F482915

General Info

Members Datasets Scaffolds Average Seq Length
836 367 1672 141

Family's Representative Sequence

Representative Sequence 3300050490|nmdc:mga03n38_203827_c1|nmdc:mga03n38_203827_c1_121_591
Length 156
Sequence MKRTPTFEGQRQMTQPDVSEATVSRDWLLTDMVRRVPEIGHAVLLSTDGLLLGASGEMNRDEADRLSAVASGFHSLAKGAGRHFGGGAVRQTVVEMEAGFLFVCAAGENAVLSTLTPDGADIGVVAYEMAMLVARLGEHLSVDSRTKELPDYRLKT

Samples

Sample ID Description Type Environment
1 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
2 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
110 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
111 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
112 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
113 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
114 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
115 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
121 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
149 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
175 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
176 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
177 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
178 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
179 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
180 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
181 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
182 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
227 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
228 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
244 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
245 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
282 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
285 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
292 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
300 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
301 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
304 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
310 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
311 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
313 2501939600 Micromonospora sp. L5 Isolate Unclassified
314 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
315 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
316 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
317 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
318 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
319 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
320 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
321 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
322 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
323 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
324 2855683550 Micromonospora sp. RP3T Isolate Unclassified
325 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
326 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
327 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
328 2858868258 Micromonospora sp. MH33 Isolate Unclassified
329 2858882152 Micromonospora noduli MED15 Isolate Nodule
330 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
331 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
332 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
333 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
334 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
335 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
336 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
337 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
338 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
339 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
340 2867475112 Streptomyces sp. TM32 Isolate Unclassified
341 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
342 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
343 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
344 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
345 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
346 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
347 2902582711 Micromonospora sp. AP08 Isolate Unclassified
348 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
349 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
350 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
351 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
352 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
353 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
354 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
355 649633069 Micromonospora sp. L5 Isolate Unclassified
356 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
357 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
358 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
359 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
360 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
361 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
362 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
363 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
364 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
365 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
366 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
367 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.46
Metatranscriptomes 0.24
Isolates 7.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.47
Nodule 0.6
Rhizoplane 2.03
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga03n38_203827_c1 3300050490 Bacteria 1025
2 JGI25160J50197_1022601 3300003354 Bacteria 1838
3 JGI25160J50197_1025476 3300003354 Bacteria 1654
4 Ga0070683_100007237 3300005329 Bacteria 9366
5 Ga0070683_100152472 3300005329 Bacteria 2191
6 Ga0070683_100713239 3300005329 Bacteria 961
7 Ga0070690_101291923 3300005330 Bacteria 584
8 Ga0068869_100087728 3300005334 Bacteria 2334
9 Ga0068869_100530155 3300005334 Bacteria 987
10 Ga0068869_100691510 3300005334 Bacteria 869
11 Ga0068869_100908760 3300005334 Bacteria 762
12 Ga0068869_101348292 3300005334 Bacteria 630
13 Ga0070682_100275910 3300005337 Bacteria 1223
14 Ga0068868_102246681 3300005338 Bacteria 520
15 Ga0070660_100787906 3300005339 Bacteria 799
16 Ga0070689_100458154 3300005340 Bacteria 1086
17 Ga0070687_101529837 3300005343 Bacteria 502
18 Ga0070661_100221310 3300005344 Bacteria 1452
19 Ga0070669_101795474 3300005353 Bacteria 535
20 Ga0070675_101300069 3300005354 Bacteria 670
21 Ga0070671_100584040 3300005355 Bacteria 965
22 Ga0070709_10063805 3300005434 Bacteria 2354
23 Ga0070709_10111954 3300005434 Bacteria 1836
24 Ga0070709_10142527 3300005434 Bacteria 1648
25 Ga0070709_10226933 3300005434 Bacteria 1334
26 Ga0070714_100000300 3300005435 Bacteria 37538
27 Ga0070714_100045116 3300005435 Bacteria 3734
28 Ga0070714_100066294 3300005435 Bacteria 3112
29 Ga0070714_100153000 3300005435 Bacteria 2080
30 Ga0070714_100155580 3300005435 Bacteria 2063
31 Ga0070714_100350755 3300005435 Bacteria 1386
32 Ga0070714_100488487 3300005435 Bacteria 1173
33 Ga0070714_100967969 3300005435 Bacteria 827
34 Ga0070713_100024601 3300005436 Bacteria 4694
35 Ga0070713_100063879 3300005436 Bacteria 3088
36 Ga0070713_100378789 3300005436 Bacteria 1318
37 Ga0070713_100438671 3300005436 Bacteria 1225
38 Ga0070713_101668982 3300005436 Bacteria 618
39 Ga0070710_10115447 3300005437 Bacteria 1618
40 Ga0070710_10125952 3300005437 Bacteria 1556
41 Ga0070710_10249480 3300005437 Bacteria 1140
42 Ga0070711_100521718 3300005439 Bacteria 982
43 Ga0070700_100708573 3300005441 Bacteria 801
44 Ga0070708_100092705 3300005445 Bacteria 2752
45 Ga0070708_100126480 3300005445 Bacteria 2363
46 Ga0070663_101933320 3300005455 Bacteria 530
47 Ga0070706_100525362 3300005467 Bacteria 1101
48 Ga0070706_100588249 3300005467 Bacteria 1034
49 Ga0070706_100608847 3300005467 Bacteria 1015
50 Ga0070707_100000443 3300005468 Bacteria 41092
51 Ga0070707_100007603 3300005468 Bacteria 10065
52 Ga0070707_100064205 3300005468 Bacteria 3525
53 Ga0070707_100314156 3300005468 Bacteria 1523
54 Ga0070698_100009111 3300005471 Bacteria 10659
55 Ga0070698_100045746 3300005471 Bacteria 4478
56 Ga0070698_100236237 3300005471 Bacteria 1761
