089 | Bacteria | 1317 |
| 557 | Ga0373949_0022087 | 3300035090 | Bacteria | 1465 |
| 558 | Ga0373945_0087275 | 3300035116 | Bacteria | 1203 |
| 559 | Ga0373954_0022269 | 3300035118 | Bacteria | 2873 |
| 560 | Ga0373954_0133729 | 3300035118 | Bacteria | 1208 |
| 561 | Ga0373956_0001784 | 3300035119 | Bacteria | 8872 |
| 562 | Ga0373957_0002283 | 3300035120 | Bacteria | 5437 |
| 563 | Ga0373943_0017013 | 3300035170 | Bacteria | 3325 |
| 564 | Ga0373943_0084416 | 3300035170 | Bacteria | 1634 |
| 565 | Ga0373955_0000478 | 3300035172 | Bacteria | 16904 |
| 566 | Ga0373955_0011131 | 3300035172 | Bacteria | 4275 |
| 567 | Ga0373955_0051117 | 3300035172 | Unclassified | 2250 |
| 568 | Ga0373931_0113494 | 3300035691 | Bacteria | 1540 |
| 569 | Ga0373931_0200410 | 3300035691 | Bacteria | 1192 |
| 570 | Ga0373935_0000974 | 3300035692 | Bacteria | 15538 |
| 571 | Ga0373935_0184745 | 3300035692 | Unclassified | 1433 |
| 572 | Ga0373935_0325947 | 3300035692 | Bacteria | 1091 |
| 573 | Ga0373927_0008745 | 3300035695 | Bacteria | 6801 |
| 574 | Ga0373927_0039757 | 3300035695 | Bacteria | 3053 |
| 575 | Ga0373927_0061501 | 3300035695 | Bacteria | 2429 |
| 576 | Ga0373933_0000033 | 3300035724 | Bacteria | 84415 |
| 577 | Ga0373933_0053316 | 3300035724 | Bacteria | 2422 |
| 578 | Ga0373947_0005801 | 3300035725 | Bacteria | 7198 |
| 579 | Ga0373947_0174908 | 3300035725 | Bacteria | 1395 |
| 580 | Ga0373937_0000158 | 3300036401 | Bacteria | 65505 |
| 581 | Ga0373937_0023307 | 3300036401 | Bacteria | 5572 |
| 582 | Ga0373937_0032620 | 3300036401 | Bacteria | 4724 |
| 583 | Ga0373937_0056784 | 3300036401 | Bacteria | 3596 |
| 584 | Ga0373937_0347028 | 3300036401 | Unclassified | 1406 |
| 585 | Ga0373925_0002081 | 3300037068 | Bacteria | 16453 |
| 586 | Ga0373925_0203206 | 3300037068 | Bacteria | 1576 |
| 587 | Ga0436365_0597434 | 3300039437 | Bacteria | 3269 |
| 588 | Ga0439439_0003899 | 3300041406 | Bacteria | 3322 |
| 589 | Ga0439439_0077261 | 3300041406 | Bacteria | 897 |
| 590 | Ga0439448_0021568 | 3300042005 | Unclassified | 1997 |
| 591 | Ga0439446_0072234 | 3300042156 | Bacteria | 1057 |
| 592 | Ga0439434_0030838 | 3300042435 | Bacteria | 1629 |
| 593 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 594 | Ga0451577_0753318 | 3300042876 | Unclassified | 881 |
| 595 | Ga0466969_0115206 | 3300044656 | Bacteria | 1255 |
| 596 | Ga0466963_0170513 | 3300044694 | Bacteria | 1517 |
| 597 | Ga0466959_0015951 | 3300045049 | Bacteria | 5482 |
| 598 | Ga0451576_0072473 | 3300045051 | Bacteria | 3584 |
| 599 | Ga0451576_0973722 | 3300045051 | Bacteria | 889 |
| 600 | Ga0466958_0353868 | 3300045836 | Bacteria | 946 |
| 601 | Ga0466967_0023654 | 3300045976 | Bacteria | 5039 |
| 602 | Ga0466967_0113180 | 3300045976 | Bacteria | 2496 |
| 603 | Ga0466967_0274661 | 3300045976 | Bacteria | 1616 |
| 604 | Ga0495592_0000976 | 3300046454 | Bacteria | 19849 |
| 605 | Ga0495603_0035019 | 3300046455 | Bacteria | 3017 |
| 606 | Ga0495629_0008985 | 3300046459 | Bacteria | 7334 |
| 607 | Ga0495629_0025272 | 3300046459 | Bacteria | 4224 |
| 608 | Ga0495629_0071754 | 3300046459 | Bacteria | 2417 |
| 609 | Ga0495629_0083200 | 3300046459 | Bacteria | 2234 |
| 610 | Ga0495629_0094913 | 3300046459 | Bacteria | 2081 |
| 611 | Ga0495629_0294261 | 3300046459 | Bacteria | 1112 |
| 612 | Ga0495651_0000893 | 3300046462 | Bacteria | 23203 |
| 613 | Ga0495651_0023586 | 3300046462 | Bacteria | 4784 |
| 614 | Ga0495651_0106142 | 3300046462 | Bacteria | 2082 |
| 615 | Ga0495653_0000173 | 3300046463 | Bacteria | 53365 |
| 616 | Ga0495653_0089320 | 3300046463 | Bacteria | 2258 |
| 617 | Ga0495580_0004972 | 3300046472 | Bacteria | 11106 |
| 618 | Ga0495580_0088355 | 3300046472 | Bacteria | 2158 |
| 619 | Ga0495582_0006104 | 3300046473 | Bacteria | 6709 |
| 620 | Ga0495582_0039838 | 3300046473 | Bacteria | 2586 |
| 621 | Ga0495582_0078363 | 3300046473 | Bacteria | 1833 |
| 622 | Ga0495639_0017395 | 3300046475 | Bacteria | 3122 |
| 623 | Ga0495639_0025008 | 3300046475 | Bacteria | 2631 |
| 624 | Ga0495662_0090359 | 3300046476 | Bacteria | 1493 |
| 625 | Ga0495662_0099135 | 3300046476 | Unclassified | 1425 |
| 626 | Ga0495664_0004103 | 3300046477 | Bacteria | 7951 |
| 627 | Ga0495664_0088709 | 3300046477 | Unclassified | 1859 |
| 628 | Ga0495594_0009845 | 3300046499 | Bacteria | 4953 |
| 629 | Ga0495594_0048806 | 3300046499 | Bacteria | 2326 |
| 630 | Ga0495594_0053371 | 3300046499 | Bacteria | 2226 |
| 631 | Ga0495594_0074959 | 3300046499 | Bacteria | 1886 |
| 632 | Ga0495608_0000763 | 3300046511 | Bacteria | 22518 |
| 633 | Ga0495608_0033340 | 3300046511 | Bacteria | 3481 |
| 634 | Ga0495618_0158090 | 3300046514 | Bacteria | 1446 |
| 635 | Ga0495628_0012681 | 3300046516 | Bacteria | 7099 |
| 636 | Ga0495628_0033195 | 3300046516 | Bacteria | 4162 |
| 637 | Ga0495628_0059929 | 3300046516 | Bacteria | 2987 |
| 638 | Ga0495628_0452550 | 3300046516 | Bacteria | 932 |
| 639 | Ga0495630_0007289 | 3300046517 | Bacteria | 7892 |
| 640 | Ga0495666_0033841 | 3300046526 | Bacteria | 2495 |
| 641 | Ga0495652_0003926 | 3300046529 | Bacteria | 14444 |
| 642 | Ga0495652_0008068 | 3300046529 | Bacteria | 9641 |
| 643 | Ga0495652_0024917 | 3300046529 | Bacteria | 5293 |
| 644 | Ga0495652_0260051 | 3300046529 | Bacteria | 1282 |
| 645 | Ga0495665_0000452 | 3300046531 | Bacteria | 20675 |
| 646 | Ga0495665_0010101 | 3300046531 | Bacteria | 5116 |
| 647 | Ga0495665_0011227 | 3300046531 | Bacteria | 4850 |
| 648 | Ga0495665_0037241 | 3300046531 | Bacteria | 2597 |
| 649 | Ga0495640_0037223 | 3300046533 | Bacteria | 3434 |
| 650 | Ga0495640_0098890 | 3300046533 | Unclassified | 1917 |
| 651 | Ga0495640_0337397 | 3300046533 | Bacteria | 932 |
| 652 | Ga0495586_0023036 | 3300046535 | Unclassified | 3325 |
| 653 | Ga0495586_0044200 | 3300046535 | Bacteria | 2399 |
| 654 | Ga0495586_0358524 | 3300046535 | Bacteria | 838 |
| 655 | Ga0495587_0001531 | 3300046536 | Bacteria | 15375 |
| 656 | Ga0495587_0001904 | 3300046536 | Bacteria | 13904 |
| 657 | Ga0495587_0002015 | 3300046536 | Bacteria | 13534 |
| 658 | Ga0495587_0015466 | 3300046536 | Bacteria | 4765 |
| 659 | Ga0495587_0138655 | 3300046536 | Bacteria | 1389 |
| 660 | Ga0495598_0018359 | 3300046537 | Bacteria | 1818 |
| 661 | Ga0495621_0065986 | 3300046539 | Bacteria | 1323 |
| 662 | Ga0495645_0000383 | 3300046543 | Bacteria | 30698 |
| 663 | Ga0495645_0000497 | 3300046543 | Bacteria | 27195 |
| 664 | Ga0495645_0061136 | 3300046543 | Bacteria | 2729 |
| 665 | Ga0495667_0000495 | 3300046559 | Bacteria | 25140 |
| 666 | Ga0495667_0001594 | 3300046559 | Bacteria | 15037 |
| 667 | Ga0495667_0015720 | 3300046559 | Bacteria | 5117 |
| 668 | Ga0495667_0212523 | 3300046559 | Bacteria | 1236 |
| 669 | Ga0495634_0156662 | 3300046642 | Unclassified | 1438 |
| 670 | Ga0495634_0391155 | 3300046642 | Bacteria | 827 |
| 671 | Ga0495635_0000120 | 3300046663 | Bacteria | 47330 |
| 672 | Ga0495635_0071741 | 3300046663 | Bacteria | 2374 |
| 673 | Ga0495635_0287120 | 3300046663 | Bacteria | 1105 |
| 674 | Ga0495635_0461804 | 3300046663 | Bacteria | 839 |
| 675 | Ga0495588_0002798 | 3300046674 | Bacteria | 7497 |
| 676 | Ga0495657_0000371 | 3300046675 | Bacteria | 41627 |
| 677 | Ga0495657_0040167 | 3300046675 | Bacteria | 3211 |
| 678 | Ga0495599_0000065 | 3300046678 | Bacteria | 72906 |
| 679 | Ga0495599_0002260 | 3300046678 | Bacteria | 11204 |
| 680 | Ga0495599_0108192 | 3300046678 | Bacteria | 1732 |
| 681 | Ga0495623_0000014 | 3300046679 | Bacteria | 119814 |
| 682 | Ga0495623_0004186 | 3300046679 | Bacteria | 9508 |
| 683 | Ga0495623_0062494 | 3300046679 | Bacteria | 2334 |
| 684 | Ga0495623_0140445 | 3300046679 | Bacteria | 1438 |
| 685 | Ga0495623_0165003 | 3300046679 | Bacteria | 1298 |
| 686 | Ga0495646_0000129 | 3300046680 | Bacteria | 38041 |
| 687 | Ga0495658_0000262 | 3300046683 | Bacteria | 29829 |
| 688 | Ga0495658_0031519 | 3300046683 | Bacteria | 2888 |
| 689 | Ga0495658_0191925 | 3300046683 | Bacteria | 1270 |
| 690 | Ga0495613_0006325 | 3300046689 | Bacteria | 8858 |
| 691 | Ga0495600_0000105 | 3300046809 | Bacteria | 46401 |
| 692 | Ga0495600_0020264 | 3300046809 | Bacteria | 4254 |
| 693 | Ga0495600_0026688 | 3300046809 | Bacteria | 3729 |
| 694 | Ga0495600_0271260 | 3300046809 | Bacteria | 1076 |
| 695 | Ga0495600_0350812 | 3300046809 | Bacteria | 924 |
| 696 | Ga0495581_0022559 | 3300047315 | Bacteria | 3648 |
| 697 | Ga0495581_0111186 | 3300047315 | Bacteria | 1593 |
| 698 | Ga0495604_0000359 | 3300047317 | Bacteria | 40820 |
| 699 | Ga0495604_0051132 | 3300047317 | Bacteria | 3205 |
| 700 | Ga0495674_0000362 | 3300047319 | Bacteria | 40383 |
| 701 | Ga0495674_0041917 | 3300047319 | Bacteria | 4086 |
| 702 | Ga0495672_0023597 | 3300047320 | Bacteria | 3980 |
| 703 | Ga0495680_0003175 | 3300047322 | Bacteria | 16358 |
| 704 | Ga0495680_0011402 | 3300047322 | Bacteria | 7868 |
| 705 | Ga0495680_0046385 | 3300047322 | Bacteria | 3427 |
| 706 | Ga0495680_0403211 | 3300047322 | Bacteria | 944 |
| 707 | Ga0495675_0000748 | 3300047444 | Bacteria | 20293 |
| 708 | Ga0495675_0023504 | 3300047444 | Bacteria | 3927 |
| 709 | Ga0495675_0045490 | 3300047444 | Bacteria | 2795 |
| 710 | Ga0495675_0098788 | 3300047444 | Bacteria | 1828 |
| 711 | Ga0495675_0334239 | 3300047444 | Bacteria | 894 |
| 712 | Ga0495684_0000288 | 3300047471 | Bacteria | 40827 |
| 713 | Ga0495684_0005125 | 3300047471 | Bacteria | 10225 |
| 714 | Ga0495684_0018431 | 3300047471 | Bacteria | 5378 |
| 715 | Ga0495593_0010392 | 3300047673 | Bacteria | 5381 |
| 716 | Ga0495602_0002905 | 3300048088 | Bacteria | 17568 |
| 717 | Ga0495602_0030782 | 3300048088 | Bacteria | 5085 |
| 718 | Ga0495602_0199776 | 3300048088 | Unclassified | 1526 |
| 719 | Ga0495602_0231674 | 3300048088 | Unclassified | 1387 |
| 720 | Ga0495614_0007574 | 3300048089 | Bacteria | 4831 |
| 721 | Ga0496101_0127898 | 3300048904 | Bacteria | 1927 |
| 722 | Ga0496102_0040439 | 3300048905 | Bacteria | 4218 |
| 723 | Ga0496102_0320942 | 3300048905 | Bacteria | 1459 |