57 Ga0070698_100472074 3300005471 Bacteria 1191
58 Ga0070684_100003402 3300005535 Bacteria 11937
59 Ga0070684_100051692 3300005535 Bacteria 3571
60 Ga0070684_100123607 3300005535 Bacteria 2329
61 Ga0070684_101430143 3300005535 Bacteria 651
62 Ga0070684_101668642 3300005535 Bacteria 601
63 Ga0070697_100036139 3300005536 Bacteria 3989
64 Ga0068853_102167446 3300005539 Bacteria 539
65 Ga0070672_100641471 3300005543 Bacteria 927
66 Ga0070693_100650629 3300005547 Bacteria 766
67 Ga0070704_101613626 3300005549 Bacteria 598
68 Ga0068855_100437349 3300005563 Bacteria 1429
69 Ga0068855_101156141 3300005563 Bacteria 807
70 Ga0070664_100088613 3300005564 Bacteria 2676
71 Ga0070664_100145904 3300005564 Bacteria 2087
72 Ga0070664_100235497 3300005564 Bacteria 1642
73 Ga0070664_100306138 3300005564 Bacteria 1437
74 Ga0068857_100059449 3300005577 Bacteria 3395
75 Ga0068857_100383853 3300005577 Bacteria 1305
76 Ga0068857_100426872 3300005577 Bacteria 1236
77 Ga0068857_100494570 3300005577 Bacteria 1147
78 Ga0068857_100910787 3300005577 Unclassified 843
79 Ga0068857_101317747 3300005577 Bacteria 701
80 Ga0068856_100112083 3300005614 Bacteria 2725
81 Ga0068856_101803321 3300005614 Bacteria 623
82 Ga0068852_101756371 3300005616 Bacteria 643
83 Ga0068859_100013820 3300005617 Bacteria 8096
84 Ga0068859_100348684 3300005617 Bacteria 1575
85 Ga0068859_102097484 3300005617 Bacteria 624
86 Ga0068864_100013574 3300005618 Bacteria 6753
87 Ga0068864_100068828 3300005618 Bacteria 3076
88 Ga0068864_100264281 3300005618 Bacteria 1601
89 Ga0068866_11040061 3300005718 Bacteria 584
90 Ga0068863_100000700 3300005841 Bacteria 33726
91 Ga0068863_100077869 3300005841 Bacteria 3138
92 Ga0068863_100126249 3300005841 Bacteria 2441
93 Ga0068863_100332931 3300005841 Bacteria 1476
94 Ga0068863_100677529 3300005841 Bacteria 1024
95 Ga0068858_100090244 3300005842 Bacteria 2851
96 Ga0068858_100111496 3300005842 Bacteria 2555
97 Ga0068858_100123563 3300005842 Bacteria 2422
98 Ga0068858_100221015 3300005842 Bacteria 1794
99 Ga0068862_100000496 3300005844 Bacteria 41859
100 Ga0068862_100238953 3300005844 Bacteria 1651
101 Ga0068862_101843964 3300005844 Bacteria 614
102 Ga0081455_10209483 3300005937 Bacteria 1453
103 Ga0081455_10374734 3300005937 Bacteria 996
104 Ga0081539_10037493 3300005985 Bacteria 2888
105 Ga0070717_10014741 3300006028 Bacteria 6014
106 Ga0070717_10042179 3300006028 Bacteria 3722
107 Ga0070717_10838179 3300006028 Bacteria 836
108 Ga0075363_100025241 3300006048 Bacteria 3029
109 Ga0070715_10006050 3300006163 Bacteria 4083
110 Ga0070715_10369146 3300006163 Bacteria 789
111 Ga0070716_100392659 3300006173 Bacteria 995
112 Ga0070712_100132989 3300006175 Bacteria 1888
113 Ga0070712_100186608 3300006175 Bacteria 1619
114 Ga0070712_100259735 3300006175 Bacteria 1391
115 Ga0097621_101155991 3300006237 Bacteria 728
116 Ga0075370_10195739 3300006353 Bacteria 1192
117 Ga0075428_100000410 3300006844 Bacteria 42619
118 Ga0075428_100084277 3300006844 Bacteria 3468
119 Ga0075428_100086491 3300006844 Bacteria 3419
120 Ga0075428_100091820 3300006844 Bacteria 3311
121 Ga0075428_100103739 3300006844 Bacteria 3101
122 Ga0075428_100625413 3300006844 Bacteria 1149
123 Ga0075428_100689374 3300006844 Bacteria 1088
124 Ga0075428_101630888 3300006844 Bacteria 674
125 Ga0075430_100037253 3300006846 Bacteria 4123
126 Ga0075430_100382671 3300006846 Bacteria 1161
127 Ga0075431_100002781 3300006847 Bacteria 16939
128 Ga0075431_100078274 3300006847 Bacteria 3413
129 Ga0075431_100175579 3300006847 Bacteria 2201
130 Ga0075431_100182905 3300006847 Bacteria 2151
131 Ga0075431_101331442 3300006847 Bacteria 679
132 Ga0075434_100225156 3300006871 Bacteria 1895
133 Ga0075429_100005553 3300006880 Bacteria 10865
134 Ga0075429_100052579 3300006880 Bacteria 3544
135 Ga0075429_100857265 3300006880 Bacteria 795
136 Ga0075436_100164328 3300006914 Bacteria 1566
137 Ga0097620_100000147 3300006931 Bacteria 66782
138 Ga0097620_100013820 3300006931 Bacteria 8096
139 Ga0097620_100348668 3300006931 Bacteria 1575
140 Ga0097620_102097190 3300006931 Bacteria 624
141 Ga0075435_100221168 3300007076 Bacteria 1608
142 Ga0105251_10091925 3300009011 Bacteria 1393
143 Ga0111539_10671224 3300009094 Bacteria 1207
144 Ga0111539_10889792 3300009094 Bacteria 1036
145 Ga0105247_11171757 3300009101 Bacteria 610
146 Ga0114129_10000074 3300009147 Bacteria 92340
147 Ga0114129_10011584 3300009147 Bacteria 12556
148 Ga0114129_10196033 3300009147 Bacteria 2739
149 Ga0105243_12568365 3300009148 Bacteria 549
150 Ga0105248_10000140 3300009177 Bacteria 82939
151 Ga0105248_10018715 3300009177 Bacteria 7657
152 Ga0105248_10063798 3300009177 Bacteria 4135
153 Ga0105237_10174445 3300009545 Bacteria 2150
154 Ga0105249_10221928 3300009553 Bacteria 1860
155 Ga0105239_11087192 3300010375 Bacteria 920
156 Ga0105246_10999714 3300011119 Bacteria 757
157 Ga0105246_11675819 3300011119 Bacteria 603
158 Ga0163162_11469355 3300013306 Bacteria 776
159 Ga0157375_10531883 3300013308 Bacteria 1338
160 Ga0157375_11402215 3300013308 Bacteria 823
161 Ga0157375_12164131 3300013308 Bacteria 662
162 Ga0163163_10005388 3300014325 Bacteria 11058
163 Ga0163163_10031208 3300014325 Bacteria 5142
164 Ga0163163_10310199 3300014325 Bacteria 1630
165 Ga0163163_10403430 3300014325 Bacteria 1425
166 Ga0163163_12839450 3300014325 Bacteria 540
167 Ga0157380_10220725 3300014326 Bacteria 1696
168 Ga0157379_10026081 3300014968 Bacteria 5200
169 Ga0157379_10185479 3300014968 Bacteria 1880
170 Ga0157379_10339279 3300014968 Bacteria 1374
171 Ga0157379_11864873 3300014968 Bacteria 592
172 Ga0213875_10000434 3300021388 Bacteria 36586
173 Ga0213875_10011254 3300021388 Bacteria 4456
174 Ga0209758_1001975 3300025297 Bacteria 22162
175 Ga0207426_1001521 3300025302 Bacteria 18901
176 Ga0207426_1002500 3300025302 Bacteria 11622
177 Ga0207426_1009989 3300025302 Bacteria 3714
178 Ga0207426_1086150 3300025302 Bacteria 841
179 Ga0207713_1047887 3300025735 Bacteria 1726
180 Ga0207713_1090628 3300025735 Bacteria 1075
181 Ga0207692_10008020 3300025898 Bacteria 4356
182 Ga0207692_10055607 3300025898 Bacteria 2027
183 Ga0207642_10951580 3300025899 Bacteria 552
184 Ga0207699_10003758 3300025906 Bacteria 7250
185 Ga0207699_10033859 3300025906 Bacteria 2892
186 Ga0207699_10159314 3300025906 Bacteria 1501
187 Ga0207699_10192299 3300025906 Bacteria 1378
188 Ga0207699_10214783 3300025906 Bacteria 1310
189 Ga0207684_10001900 3300025910 Bacteria 21709
190 Ga0207684_10004260 3300025910 Bacteria 13564
191 Ga0207684_11012994 3300025910 Bacteria 694
192 Ga0207684_11474564 3300025910 Bacteria 554
193 Ga0207671_10925576 3300025914 Bacteria 689
194 Ga0207693_10014261 3300025915 Bacteria 6392
195 Ga0207693_10022909 3300025915 Bacteria 4959
196 Ga0207693_10474331 3300025915 Bacteria 977
197 Ga0207663_10001437 3300025916 Bacteria 11071
198 Ga0207663_10072007 3300025916 Bacteria 2232
199 Ga0207649_11108857 3300025920 Bacteria 624
200 Ga0207646_10000315 3300025922 Bacteria 65468
201 Ga0207646_10042871 3300025922 Bacteria 4065
202 Ga0207646_10072110 3300025922 Bacteria 3085
203 Ga0207646_10077738 3300025922 Bacteria 2965
204 Ga0207700_10000906 3300025928 Bacteria 17010
205 Ga0207700_10013663 3300025928 Bacteria 5292
206 Ga0207700_10034548 3300025928 Bacteria 3631
207 Ga0207700_10519990 3300025928 Bacteria 1054
208 Ga0207700_10539611 3300025928 Bacteria 1034
209 Ga0207664_10004526 3300025929 Bacteria 9420
210 Ga0207664_10051928 3300025929 Bacteria 3240
211 Ga0207664_10106654 3300025929 Bacteria 2323
212 Ga0207664_10129564 3300025929 Bacteria 2122
213 Ga0207664_10135937 3300025929 Bacteria 2074
214 Ga0207664_10208306 3300025929 Bacteria 1691
215 Ga0207664_10243531 3300025929 Bacteria 1567
216 Ga0207664_10348587 3300025929 Bacteria 1310
217 Ga0207644_10288266 3300025931 Bacteria 1320
218 Ga0207644_10288742 3300025931 Bacteria 1319
219 Ga0207670_10335133 3300025936 Bacteria 1194
220 Ga0207670_10399493 3300025936 Bacteria 1098
221 Ga0207665_10005666 3300025939 Bacteria 8320
222 Ga0207665_10014454 3300025939 Bacteria 5199
223 Ga0207665_10617839 3300025939 Bacteria 847
224 Ga0207691_10592044 3300025940 Bacteria 939
225 Ga0207711_10000182 3300025941 Bacteria 67307
226 Ga0207711_10068651 3300025941 Bacteria 3070
227 Ga0207711_10092030 3300025941 Bacteria 2668
228 Ga0207711_10110324 3300025941 Bacteria 2446
229 Ga0207689_10094420 3300025942 Bacteria 2456
230 Ga0207689_10257265 3300025942 Bacteria 1444
231 Ga0207689_10907337 3300025942 Bacteria 743
232 Ga0207689_11105795 3300025942 Bacteria 668
233 Ga0207661_10000353 3300025944 Bacteria 29617
234 Ga0207661_10221146 3300025944 Bacteria 1674
235 Ga0207661_12009053 3300025944 Bacteria 524
236 Ga0207679_10176781 3300025945 Bacteria 1763
237 Ga0207679_10189485 3300025945 Bacteria 1709
238 Ga0207679_10197476 3300025945 Bacteria 1678
239 Ga0207679_10431965 3300025945 Bacteria 1164
240 Ga0207667_10298566 3300025949 Bacteria 1646
241 Ga0207712_10012209 3300025961 Bacteria 5488
242 Ga0207658_11550570 3300025986 Bacteria 606
243 Ga0207703_10105706 3300026035 Bacteria 2393
244 Ga0207703_10167299 3300026035 Bacteria 1931
245 Ga0207703_10727640 3300026035 Bacteria 945
246 Ga0207639_11986656 3300026041 Bacteria 543
247 Ga0207708_10282058 3300026075 Bacteria 1346
248 Ga0207708_10689509 3300026075 Bacteria 872
249 Ga0207702_10323577 3300026078 Bacteria 1469
250 Ga0207702_10937147 3300026078 Bacteria 858
251 Ga0207641_10079947 3300026088 Bacteria 2835
252 Ga0207641_10145659 3300026088 Bacteria 2141
253 Ga0207641_11047976 3300026088 Bacteria 813
254 Ga0207676_10219173 3300026095 Bacteria 1693
255 Ga0207674_10195154 3300026116 Bacteria 1974
256 Ga0207674_10443182 3300026116 Bacteria 1255
257 Ga0207674_10498325 3300026116 Bacteria 1177
258 Ga0207674_11389826 3300026116 Bacteria 671
259 Ga0268265_10000413 3300028380 Bacteria 45876
260 Ga0268265_10183111 3300028380 Bacteria 1802
261 Ga0265337_1000568 3300028556 Bacteria 19391
262 Ga0265326_10000761 3300028558 Bacteria 11931
263 Ga0265319_1001323 3300028563 Bacteria 14960
264 Ga0265334_10000557 3300028573 Bacteria 19003
265 Ga0265323_10004390 3300028653 Bacteria 6077
266 Ga0265322_10090262 3300028654 Bacteria 870
267 Ga0265336_10017992 3300028666 Bacteria 2294
268 Ga0307515_10206083 3300028794 Bacteria 1826
269 Ga0265338_10000144 3300028800 Bacteria 131848
270 Ga0265324_10003399 3300029957 Bacteria 7603
271 Ga0307511_10183370 3300030521 Bacteria 1123
272 Ga0307512_10001813 3300030522 Bacteria 28864
273 Ga0265763_1000467 3300030763 Bacteria 2448
274 Ga0265773_1035420 3300031018 Unclassified 554
275 Ga0265332_10000695 3300031238 Bacteria 21472
276 Ga0265320_10001390 3300031240 Bacteria 17603
277 Ga0265325_10006817 3300031241 Bacteria 6905
278 Ga0265329_10176844 3300031242 Bacteria 697
279 Ga0265340_10200463 3300031247 Bacteria 897
280 Ga0265339_10023336 3300031249 Bacteria 3578
281 Ga0265331_10097117 3300031250 Bacteria 1358
282 Ga0265316_10028372 3300031344 Bacteria 4618
283 Ga0307509_10101912 3300031507 Bacteria 2904
284 Ga0307408_100086481 3300031548 Bacteria 2357
285 Ga0307408_101791612 3300031548 Bacteria 587
286 Ga0265313_10011165 3300031595 Bacteria 5600
287 Ga0307508_10040997 3300031616 Bacteria 4156
288 Ga0307508_10075180 3300031616 Bacteria 2955
289 Ga0307508_10098242 3300031616 Bacteria 2520
290 Ga0265314_10003956 3300031711 Bacteria 14048
291 Ga0265342_10002972 3300031712 Bacteria 14234
292 Ga0307516_10126922 3300031730 Bacteria 2335
293 Ga0307405_10000189 3300031731 Bacteria 22844
294 Ga0307405_10013891 3300031731 Bacteria 4310
295 Ga0307405_10360160 3300031731 Bacteria 1125
296 Ga0307413_10060315 3300031824 Bacteria 2335
297 Ga0307413_10097148 3300031824 Bacteria 1936
298 Ga0307413_11487363 3300031824 Bacteria 598
299 Ga0307410_10001690 3300031852 Bacteria 10154
300 Ga0307410_10010542 3300031852 Bacteria 5243
301 Ga0307406_10002418 3300031901 Bacteria 10151
302 Ga0307406_10007926 3300031901 Bacteria 5913
303 Ga0307406_10111703 3300031901 Bacteria 1883
304 Ga0307406_10178473 3300031901 Bacteria 1544
305 Ga0307406_10316027 3300031901 Bacteria 1206
306 Ga0307406_10813212 3300031901 Bacteria 789
307 Ga0307407_10051555 3300031903 Bacteria 2359
308 Ga0307407_10088296 3300031903 Bacteria 1894
309 Ga0307412_10046314 3300031911 Bacteria 2849
310 Ga0307412_10240343 3300031911 Bacteria 1400
311 Ga0307412_11843828 3300031911 Bacteria 557
312 Ga0307409_100000338 3300031995 Bacteria 19399
313 Ga0307409_100002075 3300031995 Bacteria 10304
314 Ga0307409_100170281 3300031995 Bacteria 1916
315 Ga0307416_100000376 3300032002 Bacteria 23110
316 Ga0307416_100001743 3300032002 Bacteria 12038
317 Ga0307416_101840992 3300032002 Bacteria 709
318 Ga0307411_10298405 3300032005 Bacteria 1291
319 Ga0307415_100000002 3300032126 Bacteria 133560
320 Ga0307415_100000098 3300032126 Bacteria 36905
321 Ga0307415_100037428 3300032126 Bacteria 3189
322 Ga0307415_100038750 3300032126 Bacteria 3144
323 Ga0307415_100099327 3300032126 Bacteria 2130
324 Ga0307415_101308253 3300032126 Bacteria 687
325 Ga0307415_101492403 3300032126 Bacteria 646
326 Ga0307507_10012369 3300033179 Bacteria 10552
327 Ga0307507_10200254 3300033179 Bacteria 1383
328 Ga0316214_1069526 3300033545 Bacteria 519
329 Ga0373926_0003191 3300035083 Bacteria 5267
330 Ga0373926_0298621 3300035083 Bacteria 628
331 Ga0373934_0034051 3300035086 Bacteria 2001
332 Ga0373944_0000521 3300035089 Bacteria 9004
333 Ga0373923_0044000 3300035111 Bacteria 1849
334 Ga0373923_0095632 3300035111 Bacteria 1304
335 Ga0373936_0000194 3300035113 Bacteria 20266
336 Ga0373936_0005154 3300035113 Bacteria 4919
337 Ga0373936_0142741 3300035113 Bacteria 1034
338 Ga0373945_0000440 3300035116 Bacteria 11738
339 Ga0373945_0133515 3300035116 Bacteria 996
340 Ga0373953_0002891 3300035117 Bacteria 5243
341 Ga0373953_0003111 3300035117 Bacteria 5113
342 Ga0373954_0012385 3300035118 Bacteria 3791
343 Ga0373954_0036835 3300035118 Bacteria 2272
344 Ga0373956_0008684 3300035119 Bacteria 4114
345 Ga0373956_0047477 3300035119 Bacteria 1921
346 Ga0373957_0000467 3300035120 Bacteria 10237
347 Ga0373957_0472187 3300035120 Bacteria 544
348 Ga0373943_0000238 3300035170 Bacteria 22659
349 Ga0373943_0043119 3300035170 Bacteria 2190
350 Ga0373943_0137194 3300035170 Bacteria 1315
351 Ga0373943_0514688 3300035170 Bacteria 700
352 Ga0373943_0805574 3300035170 Bacteria 559
353 Ga0373955_0040840 3300035172 Bacteria 2483
354 Ga0373955_0062433 3300035172 Bacteria 2060
355 Ga0373955_0175369 3300035172 Bacteria 1270
356 Ga0373955_0883060 3300035172 Bacteria 550
357 Ga0373924_0000923 3300035410 Bacteria 9270
358 Ga0373924_0054879 3300035410 Bacteria 1657
359 Ga0373924_0087775 3300035410 Bacteria 1328
360 Ga0373931_0295606 3300035691 Bacteria 999
361 Ga0373931_0654589 3300035691 Bacteria 691
362 Ga0373935_0008808 3300035692 Bacteria 6044
363 Ga0373935_0011996 3300035692 Bacteria 5208
364 Ga0373935_0096212 3300035692 Bacteria 1945
365 Ga0373935_0174887 3300035692 Bacteria 1471
366 Ga0373927_0002463 3300035695 Bacteria 13507
367 Ga0373927_0064050 3300035695 Bacteria 2378
368 Ga0373933_0011718 3300035724 Bacteria 4839
369 Ga0373933_0090481 3300035724 Bacteria 1887
370 Ga0373947_0003136 3300035725 Bacteria 9834
371 Ga0373947_0053424 3300035725 Bacteria 2436
372 Ga0373947_0125993 3300035725 Bacteria 1631
373 Ga0373937_0008663 3300036401 Bacteria 8838
374 Ga0373937_0027843 3300036401 Bacteria 5113
375 Ga0373937_1652472 3300036401 Bacteria 587
376 Ga0373925_0001666 3300037068 Bacteria 18705
377 Ga0373925_0001907 3300037068 Bacteria 17309
378 Ga0373925_0005446 3300037068 Bacteria 9479
379 Ga0373925_0013568 3300037068 Bacteria 5898
380 Ga0373925_0222442 3300037068 Bacteria 1507
381 Ga0373925_0337781 3300037068 Bacteria 1221
382 Ga0373925_0358839 3300037068 Bacteria 1184
383 Ga0373925_0365485 3300037068 Bacteria 1173
384 Ga0373925_0559486 3300037068 Bacteria 941
385 Ga0395900_0390910 3300037418 Bacteria 1357
386 Ga0395898_0387439 3300037466 Bacteria 1333
387 Ga0436364_0760857 3300037853 Bacteria 518
388 Ga0436364_1031212 3300037853 Bacteria 64667
389 Ga0436364_1365294 3300037853 Bacteria 7664
390 Ga0451853_0365953 3300041512 Bacteria 4675
391 Ga0451853_2760413 3300041512 Bacteria 1191
392 Ga0439449_0000850 3300042007 Bacteria 11858
393 Ga0439457_009351 3300042014 Bacteria 2284
394 Ga0439457_068989 3300042014 Bacteria 805
395 Ga0450894_000021 3300042131 Bacteria 21934
396 Ga0450899_000365 3300042135 Bacteria 5015
397 Ga0450900_062231 3300042136 Bacteria 584
398 Ga0450906_003322 3300042145 Bacteria 3472
399 Ga0450907_008826 3300042146 Bacteria 1672