| 724 | Ga0496104_0102392 | 3300048907 | Bacteria | 2743 |
| 725 | Ga0496104_0116285 | 3300048907 | Bacteria | 2566 |
| 726 | Ga0496104_0365743 | 3300048907 | Bacteria | 1355 |
| 727 | Ga0496104_0582615 | 3300048907 | Bacteria | 1029 |
| 728 | Ga0496105_0313801 | 3300048908 | Bacteria | 1258 |
| 729 | Ga0496105_0350510 | 3300048908 | Bacteria | 1179 |
| 730 | Ga0496108_0101549 | 3300048911 | Bacteria | 2454 |
| 731 | Ga0496108_0139713 | 3300048911 | Bacteria | 2087 |
| 732 | Ga0496108_0156687 | 3300048911 | Bacteria | 1967 |
| 733 | Ga0496108_0336327 | 3300048911 | Bacteria | 1317 |
| 734 | Ga0496109_0118555 | 3300048912 | Bacteria | 2464 |
| 735 | Ga0496109_0121547 | 3300048912 | Bacteria | 2433 |
| 736 | Ga0496112_0015971 | 3300048915 | Bacteria | 7019 |
| 737 | Ga0496112_0129628 | 3300048915 | Bacteria | 2493 |
| 738 | Ga0496112_0350850 | 3300048915 | Unclassified | 1418 |
| 739 | Ga0496113_0033639 | 3300048916 | Bacteria | 3735 |
| 740 | Ga0496113_0091728 | 3300048916 | Bacteria | 2342 |
| 741 | Ga0496114_0077847 | 3300048917 | Bacteria | 2797 |
| 742 | Ga0501299_013580 | 3300049522 | Bacteria | 1407 |
| 743 | Ga0501032_0219301 | 3300049569 | Bacteria | 1238 |
| 744 | Ga0501033_0004626 | 3300049570 | Bacteria | 11015 |
| 745 | Ga0501034_0098870 | 3300049571 | Bacteria | 2913 |
| 746 | Ga0501036_0123895 | 3300049572 | Bacteria | 2183 |
| 747 | Ga0501038_0045327 | 3300049574 | Bacteria | 3818 |
| 748 | Ga0501038_0364306 | 3300049574 | Bacteria | 1124 |
| 749 | Ga0501039_0123640 | 3300049575 | Bacteria | 2029 |
| 750 | Ga0501039_0190987 | 3300049575 | Bacteria | 1610 |
| 751 | Ga0501040_0035689 | 3300049576 | Bacteria | 3373 |
| 752 | Ga0501040_0173680 | 3300049576 | Bacteria | 1526 |
| 753 | Ga0501040_0190484 | 3300049576 | Bacteria | 1455 |
| 754 | Ga0501041_0100478 | 3300049577 | Bacteria | 1790 |
| 755 | Ga0501043_0013304 | 3300049579 | Bacteria | 6435 |
| 756 | Ga0501047_0011463 | 3300049581 | Bacteria | 8390 |
| 757 | Ga0501047_0092525 | 3300049581 | Bacteria | 2902 |
| 758 | Ga0501047_0348014 | 3300049581 | Bacteria | 1319 |
| 759 | Ga0501048_0056808 | 3300049582 | Bacteria | 2777 |
| 760 | Ga0501048_0058107 | 3300049582 | Bacteria | 2742 |
| 761 | Ga0501048_0117578 | 3300049582 | Bacteria | 1878 |
| 762 | Ga0501070_0061189 | 3300049586 | Bacteria | 3120 |
| 763 | Ga0501070_0311122 | 3300049586 | Bacteria | 1282 |
| 764 | Ga0501071_0349316 | 3300049587 | Bacteria | 1125 |
| 765 | Ga0501074_0343817 | 3300049590 | Bacteria | 1059 |
| 766 | Ga0501075_0201423 | 3300049591 | Bacteria | 1518 |
| 767 | Ga0501076_0030374 | 3300049592 | Bacteria | 4209 |
| 768 | Ga0501076_0489775 | 3300049592 | Bacteria | 1013 |
| 769 | Ga0501077_0003877 | 3300049593 | Bacteria | 9010 |
| 770 | Ga0501077_0187994 | 3300049593 | Bacteria | 1312 |
| 771 | Ga0501209_068075 | 3300049656 | Bacteria | 1008 |
| 772 | Ga0501239_005348 | 3300049672 | Bacteria | 1291 |
| 773 | Ga0501257_050280 | 3300049686 | Bacteria | 1038 |
| 774 | Ga0501260_011818 | 3300049689 | Bacteria | 887 |
| 775 | Ga0501221_005288 | 3300049704 | Bacteria | 2154 |
| 776 | Ga0501079_0083353 | 3300049741 | Bacteria | 2473 |
| 777 | Ga0501080_0038756 | 3300049742 | Bacteria | 4448 |
| 778 | Ga0501080_0059324 | 3300049742 | Bacteria | 3561 |
| 779 | Ga0501080_0146207 | 3300049742 | Bacteria | 2185 |
| 780 | Ga0501080_0333320 | 3300049742 | Bacteria | 1372 |
| 781 | Ga0501081_0052927 | 3300049743 | Bacteria | 2802 |
| 782 | Ga0501081_0186813 | 3300049743 | Bacteria | 1500 |
| 783 | Ga0501272_001698 | 3300049769 | Bacteria | 2118 |
| 784 | Ga0501035_0216551 | 3300049822 | Bacteria | 1637 |
| 785 | Ga0501035_0349158 | 3300049822 | Bacteria | 1238 |
| 786 | Ga0501044_0072931 | 3300049823 | Bacteria | 3490 |
| 787 | Ga0501044_0356941 | 3300049823 | Bacteria | 1380 |
| 788 | Ga0501045_0003041 | 3300049824 | Bacteria | 11472 |
| 789 | Ga0501045_0106883 | 3300049824 | Bacteria | 2074 |
| 790 | nmdc:mga05p37_132137_c1 | 3300050507 | Bacteria | 3062 |
| 791 | nmdc:mga05p37_155826_c1 | 3300050507 | Bacteria | 2791 |
| 792 | nmdc:mga05p37_165045_c1 | 3300050507 | Bacteria | 2703 |
| 793 | nmdc:mga05p37_326868_c1 | 3300050507 | Bacteria | 1813 |
| 794 | nmdc:mga09592_99531_c1 | 3300050508 | Bacteria | 2489 |
| 795 | nmdc:mga0qj67_3500_c1 | 3300050509 | Bacteria | 11323 |
| 796 | nmdc:mga06r32_120099_c1 | 3300050510 | Bacteria | 2592 |
| 797 | nmdc:mga06r32_157808_c1 | 3300050510 | Bacteria | 2251 |
| 798 | nmdc:mga06r32_447519_c1 | 3300050510 | Bacteria | 1271 |
| 799 | nmdc:mga06r32_46765_c1 | 3300050510 | Bacteria | 4129 |
| 800 | nmdc:mga06r32_580153_c1 | 3300050510 | Bacteria | 1093 |
| 801 | nmdc:mga08y16_284411_c1 | 3300050511 | Bacteria | 1705 |
| 802 | nmdc:mga08y16_390941_c1 | 3300050511 | Unclassified | 1425 |
| 803 | nmdc:mga08y16_663077_c1 | 3300050511 | Unclassified | 1046 |
| 804 | nmdc:mga0n895_140891_c1 | 3300050512 | Bacteria | 2440 |
| 805 | nmdc:mga0n895_166893_c1 | 3300050512 | Bacteria | 2233 |
| 806 | nmdc:mga0n895_34022_c1 | 3300050512 | Bacteria | 4902 |
| 807 | nmdc:mga0n895_4228_c1 | 3300050512 | Bacteria | 11738 |
| 808 | nmdc:mga0n895_48315_c1 | 3300050512 | Bacteria | 4164 |
| 809 | nmdc:mga0n895_7448_c1 | 3300050512 | Bacteria | 9394 |
| 810 | nmdc:mga0rr50_18724_c1 | 3300050513 | Bacteria | 4658 |
| 811 | nmdc:mga0rr50_1947_c1 | 3300050513 | Bacteria | 11457 |
| 812 | nmdc:mga0rr50_219465_c1 | 3300050513 | Bacteria | 1570 |
| 813 | nmdc:mga0rr50_241941_c1 | 3300050513 | Bacteria | 1496 |
| 814 | nmdc:mga0rr50_63277_c1 | 3300050513 | Bacteria | 2794 |
| 815 | nmdc:mga08x19_11135_c1 | 3300050514 | Bacteria | 5414 |
| 816 | nmdc:mga08x19_352268_c1 | 3300050514 | Bacteria | 1028 |
| 817 | nmdc:mga0a205_111874_c1 | 3300050515 | Bacteria | 2630 |
| 818 | nmdc:mga0a205_545693_c1 | 3300050515 | Eukaryota | 1015 |
| 819 | Ga0495601_0001013 | 3300053077 | Bacteria | 15368 |
| 820 | Ga0495612_0000636 | 3300053078 | Bacteria | 14100 |
| 821 | Ga0495595_0026591 | 3300053084 | Bacteria | 2572 |
| 822 | Ga0495595_0069728 | 3300053084 | Bacteria | 1660 |
| 823 | Ga0495595_0190320 | 3300053084 | Bacteria | 1020 |
| 824 | Ga0495619_0001764 | 3300053085 | Bacteria | 14393 |
| 825 | Ga0495619_0234348 | 3300053085 | Bacteria | 1272 |
| 826 | Ga0501084_0006948 | 3300054114 | Bacteria | 9322 |
| 827 | Ga0501084_0016560 | 3300054114 | Bacteria | 6121 |
| 828 | Ga0501084_0066227 | 3300054114 | Bacteria | 3022 |
| 829 | Ga0501084_0211651 | 3300054114 | Bacteria | 1636 |
| 830 | Ga0590074_025282 | 3300059423 | Bacteria | 1034 |
| 831 | Ga0590075_010266 | 3300059424 | Bacteria | 2253 |
| 832 | Ga0590077_033794 | 3300059426 | Bacteria | 1123 |
| 833 | Ga0501082_0012266 | 3300060353 | Bacteria | 7366 |
| 834 | Ga0501082_0052736 | 3300060353 | Bacteria | 3506 |
| 835 | Ga0501082_0074105 | 3300060353 | Bacteria | 2932 |
| 836 | Ga0501082_0679953 | 3300060353 | Unclassified | 901 |
| 837 | Ga0466962_0251786 | 3300061719 | Bacteria | 868 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005330 | Ga0070690_100074670 | Ga0070690_1000746702 | 232 |
| 2 | 3300005345 | Ga0070692_10208081 | Ga0070692_102080812 | 232 |
| 3 | 3300005438 | Ga0070701_10002580 | Ga0070701_100025803 | 232 |
| 4 | 3300005459 | Ga0068867_100047606 | Ga0068867_1000476063 | 232 |
| 5 | 3300005544 | Ga0070686_100048541 | Ga0070686_1000485412 | 232 |
| 6 | 3300005546 | Ga0070696_100146867 | Ga0070696_1001468672 | 232 |
| 7 | 3300005549 | Ga0070704_100124498 | Ga0070704_1001244982 | 232 |
| 8 | 3300005615 | Ga0070702_100013457 | Ga0070702_1000134571 | 232 |
| 9 | 3300009094 | Ga0111539_10330678 | Ga0111539_103306782 | 232 |
| 10 | 3300009098 | Ga0105245_10584671 | Ga0105245_105846712 | 232 |
| 11 | 3300049591 | Ga0501075_0201423 | Ga0501075_0201423_469_1221 | 232 |
| 12 | 3300054114 | Ga0501084_0211651 | Ga0501084_0211651_234_986 | 232 |
| 13 | 3300005406 | Ga0070703_10039499 | Ga0070703_100394992 | 235 |
| 14 | 3300005440 | Ga0070705_100027043 | Ga0070705_1000270432 | 235 |
| 15 | 3300005444 | Ga0070694_100125301 | Ga0070694_1001253012 | 235 |
| 16 | 3300005445 | Ga0070708_100084310 | Ga0070708_1000843102 | 235 |
| 17 | 3300005467 | Ga0070706_100028449 | Ga0070706_1000284494 | 235 |
| 18 | 3300005471 | Ga0070698_100015560 | Ga0070698_1000155606 | 235 |
| 19 | 3300005545 | Ga0070695_100109486 | Ga0070695_1001094862 | 235 |
| 20 | 3300005549 | Ga0070704_100255778 | Ga0070704_1002557782 | 235 |
| 21 | 3300006175 | Ga0070712_100118282 | Ga0070712_1001182822 | 235 |
| 22 | 3300025885 | Ga0207653_10078437 | Ga0207653_100784372 | 235 |
| 23 | 3300025905 | Ga0207685_10030110 | Ga0207685_100301103 | 235 |
| 24 | 3300025910 | Ga0207684_10241536 | Ga0207684_102415362 | 235 |
| 25 | 3300025922 | Ga0207646_10027930 | Ga0207646_100279303 | 235 |
| 26 | 3300049575 | Ga0501039_0190987 | Ga0501039_0190987_827_1579 | 235 |
| 27 | 3300006871 | Ga0075434_100077827 | Ga0075434_1000778273 | 236 |
| 28 | 3300006914 | Ga0075436_100005526 | Ga0075436_1000055266 | 236 |
| 29 | 3300050512 | nmdc:mga0n895_4228_c1 | nmdc:mga0n895_4228_c1_4604_5356 | 236 |
| 30 | 3300050513 | nmdc:mga0rr50_18724_c1 | nmdc:mga0rr50_18724_c1_388_1140 | 236 |
| 31 | 3300050514 | nmdc:mga08x19_11135_c1 | nmdc:mga08x19_11135_c1_1222_1974 | 236 |
| 32 | 3300005546 | Ga0070696_100127985 | Ga0070696_1001279851 | 237 |
| 33 | 3300032002 | Ga0307416_100014279 | Ga0307416_1000142795 | 237 |
| 34 | 3300049656 | Ga0501209_068075 | Ga0501209_068075_169_882 | 237 |
| 35 | 3300049672 | Ga0501239_005348 | Ga0501239_005348_340_1053 | 237 |
| 36 | 3300049686 | Ga0501257_050280 | Ga0501257_050280_30_743 | 237 |
| 37 | 3300049704 | Ga0501221_005288 | Ga0501221_005288_105_818 | 237 |
| 38 | 3300049769 | Ga0501272_001698 | Ga0501272_001698_1130_1843 | 237 |
| 39 | 3300006847 | Ga0075431_100236280 | Ga0075431_1002362802 | 238 |
| 40 | 3300041406 | Ga0439439_0077261 | Ga0439439_0077261_29_745 | 238 |
| 41 | 3300046476 | Ga0495662_0090359 | Ga0495662_0090359_749_1465 | 238 |
| 42 | 3300049576 | Ga0501040_0035689 | Ga0501040_0035689_2647_3363 | 238 |