400 Ga0450908_006277 3300042184 Bacteria 2262
401 Ga0439434_0155705 3300042435 Bacteria 758
402 Ga0466969_0025722 3300044656 Bacteria 3024
403 Ga0466969_0061342 3300044656 Bacteria 1826
404 Ga0466969_0167954 3300044656 Bacteria 1006
405 Ga0466972_0002024 3300044658 Bacteria 9925
406 Ga0466972_0011716 3300044658 Bacteria 4403
407 Ga0466965_0002853 3300044683 Bacteria 7455
408 Ga0466965_0052326 3300044683 Bacteria 2028
409 Ga0466966_0001829 3300044684 Bacteria 13802
410 Ga0466966_0004992 3300044684 Bacteria 8723
411 Ga0466966_0025912 3300044684 Bacteria 3830
412 Ga0466961_0000531 3300044693 Bacteria 24191
413 Ga0466961_0086168 3300044693 Bacteria 1985
414 Ga0466961_0255898 3300044693 Bacteria 1074
415 Ga0466963_0012167 3300044694 Bacteria 5259
416 Ga0466963_0087167 3300044694 Bacteria 2122
417 Ga0466963_0397113 3300044694 Bacteria 972
418 Ga0466963_0727758 3300044694 Bacteria 700
419 Ga0466963_0768842 3300044694 Bacteria 679
420 Ga0466964_0566640 3300044706 Bacteria 619
421 Ga0466971_0000247 3300044719 Bacteria 20764
422 Ga0466971_0084888 3300044719 Bacteria 1446
423 Ga0466971_0094034 3300044719 Bacteria 1374
424 Ga0466970_0008217 3300044765 Bacteria 5241
425 Ga0466957_0016961 3300044842 Bacteria 4261
426 Ga0466957_0086430 3300044842 Bacteria 1960
427 Ga0466957_0126758 3300044842 Bacteria 1632
428 Ga0466957_0353132 3300044842 Bacteria 998
429 Ga0466959_0001026 3300045049 Bacteria 16663
430 Ga0466959_0028003 3300045049 Bacteria 4178
431 Ga0466959_0066583 3300045049 Bacteria 2613
432 Ga0466959_0071062 3300045049 Bacteria 2521
433 Ga0466967_0001642 3300045976 Bacteria 13215
434 Ga0466967_0024496 3300045976 Bacteria 4963
435 Ga0466967_0453382 3300045976 Bacteria 1254
436 Ga0466967_0600944 3300045976 Bacteria 1086
437 Ga0466967_0713157 3300045976 Bacteria 994
438 Ga0466967_1697886 3300045976 Bacteria 629
439 Ga0466967_1796462 3300045976 Bacteria 610
440 Ga0495592_0018609 3300046454 Bacteria 5286
441 Ga0495592_0090365 3300046454 Bacteria 2197
442 Ga0495592_0090977 3300046454 Bacteria 2188
443 Ga0495592_0131686 3300046454 Bacteria 1748
444 Ga0495592_0230873 3300046454 Bacteria 1232
445 Ga0495603_0004349 3300046455 Bacteria 8451
446 Ga0495603_0008962 3300046455 Bacteria 6048
447 Ga0495629_0004766 3300046459 Bacteria 10168
448 Ga0495629_0006156 3300046459 Bacteria 8908
449 Ga0495629_0010472 3300046459 Bacteria 6746
450 Ga0495629_0097843 3300046459 Bacteria 2047
451 Ga0495638_0368646 3300046460 Bacteria 753
452 Ga0495641_0006254 3300046461 Bacteria 7761
453 Ga0495641_0010448 3300046461 Bacteria 5379
454 Ga0495651_0006618 3300046462 Bacteria 8848
455 Ga0495651_0013817 3300046462 Bacteria 6245
456 Ga0495651_0081745 3300046462 Bacteria 2438
457 Ga0495651_0122381 3300046462 Bacteria 1909
458 Ga0495651_0293025 3300046462 Bacteria 1094
459 Ga0495651_0352876 3300046462 Bacteria 971
460 Ga0495653_0001909 3300046463 Bacteria 16441
461 Ga0495653_0021492 3300046463 Bacteria 5228
462 Ga0495653_0022258 3300046463 Bacteria 5130
463 Ga0495653_0023520 3300046463 Bacteria 4975
464 Ga0495580_0060867 3300046472 Bacteria 2652
465 Ga0495582_0003023 3300046473 Bacteria 9425
466 Ga0495582_0151167 3300046473 Bacteria 1318
467 Ga0495639_0004896 3300046475 Bacteria 5746
468 Ga0495639_0053950 3300046475 Bacteria 1832
469 Ga0495639_0270244 3300046475 Bacteria 843
470 Ga0495662_0002214 3300046476 Bacteria 9803
471 Ga0495662_0002353 3300046476 Bacteria 9525
472 Ga0495662_0003118 3300046476 Bacteria 8358
473 Ga0495662_0004039 3300046476 Bacteria 7389
474 Ga0495662_0095975 3300046476 Bacteria 1449
475 Ga0495664_0000247 3300046477 Bacteria 26024
476 Ga0495664_0000316 3300046477 Bacteria 23212
477 Ga0495664_0002335 3300046477 Bacteria 10163
478 Ga0495664_0015093 3300046477 Bacteria 4388
479 Ga0495594_0111957 3300046499 Bacteria 1539
480 Ga0495594_0164692 3300046499 Bacteria 1261
481 Ga0495608_0010772 3300046511 Bacteria 6373
482 Ga0495608_0025446 3300046511 Bacteria 4040
483 Ga0495608_0107372 3300046511 Bacteria 1796
484 Ga0495618_0021245 3300046514 Bacteria 4001
485 Ga0495618_0021603 3300046514 Bacteria 3968
486 Ga0495618_0105798 3300046514 Bacteria 1801
487 Ga0495618_0109315 3300046514 Bacteria 1770
488 Ga0495628_0014905 3300046516 Bacteria 6500
489 Ga0495628_0018429 3300046516 Bacteria 5782
490 Ga0495628_0409051 3300046516 Bacteria 990
491 Ga0495628_1216557 3300046516 Bacteria 510
492 Ga0495630_0044758 3300046517 Bacteria 3308
493 Ga0495630_0047829 3300046517 Bacteria 3200
494 Ga0495630_0119896 3300046517 Bacteria 1996
495 Ga0495630_0144420 3300046517 Bacteria 1809
496 Ga0495630_0207819 3300046517 Bacteria 1494
497 Ga0495630_0209003 3300046517 Bacteria 1489
498 Ga0495630_0234413 3300046517 Bacteria 1402
499 Ga0495630_0293546 3300046517 Bacteria 1242
500 Ga0495666_0000742 3300046526 Bacteria 14986
501 Ga0495666_0188388 3300046526 Bacteria 951
502 Ga0495666_0202819 3300046526 Bacteria 911
503 Ga0495652_0001917 3300046529 Bacteria 22128
504 Ga0495652_0066412 3300046529 Bacteria 3027
505 Ga0495652_0201992 3300046529 Bacteria 1507
506 Ga0495665_0003609 3300046531 Bacteria 8402
507 Ga0495665_0004092 3300046531 Bacteria 7858
508 Ga0495665_0543568 3300046531 Bacteria 583
509 Ga0495640_0017843 3300046533 Bacteria 5278
510 Ga0495640_0038410 3300046533 Bacteria 3367
511 Ga0495640_0115938 3300046533 Bacteria 1745
512 Ga0495640_0342323 3300046533 Bacteria 924
513 Ga0495640_0773630 3300046533 Bacteria 573
514 Ga0495586_0006159 3300046535 Bacteria 6415
515 Ga0495586_0069625 3300046535 Bacteria 1920
516 Ga0495586_0103792 3300046535 Bacteria 1579
517 Ga0495586_0166944 3300046535 Bacteria 1243
518 Ga0495587_0001362 3300046536 Bacteria 16198
519 Ga0495587_0033397 3300046536 Bacteria 3106
520 Ga0495587_0048122 3300046536 Bacteria 2526
521 Ga0495587_0166307 3300046536 Bacteria 1254
522 Ga0495587_0674119 3300046536 Bacteria 567
523 Ga0495645_0030273 3300046543 Bacteria 3941
524 Ga0495645_0037276 3300046543 Bacteria 3543
525 Ga0495645_0063365 3300046543 Bacteria 2677
526 Ga0495645_0176786 3300046543 Bacteria 1465
527 Ga0495645_0816324 3300046543 Bacteria 558
528 Ga0495633_0359551 3300046558 Bacteria 659
529 Ga0495667_0004115 3300046559 Bacteria 9774
530 Ga0495667_0007662 3300046559 Bacteria 7325
531 Ga0495667_0025011 3300046559 Bacteria 4024
532 Ga0495667_0087561 3300046559 Bacteria 2019
533 Ga0495667_0321133 3300046559 Bacteria 980
534 Ga0495667_0387061 3300046559 Bacteria 881
535 Ga0495656_0137023 3300046615 Bacteria 1170
536 Ga0495634_0005386 3300046642 Bacteria 9858
537 Ga0495634_0025122 3300046642 Bacteria 4173
538 Ga0495634_0090445 3300046642 Bacteria 1988
539 Ga0495634_0186145 3300046642 Bacteria 1297
540 Ga0495634_0243754 3300046642 Bacteria 1101
541 Ga0495634_0609373 3300046642 Bacteria 633
542 Ga0495635_0000167 3300046663 Bacteria 40888
543 Ga0495635_0003202 3300046663 Bacteria 11285
544 Ga0495635_0008825 3300046663 Bacteria 7040
545 Ga0495635_0042469 3300046663 Bacteria 3139
546 Ga0495635_0052118 3300046663 Bacteria 2818
547 Ga0495635_0075774 3300046663 Bacteria 2304
548 Ga0495635_0396581 3300046663 Bacteria 917
549 Ga0495661_0107077 3300046665 Bacteria 1563
550 Ga0495588_0002910 3300046674 Bacteria 7383
551 Ga0495657_0000773 3300046675 Bacteria 28412
552 Ga0495657_0001338 3300046675 Bacteria 21439
553 Ga0495657_0018126 3300046675 Bacteria 5100
554 Ga0495657_0030586 3300046675 Bacteria 3769
555 Ga0495657_0061939 3300046675 Bacteria 2473
556 Ga0495657_0318688 3300046675 Bacteria 924
557 Ga0495599_0034805 3300046678 Bacteria 3163
558 Ga0495599_0075500 3300046678 Bacteria 2104
559 Ga0495599_0318435 3300046678 Bacteria 936
560 Ga0495623_0031456 3300046679 Bacteria 3411
561 Ga0495623_0066758 3300046679 Bacteria 2247
562 Ga0495623_0083640 3300046679 Bacteria 1970
563 Ga0495623_0149472 3300046679 Bacteria 1382
564 Ga0495623_0263528 3300046679 Bacteria 964
565 Ga0495646_0001609 3300046680 Bacteria 13429
566 Ga0495646_0005504 3300046680 Bacteria 8009
567 Ga0495646_0029330 3300046680 Bacteria 3439
568 Ga0495646_0044251 3300046680 Bacteria 2722
569 Ga0495647_0040917 3300046681 Bacteria 1763
570 Ga0495658_0005075 3300046683 Bacteria 6469
571 Ga0495658_0036706 3300046683 Bacteria 2705
572 Ga0495613_0032948 3300046689 Bacteria 3849
573 Ga0495613_0043331 3300046689 Bacteria 3329
574 Ga0495613_0115006 3300046689 Bacteria 1936
575 Ga0495613_0236408 3300046689 Bacteria 1278
576 Ga0495613_1093319 3300046689 Bacteria 509
577 Ga0495624_0007830 3300046690 Bacteria 7498
578 Ga0495624_0014916 3300046690 Bacteria 5262
579 Ga0495624_0565966 3300046690 Bacteria 678
580 Ga0495671_0192197 3300046692 Bacteria 991
581 Ga0495589_0246121 3300046794 Bacteria 836
582 Ga0495600_0012852 3300046809 Bacteria 5244
583 Ga0495600_0032630 3300046809 Bacteria 3379
584 Ga0495600_0054189 3300046809 Bacteria 2619
585 Ga0495600_0104179 3300046809 Bacteria 1848
586 Ga0495600_0177786 3300046809 Bacteria 1372
587 Ga0495581_0009288 3300047315 Bacteria 5691
588 Ga0495581_0017432 3300047315 Bacteria 4171
589 Ga0495581_0021811 3300047315 Bacteria 3711
590 Ga0495581_0174472 3300047315 Bacteria 1257
591 Ga0495604_0001147 3300047317 Bacteria 21946
592 Ga0495604_0016962 3300047317 Bacteria 5824
593 Ga0495604_0031311 3300047317 Bacteria 4219
594 Ga0495604_0069299 3300047317 Bacteria 2674
595 Ga0495636_0001180 3300047318 Bacteria 9852
596 Ga0495636_0018480 3300047318 Bacteria 2797
597 Ga0495674_0003289 3300047319 Bacteria 15694
598 Ga0495674_0079561 3300047319 Bacteria 2814
599 Ga0495674_0297551 3300047319 Bacteria 1318
600 Ga0495674_0808380 3300047319 Bacteria 729
601 Ga0495676_0002649 3300047321 Bacteria 16011
602 Ga0495676_0008469 3300047321 Bacteria 9423
603 Ga0495676_0252125 3300047321 Bacteria 1203
604 Ga0495680_0015558 3300047322 Bacteria 6562
605 Ga0495680_0016758 3300047322 Bacteria 6282
606 Ga0495680_0033499 3300047322 Bacteria 4157
607 Ga0495680_0420955 3300047322 Bacteria 919
608 Ga0495675_0010973 3300047444 Bacteria 5679
609 Ga0495675_0013249 3300047444 Bacteria 5204
610 Ga0495675_0018093 3300047444 Bacteria 4468
611 Ga0495675_0018701 3300047444 Bacteria 4399
612 Ga0495675_0196034 3300047444 Bacteria 1231
613 Ga0495675_0207583 3300047444 Bacteria 1190
614 Ga0495685_007593 3300047447 Bacteria 3586
615 Ga0495685_008397 3300047447 Bacteria 3428
616 Ga0495685_144024 3300047447 Bacteria 775
617 Ga0495681_0382553 3300047470 Bacteria 529
618 Ga0495684_0002297 3300047471 Bacteria 15309
619 Ga0495684_0109541 3300047471 Bacteria 2085
620 Ga0495684_0127937 3300047471 Bacteria 1909
621 Ga0495684_0176061 3300047471 Bacteria 1588
622 Ga0495593_0005070 3300047673 Bacteria 7786
623 Ga0495593_0009211 3300047673 Bacteria 5725
624 Ga0495593_0086836 3300047673 Bacteria 1613
625 Ga0495602_0022314 3300048088 Bacteria 6200
626 Ga0495602_0051532 3300048088 Bacteria 3664
627 Ga0495602_0082563 3300048088 Bacteria 2696
628 Ga0495602_0110354 3300048088 Bacteria 2236
629 Ga0495602_0422344 3300048088 Bacteria 946
630 Ga0495614_0008778 3300048089 Bacteria 4488
631 Ga0495614_0046986 3300048089 Bacteria 1851
632 Ga0496100_0714994 3300048903 Bacteria 782
633 Ga0496102_0613448 3300048905 Bacteria 1011
634 Ga0496104_0012898 3300048907 Bacteria 7528
635 Ga0496105_0026628 3300048908 Bacteria 4720
636 Ga0496106_0211570 3300048909 Bacteria 1545
637 Ga0496107_1102612 3300048910 Bacteria 573
638 Ga0496108_0071721 3300048911 Bacteria 2923
639 Ga0496108_0207793 3300048911 Bacteria 1699
640 Ga0496109_0069627 3300048912 Bacteria 3227
641 Ga0496109_0869981 3300048912 Bacteria 839
642 Ga0496110_0006856 3300048913 Bacteria 9053
643 Ga0496110_0254089 3300048913 Bacteria 1600
644 Ga0496112_0078594 3300048915 Bacteria 3262
645 Ga0496112_0458038 3300048915 Bacteria 1213
646 Ga0496113_0185806 3300048916 Bacteria 1648
647 Ga0496113_0661526 3300048916 Bacteria 835
648 Ga0496118_0050726 3300048921 Bacteria 3181
649 Ga0501031_0003919 3300049568 Bacteria 9577
650 Ga0501031_0106523 3300049568 Bacteria 1830
651 Ga0501031_0356150 3300049568 Bacteria 947
652 Ga0501032_0001291 3300049569 Bacteria 20081
653 Ga0501032_0068418 3300049569 Bacteria 2370
654 Ga0501033_0016210 3300049570 Bacteria 5643
655 Ga0501033_0026945 3300049570 Bacteria 4323
656 Ga0501033_0069408 3300049570 Bacteria 2590
657 Ga0501033_0225042 3300049570 Bacteria 1334
658 Ga0501033_0254674 3300049570 Bacteria 1243
659 Ga0501034_0006043 3300049571 Bacteria 13079
660 Ga0501034_0009322 3300049571 Bacteria 10286
661 Ga0501034_0050027 3300049571 Bacteria 4216
662 Ga0501034_0061081 3300049571 Bacteria 3785
663 Ga0501034_1226948 3300049571 Bacteria 628
664 Ga0501036_0016208 3300049572 Bacteria 6223
665 Ga0501036_0135360 3300049572 Bacteria 2080
666 Ga0501037_0010214 3300049573 Bacteria 6887
667 Ga0501037_0010871 3300049573 Bacteria 6687
668 Ga0501037_0028282 3300049573 Bacteria 4141
669 Ga0501037_0228408 3300049573 Bacteria 1307
670 Ga0501037_0594567 3300049573 Bacteria 743
671 Ga0501038_0009661 3300049574 Bacteria 8847
672 Ga0501038_0132857 3300049574 Bacteria 2041
673 Ga0501038_0153011 3300049574 Bacteria 1879
674 Ga0501038_0195012 3300049574 Bacteria 1628
675 Ga0501038_0283223 3300049574 Bacteria 1304
676 Ga0501038_0335885 3300049574 Bacteria 1179
677 Ga0501039_0049584 3300049575 Bacteria 3246
678 Ga0501039_0071959 3300049575 Bacteria 2687
679 Ga0501039_0081455 3300049575 Bacteria 2520
680 Ga0501039_0529002 3300049575 Bacteria 925
681 Ga0501042_0003321 3300049578 Bacteria 10074
682 Ga0501042_0018064 3300049578 Bacteria 4878
683 Ga0501042_0036608 3300049578 Bacteria 3482
684 Ga0501043_0000673 3300049579 Bacteria 30061
685 Ga0501043_0001578 3300049579 Bacteria 19823
686 Ga0501043_0002129 3300049579 Bacteria 16906
687 Ga0501043_0126463 3300049579 Bacteria 2004
688 Ga0501043_0537784 3300049579 Bacteria 869
689 Ga0501043_0777207 3300049579 Bacteria 694
690 Ga0501046_0005101 3300049580 Bacteria 11782
691 Ga0501046_0011092 3300049580 Bacteria 7715
692 Ga0501046_0408945 3300049580 Bacteria 979
693 Ga0501047_0000103 3300049581 Bacteria 104053
694 Ga0501047_0000324 3300049581 Bacteria 55265
695 Ga0501047_0002749 3300049581 Bacteria 16746
696 Ga0501047_0004142 3300049581 Bacteria 13652
697 Ga0501047_0064149 3300049581 Bacteria 3543
698 Ga0501047_0254454 3300049581 Bacteria 1604
699 Ga0501047_0259083 3300049581 Bacteria 1587
700 Ga0501047_0553155 3300049581 Bacteria 975
701 Ga0501048_0009631 3300049582 Bacteria 7248
702 Ga0501048_0055495 3300049582 Bacteria 2812
703 Ga0501069_0254695 3300049585 Bacteria 1024
704 Ga0501070_0001568 3300049586 Bacteria 20323
705 Ga0501070_0417303 3300049586 Bacteria 1084
706 Ga0501071_1046348 3300049587 Bacteria 631
707 Ga0501073_0011517 3300049589 Bacteria 6467
708 Ga0501073_0571255 3300049589 Bacteria 781
709 Ga0501074_0003059 3300049590 Bacteria 11793
710 Ga0501074_0003200 3300049590 Bacteria 11546
711 Ga0501080_0362432 3300049742 Bacteria 1308
712 Ga0501083_0428815 3300049744 Bacteria 860
713 Ga0501035_0021129 3300049822 Bacteria 5983
714 Ga0501035_0037973 3300049822 Bacteria 4361
715 Ga0501035_0089351 3300049822 Bacteria 2713
716 Ga0501035_0373759 3300049822 Bacteria 1189
717 Ga0501044_0000489 3300049823 Bacteria 48052
718 Ga0501044_0002151 3300049823 Bacteria 22603
719 Ga0501044_0033756 3300049823 Bacteria 5373
720 Ga0501044_0144941 3300049823 Bacteria 2361
721 Ga0501044_0254599 3300049823 Bacteria 1695
722 Ga0501044_0256880 3300049823 Bacteria 1686
723 Ga0501044_0257162 3300049823 Bacteria 1685
724 Ga0501044_0293754 3300049823 Bacteria 1556
725 Ga0501044_0390713 3300049823 Bacteria 1305
726 Ga0501045_0175405 3300049824 Bacteria 1597
727 Ga0501045_0407841 3300049824 Bacteria 1011
728 nmdc:mga07m45_179045_c1 3300050496 Bacteria 1233
729 nmdc:mga05p37_420_c1 3300050507 Bacteria 45931
730 nmdc:mga09592_13_c1 3300050508 Bacteria 101979
731 nmdc:mga09592_373135_c1 3300050508 Bacteria 1234
732 nmdc:mga09592_48386_c1 3300050508 Bacteria 3584
733 nmdc:mga0qj67_683943_c1 3300050509 Bacteria 817
734 nmdc:mga0qj67_79_c2 3300050509 Bacteria 27322
735 nmdc:mga06r32_1382906_c1 3300050510 Bacteria 646
736 nmdc:mga06r32_182855_c1 3300050510 Bacteria 2082
737 nmdc:mga06r32_475605_c1 3300050510 Bacteria 1228
738 nmdc:mga06r32_493798_c1 3300050510 Bacteria 1201
739 nmdc:mga06r32_839_c1 3300050510 Bacteria 27208
740 nmdc:mga08y16_876828_c1 3300050511 Bacteria 885
741 nmdc:mga0rr50_1212798_c1 3300050513 Bacteria 641
742 nmdc:mga08x19_158905_c1 3300050514 Bacteria 1534
743 nmdc:mga0a205_888322_c1 3300050515 Bacteria 738
744 Ga0495601_0001481 3300053077 Bacteria 12950
745 Ga0495601_0013978 3300053077 Bacteria 4833
746 Ga0495601_0052360 3300053077 Bacteria 2577
747 Ga0495601_1006136 3300053077 Bacteria 524