| 43 | 3300049582 | Ga0501048_0056808 | Ga0501048_0056808_96_812 | 238 |
| 44 | 3300049582 | Ga0501048_0058107 | Ga0501048_0058107_1095_1811 | 238 |
| 45 | 3300049587 | Ga0501071_0349316 | Ga0501071_0349316_281_997 | 238 |
| 46 | 3300049592 | Ga0501076_0489775 | Ga0501076_0489775_65_781 | 238 |
| 47 | 3300049689 | Ga0501260_011818 | Ga0501260_011818_116_832 | 238 |
| 48 | 3300049741 | Ga0501079_0083353 | Ga0501079_0083353_18_734 | 238 |
| 49 | 3300049742 | Ga0501080_0059324 | Ga0501080_0059324_250_966 | 238 |
| 50 | 3300049742 | Ga0501080_0146207 | Ga0501080_0146207_1275_1991 | 238 |
| 51 | 3300049824 | Ga0501045_0003041 | Ga0501045_0003041_3020_3736 | 238 |
| 52 | 3300050510 | nmdc:mga06r32_447519_c1 | nmdc:mga06r32_447519_c1_509_1225 | 238 |
| 53 | 3300050512 | nmdc:mga0n895_140891_c1 | nmdc:mga0n895_140891_c1_11_727 | 238 |
| 54 | 3300054114 | Ga0501084_0006948 | Ga0501084_0006948_939_1655 | 238 |
| 55 | 3300060353 | Ga0501082_0012266 | Ga0501082_0012266_5869_6585 | 238 |
| 56 | 3300009176 | Ga0105242_10249134 | Ga0105242_102491342 | 239 |
| 57 | 3300005518 | Ga0070699_100008858 | Ga0070699_1000088589 | 241 |
| 58 | 3300005445 | Ga0070708_100058288 | Ga0070708_1000582882 | 242 |
| 59 | 3300005471 | Ga0070698_100001280 | Ga0070698_1000012803 | 244 |
| 60 | 3300005518 | Ga0070699_100004498 | Ga0070699_1000044982 | 244 |
| 61 | 3300025922 | Ga0207646_10074317 | Ga0207646_100743172 | 244 |
| 62 | 3300026075 | Ga0207708_10383521 | Ga0207708_103835211 | 244 |
| 63 | 3300060353 | Ga0501082_0679953 | Ga0501082_0679953_82_822 | 245 |
| 64 | 3300005471 | Ga0070698_100112996 | Ga0070698_1001129962 | 249 |
| 65 | 3300009147 | Ga0114129_10394119 | Ga0114129_103941192 | 249 |
| 66 | 3300031824 | Ga0307413_10018637 | Ga0307413_100186373 | 249 |
| 67 | 3300031852 | Ga0307410_10034418 | Ga0307410_100344182 | 249 |
| 68 | 3300031852 | Ga0307410_10049062 | Ga0307410_100490623 | 249 |
| 69 | 3300031852 | Ga0307410_10064954 | Ga0307410_100649542 | 249 |
| 70 | 3300031903 | Ga0307407_10033836 | Ga0307407_100338363 | 249 |
| 71 | 3300031903 | Ga0307407_10089403 | Ga0307407_100894032 | 249 |
| 72 | 3300031995 | Ga0307409_100030031 | Ga0307409_1000300314 | 249 |
| 73 | 3300031995 | Ga0307409_100041124 | Ga0307409_1000411243 | 249 |
| 74 | 3300032002 | Ga0307416_100061123 | Ga0307416_1000611232 | 249 |
| 75 | 3300032004 | Ga0307414_10104544 | Ga0307414_101045442 | 249 |
| 76 | 3300032005 | Ga0307411_10022852 | Ga0307411_100228524 | 249 |
| 77 | 3300032005 | Ga0307411_10030446 | Ga0307411_100304462 | 249 |
| 78 | 3300032005 | Ga0307411_10144154 | Ga0307411_101441542 | 249 |
| 79 | 3300032126 | Ga0307415_100034660 | Ga0307415_1000346603 | 249 |
| 80 | 3300035088 | Ga0373940_0064287 | Ga0373940_0064287_122_871 | 249 |
| 81 | 3300035090 | Ga0373949_0022087 | Ga0373949_0022087_195_944 | 249 |
| 82 | 3300035691 | Ga0373931_0113494 | Ga0373931_0113494_781_1530 | 249 |
| 83 | 3300042156 | Ga0439446_0072234 | Ga0439446_0072234_272_1042 | 249 |
| 84 | 3300048917 | Ga0496114_0077847 | Ga0496114_0077847_507_1256 | 249 |
| 85 | 3300005293 | Ga0065715_10209515 | Ga0065715_102095152 | 250 |
| 86 | 3300005327 | Ga0070658_10007057 | Ga0070658_100070573 | 250 |
| 87 | 3300005327 | Ga0070658_10020907 | Ga0070658_100209072 | 250 |
| 88 | 3300005327 | Ga0070658_10227287 | Ga0070658_102272871 | 250 |
| 89 | 3300005328 | Ga0070676_10011596 | Ga0070676_100115962 | 250 |
| 90 | 3300005329 | Ga0070683_100000171 | Ga0070683_10000017124 | 250 |
| 91 | 3300005329 | Ga0070683_100000440 | Ga0070683_10000044023 | 250 |
| 92 | 3300005329 | Ga0070683_100006205 | Ga0070683_1000062053 | 250 |
| 93 | 3300005329 | Ga0070683_100010918 | Ga0070683_1000109183 | 250 |
| 94 | 3300005329 | Ga0070683_100048552 | Ga0070683_1000485524 | 250 |
| 95 | 3300005329 | Ga0070683_100049271 | Ga0070683_1000492711 | 250 |
| 96 | 3300005329 | Ga0070683_100074501 | Ga0070683_1000745013 | 250 |
| 97 | 3300005329 | Ga0070683_100075540 | Ga0070683_1000755403 | 250 |
| 98 | 3300005329 | Ga0070683_100098251 | Ga0070683_1000982513 | 250 |
| 99 | 3300005329 | Ga0070683_100108253 | Ga0070683_1001082532 | 250 |
| 100 | 3300005330 | Ga0070690_100008925 | Ga0070690_1000089253 | 250 |
| 101 | 3300005330 | Ga0070690_100055174 | Ga0070690_1000551741 | 250 |
| 102 | 3300005330 | Ga0070690_100073397 | Ga0070690_1000733972 | 250 |
| 103 | 3300005330 | Ga0070690_100120948 | Ga0070690_1001209482 | 250 |
| 104 | 3300005331 | Ga0070670_100007041 | Ga0070670_1000070419 | 250 |
| 105 | 3300005331 | Ga0070670_100007905 | Ga0070670_1000079057 | 250 |
| 106 | 3300005331 | Ga0070670_100150990 | Ga0070670_1001509902 | 250 |
| 107 | 3300005331 | Ga0070670_100385940 | Ga0070670_1003859402 | 250 |
| 108 | 3300005331 | Ga0070670_100489284 | Ga0070670_1004892842 | 250 |
| 109 | 3300005334 | Ga0068869_100009371 | Ga0068869_1000093713 | 250 |
| 110 | 3300005334 | Ga0068869_100033861 | Ga0068869_1000338612 | 250 |
| 111 | 3300005335 | Ga0070666_10079426 | Ga0070666_100794262 | 250 |
| 112 | 3300005336 | Ga0070680_100000733 | Ga0070680_10000073317 | 250 |
| 113 | 3300005336 | Ga0070680_100004315 | Ga0070680_1000043153 | 250 |
| 114 | 3300005336 | Ga0070680_100046151 | Ga0070680_1000461513 | 250 |
| 115 | 3300005336 | Ga0070680_100065117 | Ga0070680_1000651172 | 250 |
| 116 | 3300005338 | Ga0068868_100006090 | Ga0068868_1000060903 | 250 |
| 117 | 3300005339 | Ga0070660_100003841 | Ga0070660_1000038416 | 250 |
| 118 | 3300005339 | Ga0070660_100017277 | Ga0070660_1000172772 | 250 |
| 119 | 3300005339 | Ga0070660_100017406 | Ga0070660_1000174062 | 250 |
| 120 | 3300005339 | Ga0070660_100160829 | Ga0070660_1001608291 | 250 |
| 121 | 3300005340 | Ga0070689_100003002 | Ga0070689_1000030023 | 250 |
| 122 | 3300005340 | Ga0070689_100003984 | Ga0070689_1000039842 | 250 |
| 123 | 3300005340 | Ga0070689_100066588 | Ga0070689_1000665882 | 250 |
| 124 | 3300005340 | Ga0070689_100108048 | Ga0070689_1001080482 | 250 |
| 125 | 3300005341 | Ga0070691_10002628 | Ga0070691_100026286 | 250 |
| 126 | 3300005343 | Ga0070687_100047025 | Ga0070687_1000470252 | 250 |
| 127 | 3300005344 | Ga0070661_100000331 | Ga0070661_10000033117 | 250 |
| 128 | 3300005345 | Ga0070692_10022338 | Ga0070692_100223383 | 250 |
| 129 | 3300005345 | Ga0070692_10022639 | Ga0070692_100226391 | 250 |
| 130 | 3300005347 | Ga0070668_100024896 | Ga0070668_1000248964 | 250 |
| 131 | 3300005347 | Ga0070668_100068765 | Ga0070668_1000687652 | 250 |
| 132 | 3300005353 | Ga0070669_100078097 | Ga0070669_1000780972 | 250 |
| 133 | 3300005353 | Ga0070669_100212749 | Ga0070669_1002127492 | 250 |
| 134 | 3300005354 | Ga0070675_100001364 | Ga0070675_1000013645 | 250 |
| 135 | 3300005354 | Ga0070675_100011838 | Ga0070675_1000118386 | 250 |
| 136 | 3300005354 | Ga0070675_100012790 | Ga0070675_1000127902 | 250 |
| 137 | 3300005354 | Ga0070675_100051961 | Ga0070675_1000519612 | 250 |
| 138 | 3300005354 | Ga0070675_100151507 | Ga0070675_1001515072 | 250 |
| 139 | 3300005354 | Ga0070675_100410378 | Ga0070675_1004103782 | 250 |
| 140 | 3300005355 | Ga0070671_100053238 | Ga0070671_1000532384 | 250 |
| 141 | 3300005355 | Ga0070671_100643229 | Ga0070671_1006432291 | 250 |
| 142 | 3300005356 | Ga0070674_100143652 | Ga0070674_1001436522 | 250 |
| 143 | 3300005356 | Ga0070674_100207520 | Ga0070674_1002075202 | 250 |
| 144 | 3300005356 | Ga0070674_100219437 | Ga0070674_1002194372 | 250 |
| 145 | 3300005356 | Ga0070674_100475815 | Ga0070674_1004758151 | 250 |
| 146 | 3300005364 | Ga0070673_100201070 | Ga0070673_1002010701 | 250 |
| 147 | 3300005364 | Ga0070673_100275313 | Ga0070673_1002753132 | 250 |
| 148 | 3300005365 | Ga0070688_100011427 | Ga0070688_1000114273 | 250 |
| 149 | 3300005365 | Ga0070688_100083716 | Ga0070688_1000837163 | 250 |
| 150 | 3300005366 | Ga0070659_100003745 | Ga0070659_10000374510 | 250 |
| 151 | 3300005366 | Ga0070659_100019870 | Ga0070659_1000198702 | 250 |
| 152 | 3300005366 | Ga0070659_100035374 | Ga0070659_1000353743 | 250 |
| 153 | 3300005366 | Ga0070659_100092186 | Ga0070659_1000921862 | 250 |
| 154 | 3300005367 | Ga0070667_100027832 | Ga0070667_1000278324 | 250 |
| 155 | 3300005367 | Ga0070667_100387295 | Ga0070667_1003872952 | 250 |
| 156 | 3300005367 | Ga0070667_100396394 | Ga0070667_1003963942 | 250 |
| 157 | 3300005406 | Ga0070703_10000558 | Ga0070703_100005582 | 250 |
| 158 | 3300005434 | Ga0070709_10001756 | Ga0070709_100017563 | 250 |
| 159 | 3300005434 | Ga0070709_10009907 | Ga0070709_100099073 | 250 |
| 160 | 3300005434 | Ga0070709_10032503 | Ga0070709_100325032 | 250 |
| 161 | 3300005435 | Ga0070714_100003987 | Ga0070714_1000039874 | 250 |
| 162 | 3300005435 | Ga0070714_100096712 | Ga0070714_1000967122 | 250 |
| 163 | 3300005436 | Ga0070713_100000149 | Ga0070713_10000014926 | 250 |
| 164 | 3300005436 | Ga0070713_100010992 | Ga0070713_1000109924 | 250 |
| 165 | 3300005436 | Ga0070713_100029513 | Ga0070713_1000295135 | 250 |
| 166 | 3300005436 | Ga0070713_100046876 | Ga0070713_1000468762 | 250 |
| 167 | 3300005436 | Ga0070713_100331951 | Ga0070713_1003319511 | 250 |
| 168 | 3300005437 | Ga0070710_10124963 | Ga0070710_101249632 | 250 |
| 169 | 3300005438 | Ga0070701_10010767 | Ga0070701_100107672 | 250 |
| 170 | 3300005439 | Ga0070711_100143458 | Ga0070711_1001434582 | 250 |
| 171 | 3300005439 | Ga0070711_100151770 | Ga0070711_1001517702 | 250 |
| 172 | 3300005440 | Ga0070705_100017142 | Ga0070705_1000171422 | 250 |
| 173 | 3300005440 | Ga0070705_100042485 | Ga0070705_1000424852 | 250 |
| 174 | 3300005441 | Ga0070700_100057968 | Ga0070700_1000579682 | 250 |
| 175 | 3300005444 | Ga0070694_100019882 | Ga0070694_1000198823 | 250 |
| 176 | 3300005444 | Ga0070694_100106302 | Ga0070694_1001063022 | 250 |
| 177 | 3300005445 | Ga0070708_100000045 | Ga0070708_10000004570 | 250 |
| 178 | 3300005445 | Ga0070708_100021041 | Ga0070708_1000210412 | 250 |
| 179 | 3300005445 | Ga0070708_100181689 | Ga0070708_1001816892 | 250 |
| 180 | 3300005445 | Ga0070708_100377408 | Ga0070708_1003774082 | 250 |