748 Ga0495612_0003381 3300053078 Bacteria 6610
749 Ga0495612_0059382 3300053078 Bacteria 1581
750 Ga0495655_0137215 3300053083 Bacteria 758
751 Ga0495595_0104458 3300053084 Bacteria 1369
752 Ga0495619_0012562 3300053085 Bacteria 5333
753 Ga0495619_0183718 3300053085 Bacteria 1447
754 Ga0495619_0304285 3300053085 Bacteria 1104
755 Ga0500646_0001692 3300053090 Bacteria 5824
756 Ga0500583_0024134 3300053092 Bacteria 2576
757 Ga0500640_034466 3300053095 Bacteria 2223
758 Ga0500641_0044721 3300053096 Bacteria 1801
759 Ga0500560_000756 3300053107 Bacteria 4907
760 Ga0500572_184658 3300053111 Bacteria 683
761 Ga0500594_0040537 3300053118 Bacteria 1272
762 Ga0500594_0191549 3300053118 Bacteria 670
763 Ga0500573_0012698 3300053140 Bacteria 4734
764 Ga0500573_0055408 3300053140 Bacteria 2275
765 Ga0500573_0300706 3300053140 Bacteria 802
766 Ga0500573_0388632 3300053140 Bacteria 664
767 Ga0500588_0042843 3300053146 Bacteria 1373
768 Ga0500616_0003572 3300053153 Bacteria 11769
769 Ga0500624_001412 3300053157 Bacteria 3955
770 Ga0500627_0234482 3300053158 Bacteria 816
771 Ga0500633_0061389 3300053160 Bacteria 1323
772 Ga0500633_0184354 3300053160 Bacteria 782
773 Ga0466962_0000284 3300061719 Bacteria 21433
774 Ga0466962_0004160 3300061719 Bacteria 6936
775 Ga0466962_0021439 3300061719 Bacteria 3102
776 2501939941 2501939600 Bacteria 6907073
777 2515758259 2515154137 Bacteria 5711575
778 2516091859 2515154203 Bacteria 5458536
779 2772646956 2772190715 Bacteria 6959372
780 2776373093 2775506925 Bacteria 7237746
781 2793976747 2791355406 Bacteria 11364898
782 2804843633 2802429296 Bacteria 7227771
783 2831937343 2831935698 Bacteria 5963223
784 2832010345 2832004796 Bacteria 6538017
785 2855675395 2855670206 Bacteria 7120389
786 2855682973 2855676851 Bacteria 7063653
787 2855688717 2855683550 Bacteria 7134265
788 2856864285 2856858025 Bacteria 7255264
789 2857292809 2857288857 Bacteria 7189066
790 2858853532 2858848962 Bacteria 6963058
791 2858871157 2858868258 Bacteria 7683772
792 2858884945 2858882152 Bacteria 7230291
793 2858891236 2858888857 Bacteria 7060307
794 2858897284 2858895516 Bacteria 7378898
795 2858906615 2858902515 Bacteria 7086037
796 2863069257 2863067949 Bacteria 8541735
797 2863070821 2863067949 Bacteria 8541735
798 2863407077 2863404153 Bacteria 9672205
799 2866065583 2866065130 Bacteria 6518152
800 2866552845 2866552031 Bacteria 5824618
801 2866555237 2866552031 Bacteria 5824618
802 2866557518 2866552031 Bacteria 5824618
803 2867303721 2867302475 Bacteria 7087181
804 2867318812 2867312974 Bacteria 7058875
805 2867320775 2867319477 Bacteria 7069771
806 2867479835 2867475112 Bacteria 6909112
807 2867511952 2867507094 Bacteria 6506033
808 2869048882 2869048445 Bacteria 6875584
809 2869063320 2869061728 Bacteria 7112407
810 2869074905 2869068681 Bacteria 7205615
811 2880489891 2880489317 Bacteria 7096270
812 2880502678 2880495981 Bacteria 7340502
813 2902585840 2902582711 Bacteria 6187705
814 2929224498 2929219909 Bacteria 6984360
815 2929231101 2929226422 Bacteria 7248583
816 2990059686 2990059506 Bacteria 9321252
817 2990090471 2990088156 Bacteria 6657676
818 2996223082 2996221748 Bacteria 6799777
819 2996224354 2996221748 Bacteria 6799777
820 2997453765 2997451912 Bacteria 8492419
821 3006488268 3006486233 Bacteria 8157040
822 649813417 649633069 Bacteria 6962533
823 649814186 649633069 Bacteria 6962533
824 8003832080 8003830390 Bacteria 6541657
825 8003856781 8003856774 Bacteria 7675274
826 8025414764 8025413630 Bacteria 7014048
827 8047901183 8047893842 Bacteria 11723082
828 8048357718 8048356638 Bacteria 11044339
829 8048378122 8048369669 Bacteria 11666822
830 8048387220 8048379754 Bacteria 11877923
831 8054731380 8054727385 Bacteria 7558670
832 8054736627 8054734606 Bacteria 6947278
833 8055415260 8055412473 Bacteria 6257500
834 8056066077 8056060235 Bacteria 7259403
835 8056209290 8056207758 Bacteria 8639239
836 8056211747 8056207758 Bacteria 8639239
837 nmdc:mga03n38_203827_c1
838 JGI25160J50197_1022601
839 JGI25160J50197_1025476
840 Ga0070683_100007237
841 Ga0070683_100152472
842 Ga0070683_100713239
843 Ga0070690_101291923
844 Ga0068869_100087728
845 Ga0068869_100530155
846 Ga0068869_100691510
847 Ga0068869_100908760
848 Ga0068869_101348292
849 Ga0070682_100275910
850 Ga0068868_102246681
851 Ga0070660_100787906
852 Ga0070689_100458154
853 Ga0070687_101529837
854 Ga0070661_100221310
855 Ga0070669_101795474
856 Ga0070675_101300069
857 Ga0070671_100584040
858 Ga0070709_10063805
859 Ga0070709_10111954
860 Ga0070709_10142527
861 Ga0070709_10226933
862 Ga0070714_100000300
863 Ga0070714_100045116
864 Ga0070714_100066294
865 Ga0070714_100153000
866 Ga0070714_100155580
867 Ga0070714_100350755
868 Ga0070714_100488487
869 Ga0070714_100967969
870 Ga0070713_100024601
871 Ga0070713_100063879
872 Ga0070713_100378789
873 Ga0070713_100438671
874 Ga0070713_101668982
875 Ga0070710_10115447
876 Ga0070710_10125952
877 Ga0070710_10249480
878 Ga0070711_100521718
879 Ga0070700_100708573
880 Ga0070708_100092705
881 Ga0070708_100126480
882 Ga0070663_101933320
883 Ga0070706_100525362
884 Ga0070706_100588249
885 Ga0070706_100608847
886 Ga0070707_100000443
887 Ga0070707_100007603
888 Ga0070707_100064205
889 Ga0070707_100314156
890 Ga0070698_100009111
891 Ga0070698_100045746
892 Ga0070698_100236237
893 Ga0070698_100472074
894 Ga0070684_100003402
895 Ga0070684_100051692
896 Ga0070684_100123607
897 Ga0070684_101430143
898 Ga0070684_101668642
899 Ga0070697_100036139
900 Ga0068853_102167446
901 Ga0070672_100641471
902 Ga0070693_100650629
903 Ga0070704_101613626
904 Ga0068855_100437349
905 Ga0068855_101156141
906 Ga0070664_100088613
907 Ga0070664_100145904
908 Ga0070664_100235497
909 Ga0070664_100306138
910 Ga0068857_100059449
911 Ga0068857_100383853
912 Ga0068857_100426872
913 Ga0068857_100494570
914 Ga0068857_100910787
915 Ga0068857_101317747
916 Ga0068856_100112083
917 Ga0068856_101803321
918 Ga0068852_101756371
919 Ga0068859_100013820
920 Ga0068859_100348684
921 Ga0068859_102097484
922 Ga0068864_100013574
923 Ga0068864_100068828
924 Ga0068864_100264281
925 Ga0068866_11040061
926 Ga0068863_100000700
927 Ga0068863_100077869
928 Ga0068863_100126249
929 Ga0068863_100332931
930 Ga0068863_100677529
931 Ga0068858_100090244
932 Ga0068858_100111496
933 Ga0068858_100123563
934 Ga0068858_100221015
935 Ga0068862_100000496
936 Ga0068862_100238953
937 Ga0068862_101843964
938 Ga0081455_10209483
939 Ga0081455_10374734
940 Ga0081539_10037493
941 Ga0070717_10014741
942 Ga0070717_10042179
943 Ga0070717_10838179
944 Ga0075363_100025241
945 Ga0070715_10006050
946 Ga0070715_10369146
947 Ga0070716_100392659
948 Ga0070712_100132989
949 Ga0070712_100186608
950 Ga0070712_100259735
951 Ga0097621_101155991
952 Ga0075370_10195739
953 Ga0075428_100000410
954 Ga0075428_100084277
955 Ga0075428_100086491
956 Ga0075428_100091820
957 Ga0075428_100103739
958 Ga0075428_100625413
959 Ga0075428_100689374
960 Ga0075428_101630888
961 Ga0075430_100037253
962 Ga0075430_100382671
963 Ga0075431_100002781
964 Ga0075431_100078274
965 Ga0075431_100175579
966 Ga0075431_100182905
967 Ga0075431_101331442
968 Ga0075434_100225156
969 Ga0075429_100005553
970 Ga0075429_100052579
971 Ga0075429_100857265
972 Ga0075436_100164328
973 Ga0097620_100000147
974 Ga0097620_100013820
975 Ga0097620_100348668
976 Ga0097620_102097190
977 Ga0075435_100221168
978 Ga0105251_10091925
979 Ga0111539_10671224
980 Ga0111539_10889792
981 Ga0105247_11171757
982 Ga0114129_10000074
983 Ga0114129_10011584
984 Ga0114129_10196033
985 Ga0105243_12568365
986 Ga0105248_10000140
987 Ga0105248_10018715
988 Ga0105248_10063798
989 Ga0105237_10174445
990 Ga0105249_10221928
991 Ga0105239_11087192
992 Ga0105246_10999714
993 Ga0105246_11675819
994 Ga0163162_11469355
995 Ga0157375_10531883
996 Ga0157375_11402215
997 Ga0157375_12164131
998 Ga0163163_10005388
999 Ga0163163_10031208
1000 Ga0163163_10310199
1001 Ga0163163_10403430
1002 Ga0163163_12839450
1003 Ga0157380_10220725
1004 Ga0157379_10026081
1005 Ga0157379_10185479
1006 Ga0157379_10339279
1007 Ga0157379_11864873
1008 Ga0213875_10000434
1009 Ga0213875_10011254
1010 Ga0209758_1001975
1011 Ga0207426_1001521
1012 Ga0207426_1002500
1013 Ga0207426_1009989
1014 Ga0207426_1086150
1015 Ga0207713_1047887
1016 Ga0207713_1090628
1017 Ga0207692_10008020
1018 Ga0207692_10055607
1019 Ga0207642_10951580
1020 Ga0207699_10003758
1021 Ga0207699_10033859
1022 Ga0207699_10159314
1023 Ga0207699_10192299
1024 Ga0207699_10214783
1025 Ga0207684_10001900
1026 Ga0207684_10004260
1027 Ga0207684_11012994
1028 Ga0207684_11474564
1029 Ga0207671_10925576
1030 Ga0207693_10014261
1031 Ga0207693_10022909
1032 Ga0207693_10474331
1033 Ga0207663_10001437
1034 Ga0207663_10072007
1035 Ga0207649_11108857
1036 Ga0207646_10000315
1037 Ga0207646_10042871
1038 Ga0207646_10072110
1039 Ga0207646_10077738
1040 Ga0207700_10000906
1041 Ga0207700_10013663
1042 Ga0207700_10034548
1043 Ga0207700_10519990
1044 Ga0207700_10539611
1045 Ga0207664_10004526
1046 Ga0207664_10051928
1047 Ga0207664_10106654
1048 Ga0207664_10129564
1049 Ga0207664_10135937
1050 Ga0207664_10208306
1051 Ga0207664_10243531
1052 Ga0207664_10348587
1053 Ga0207644_10288266
1054 Ga0207644_10288742
1055 Ga0207670_10335133
1056 Ga0207670_10399493
1057 Ga0207665_10005666
1058 Ga0207665_10014454
1059 Ga0207665_10617839
1060 Ga0207691_10592044
1061 Ga0207711_10000182
1062 Ga0207711_10068651
1063 Ga0207711_10092030
1064 Ga0207711_10110324
1065 Ga0207689_10094420
1066 Ga0207689_10257265
1067 Ga0207689_10907337
1068 Ga0207689_11105795
1069 Ga0207661_10000353
1070 Ga0207661_10221146
1071 Ga0207661_12009053
1072 Ga0207679_10176781
1073 Ga0207679_10189485
1074 Ga0207679_10197476
1075 Ga0207679_10431965
1076 Ga0207667_10298566
1077 Ga0207712_10012209
1078 Ga0207658_11550570
1079 Ga0207703_10105706
1080 Ga0207703_10167299
1081 Ga0207703_10727640
1082 Ga0207639_11986656
1083 Ga0207708_10282058
1084 Ga0207708_10689509
1085 Ga0207702_10323577
1086 Ga0207702_10937147
1087 Ga0207641_10079947
1088 Ga0207641_10145659
1089 Ga0207641_11047976
1090 Ga0207676_10219173
1091 Ga0207674_10195154
1092 Ga0207674_10443182
1093 Ga0207674_10498325
1094 Ga0207674_11389826
1095 Ga0268265_10000413
1096 Ga0268265_10183111
1097 Ga0265337_1000568
1098 Ga0265326_10000761
1099 Ga0265319_1001323
1100 Ga0265334_10000557
1101 Ga0265323_10004390
1102 Ga0265322_10090262
1103 Ga0265336_10017992
1104 Ga0307515_10206083
1105 Ga0265338_10000144
1106 Ga0265324_10003399
1107 Ga0307511_10183370
1108 Ga0307512_10001813
1109 Ga0265763_1000467
1110 Ga0265773_1035420
1111 Ga0265332_10000695
1112 Ga0265320_10001390
1113 Ga0265325_10006817
1114 Ga0265329_10176844
1115 Ga0265340_10200463
1116 Ga0265339_10023336
1117 Ga0265331_10097117
1118 Ga0265316_10028372
1119 Ga0307509_10101912
1120 Ga0307408_100086481
1121 Ga0307408_101791612
1122 Ga0265313_10011165
1123 Ga0307508_10040997
1124 Ga0307508_10075180
1125 Ga0307508_10098242
1126 Ga0265314_10003956
1127 Ga0265342_10002972
1128 Ga0307516_10126922
1129 Ga0307405_10000189
1130 Ga0307405_10013891
1131 Ga0307405_10360160
1132 Ga0307413_10060315
1133 Ga0307413_10097148
1134 Ga0307413_11487363
1135 Ga0307410_10001690
1136 Ga0307410_10010542
1137 Ga0307406_10002418
1138 Ga0307406_10007926
1139 Ga0307406_10111703
1140 Ga0307406_10178473
1141 Ga0307406_10316027
1142 Ga0307406_10813212
1143 Ga0307407_10051555
1144 Ga0307407_10088296
1145 Ga0307412_10046314
1146 Ga0307412_10240343
1147 Ga0307412_11843828
1148 Ga0307409_100000338
1149 Ga0307409_100002075
1150 Ga0307409_100170281
1151 Ga0307416_100000376
1152 Ga0307416_100001743
1153 Ga0307416_101840992
1154 Ga0307411_10298405
1155 Ga0307415_100000002
1156 Ga0307415_100000098
1157 Ga0307415_100037428
1158 Ga0307415_100038750
1159 Ga0307415_100099327
1160 Ga0307415_101308253
1161 Ga0307415_101492403
1162 Ga0307507_10012369
1163 Ga0307507_10200254
1164 Ga0316214_1069526
1165 Ga0373926_0003191
1166 Ga0373926_0298621
1167 Ga0373934_0034051
1168 Ga0373944_0000521
1169 Ga0373923_0044000
1170 Ga0373923_0095632
1171 Ga0373936_0000194
1172 Ga0373936_0005154
1173 Ga0373936_0142741
1174 Ga0373945_0000440
1175 Ga0373945_0133515
1176 Ga0373953_0002891
1177 Ga0373953_0003111
1178 Ga0373954_0012385
1179 Ga0373954_0036835
1180 Ga0373956_0008684
1181 Ga0373956_0047477
1182 Ga0373957_0000467
1183 Ga0373957_0472187
1184 Ga0373943_0000238
1185 Ga0373943_0043119
1186 Ga0373943_0137194
1187 Ga0373943_0514688
1188 Ga0373943_0805574
1189 Ga0373955_0040840
1190 Ga0373955_0062433
1191 Ga0373955_0175369
1192 Ga0373955_0883060
1193 Ga0373924_0000923
1194 Ga0373924_0054879
1195 Ga0373924_0087775
1196 Ga0373931_0295606
1197 Ga0373931_0654589
1198 Ga0373935_0008808
1199 Ga0373935_0011996
1200 Ga0373935_0096212
1201 Ga0373935_0174887
1202 Ga0373927_0002463
1203 Ga0373927_0064050
1204 Ga0373933_0011718
1205 Ga0373933_0090481
1206 Ga0373947_0003136
1207 Ga0373947_0053424
1208 Ga0373947_0125993
1209 Ga0373937_0008663
1210 Ga0373937_0027843
1211 Ga0373937_1652472
1212 Ga0373925_0001666
1213 Ga0373925_0001907
1214 Ga0373925_0005446
1215 Ga0373925_0013568
1216 Ga0373925_0222442
1217 Ga0373925_0337781
1218 Ga0373925_0358839
1219 Ga0373925_0365485
1220 Ga0373925_0559486
1221 Ga0395900_0390910
1222 Ga0395898_0387439
1223 Ga0436364_0760857
1224 Ga0436364_1031212
1225 Ga0436364_1365294
1226 Ga0451853_0365953
1227 Ga0451853_2760413
1228 Ga0439449_0000850
1229 Ga0439457_009351
1230 Ga0439457_068989
1231 Ga0450894_000021
1232 Ga0450899_000365
1233 Ga0450900_062231
1234 Ga0450906_003322
1235 Ga0450907_008826
1236 Ga0450908_006277
1237 Ga0439434_0155705
1238 Ga0466969_0025722
1239 Ga0466969_0061342
1240 Ga0466969_0167954
1241 Ga0466972_0002024
1242 Ga0466972_0011716
1243 Ga0466965_0002853
1244 Ga0466965_0052326
1245 Ga0466966_0001829
1246 Ga0466966_0004992
1247 Ga0466966_0025912
1248 Ga0466961_0000531
1249 Ga0466961_0086168
1250 Ga0466961_0255898
1251 Ga0466963_0012167
1252 Ga0466963_0087167
1253 Ga0466963_0397113
1254 Ga0466963_0727758
1255 Ga0466963_0768842
1256 Ga0466964_0566640
1257 Ga0466971_0000247
1258 Ga0466971_0084888
1259 Ga0466971_0094034
1260 Ga0466970_0008217
1261 Ga0466957_0016961
1262 Ga0466957_0086430
1263 Ga0466957_0126758
1264 Ga0466957_0353132
1265 Ga0466959_0001026
1266 Ga0466959_0028003
1267 Ga0466959_0066583
1268 Ga0466959_0071062
1269 Ga0466967_0001642
1270 Ga0466967_0024496
1271 Ga0466967_0453382
1272 Ga0466967_0600944
1273 Ga0466967_0713157
1274 Ga0466967_1697886
1275 Ga0466967_1796462
1276 Ga0495592_0018609
1277 Ga0495592_0090365
1278 Ga0495592_0090977
1279 Ga0495592_0131686
1280 Ga0495592_0230873
1281 Ga0495603_0004349
1282 Ga0495603_0008962
1283 Ga0495629_0004766
1284 Ga0495629_0006156
1285 Ga0495629_0010472
1286 Ga0495629_0097843
1287 Ga0495638_0368646
1288 Ga0495641_0006254
1289 Ga0495641_0010448
1290 Ga0495651_0006618
1291 Ga0495651_0013817
1292 Ga0495651_0081745
1293 Ga0495651_0122381
1294 Ga0495651_0293025
1295 Ga0495651_0352876
1296 Ga0495653_0001909
1297 Ga0495653_0021492
1298 Ga0495653_0022258
1299 Ga0495653_0023520
1300 Ga0495580_0060867
1301 Ga0495582_0003023
1302 Ga0495582_0151167
1303 Ga0495639_0004896
1304 Ga0495639_0053950
1305 Ga0495639_0270244
1306 Ga0495662_0002214
1307 Ga0495662_0002353
1308 Ga0495662_0003118
1309 Ga0495662_0004039
1310 Ga0495662_0095975
1311 Ga0495664_0000247
1312 Ga0495664_0000316
1313 Ga0495664_0002335
1314 Ga0495664_0015093
1315 Ga0495594_0111957
1316 Ga0495594_0164692
1317 Ga0495608_0010772
1318 Ga0495608_0025446
1319 Ga0495608_0107372
1320 Ga0495618_0021245
1321 Ga0495618_0021603
1322 Ga0495618_0105798
1323 Ga0495618_0109315
1324 Ga0495628_0014905
1325 Ga0495628_0018429
1326 Ga0495628_0409051
1327 Ga0495628_1216557
1328 Ga0495630_0044758
1329 Ga0495630_0047829
1330 Ga0495630_0119896
1331 Ga0495630_0144420
1332 Ga0495630_0207819
1333 Ga0495630_0209003
1334 Ga0495630_0234413
1335 Ga0495630_0293546
1336 Ga0495666_0000742
1337 Ga0495666_0188388
1338 Ga0495666_0202819
1339 Ga0495652_0001917
1340 Ga0495652_0066412
1341 Ga0495652_0201992
1342 Ga0495665_0003609
1343 Ga0495665_0004092
1344 Ga0495665_0543568
1345 Ga0495640_0017843
1346 Ga0495640_0038410
1347 Ga0495640_0115938
1348 Ga0495640_0342323
1349 Ga0495640_0773630
1350 Ga0495586_0006159
1351 Ga0495586_0069625
1352 Ga0495586_0103792
1353 Ga0495586_0166944
1354 Ga0495587_0001362
1355 Ga0495587_0033397
1356 Ga0495587_0048122
1357 Ga0495587_0166307
1358 Ga0495587_0674119
1359 Ga0495645_0030273
1360 Ga0495645_0037276
1361 Ga0495645_0063365
1362 Ga0495645_0176786
1363 Ga0495645_0816324
1364 Ga0495633_0359551
1365 Ga0495667_0004115
1366 Ga0495667_0007662