| 181 | 3300005455 | Ga0070663_100071034 | Ga0070663_1000710342 | 250 |
| 182 | 3300005456 | Ga0070678_100388204 | Ga0070678_1003882041 | 250 |
| 183 | 3300005457 | Ga0070662_100015491 | Ga0070662_1000154912 | 250 |
| 184 | 3300005457 | Ga0070662_100208715 | Ga0070662_1002087152 | 250 |
| 185 | 3300005458 | Ga0070681_10001111 | Ga0070681_1000111119 | 250 |
| 186 | 3300005458 | Ga0070681_10001558 | Ga0070681_100015583 | 250 |
| 187 | 3300005458 | Ga0070681_10003103 | Ga0070681_100031032 | 250 |
| 188 | 3300005458 | Ga0070681_10044788 | Ga0070681_100447883 | 250 |
| 189 | 3300005458 | Ga0070681_10068350 | Ga0070681_100683502 | 250 |
| 190 | 3300005458 | Ga0070681_10107087 | Ga0070681_101070872 | 250 |
| 191 | 3300005458 | Ga0070681_10168120 | Ga0070681_101681201 | 250 |
| 192 | 3300005458 | Ga0070681_10221985 | Ga0070681_102219852 | 250 |
| 193 | 3300005458 | Ga0070681_10690315 | Ga0070681_106903151 | 250 |
| 194 | 3300005459 | Ga0068867_100360046 | Ga0068867_1003600462 | 250 |
| 195 | 3300005466 | Ga0070685_10087902 | Ga0070685_100879022 | 250 |
| 196 | 3300005467 | Ga0070706_100073302 | Ga0070706_1000733022 | 250 |
| 197 | 3300005467 | Ga0070706_100145381 | Ga0070706_1001453812 | 250 |
| 198 | 3300005467 | Ga0070706_100250384 | Ga0070706_1002503842 | 250 |
| 199 | 3300005471 | Ga0070698_100035195 | Ga0070698_1000351953 | 250 |
| 200 | 3300005471 | Ga0070698_100099490 | Ga0070698_1000994903 | 250 |
| 201 | 3300005518 | Ga0070699_100009323 | Ga0070699_1000093234 | 250 |
| 202 | 3300005530 | Ga0070679_100000772 | Ga0070679_1000007724 | 250 |
| 203 | 3300005530 | Ga0070679_100001050 | Ga0070679_1000010501 | 250 |
| 204 | 3300005530 | Ga0070679_100011589 | Ga0070679_1000115895 | 250 |
| 205 | 3300005530 | Ga0070679_100012412 | Ga0070679_1000124122 | 250 |
| 206 | 3300005530 | Ga0070679_100032305 | Ga0070679_1000323053 | 250 |
| 207 | 3300005530 | Ga0070679_100045263 | Ga0070679_1000452635 | 250 |
| 208 | 3300005530 | Ga0070679_100212162 | Ga0070679_1002121621 | 250 |
| 209 | 3300005530 | Ga0070679_100261040 | Ga0070679_1002610403 | 250 |
| 210 | 3300005530 | Ga0070679_100532564 | Ga0070679_1005325641 | 250 |
| 211 | 3300005530 | Ga0070679_100652642 | Ga0070679_1006526421 | 250 |
| 212 | 3300005535 | Ga0070684_100003911 | Ga0070684_10000391111 | 250 |
| 213 | 3300005535 | Ga0070684_100004027 | Ga0070684_1000040273 | 250 |
| 214 | 3300005535 | Ga0070684_100005252 | Ga0070684_1000052525 | 250 |
| 215 | 3300005535 | Ga0070684_100010947 | Ga0070684_1000109476 | 250 |
| 216 | 3300005535 | Ga0070684_100011827 | Ga0070684_1000118273 | 250 |
| 217 | 3300005535 | Ga0070684_100038477 | Ga0070684_1000384774 | 250 |
| 218 | 3300005535 | Ga0070684_100089480 | Ga0070684_1000894802 | 250 |
| 219 | 3300005535 | Ga0070684_100091007 | Ga0070684_1000910072 | 250 |
| 220 | 3300005535 | Ga0070684_100100588 | Ga0070684_1001005883 | 250 |
| 221 | 3300005535 | Ga0070684_100160255 | Ga0070684_1001602552 | 250 |
| 222 | 3300005535 | Ga0070684_100620762 | Ga0070684_1006207621 | 250 |
| 223 | 3300005535 | Ga0070684_100628709 | Ga0070684_1006287092 | 250 |
| 224 | 3300005536 | Ga0070697_100003217 | Ga0070697_10000321715 | 250 |
| 225 | 3300005536 | Ga0070697_100026488 | Ga0070697_1000264882 | 250 |
| 226 | 3300005536 | Ga0070697_100045094 | Ga0070697_1000450943 | 250 |
| 227 | 3300005539 | Ga0068853_100008377 | Ga0068853_1000083773 | 250 |
| 228 | 3300005539 | Ga0068853_100184561 | Ga0068853_1001845612 | 250 |
| 229 | 3300005543 | Ga0070672_100027948 | Ga0070672_1000279483 | 250 |
| 230 | 3300005543 | Ga0070672_100030900 | Ga0070672_1000309003 | 250 |
| 231 | 3300005543 | Ga0070672_100049621 | Ga0070672_1000496213 | 250 |
| 232 | 3300005543 | Ga0070672_100052303 | Ga0070672_1000523032 | 250 |
| 233 | 3300005543 | Ga0070672_100519237 | Ga0070672_1005192371 | 250 |
| 234 | 3300005543 | Ga0070672_100843294 | Ga0070672_1008432941 | 250 |
| 235 | 3300005544 | Ga0070686_100228275 | Ga0070686_1002282752 | 250 |
| 236 | 3300005545 | Ga0070695_100024915 | Ga0070695_1000249152 | 250 |
| 237 | 3300005545 | Ga0070695_100153888 | Ga0070695_1001538882 | 250 |
| 238 | 3300005545 | Ga0070695_100155628 | Ga0070695_1001556282 | 250 |
| 239 | 3300005546 | Ga0070696_100000113 | Ga0070696_10000011336 | 250 |
| 240 | 3300005546 | Ga0070696_100006443 | Ga0070696_1000064432 | 250 |
| 241 | 3300005547 | Ga0070693_100008367 | Ga0070693_1000083673 | 250 |
| 242 | 3300005548 | Ga0070665_100028248 | Ga0070665_1000282483 | 250 |
| 243 | 3300005563 | Ga0068855_100036976 | Ga0068855_1000369764 | 250 |
| 244 | 3300005563 | Ga0068855_100066073 | Ga0068855_1000660733 | 250 |
| 245 | 3300005563 | Ga0068855_100070607 | Ga0068855_1000706072 | 250 |
| 246 | 3300005563 | Ga0068855_100164028 | Ga0068855_1001640283 | 250 |
| 247 | 3300005563 | Ga0068855_100352241 | Ga0068855_1003522412 | 250 |
| 248 | 3300005564 | Ga0070664_100000995 | Ga0070664_10000099520 | 250 |
| 249 | 3300005564 | Ga0070664_100009674 | Ga0070664_1000096747 | 250 |
| 250 | 3300005564 | Ga0070664_100010051 | Ga0070664_1000100515 | 250 |
| 251 | 3300005564 | Ga0070664_100013873 | Ga0070664_1000138734 | 250 |
| 252 | 3300005564 | Ga0070664_100035511 | Ga0070664_1000355114 | 250 |
| 253 | 3300005564 | Ga0070664_100345046 | Ga0070664_1003450462 | 250 |
| 254 | 3300005564 | Ga0070664_100726061 | Ga0070664_1007260612 | 250 |
| 255 | 3300005577 | Ga0068857_100003760 | Ga0068857_1000037603 | 250 |
| 256 | 3300005577 | Ga0068857_100016130 | Ga0068857_1000161305 | 250 |
| 257 | 3300005577 | Ga0068857_100024005 | Ga0068857_1000240053 | 250 |
| 258 | 3300005577 | Ga0068857_100210193 | Ga0068857_1002101932 | 250 |
| 259 | 3300005578 | Ga0068854_100074455 | Ga0068854_1000744553 | 250 |
| 260 | 3300005614 | Ga0068856_100023996 | Ga0068856_1000239965 | 250 |
| 261 | 3300005614 | Ga0068856_100036053 | Ga0068856_1000360531 | 250 |
| 262 | 3300005614 | Ga0068856_100335608 | Ga0068856_1003356082 | 250 |
| 263 | 3300005615 | Ga0070702_100002959 | Ga0070702_1000029593 | 250 |
| 264 | 3300005616 | Ga0068852_100045546 | Ga0068852_1000455464 | 250 |
| 265 | 3300005616 | Ga0068852_100065392 | Ga0068852_1000653922 | 250 |
| 266 | 3300005616 | Ga0068852_100107033 | Ga0068852_1001070332 | 250 |
| 267 | 3300005617 | Ga0068859_100050496 | Ga0068859_1000504964 | 250 |
| 268 | 3300005617 | Ga0068859_100090186 | Ga0068859_1000901863 | 250 |
| 269 | 3300005617 | Ga0068859_100113118 | Ga0068859_1001131182 | 250 |
| 270 | 3300005618 | Ga0068864_100375892 | Ga0068864_1003758922 | 250 |
| 271 | 3300005718 | Ga0068866_10045753 | Ga0068866_100457533 | 250 |
| 272 | 3300005719 | Ga0068861_100000159 | Ga0068861_10000015924 | 250 |
| 273 | 3300005840 | Ga0068870_10014684 | Ga0068870_100146843 | 250 |
| 274 | 3300005841 | Ga0068863_100007245 | Ga0068863_1000072454 | 250 |
| 275 | 3300005841 | Ga0068863_100190819 | Ga0068863_1001908192 | 250 |
| 276 | 3300005841 | Ga0068863_100227247 | Ga0068863_1002272472 | 250 |
| 277 | 3300005841 | Ga0068863_100401015 | Ga0068863_1004010152 | 250 |
| 278 | 3300005842 | Ga0068858_100012458 | Ga0068858_1000124587 | 250 |
| 279 | 3300005842 | Ga0068858_100056481 | Ga0068858_1000564812 | 250 |
| 280 | 3300005843 | Ga0068860_100022982 | Ga0068860_1000229824 | 250 |
| 281 | 3300005843 | Ga0068860_100038284 | Ga0068860_1000382844 | 250 |
| 282 | 3300005844 | Ga0068862_100011812 | Ga0068862_1000118124 | 250 |
| 283 | 3300005844 | Ga0068862_100198283 | Ga0068862_1001982832 | 250 |
| 284 | 3300005981 | Ga0081538_10030216 | Ga0081538_100302162 | 250 |
| 285 | 3300005985 | Ga0081539_10000174 | Ga0081539_1000017487 | 250 |
| 286 | 3300006028 | Ga0070717_10034077 | Ga0070717_100340773 | 250 |
| 287 | 3300006173 | Ga0070716_100087416 | Ga0070716_1000874162 | 250 |
| 288 | 3300006175 | Ga0070712_100014254 | Ga0070712_1000142543 | 250 |
| 289 | 3300006175 | Ga0070712_100018761 | Ga0070712_1000187612 | 250 |
| 290 | 3300006175 | Ga0070712_100219079 | Ga0070712_1002190792 | 250 |
| 291 | 3300006237 | Ga0097621_100047853 | Ga0097621_1000478531 | 250 |
| 292 | 3300006358 | Ga0068871_100092028 | Ga0068871_1000920283 | 250 |
| 293 | 3300006846 | Ga0075430_100003033 | Ga0075430_1000030338 | 250 |
| 294 | 3300006846 | Ga0075430_100116645 | Ga0075430_1001166452 | 250 |
| 295 | 3300006846 | Ga0075430_100286042 | Ga0075430_1002860422 | 250 |
| 296 | 3300006847 | Ga0075431_100005056 | Ga0075431_10000505611 | 250 |
| 297 | 3300006847 | Ga0075431_100013930 | Ga0075431_1000139302 | 250 |
| 298 | 3300006847 | Ga0075431_100302420 | Ga0075431_1003024202 | 250 |
| 299 | 3300006847 | Ga0075431_100504883 | Ga0075431_1005048831 | 250 |
| 300 | 3300006852 | Ga0075433_10149367 | Ga0075433_101493672 | 250 |
| 301 | 3300006852 | Ga0075433_10300041 | Ga0075433_103000412 | 250 |
| 302 | 3300006871 | Ga0075434_100296288 | Ga0075434_1002962882 | 250 |
| 303 | 3300006880 | Ga0075429_100009585 | Ga0075429_1000095855 | 250 |
| 304 | 3300006880 | Ga0075429_100024226 | Ga0075429_1000242264 | 250 |
| 305 | 3300006881 | Ga0068865_100031767 | Ga0068865_1000317672 | 250 |
| 306 | 3300006914 | Ga0075436_100015174 | Ga0075436_1000151742 | 250 |
| 307 | 3300006914 | Ga0075436_100071491 | Ga0075436_1000714912 | 250 |
| 308 | 3300006914 | Ga0075436_100188884 | Ga0075436_1001888842 | 250 |
| 309 | 3300006931 | Ga0097620_100050498 | Ga0097620_1000504984 | 250 |
| 310 | 3300006931 | Ga0097620_100090186 | Ga0097620_1000901863 | 250 |
| 311 | 3300006931 | Ga0097620_100113119 | Ga0097620_1001131192 | 250 |
| 312 | 3300007076 | Ga0075435_100012532 | Ga0075435_1000125323 | 250 |
| 313 | 3300007076 | Ga0075435_100130410 | Ga0075435_1001304102 | 250 |
| 314 | 3300007076 | Ga0075435_100284203 | Ga0075435_1002842032 | 250 |
| 315 | 3300007265 | Ga0099794_10000159 | Ga0099794_1000015911 | 250 |
| 316 | 3300009094 | Ga0111539_10078098 | Ga0111539_100780983 | 250 |
| 317 | 3300009094 | Ga0111539_10187271 | Ga0111539_101872713 | 250 |
| 318 | 3300009094 | Ga0111539_10215561 | Ga0111539_102155613 | 250 |
| 319 | 3300009098 | Ga0105245_10001478 | Ga0105245_1000147811 | 250 |
| 320 | 3300009098 | Ga0105245_10049888 | Ga0105245_100498883 | 250 |
| 321 | 3300009098 | Ga0105245_10111226 | Ga0105245_101112263 | 250 |
| 322 | 3300009098 | Ga0105245_10195545 | Ga0105245_101955453 | 250 |
| 323 | 3300009098 | Ga0105245_10289383 | Ga0105245_102893832 | 250 |
| 324 | 3300009098 | Ga0105245_10302874 | Ga0105245_103028742 | 250 |
| 325 | 3300009098 | Ga0105245_10558659 | Ga0105245_105586592 | 250 |
| 326 | 3300009098 | Ga0105245_10862123 | Ga0105245_108621231 | 250 |
| 327 | 3300009147 | Ga0114129_10069432 | Ga0114129_100694325 | 250 |
| 328 | 3300009147 | Ga0114129_10077699 | Ga0114129_100776992 | 250 |
| 329 | 3300009147 | Ga0114129_10253321 | Ga0114129_102533212 | 250 |
| 330 | 3300009148 | Ga0105243_10070943 | Ga0105243_100709432 | 250 |
| 331 | 3300009174 | Ga0105241_10117056 | Ga0105241_101170563 | 250 |
| 332 | 3300009174 | Ga0105241_10130184 | Ga0105241_101301843 | 250 |
| 333 | 3300009176 | Ga0105242_10012697 | Ga0105242_100126973 | 250 |
| 334 | 3300009176 | Ga0105242_10116505 | Ga0105242_101165052 | 250 |
| 335 | 3300009177 | Ga0105248_10001272 | Ga0105248_1000127219 | 250 |
| 336 | 3300009177 | Ga0105248_10066259 | Ga0105248_100662594 | 250 |
| 337 | 3300009177 | Ga0105248_10137998 | Ga0105248_101379983 | 250 |
| 338 | 3300009177 | Ga0105248_10141219 | Ga0105248_101412191 | 250 |
| 339 | 3300009177 | Ga0105248_10293326 | Ga0105248_102933262 | 250 |
| 340 | 3300009177 | Ga0105248_10436503 | Ga0105248_104365032 | 250 |
| 341 | 3300009545 | Ga0105237_10724320 | Ga0105237_107243202 | 250 |
| 342 | 3300009551 | Ga0105238_10070208 | Ga0105238_100702084 | 250 |
| 343 | 3300009551 | Ga0105238_10070936 | Ga0105238_100709363 | 250 |
| 344 | 3300009551 | Ga0105238_10121138 | Ga0105238_101211382 | 250 |
| 345 | 3300009553 | Ga0105249_10003084 | Ga0105249_100030843 | 250 |
| 346 | 3300010375 | Ga0105239_10059094 | Ga0105239_100590943 | 250 |
| 347 | 3300011119 | Ga0105246_10000522 | Ga0105246_1000052218 | 250 |
| 348 | 3300013100 | Ga0157373_10016038 | Ga0157373_100160382 | 250 |
| 349 | 3300013100 | Ga0157373_10073716 | Ga0157373_100737162 | 250 |
| 350 | 3300013100 | Ga0157373_10366933 | Ga0157373_103669332 | 250 |
| 351 | 3300013102 | Ga0157371_10003449 | Ga0157371_1000344912 | 250 |
| 352 | 3300013102 | Ga0157371_10013563 | Ga0157371_100135633 | 250 |
| 353 | 3300013102 | Ga0157371_10108983 | Ga0157371_101089832 | 250 |
| 354 | 3300013104 | Ga0157370_10016785 | Ga0157370_100167857 | 250 |
| 355 | 3300013104 | Ga0157370_10385153 | Ga0157370_103851532 | 250 |
| 356 | 3300013105 | Ga0157369_10031048 | Ga0157369_100310482 | 250 |
| 357 | 3300013105 | Ga0157369_10216558 | Ga0157369_102165582 | 250 |
| 358 | 3300013105 | Ga0157369_10315757 | Ga0157369_103157572 | 250 |
| 359 | 3300013105 | Ga0157369_10341386 | Ga0157369_103413862 | 250 |
| 360 | 3300013105 | Ga0157369_10405202 | Ga0157369_104052022 | 250 |
| 361 | 3300013105 | Ga0157369_10414241 | Ga0157369_104142412 | 250 |
| 362 | 3300013105 | Ga0157369_10816155 | Ga0157369_108161551 | 250 |
| 363 | 3300013296 | Ga0157374_10006995 | Ga0157374_100069957 | 250 |
| 364 | 3300013296 | Ga0157374_10588017 | Ga0157374_105880171 | 250 |
| 365 | 3300013296 | Ga0157374_10597086 | Ga0157374_105970862 | 250 |
| 366 | 3300013297 | Ga0157378_10385904 | Ga0157378_103859042 | 250 |
| 367 | 3300013297 | Ga0157378_10690526 | Ga0157378_106905261 | 250 |
| 368 | 3300013306 | Ga0163162_10001610 | Ga0163162_1000161010 | 250 |
| 369 | 3300013306 | Ga0163162_10415506 | Ga0163162_104155062 | 250 |
| 370 | 3300013307 | Ga0157372_10020362 | Ga0157372_100203626 | 250 |
| 371 | 3300013307 | Ga0157372_10021441 | Ga0157372_100214415 | 250 |
| 372 | 3300013307 | Ga0157372_10033001 | Ga0157372_100330014 | 250 |
| 373 | 3300013307 | Ga0157372_10042228 | Ga0157372_100422285 | 250 |
| 374 | 3300013307 | Ga0157372_10043863 | Ga0157372_100438632 | 250 |
| 375 | 3300013307 | Ga0157372_10102077 | Ga0157372_101020773 | 250 |
| 376 | 3300013307 | Ga0157372_10154499 | Ga0157372_101544993 | 250 |
| 377 | 3300013307 | Ga0157372_10269874 | Ga0157372_102698742 | 250 |
| 378 | 3300013307 | Ga0157372_10373281 | Ga0157372_103732812 | 250 |
| 379 | 3300013307 | Ga0157372_10674511 | Ga0157372_106745112 | 250 |
| 380 | 3300013307 | Ga0157372_10693136 | Ga0157372_106931362 | 250 |
| 381 | 3300013307 | Ga0157372_11146320 | Ga0157372_111463202 | 250 |
| 382 | 3300013308 | Ga0157375_10030709 | Ga0157375_100307093 | 250 |
| 383 | 3300013308 | Ga0157375_10055591 | Ga0157375_100555914 | 250 |
| 384 | 3300013308 | Ga0157375_10094530 | Ga0157375_100945303 | 250 |
| 385 | 3300013308 | Ga0157375_10127136 | Ga0157375_101271362 | 250 |
| 386 | 3300013308 | Ga0157375_10649265 | Ga0157375_106492651 | 250 |
| 387 | 3300013308 | Ga0157375_10850113 | Ga0157375_108501132 | 250 |
| 388 | 3300014325 | Ga0163163_10004113 | Ga0163163_100041137 | 250 |
| 389 | 3300014325 | Ga0163163_10057127 | Ga0163163_100571272 | 250 |
| 390 | 3300014326 | Ga0157380_10263785 | Ga0157380_102637852 | 250 |
| 391 | 3300014745 | Ga0157377_10000600 | Ga0157377_100006004 | 250 |
| 392 | 3300014745 | Ga0157377_10000911 | Ga0157377_100009117 | 250 |
| 393 | 3300014968 | Ga0157379_10003764 | Ga0157379_100037649 | 250 |
| 394 | 3300014969 | Ga0157376_10022494 | Ga0157376_100224944 | 250 |
| 395 | 3300014969 | Ga0157376_10317585 | Ga0157376_103175851 | 250 |
| 396 | 3300014969 | Ga0157376_10440972 | Ga0157376_104409722 | 250 |
| 397 | 3300017792 | Ga0163161_10106386 | Ga0163161_101063861 | 250 |
| 398 | 3300017792 | Ga0163161_10145557 | Ga0163161_101455572 | 250 |
| 399 | 3300025885 | Ga0207653_10000193 | Ga0207653_1000019319 | 250 |
| 400 | 3300025893 | Ga0207682_10036039 | Ga0207682_100360393 | 250 |
| 401 | 3300025898 | Ga0207692_10203057 | Ga0207692_102030572 | 250 |
| 402 | 3300025899 | Ga0207642_10057020 | Ga0207642_100570203 | 250 |
| 403 | 3300025900 | Ga0207710_10159040 | Ga0207710_101590402 | 250 |
| 404 | 3300025901 | Ga0207688_10051685 | Ga0207688_100516852 | 250 |
| 405 | 3300025904 | Ga0207647_10247599 | Ga0207647_102475992 | 250 |
| 406 | 3300025906 | Ga0207699_10005806 | Ga0207699_100058064 | 250 |
| 407 | 3300025906 | Ga0207699_10123914 | Ga0207699_101239142 | 250 |
| 408 | 3300025906 | Ga0207699_10217058 | Ga0207699_102170582 | 250 |
| 409 | 3300025907 | Ga0207645_10000126 | Ga0207645_1000012637 | 250 |
| 410 | 3300025907 | Ga0207645_10042462 | Ga0207645_100424622 | 250 |
| 411 | 3300025908 | Ga0207643_10016451 | Ga0207643_100164512 | 250 |
| 412 | 3300025908 | Ga0207643_10035541 | Ga0207643_100355413 | 250 |
| 413 | 3300025909 | Ga0207705_10011135 | Ga0207705_100111351 | 250 |
| 414 | 3300025909 | Ga0207705_10026485 | Ga0207705_100264851 | 250 |
| 415 | 3300025909 | Ga0207705_10279039 | Ga0207705_102790392 | 250 |
| 416 | 3300025910 | Ga0207684_10124054 | Ga0207684_101240542 | 250 |
| 417 | 3300025910 | Ga0207684_10317139 | Ga0207684_103171391 | 250 |
| 418 | 3300025911 | Ga0207654_10131702 | Ga0207654_101317022 | 250 |
| 419 | 3300025912 | Ga0207707_10001370 | Ga0207707_1000137015 | 250 |
| 420 | 3300025912 | Ga0207707_10006243 | Ga0207707_100062432 | 250 |
| 421 | 3300025912 | Ga0207707_10006657 | Ga0207707_1000665711 | 250 |
| 422 | 3300025912 | Ga0207707_10047510 | Ga0207707_100475103 | 250 |
| 423 | 3300025912 | Ga0207707_10111930 | Ga0207707_101119302 | 250 |
| 424 | 3300025912 | Ga0207707_10293253 | Ga0207707_102932531 | 250 |
| 425 | 3300025915 | Ga0207693_10039227 | Ga0207693_100392273 | 250 |
| 426 | 3300025915 | Ga0207693_10070454 | Ga0207693_100704543 | 250 |
| 427 | 3300025916 | Ga0207663_10052611 | Ga0207663_100526112 | 250 |
| 428 | 3300025916 | Ga0207663_10125158 | Ga0207663_101251582 | 250 |
| 429 | 3300025916 | Ga0207663_10188239 | Ga0207663_101882392 | 250 |
| 430 | 3300025917 | Ga0207660_10001337 | Ga0207660_100013375 | 250 |
| 431 | 3300025917 | Ga0207660_10040194 | Ga0207660_100401943 | 250 |
| 432 | 3300025917 | Ga0207660_10224299 | Ga0207660_102242992 | 250 |
| 433 | 3300025917 | Ga0207660_10510744 | Ga0207660_105107441 | 250 |
| 434 | 3300025918 | Ga0207662_10019471 | Ga0207662_100194713 | 250 |
| 435 | 3300025918 | Ga0207662_10028340 | Ga0207662_100283403 | 250 |
| 436 | 3300025918 | Ga0207662_10043404 | Ga0207662_100434043 | 250 |
| 437 | 3300025918 | Ga0207662_10053677 | Ga0207662_100536772 | 250 |
| 438 | 3300025919 | Ga0207657_10002485 | Ga0207657_100024852 | 250 |
| 439 | 3300025919 | Ga0207657_10033132 | Ga0207657_100331323 | 250 |
| 440 | 3300025919 | Ga0207657_10526036 | Ga0207657_105260361 | 250 |
| 441 | 3300025920 | Ga0207649_10037927 | Ga0207649_100379272 | 250 |
| 442 | 3300025920 | Ga0207649_10269162 | Ga0207649_102691622 | 250 |
| 443 | 3300025920 | Ga0207649_10366602 | Ga0207649_103666021 | 250 |
| 444 | 3300025921 | Ga0207652_10005794 | Ga0207652_100057942 | 250 |
| 445 | 3300025921 | Ga0207652_10008992 | Ga0207652_100089927 | 250 |
| 446 | 3300025921 | Ga0207652_10107967 | Ga0207652_101079672 | 250 |
| 447 | 3300025921 | Ga0207652_10381888 | Ga0207652_103818882 | 250 |
| 448 | 3300025921 | Ga0207652_10592518 | Ga0207652_105925181 | 250 |
| 449 | 3300025923 | Ga0207681_10012890 | Ga0207681_100128904 | 250 |
| 450 | 3300025923 | Ga0207681_10453097 | Ga0207681_104530972 | 250 |
| 451 | 3300025925 | Ga0207650_10148610 | Ga0207650_101486102 | 250 |
| 452 | 3300025925 | Ga0207650_10190558 | Ga0207650_101905582 | 250 |
| 453 | 3300025925 | Ga0207650_10193923 | Ga0207650_101939232 | 250 |
| 454 | 3300025925 | Ga0207650_10230506 | Ga0207650_102305062 | 250 |
| 455 | 3300025926 | Ga0207659_10023295 | Ga0207659_100232953 | 250 |
| 456 | 3300025927 | Ga0207687_10026879 | Ga0207687_100268794 | 250 |
| 457 | 3300025927 | Ga0207687_10124491 | Ga0207687_101244913 | 250 |
| 458 | 3300025927 | Ga0207687_10127829 | Ga0207687_101278292 | 250 |
| 459 | 3300025927 | Ga0207687_10214669 | Ga0207687_102146691 | 250 |
| 460 | 3300025928 | Ga0207700_10000713 | Ga0207700_1000071314 | 250 |
| 461 | 3300025928 | Ga0207700_10012092 | Ga0207700_100120923 | 250 |