1367 Ga0495667_0025011
1368 Ga0495667_0087561
1369 Ga0495667_0321133
1370 Ga0495667_0387061
1371 Ga0495656_0137023
1372 Ga0495634_0005386
1373 Ga0495634_0025122
1374 Ga0495634_0090445
1375 Ga0495634_0186145
1376 Ga0495634_0243754
1377 Ga0495634_0609373
1378 Ga0495635_0000167
1379 Ga0495635_0003202
1380 Ga0495635_0008825
1381 Ga0495635_0042469
1382 Ga0495635_0052118
1383 Ga0495635_0075774
1384 Ga0495635_0396581
1385 Ga0495661_0107077
1386 Ga0495588_0002910
1387 Ga0495657_0000773
1388 Ga0495657_0001338
1389 Ga0495657_0018126
1390 Ga0495657_0030586
1391 Ga0495657_0061939
1392 Ga0495657_0318688
1393 Ga0495599_0034805
1394 Ga0495599_0075500
1395 Ga0495599_0318435
1396 Ga0495623_0031456
1397 Ga0495623_0066758
1398 Ga0495623_0083640
1399 Ga0495623_0149472
1400 Ga0495623_0263528
1401 Ga0495646_0001609
1402 Ga0495646_0005504
1403 Ga0495646_0029330
1404 Ga0495646_0044251
1405 Ga0495647_0040917
1406 Ga0495658_0005075
1407 Ga0495658_0036706
1408 Ga0495613_0032948
1409 Ga0495613_0043331
1410 Ga0495613_0115006
1411 Ga0495613_0236408
1412 Ga0495613_1093319
1413 Ga0495624_0007830
1414 Ga0495624_0014916
1415 Ga0495624_0565966
1416 Ga0495671_0192197
1417 Ga0495589_0246121
1418 Ga0495600_0012852
1419 Ga0495600_0032630
1420 Ga0495600_0054189
1421 Ga0495600_0104179
1422 Ga0495600_0177786
1423 Ga0495581_0009288
1424 Ga0495581_0017432
1425 Ga0495581_0021811
1426 Ga0495581_0174472
1427 Ga0495604_0001147
1428 Ga0495604_0016962
1429 Ga0495604_0031311
1430 Ga0495604_0069299
1431 Ga0495636_0001180
1432 Ga0495636_0018480
1433 Ga0495674_0003289
1434 Ga0495674_0079561
1435 Ga0495674_0297551
1436 Ga0495674_0808380
1437 Ga0495676_0002649
1438 Ga0495676_0008469
1439 Ga0495676_0252125
1440 Ga0495680_0015558
1441 Ga0495680_0016758
1442 Ga0495680_0033499
1443 Ga0495680_0420955
1444 Ga0495675_0010973
1445 Ga0495675_0013249
1446 Ga0495675_0018093
1447 Ga0495675_0018701
1448 Ga0495675_0196034
1449 Ga0495675_0207583
1450 Ga0495685_007593
1451 Ga0495685_008397
1452 Ga0495685_144024
1453 Ga0495681_0382553
1454 Ga0495684_0002297
1455 Ga0495684_0109541
1456 Ga0495684_0127937
1457 Ga0495684_0176061
1458 Ga0495593_0005070
1459 Ga0495593_0009211
1460 Ga0495593_0086836
1461 Ga0495602_0022314
1462 Ga0495602_0051532
1463 Ga0495602_0082563
1464 Ga0495602_0110354
1465 Ga0495602_0422344
1466 Ga0495614_0008778
1467 Ga0495614_0046986
1468 Ga0496100_0714994
1469 Ga0496102_0613448
1470 Ga0496104_0012898
1471 Ga0496105_0026628
1472 Ga0496106_0211570
1473 Ga0496107_1102612
1474 Ga0496108_0071721
1475 Ga0496108_0207793
1476 Ga0496109_0069627
1477 Ga0496109_0869981
1478 Ga0496110_0006856
1479 Ga0496110_0254089
1480 Ga0496112_0078594
1481 Ga0496112_0458038
1482 Ga0496113_0185806
1483 Ga0496113_0661526
1484 Ga0496118_0050726
1485 Ga0501031_0003919
1486 Ga0501031_0106523
1487 Ga0501031_0356150
1488 Ga0501032_0001291
1489 Ga0501032_0068418
1490 Ga0501033_0016210
1491 Ga0501033_0026945
1492 Ga0501033_0069408
1493 Ga0501033_0225042
1494 Ga0501033_0254674
1495 Ga0501034_0006043
1496 Ga0501034_0009322
1497 Ga0501034_0050027
1498 Ga0501034_0061081
1499 Ga0501034_1226948
1500 Ga0501036_0016208
1501 Ga0501036_0135360
1502 Ga0501037_0010214
1503 Ga0501037_0010871
1504 Ga0501037_0028282
1505 Ga0501037_0228408
1506 Ga0501037_0594567
1507 Ga0501038_0009661
1508 Ga0501038_0132857
1509 Ga0501038_0153011
1510 Ga0501038_0195012
1511 Ga0501038_0283223
1512 Ga0501038_0335885
1513 Ga0501039_0049584
1514 Ga0501039_0071959
1515 Ga0501039_0081455
1516 Ga0501039_0529002
1517 Ga0501042_0003321
1518 Ga0501042_0018064
1519 Ga0501042_0036608
1520 Ga0501043_0000673
1521 Ga0501043_0001578
1522 Ga0501043_0002129
1523 Ga0501043_0126463
1524 Ga0501043_0537784
1525 Ga0501043_0777207
1526 Ga0501046_0005101
1527 Ga0501046_0011092
1528 Ga0501046_0408945
1529 Ga0501047_0000103
1530 Ga0501047_0000324
1531 Ga0501047_0002749
1532 Ga0501047_0004142
1533 Ga0501047_0064149
1534 Ga0501047_0254454
1535 Ga0501047_0259083
1536 Ga0501047_0553155
1537 Ga0501048_0009631
1538 Ga0501048_0055495
1539 Ga0501069_0254695
1540 Ga0501070_0001568
1541 Ga0501070_0417303
1542 Ga0501071_1046348
1543 Ga0501073_0011517
1544 Ga0501073_0571255
1545 Ga0501074_0003059
1546 Ga0501074_0003200
1547 Ga0501080_0362432
1548 Ga0501083_0428815
1549 Ga0501035_0021129
1550 Ga0501035_0037973
1551 Ga0501035_0089351
1552 Ga0501035_0373759
1553 Ga0501044_0000489
1554 Ga0501044_0002151
1555 Ga0501044_0033756
1556 Ga0501044_0144941
1557 Ga0501044_0254599
1558 Ga0501044_0256880
1559 Ga0501044_0257162
1560 Ga0501044_0293754
1561 Ga0501044_0390713
1562 Ga0501045_0175405
1563 Ga0501045_0407841
1564 nmdc:mga07m45_179045_c1
1565 nmdc:mga05p37_420_c1
1566 nmdc:mga09592_13_c1
1567 nmdc:mga09592_373135_c1
1568 nmdc:mga09592_48386_c1
1569 nmdc:mga0qj67_683943_c1
1570 nmdc:mga0qj67_79_c2
1571 nmdc:mga06r32_1382906_c1
1572 nmdc:mga06r32_182855_c1
1573 nmdc:mga06r32_475605_c1
1574 nmdc:mga06r32_493798_c1
1575 nmdc:mga06r32_839_c1
1576 nmdc:mga08y16_876828_c1
1577 nmdc:mga0rr50_1212798_c1
1578 nmdc:mga08x19_158905_c1
1579 nmdc:mga0a205_888322_c1
1580 Ga0495601_0001481
1581 Ga0495601_0013978
1582 Ga0495601_0052360
1583 Ga0495601_1006136
1584 Ga0495612_0003381
1585 Ga0495612_0059382
1586 Ga0495655_0137215
1587 Ga0495595_0104458
1588 Ga0495619_0012562
1589 Ga0495619_0183718
1590 Ga0495619_0304285
1591 Ga0500646_0001692
1592 Ga0500583_0024134
1593 Ga0500640_034466
1594 Ga0500641_0044721
1595 Ga0500560_000756
1596 Ga0500572_184658
1597 Ga0500594_0040537
1598 Ga0500594_0191549
1599 Ga0500573_0012698
1600 Ga0500573_0055408
1601 Ga0500573_0300706
1602 Ga0500573_0388632
1603 Ga0500588_0042843
1604 Ga0500616_0003572
1605 Ga0500624_001412
1606 Ga0500627_0234482
1607 Ga0500633_0061389
1608 Ga0500633_0184354
1609 Ga0466962_0000284
1610 Ga0466962_0004160
1611 Ga0466962_0021439
1612 2501939941
1613 2515758259
1614 2516091859
1615 2772646956
1616 2776373093
1617 2793976747
1618 2804843633
1619 2831937343
1620 2832010345
1621 2855675395
1622 2855682973
1623 2855688717
1624 2856864285
1625 2857292809
1626 2858853532
1627 2858871157
1628 2858884945
1629 2858891236
1630 2858897284
1631 2858906615
1632 2863069257
1633 2863070821
1634 2863407077
1635 2866065583
1636 2866552845
1637 2866555237
1638 2866557518
1639 2867303721
1640 2867318812
1641 2867320775
1642 2867479835
1643 2867511952
1644 2869048882
1645 2869063320
1646 2869074905
1647 2880489891
1648 2880502678
1649 2902585840
1650 2929224498
1651 2929231101
1652 2990059686
1653 2990090471
1654 2996223082
1655 2996224354
1656 2997453765
1657 3006488268
1658 649813417
1659 649814186
1660 8003832080
1661 8003856781
1662 8025414764
1663 8047901183
1664 8048357718
1665 8048378122
1666 8048387220
1667 8054731380
1668 8054736627
1669 8055415260
1670 8056066077
1671 8056209290
1672 8056211747

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03259

Robl_LC7

Roadblock/LC7 domain

25

116

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3leq-assembly1.cif.gz_A the crystal structure of the roadblock/lc7 domain from streptomyces avermitillis to 1.85a 0.9402 18 128
3kye-assembly2.cif.gz_C crystal structure of roadblock/lc7 domain from streptomyces avermitilis 0.9341 18 133
5y3a-assembly1.cif.gz_B crystal structure of ragulator complex (p18 49-161) 0.9053 18 130
5x6u-assembly1.cif.gz_B crystal structure of human heteropentameric complex 0.8999 18 133
2hz5-assembly2.cif.gz_B crystal structure of human dynein light chain dnlc2a 0.8988 31 110
ID Description Score Start End Superfamily
af_O50393_7_130_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.9628 18 133 3.30.450.30
3kyeD00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.9277 18 132 3.30.450.30
af_Q58736_1_114_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.9106 18 132 3.30.450.30
3leqA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.9071 18 128 3.30.450.30
3l9kA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8956 22 110 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A0K9XKB1-F1-model_v4 Dynein regulation protein LC7 0.9837 18 130
AF-A0A6B1MQU4-F1-model_v4 deleted 0.9776 18 125
AF-A0A349B0G0-F1-model_v4 Dynein regulation protein LC7 0.9731 17 131
AF-A0A6B3I616-F1-model_v4 Roadblock/LC7 domain-containing protein 0.9711 20 133
AF-A0A7M3LQV1-F1-model_v4 Dynein regulation protein LC7 0.9704 26 129

Map