| 462 | 3300025928 | Ga0207700_10157062 | Ga0207700_101570622 | 250 |
| 463 | 3300025928 | Ga0207700_10166242 | Ga0207700_101662422 | 250 |
| 464 | 3300025928 | Ga0207700_10199605 | Ga0207700_101996052 | 250 |
| 465 | 3300025928 | Ga0207700_10321260 | Ga0207700_103212602 | 250 |
| 466 | 3300025929 | Ga0207664_10003774 | Ga0207664_100037747 | 250 |
| 467 | 3300025929 | Ga0207664_10120633 | Ga0207664_101206331 | 250 |
| 468 | 3300025931 | Ga0207644_10492585 | Ga0207644_104925851 | 250 |
| 469 | 3300025931 | Ga0207644_10628828 | Ga0207644_106288281 | 250 |
| 470 | 3300025932 | Ga0207690_10004856 | Ga0207690_100048564 | 250 |
| 471 | 3300025932 | Ga0207690_10011490 | Ga0207690_100114903 | 250 |
| 472 | 3300025932 | Ga0207690_10028632 | Ga0207690_100286321 | 250 |
| 473 | 3300025932 | Ga0207690_10085243 | Ga0207690_100852432 | 250 |
| 474 | 3300025933 | Ga0207706_10000360 | Ga0207706_1000036021 | 250 |
| 475 | 3300025933 | Ga0207706_10027041 | Ga0207706_100270412 | 250 |
| 476 | 3300025933 | Ga0207706_10470777 | Ga0207706_104707772 | 250 |
| 477 | 3300025934 | Ga0207686_10034664 | Ga0207686_100346641 | 250 |
| 478 | 3300025934 | Ga0207686_10080842 | Ga0207686_100808423 | 250 |
| 479 | 3300025934 | Ga0207686_10115623 | Ga0207686_101156233 | 250 |
| 480 | 3300025934 | Ga0207686_10242766 | Ga0207686_102427662 | 250 |
| 481 | 3300025936 | Ga0207670_10015237 | Ga0207670_100152372 | 250 |
| 482 | 3300025936 | Ga0207670_10166131 | Ga0207670_101661312 | 250 |
| 483 | 3300025937 | Ga0207669_10007595 | Ga0207669_100075952 | 250 |
| 484 | 3300025937 | Ga0207669_10134138 | Ga0207669_101341382 | 250 |
| 485 | 3300025939 | Ga0207665_10186041 | Ga0207665_101860412 | 250 |
| 486 | 3300025940 | Ga0207691_10002534 | Ga0207691_100025343 | 250 |
| 487 | 3300025940 | Ga0207691_10003202 | Ga0207691_100032023 | 250 |
| 488 | 3300025940 | Ga0207691_10039995 | Ga0207691_100399955 | 250 |
| 489 | 3300025940 | Ga0207691_10047980 | Ga0207691_100479802 | 250 |
| 490 | 3300025940 | Ga0207691_10061922 | Ga0207691_100619224 | 250 |
| 491 | 3300025940 | Ga0207691_10232467 | Ga0207691_102324672 | 250 |
| 492 | 3300025941 | Ga0207711_10011146 | Ga0207711_100111466 | 250 |
| 493 | 3300025941 | Ga0207711_10024832 | Ga0207711_100248323 | 250 |
| 494 | 3300025941 | Ga0207711_10326655 | Ga0207711_103266552 | 250 |
| 495 | 3300025941 | Ga0207711_10345965 | Ga0207711_103459652 | 250 |
| 496 | 3300025941 | Ga0207711_10415405 | Ga0207711_104154051 | 250 |
| 497 | 3300025942 | Ga0207689_10009951 | Ga0207689_100099516 | 250 |
| 498 | 3300025944 | Ga0207661_10003744 | Ga0207661_1000374411 | 250 |
| 499 | 3300025944 | Ga0207661_10039887 | Ga0207661_100398873 | 250 |
| 500 | 3300025944 | Ga0207661_10066666 | Ga0207661_100666663 | 250 |
| 501 | 3300025944 | Ga0207661_10087859 | Ga0207661_100878592 | 250 |
| 502 | 3300025944 | Ga0207661_10113031 | Ga0207661_101130312 | 250 |
| 503 | 3300025944 | Ga0207661_10114042 | Ga0207661_101140422 | 250 |
| 504 | 3300025944 | Ga0207661_10233346 | Ga0207661_102333462 | 250 |
| 505 | 3300025944 | Ga0207661_10535090 | Ga0207661_105350901 | 250 |
| 506 | 3300025944 | Ga0207661_10537887 | Ga0207661_105378871 | 250 |
| 507 | 3300025944 | Ga0207661_10761917 | Ga0207661_107619171 | 250 |
| 508 | 3300025945 | Ga0207679_10004676 | Ga0207679_100046762 | 250 |
| 509 | 3300025945 | Ga0207679_10018528 | Ga0207679_100185283 | 250 |
| 510 | 3300025945 | Ga0207679_10034869 | Ga0207679_100348693 | 250 |
| 511 | 3300025945 | Ga0207679_10090522 | Ga0207679_100905222 | 250 |
| 512 | 3300025945 | Ga0207679_10242268 | Ga0207679_102422682 | 250 |
| 513 | 3300025945 | Ga0207679_10308582 | Ga0207679_103085822 | 250 |
| 514 | 3300025945 | Ga0207679_10570648 | Ga0207679_105706481 | 250 |
| 515 | 3300025949 | Ga0207667_10035867 | Ga0207667_100358673 | 250 |
| 516 | 3300025949 | Ga0207667_10114539 | Ga0207667_101145393 | 250 |
| 517 | 3300025949 | Ga0207667_10278142 | Ga0207667_102781422 | 250 |
| 518 | 3300025949 | Ga0207667_10306688 | Ga0207667_103066882 | 250 |
| 519 | 3300025960 | Ga0207651_10256972 | Ga0207651_102569722 | 250 |
| 520 | 3300025961 | Ga0207712_10002205 | Ga0207712_100022052 | 250 |
| 521 | 3300025961 | Ga0207712_10118982 | Ga0207712_101189822 | 250 |
| 522 | 3300025972 | Ga0207668_10014847 | Ga0207668_100148474 | 250 |
| 523 | 3300025972 | Ga0207668_10098453 | Ga0207668_100984532 | 250 |
| 524 | 3300025981 | Ga0207640_10150065 | Ga0207640_101500652 | 250 |
| 525 | 3300025981 | Ga0207640_10782756 | Ga0207640_107827561 | 250 |
| 526 | 3300025986 | Ga0207658_10045091 | Ga0207658_100450914 | 250 |
| 527 | 3300025986 | Ga0207658_10085411 | Ga0207658_100854112 | 250 |
| 528 | 3300025986 | Ga0207658_10194708 | Ga0207658_101947083 | 250 |
| 529 | 3300025986 | Ga0207658_10805954 | Ga0207658_108059541 | 250 |
| 530 | 3300026035 | Ga0207703_10276924 | Ga0207703_102769242 | 250 |
| 531 | 3300026035 | Ga0207703_10719194 | Ga0207703_107191942 | 250 |
| 532 | 3300026035 | Ga0207703_10751796 | Ga0207703_107517961 | 250 |
| 533 | 3300026041 | Ga0207639_10163108 | Ga0207639_101631082 | 250 |
| 534 | 3300026041 | Ga0207639_10538486 | Ga0207639_105384862 | 250 |
| 535 | 3300026067 | Ga0207678_10008055 | Ga0207678_100080553 | 250 |
| 536 | 3300026075 | Ga0207708_10048846 | Ga0207708_100488462 | 250 |
| 537 | 3300026075 | Ga0207708_10245980 | Ga0207708_102459802 | 250 |
| 538 | 3300026078 | Ga0207702_10011688 | Ga0207702_100116882 | 250 |
| 539 | 3300026078 | Ga0207702_10026823 | Ga0207702_100268233 | 250 |
| 540 | 3300026078 | Ga0207702_10274081 | Ga0207702_102740811 | 250 |
| 541 | 3300026078 | Ga0207702_10374263 | Ga0207702_103742631 | 250 |
| 542 | 3300026078 | Ga0207702_10544182 | Ga0207702_105441822 | 250 |
| 543 | 3300026088 | Ga0207641_10038720 | Ga0207641_100387202 | 250 |
| 544 | 3300026088 | Ga0207641_10046937 | Ga0207641_100469374 | 250 |
| 545 | 3300026089 | Ga0207648_10027761 | Ga0207648_100277612 | 250 |
| 546 | 3300026089 | Ga0207648_10434164 | Ga0207648_104341642 | 250 |
| 547 | 3300026095 | Ga0207676_10023859 | Ga0207676_100238592 | 250 |
| 548 | 3300026095 | Ga0207676_10079204 | Ga0207676_100792042 | 250 |
| 549 | 3300026095 | Ga0207676_10450954 | Ga0207676_104509542 | 250 |
| 550 | 3300026116 | Ga0207674_10000528 | Ga0207674_1000052821 | 250 |
| 551 | 3300026116 | Ga0207674_10002884 | Ga0207674_1000288421 | 250 |
| 552 | 3300026116 | Ga0207674_10013853 | Ga0207674_100138537 | 250 |
| 553 | 3300026116 | Ga0207674_10043791 | Ga0207674_100437913 | 250 |
| 554 | 3300026116 | Ga0207674_10045491 | Ga0207674_100454912 | 250 |
| 555 | 3300026116 | Ga0207674_10117375 | Ga0207674_101173753 | 250 |
| 556 | 3300026116 | Ga0207674_10420867 | Ga0207674_104208672 | 250 |
| 557 | 3300026118 | Ga0207675_100004288 | Ga0207675_1000042883 | 250 |
| 558 | 3300026118 | Ga0207675_100410485 | Ga0207675_1004104852 | 250 |
| 559 | 3300026121 | Ga0207683_10555822 | Ga0207683_105558222 | 250 |
| 560 | 3300026142 | Ga0207698_10027527 | Ga0207698_100275275 | 250 |
| 561 | 3300026142 | Ga0207698_10179487 | Ga0207698_101794872 | 250 |
| 562 | 3300026142 | Ga0207698_10201083 | Ga0207698_102010832 | 250 |
| 563 | 3300026142 | Ga0207698_10217355 | Ga0207698_102173552 | 250 |
| 564 | 3300028379 | Ga0268266_10072508 | Ga0268266_100725083 | 250 |
| 565 | 3300028380 | Ga0268265_10046502 | Ga0268265_100465023 | 250 |
| 566 | 3300028380 | Ga0268265_10209093 | Ga0268265_102090932 | 250 |
| 567 | 3300028381 | Ga0268264_10269800 | Ga0268264_102698002 | 250 |
| 568 | 3300028381 | Ga0268264_10343149 | Ga0268264_103431492 | 250 |
| 569 | 3300031238 | Ga0265332_10011303 | Ga0265332_100113033 | 250 |
| 570 | 3300031251 | Ga0265327_10021313 | Ga0265327_100213133 | 250 |
| 571 | 3300031548 | Ga0307408_100003736 | Ga0307408_1000037366 | 250 |
| 572 | 3300031711 | Ga0265314_10029359 | Ga0265314_100293592 | 250 |
| 573 | 3300031731 | Ga0307405_10155051 | Ga0307405_101550512 | 250 |
| 574 | 3300031824 | Ga0307413_10099106 | Ga0307413_100991062 | 250 |
| 575 | 3300031852 | Ga0307410_10093351 | Ga0307410_100933512 | 250 |
| 576 | 3300031852 | Ga0307410_10203856 | Ga0307410_102038562 | 250 |
| 577 | 3300031901 | Ga0307406_10015818 | Ga0307406_100158182 | 250 |
| 578 | 3300031901 | Ga0307406_10411980 | Ga0307406_104119802 | 250 |
| 579 | 3300031901 | Ga0307406_10541330 | Ga0307406_105413301 | 250 |
| 580 | 3300031995 | Ga0307409_100266064 | Ga0307409_1002660642 | 250 |
| 581 | 3300032002 | Ga0307416_100278572 | Ga0307416_1002785722 | 250 |
| 582 | 3300032004 | Ga0307414_10120693 | Ga0307414_101206931 | 250 |
| 583 | 3300032004 | Ga0307414_10180513 | Ga0307414_101805132 | 250 |
| 584 | 3300032005 | Ga0307411_10024423 | Ga0307411_100244233 | 250 |
| 585 | 3300035083 | Ga0373926_0013037 | Ga0373926_0013037_1720_2472 | 250 |
| 586 | 3300035086 | Ga0373934_0000378 | Ga0373934_0000378_10691_11443 | 250 |
| 587 | 3300035086 | Ga0373934_0005214 | Ga0373934_0005214_2530_3282 | 250 |
| 588 | 3300035089 | Ga0373944_0049828 | Ga0373944_0049828_346_1098 | 250 |
| 589 | 3300035116 | Ga0373945_0087275 | Ga0373945_0087275_359_1111 | 250 |
| 590 | 3300035118 | Ga0373954_0022269 | Ga0373954_0022269_1241_1993 | 250 |
| 591 | 3300035118 | Ga0373954_0133729 | Ga0373954_0133729_189_941 | 250 |
| 592 | 3300035119 | Ga0373956_0001784 | Ga0373956_0001784_1304_2056 | 250 |
| 593 | 3300035120 | Ga0373957_0002283 | Ga0373957_0002283_4170_4922 | 250 |
| 594 | 3300035170 | Ga0373943_0017013 | Ga0373943_0017013_2549_3301 | 250 |
| 595 | 3300035170 | Ga0373943_0084416 | Ga0373943_0084416_26_778 | 250 |
| 596 | 3300035172 | Ga0373955_0000478 | Ga0373955_0000478_6904_7656 | 250 |
| 597 | 3300035172 | Ga0373955_0011131 | Ga0373955_0011131_1450_2202 | 250 |
| 598 | 3300035172 | Ga0373955_0051117 | Ga0373955_0051117_908_1660 | 250 |
| 599 | 3300035691 | Ga0373931_0200410 | Ga0373931_0200410_308_1060 | 250 |
| 600 | 3300035692 | Ga0373935_0000974 | Ga0373935_0000974_6123_6875 | 250 |
| 601 | 3300035692 | Ga0373935_0184745 | Ga0373935_0184745_139_891 | 250 |
| 602 | 3300035692 | Ga0373935_0325947 | Ga0373935_0325947_284_1036 | 250 |
| 603 | 3300035695 | Ga0373927_0008745 | Ga0373927_0008745_975_1727 | 250 |
| 604 | 3300035695 | Ga0373927_0039757 | Ga0373927_0039757_806_1558 | 250 |
| 605 | 3300035695 | Ga0373927_0061501 | Ga0373927_0061501_1621_2379 | 250 |
| 606 | 3300035724 | Ga0373933_0000033 | Ga0373933_0000033_9306_10058 | 250 |
| 607 | 3300035724 | Ga0373933_0053316 | Ga0373933_0053316_817_1569 | 250 |
| 608 | 3300035725 | Ga0373947_0005801 | Ga0373947_0005801_6330_7082 | 250 |
| 609 | 3300035725 | Ga0373947_0174908 | Ga0373947_0174908_347_1099 | 250 |
| 610 | 3300036401 | Ga0373937_0000158 | Ga0373937_0000158_14042_14794 | 250 |
| 611 | 3300036401 | Ga0373937_0023307 | Ga0373937_0023307_837_1589 | 250 |
| 612 | 3300036401 | Ga0373937_0032620 | Ga0373937_0032620_2822_3574 | 250 |
| 613 | 3300036401 | Ga0373937_0056784 | Ga0373937_0056784_49_801 | 250 |
| 614 | 3300036401 | Ga0373937_0347028 | Ga0373937_0347028_309_1061 | 250 |
| 615 | 3300037068 | Ga0373925_0002081 | Ga0373925_0002081_3779_4531 | 250 |
| 616 | 3300037068 | Ga0373925_0203206 | Ga0373925_0203206_156_908 | 250 |
| 617 | 3300039437 | Ga0436365_0597434 | Ga0436365_0597434_112_864 | 250 |
| 618 | 3300041406 | Ga0439439_0003899 | Ga0439439_0003899_2535_3287 | 250 |
| 619 | 3300042005 | Ga0439448_0021568 | Ga0439448_0021568_754_1506 | 250 |
| 620 | 3300042435 | Ga0439434_0030838 | Ga0439434_0030838_795_1547 | 250 |
| 621 | 3300042876 | Ga0451577_0000005 | Ga0451577_0000005_20085_20837 | 250 |
| 622 | 3300042876 | Ga0451577_0753318 | Ga0451577_0753318_17_772 | 250 |
| 623 | 3300044656 | Ga0466969_0115206 | Ga0466969_0115206_427_1179 | 250 |
| 624 | 3300044694 | Ga0466963_0170513 | Ga0466963_0170513_128_880 | 250 |
| 625 | 3300045049 | Ga0466959_0015951 | Ga0466959_0015951_1146_1898 | 250 |
| 626 | 3300045051 | Ga0451576_0072473 | Ga0451576_0072473_1017_1769 | 250 |
| 627 | 3300045051 | Ga0451576_0973722 | Ga0451576_0973722_53_805 | 250 |
| 628 | 3300045836 | Ga0466958_0353868 | Ga0466958_0353868_80_832 | 250 |
| 629 | 3300045976 | Ga0466967_0023654 | Ga0466967_0023654_3996_4748 | 250 |
| 630 | 3300045976 | Ga0466967_0113180 | Ga0466967_0113180_339_1097 | 250 |
| 631 | 3300045976 | Ga0466967_0274661 | Ga0466967_0274661_779_1531 | 250 |
| 632 | 3300046454 | Ga0495592_0000976 | Ga0495592_0000976_16023_16775 | 250 |
| 633 | 3300046455 | Ga0495603_0035019 | Ga0495603_0035019_205_957 | 250 |
| 634 | 3300046459 | Ga0495629_0008985 | Ga0495629_0008985_5596_6348 | 250 |
| 635 | 3300046459 | Ga0495629_0025272 | Ga0495629_0025272_1825_2577 | 250 |
| 636 | 3300046459 | Ga0495629_0071754 | Ga0495629_0071754_1382_2134 | 250 |
| 637 | 3300046459 | Ga0495629_0083200 | Ga0495629_0083200_1400_2152 | 250 |
| 638 | 3300046459 | Ga0495629_0094913 | Ga0495629_0094913_103_855 | 250 |
| 639 | 3300046459 | Ga0495629_0294261 | Ga0495629_0294261_136_888 | 250 |
| 640 | 3300046462 | Ga0495651_0000893 | Ga0495651_0000893_12872_13624 | 250 |
| 641 | 3300046462 | Ga0495651_0023586 | Ga0495651_0023586_2786_3538 | 250 |
| 642 | 3300046462 | Ga0495651_0106142 | Ga0495651_0106142_1042_1794 | 250 |
| 643 | 3300046463 | Ga0495653_0000173 | Ga0495653_0000173_12666_13418 | 250 |
| 644 | 3300046463 | Ga0495653_0089320 | Ga0495653_0089320_95_847 | 250 |
| 645 | 3300046472 | Ga0495580_0004972 | Ga0495580_0004972_604_1356 | 250 |
| 646 | 3300046472 | Ga0495580_0088355 | Ga0495580_0088355_1154_1906 | 250 |
| 647 | 3300046473 | Ga0495582_0006104 | Ga0495582_0006104_3638_4390 | 250 |
| 648 | 3300046473 | Ga0495582_0039838 | Ga0495582_0039838_597_1349 | 250 |
| 649 | 3300046473 | Ga0495582_0078363 | Ga0495582_0078363_759_1511 | 250 |
| 650 | 3300046475 | Ga0495639_0017395 | Ga0495639_0017395_772_1524 | 250 |
| 651 | 3300046475 | Ga0495639_0025008 | Ga0495639_0025008_1264_2016 | 250 |
| 652 | 3300046476 | Ga0495662_0099135 | Ga0495662_0099135_593_1345 | 250 |
| 653 | 3300046477 | Ga0495664_0004103 | Ga0495664_0004103_5800_6552 | 250 |
| 654 | 3300046477 | Ga0495664_0088709 | Ga0495664_0088709_968_1720 | 250 |
| 655 | 3300046499 | Ga0495594_0009845 | Ga0495594_0009845_3832_4584 | 250 |
| 656 | 3300046499 | Ga0495594_0048806 | Ga0495594_0048806_380_1132 | 250 |
| 657 | 3300046499 | Ga0495594_0053371 | Ga0495594_0053371_750_1502 | 250 |
| 658 | 3300046499 | Ga0495594_0074959 | Ga0495594_0074959_935_1687 | 250 |
| 659 | 3300046511 | Ga0495608_0000763 | Ga0495608_0000763_9984_10736 | 250 |
| 660 | 3300046511 | Ga0495608_0033340 | Ga0495608_0033340_1681_2433 | 250 |
| 661 | 3300046514 | Ga0495618_0158090 | Ga0495618_0158090_622_1374 | 250 |
| 662 | 3300046516 | Ga0495628_0012681 | Ga0495628_0012681_4573_5325 | 250 |
| 663 | 3300046516 | Ga0495628_0033195 | Ga0495628_0033195_376_1128 | 250 |
| 664 | 3300046516 | Ga0495628_0059929 | Ga0495628_0059929_170_922 | 250 |
| 665 | 3300046516 | Ga0495628_0452550 | Ga0495628_0452550_159_911 | 250 |
| 666 | 3300046517 | Ga0495630_0007289 | Ga0495630_0007289_1163_1915 | 250 |
| 667 | 3300046526 | Ga0495666_0033841 | Ga0495666_0033841_728_1480 | 250 |
| 668 | 3300046529 | Ga0495652_0003926 | Ga0495652_0003926_12442_13194 | 250 |
| 669 | 3300046529 | Ga0495652_0008068 | Ga0495652_0008068_2716_3468 | 250 |
| 670 | 3300046529 | Ga0495652_0024917 | Ga0495652_0024917_643_1395 | 250 |
| 671 | 3300046529 | Ga0495652_0260051 | Ga0495652_0260051_81_833 | 250 |
| 672 | 3300046531 | Ga0495665_0000452 | Ga0495665_0000452_15077_15829 | 250 |
| 673 | 3300046531 | Ga0495665_0010101 | Ga0495665_0010101_3437_4189 | 250 |
| 674 | 3300046531 | Ga0495665_0011227 | Ga0495665_0011227_2511_3263 | 250 |
| 675 | 3300046531 | Ga0495665_0037241 | Ga0495665_0037241_815_1567 | 250 |
| 676 | 3300046533 | Ga0495640_0037223 | Ga0495640_0037223_250_1002 | 250 |
| 677 | 3300046533 | Ga0495640_0098890 | Ga0495640_0098890_160_912 | 250 |
| 678 | 3300046533 | Ga0495640_0337397 | Ga0495640_0337397_108_860 | 250 |
| 679 | 3300046535 | Ga0495586_0023036 | Ga0495586_0023036_151_903 | 250 |
| 680 | 3300046535 | Ga0495586_0044200 | Ga0495586_0044200_906_1658 | 250 |
| 681 | 3300046535 | Ga0495586_0358524 | Ga0495586_0358524_25_777 | 250 |
| 682 | 3300046536 | Ga0495587_0001531 | Ga0495587_0001531_14544_15296 | 250 |
| 683 | 3300046536 | Ga0495587_0001904 | Ga0495587_0001904_9001_9753 | 250 |
| 684 | 3300046536 | Ga0495587_0002015 | Ga0495587_0002015_12436_13188 | 250 |
| 685 | 3300046536 | Ga0495587_0015466 | Ga0495587_0015466_1678_2430 | 250 |
| 686 | 3300046536 | Ga0495587_0138655 | Ga0495587_0138655_112_864 | 250 |
| 687 | 3300046537 | Ga0495598_0018359 | Ga0495598_0018359_300_1067 | 250 |
| 688 | 3300046539 | Ga0495621_0065986 | Ga0495621_0065986_458_1225 | 250 |
| 689 | 3300046543 | Ga0495645_0000383 | Ga0495645_0000383_25900_26652 | 250 |
| 690 | 3300046543 | Ga0495645_0000497 | Ga0495645_0000497_15818_16570 | 250 |
| 691 | 3300046543 | Ga0495645_0061136 | Ga0495645_0061136_881_1633 | 250 |
| 692 | 3300046559 | Ga0495667_0000495 | Ga0495667_0000495_10626_11378 | 250 |
| 693 | 3300046559 | Ga0495667_0001594 | Ga0495667_0001594_9712_10464 | 250 |
| 694 | 3300046559 | Ga0495667_0015720 | Ga0495667_0015720_2152_2904 | 250 |
| 695 | 3300046559 | Ga0495667_0212523 | Ga0495667_0212523_38_790 | 250 |
| 696 | 3300046642 | Ga0495634_0156662 | Ga0495634_0156662_127_879 | 250 |
| 697 | 3300046642 | Ga0495634_0391155 | Ga0495634_0391155_15_767 | 250 |
| 698 | 3300046663 | Ga0495635_0000120 | Ga0495635_0000120_1017_1769 | 250 |
| 699 | 3300046663 | Ga0495635_0071741 | Ga0495635_0071741_20_772 | 250 |
| 700 | 3300046663 | Ga0495635_0287120 | Ga0495635_0287120_279_1031 | 250 |
| 701 | 3300046663 | Ga0495635_0461804 | Ga0495635_0461804_76_828 | 250 |
| 702 | 3300046674 | Ga0495588_0002798 | Ga0495588_0002798_962_1714 | 250 |
| 703 | 3300046675 | Ga0495657_0000371 | Ga0495657_0000371_12108_12860 | 250 |
| 704 | 3300046675 | Ga0495657_0040167 | Ga0495657_0040167_1894_2646 | 250 |
| 705 | 3300046678 | Ga0495599_0000065 | Ga0495599_0000065_47974_48726 | 250 |
| 706 | 3300046678 | Ga0495599_0002260 | Ga0495599_0002260_1779_2531 | 250 |
| 707 | 3300046678 | Ga0495599_0108192 | Ga0495599_0108192_652_1404 | 250 |
| 708 | 3300046679 | Ga0495623_0000014 | Ga0495623_0000014_73058_73810 | 250 |
| 709 | 3300046679 | Ga0495623_0004186 | Ga0495623_0004186_6503_7255 | 250 |
| 710 | 3300046679 | Ga0495623_0062494 | Ga0495623_0062494_981_1751 | 250 |
| 711 | 3300046679 | Ga0495623_0140445 | Ga0495623_0140445_661_1413 | 250 |
| 712 | 3300046679 | Ga0495623_0165003 | Ga0495623_0165003_105_857 | 250 |
| 713 | 3300046680 | Ga0495646_0000129 | Ga0495646_0000129_12996_13748 | 250 |
| 714 | 3300046683 | Ga0495658_0000262 | Ga0495658_0000262_10221_10973 | 250 |
| 715 | 3300046683 | Ga0495658_0031519 | Ga0495658_0031519_1809_2561 | 250 |
| 716 | 3300046683 | Ga0495658_0191925 | Ga0495658_0191925_297_1049 | 250 |
| 717 | 3300046689 | Ga0495613_0006325 | Ga0495613_0006325_6166_6918 | 250 |
| 718 | 3300046809 | Ga0495600_0000105 | Ga0495600_0000105_41345_42097 | 250 |
| 719 | 3300046809 | Ga0495600_0020264 | Ga0495600_0020264_620_1372 | 250 |
| 720 | 3300046809 | Ga0495600_0026688 | Ga0495600_0026688_2636_3388 | 250 |
| 721 | 3300046809 | Ga0495600_0271260 | Ga0495600_0271260_216_968 | 250 |
| 722 | 3300046809 | Ga0495600_0350812 | Ga0495600_0350812_18_770 | 250 |
| 723 | 3300047315 | Ga0495581_0022559 | Ga0495581_0022559_1106_1858 | 250 |
| 724 | 3300047315 | Ga0495581_0111186 | Ga0495581_0111186_725_1477 | 250 |
| 725 | 3300047317 | Ga0495604_0000359 | Ga0495604_0000359_1648_2400 | 250 |
| 726 | 3300047317 | Ga0495604_0051132 | Ga0495604_0051132_1523_2275 | 250 |
| 727 | 3300047319 | Ga0495674_0000362 | Ga0495674_0000362_27933_28685 | 250 |
| 728 | 3300047319 | Ga0495674_0041917 | Ga0495674_0041917_348_1100 | 250 |
| 729 | 3300047320 | Ga0495672_0023597 | Ga0495672_0023597_2176_2928 | 250 |
| 730 | 3300047322 | Ga0495680_0003175 | Ga0495680_0003175_12964_13716 | 250 |
| 731 | 3300047322 | Ga0495680_0011402 | Ga0495680_0011402_5580_6332 | 250 |
| 732 | 3300047322 | Ga0495680_0046385 | Ga0495680_0046385_560_1312 | 250 |
| 733 | 3300047322 | Ga0495680_0403211 | Ga0495680_0403211_161_931 | 250 |
| 734 | 3300047444 | Ga0495675_0000748 | Ga0495675_0000748_13393_14145 | 250 |
| 735 | 3300047444 | Ga0495675_0023504 | Ga0495675_0023504_2166_2918 | 250 |
| 736 | 3300047444 | Ga0495675_0045490 | Ga0495675_0045490_1091_1861 | 250 |
| 737 | 3300047444 | Ga0495675_0098788 | Ga0495675_0098788_716_1468 | 250 |
| 738 | 3300047444 | Ga0495675_0334239 | Ga0495675_0334239_40_792 | 250 |
| 739 | 3300047471 | Ga0495684_0000288 | Ga0495684_0000288_38428_39180 | 250 |
| 740 | 3300047471 | Ga0495684_0005125 | Ga0495684_0005125_7875_8627 | 250 |
| 741 | 3300047471 | Ga0495684_0018431 | Ga0495684_0018431_159_911 | 250 |
| 742 | 3300047673 | Ga0495593_0010392 | Ga0495593_0010392_1096_1848 | 250 |
| 743 | 3300048088 | Ga0495602_0002905 | Ga0495602_0002905_15052_15804 | 250 |
| 744 | 3300048088 | Ga0495602_0030782 | Ga0495602_0030782_4039_4791 | 250 |
| 745 | 3300048088 | Ga0495602_0199776 | Ga0495602_0199776_105_857 | 250 |
| 746 | 3300048088 | Ga0495602_0231674 | Ga0495602_0231674_45_797 | 250 |
| 747 | 3300048089 | Ga0495614_0007574 | Ga0495614_0007574_1237_1989 | 250 |
| 748 | 3300048904 | Ga0496101_0127898 | Ga0496101_0127898_1099_1869 | 250 |
| 749 | 3300048905 | Ga0496102_0040439 | Ga0496102_0040439_1290_2042 | 250 |
| 750 | 3300048905 | Ga0496102_0320942 | Ga0496102_0320942_431_1183 | 250 |
| 751 | 3300048907 | Ga0496104_0102392 | Ga0496104_0102392_1836_2588 | 250 |
| 752 | 3300048907 | Ga0496104_0116285 | Ga0496104_0116285_1236_1988 | 250 |
| 753 | 3300048907 | Ga0496104_0365743 | Ga0496104_0365743_448_1218 | 250 |
| 754 | 3300048907 | Ga0496104_0582615 | Ga0496104_0582615_50_820 | 250 |
| 755 | 3300048908 | Ga0496105_0313801 | Ga0496105_0313801_358_1110 | 250 |
| 756 | 3300048908 | Ga0496105_0350510 | Ga0496105_0350510_302_1072 | 250 |
| 757 | 3300048911 | Ga0496108_0101549 | Ga0496108_0101549_897_1649 | 250 |
| 758 | 3300048911 | Ga0496108_0139713 | Ga0496108_0139713_835_1587 | 250 |
| 759 | 3300048911 | Ga0496108_0156687 | Ga0496108_0156687_716_1486 | 250 |
| 760 | 3300048911 | Ga0496108_0336327 | Ga0496108_0336327_55_825 | 250 |
| 761 | 3300048912 | Ga0496109_0118555 | Ga0496109_0118555_1662_2432 | 250 |
| 762 | 3300048912 | Ga0496109_0121547 | Ga0496109_0121547_56_808 | 250 |
| 763 | 3300048915 | Ga0496112_0015971 | Ga0496112_0015971_4887_5657 | 250 |
| 764 | 3300048915 | Ga0496112_0129628 | Ga0496112_0129628_730_1500 | 250 |
| 765 | 3300048915 | Ga0496112_0350850 | Ga0496112_0350850_345_1097 | 250 |
| 766 | 3300048916 | Ga0496113_0033639 | Ga0496113_0033639_2913_3683 | 250 |
| 767 | 3300048916 | Ga0496113_0091728 | Ga0496113_0091728_1508_2260 | 250 |
| 768 | 3300049522 | Ga0501299_013580 | Ga0501299_013580_215_973 | 250 |
| 769 | 3300049569 | Ga0501032_0219301 | Ga0501032_0219301_419_1171 | 250 |
| 770 | 3300049570 | Ga0501033_0004626 | Ga0501033_0004626_5507_6259 | 250 |
| 771 | 3300049571 | Ga0501034_0098870 | Ga0501034_0098870_1656_2408 | 250 |
| 772 | 3300049572 | Ga0501036_0123895 | Ga0501036_0123895_823_1575 | 250 |
| 773 | 3300049574 | Ga0501038_0045327 | Ga0501038_0045327_519_1271 | 250 |
| 774 | 3300049574 | Ga0501038_0364306 | Ga0501038_0364306_276_1028 | 250 |
| 775 | 3300049575 | Ga0501039_0123640 | Ga0501039_0123640_379_1131 | 250 |
| 776 | 3300049576 | Ga0501040_0173680 | Ga0501040_0173680_123_878 | 250 |
| 777 | 3300049576 | Ga0501040_0190484 | Ga0501040_0190484_623_1375 | 250 |
| 778 | 3300049577 | Ga0501041_0100478 | Ga0501041_0100478_579_1334 | 250 |
| 779 | 3300049579 | Ga0501043_0013304 | Ga0501043_0013304_2757_3509 | 250 |
| 780 | 3300049581 | Ga0501047_0011463 | Ga0501047_0011463_1949_2701 | 250 |
| 781 | 3300049581 | Ga0501047_0092525 | Ga0501047_0092525_912_1664 | 250 |
| 782 | 3300049581 | Ga0501047_0348014 | Ga0501047_0348014_530_1282 | 250 |
| 783 | 3300049582 | Ga0501048_0117578 | Ga0501048_0117578_1107_1859 | 250 |
| 784 | 3300049586 | Ga0501070_0061189 | Ga0501070_0061189_1883_2635 | 250 |
| 785 | 3300049586 | Ga0501070_0311122 | Ga0501070_0311122_48_800 | 250 |
| 786 | 3300049590 | Ga0501074_0343817 | Ga0501074_0343817_270_1022 | 250 |
| 787 | 3300049592 | Ga0501076_0030374 | Ga0501076_0030374_1884_2639 | 250 |
| 788 | 3300049593 | Ga0501077_0003877 | Ga0501077_0003877_2148_2900 | 250 |
| 789 | 3300049593 | Ga0501077_0187994 | Ga0501077_0187994_411_1166 | 250 |
| 790 | 3300049742 | Ga0501080_0038756 | Ga0501080_0038756_3538_4293 | 250 |
| 791 | 3300049742 | Ga0501080_0333320 | Ga0501080_0333320_510_1262 | 250 |
| 792 | 3300049743 | Ga0501081_0052927 | Ga0501081_0052927_1102_1857 | 250 |
| 793 | 3300049743 | Ga0501081_0186813 | Ga0501081_0186813_490_1242 | 250 |
| 794 | 3300049822 | Ga0501035_0216551 | Ga0501035_0216551_837_1604 | 250 |
| 795 | 3300049822 | Ga0501035_0349158 | Ga0501035_0349158_233_985 | 250 |
| 796 | 3300049823 | Ga0501044_0072931 | Ga0501044_0072931_164_931 | 250 |
| 797 | 3300049823 | Ga0501044_0356941 | Ga0501044_0356941_220_972 | 250 |
| 798 | 3300049824 | Ga0501045_0106883 | Ga0501045_0106883_1185_1940 | 250 |
| 799 | 3300050507 | nmdc:mga05p37_132137_c1 | nmdc:mga05p37_132137_c1_2210_2962 | 250 |
| 800 | 3300050507 | nmdc:mga05p37_155826_c1 | nmdc:mga05p37_155826_c1_834_1586 | 250 |
| 801 | 3300050507 | nmdc:mga05p37_165045_c1 | nmdc:mga05p37_165045_c1_1139_1891 | 250 |
| 802 | 3300050507 | nmdc:mga05p37_326868_c1 | nmdc:mga05p37_326868_c1_690_1442 | 250 |
| 803 | 3300050508 | nmdc:mga09592_99531_c1 | nmdc:mga09592_99531_c1_1027_1779 | 250 |
| 804 | 3300050509 | nmdc:mga0qj67_3500_c1 | nmdc:mga0qj67_3500_c1_8035_8787 | 250 |
| 805 | 3300050510 | nmdc:mga06r32_120099_c1 | nmdc:mga06r32_120099_c1_450_1202 | 250 |
| 806 | 3300050510 | nmdc:mga06r32_157808_c1 | nmdc:mga06r32_157808_c1_1015_1767 | 250 |
| 807 | 3300050510 | nmdc:mga06r32_46765_c1 | nmdc:mga06r32_46765_c1_655_1407 | 250 |
| 808 | 3300050510 | nmdc:mga06r32_580153_c1 | nmdc:mga06r32_580153_c1_306_1058 | 250 |
| 809 | 3300050511 | nmdc:mga08y16_284411_c1 | nmdc:mga08y16_284411_c1_876_1643 | 250 |
| 810 | 3300050511 | nmdc:mga08y16_390941_c1 | nmdc:mga08y16_390941_c1_606_1358 | 250 |
| 811 | 3300050511 | nmdc:mga08y16_663077_c1 | nmdc:mga08y16_663077_c1_28_780 | 250 |
| 812 | 3300050512 | nmdc:mga0n895_166893_c1 | nmdc:mga0n895_166893_c1_571_1323 | 250 |
| 813 | 3300050512 | nmdc:mga0n895_34022_c1 | nmdc:mga0n895_34022_c1_2993_3745 | 250 |
| 814 | 3300050512 | nmdc:mga0n895_48315_c1 | nmdc:mga0n895_48315_c1_2321_3088 | 250 |
| 815 | 3300050512 | nmdc:mga0n895_7448_c1 | nmdc:mga0n895_7448_c1_2279_3034 | 250 |
| 816 | 3300050513 | nmdc:mga0rr50_1947_c1 | nmdc:mga0rr50_1947_c1_8721_9476 | 250 |
| 817 | 3300050513 | nmdc:mga0rr50_219465_c1 | nmdc:mga0rr50_219465_c1_246_1001 | 250 |
| 818 | 3300050513 | nmdc:mga0rr50_241941_c1 | nmdc:mga0rr50_241941_c1_677_1429 | 250 |
| 819 | 3300050513 | nmdc:mga0rr50_63277_c1 | nmdc:mga0rr50_63277_c1_1728_2483 | 250 |
| 820 | 3300050514 | nmdc:mga08x19_352268_c1 | nmdc:mga08x19_352268_c1_136_888 | 250 |
| 821 | 3300050515 | nmdc:mga0a205_111874_c1 | nmdc:mga0a205_111874_c1_1389_2141 | 250 |
| 822 | 3300050515 | nmdc:mga0a205_545693_c1 | nmdc:mga0a205_545693_c1_204_959 | 250 |
| 823 | 3300053077 | Ga0495601_0001013 | Ga0495601_0001013_11672_12424 | 250 |
| 824 | 3300053078 | Ga0495612_0000636 | Ga0495612_0000636_10185_10937 | 250 |
| 825 | 3300053084 | Ga0495595_0026591 | Ga0495595_0026591_1382_2134 | 250 |
| 826 | 3300053084 | Ga0495595_0069728 | Ga0495595_0069728_597_1349 | 250 |
| 827 | 3300053084 | Ga0495595_0190320 | Ga0495595_0190320_75_827 | 250 |
| 828 | 3300053085 | Ga0495619_0001764 | Ga0495619_0001764_11972_12724 | 250 |
| 829 | 3300053085 | Ga0495619_0234348 | Ga0495619_0234348_207_959 | 250 |
| 830 | 3300054114 | Ga0501084_0016560 | Ga0501084_0016560_3718_4473 | 250 |
| 831 | 3300054114 | Ga0501084_0066227 | Ga0501084_0066227_2228_2980 | 250 |
| 832 | 3300059423 | Ga0590074_025282 | Ga0590074_025282_252_1004 | 250 |
| 833 | 3300059424 | Ga0590075_010266 | Ga0590075_010266_1051_1803 | 250 |
| 834 | 3300059426 | Ga0590077_033794 | Ga0590077_033794_50_802 | 250 |
| 835 | 3300060353 | Ga0501082_0052736 | Ga0501082_0052736_1335_2090 | 250 |
| 836 | 3300060353 | Ga0501082_0074105 | Ga0501082_0074105_1859_2611 | 250 |
| 837 | 3300061719 | Ga0466962_0251786 | Ga0466962_0251786_27_779 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t9g-assembly1.cif.gz_S | structure of the human mcad:etf complex | 0.9366 | 1 | 221 |
| 1o95-assembly1.cif.gz_E | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9163 | 1 | 221 |
| 1o95-assembly1.cif.gz_C | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9128 | 1 | 220 |
| 1t9g-assembly1.cif.gz_S | structure of the human mcad:etf complex | 0.9051 | 1 | 221 |
| 1efp-assembly2.cif.gz_D | electron transfer flavoprotein (etf) from paracoccus denitrificans | 0.8852 | 1 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t9gS00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9366 | 1 | 221 | 3.40.50.620 |
| 1o94C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9091 | 1 | 220 | 3.40.50.620 |
| 1t9gS00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9051 | 1 | 221 | 3.40.50.620 |
| af_Q9CAE9_66_360_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8881 | 144 | 170 | 2.120.10.80 |
| 4o2dB01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8773 | 144 | 169 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5VRZ0-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9792 | 32 | 173 |
GO:0009055
|
| AF-A0A800K6X5-F1-model_v4 | Electron transfer flavoprotein beta subunit/FixA family protein | 0.974 | 1 | 220 |
GO:0009055
|
| AF-A0A7C5RDI6-F1-model_v4 | Electron transfer flavoprotein beta subunit/FixA family protein | 0.9724 | 1 | 204 |
GO:0009055
|
| AF-A0A7V5IFK9-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9719 | 1 | 133 |
GO:0009055
|
| AF-A0A4R0BDJ9-F1-model_v4 | deleted | 0.9694 | 27 | 204 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar