F482915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 367 | 1672 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300050490|nmdc:mga03n38_203827_c1|nmdc:mga03n38_203827_c1_121_591 |
| Length | 156 |
| Sequence | MKRTPTFEGQRQMTQPDVSEATVSRDWLLTDMVRRVPEIGHAVLLSTDGLLLGASGEMNRDEADRLSAVASGFHSLAKGAGRHFGGGAVRQTVVEMEAGFLFVCAAGENAVLSTLTPDGADIGVVAYEMAMLVARLGEHLSVDSRTKELPDYRLKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 2 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 76 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 111 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 112 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 114 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 117 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 119 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 120 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 121 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 123 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 125 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 128 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 131 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 135 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 136 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 137 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 148 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 149 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 150 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 155 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 156 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 171 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 174 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 175 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 176 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 177 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 178 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 179 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 180 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 181 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 182 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 183 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 184 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 185 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 186 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 187 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 193 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 260 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 300 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 301 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 302 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 303 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 304 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 306 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 307 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 310 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 312 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 313 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 314 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 315 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 316 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 317 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 318 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 319 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 320 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 321 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 322 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 323 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 324 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 325 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 326 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 327 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 328 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 329 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 330 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 331 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 332 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 333 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 334 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 335 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 336 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 337 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 338 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 339 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 340 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 341 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 342 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 343 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 344 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 345 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 346 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 347 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 348 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 349 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 350 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 351 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 352 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 353 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 354 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 355 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 356 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 357 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 358 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 359 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 360 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 361 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 362 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 363 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 364 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 365 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 366 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 367 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.46 |
| Metatranscriptomes | 0.24 |
| Isolates | 7.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.47 |
| Nodule | 0.6 |
| Rhizoplane | 2.03 |
| Rhizosphere | 86.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | nmdc:mga03n38_203827_c1 | 3300050490 | Bacteria | 1025 |
| 2 | JGI25160J50197_1022601 | 3300003354 | Bacteria | 1838 |
| 3 | JGI25160J50197_1025476 | 3300003354 | Bacteria | 1654 |
| 4 | Ga0070683_100007237 | 3300005329 | Bacteria | 9366 |
| 5 | Ga0070683_100152472 | 3300005329 | Bacteria | 2191 |
| 6 | Ga0070683_100713239 | 3300005329 | Bacteria | 961 |
| 7 | Ga0070690_101291923 | 3300005330 | Bacteria | 584 |
| 8 | Ga0068869_100087728 | 3300005334 | Bacteria | 2334 |
| 9 | Ga0068869_100530155 | 3300005334 | Bacteria | 987 |
| 10 | Ga0068869_100691510 | 3300005334 | Bacteria | 869 |
| 11 | Ga0068869_100908760 | 3300005334 | Bacteria | 762 |
| 12 | Ga0068869_101348292 | 3300005334 | Bacteria | 630 |
| 13 | Ga0070682_100275910 | 3300005337 | Bacteria | 1223 |
| 14 | Ga0068868_102246681 | 3300005338 | Bacteria | 520 |
| 15 | Ga0070660_100787906 | 3300005339 | Bacteria | 799 |
| 16 | Ga0070689_100458154 | 3300005340 | Bacteria | 1086 |
| 17 | Ga0070687_101529837 | 3300005343 | Bacteria | 502 |
| 18 | Ga0070661_100221310 | 3300005344 | Bacteria | 1452 |
| 19 | Ga0070669_101795474 | 3300005353 | Bacteria | 535 |
| 20 | Ga0070675_101300069 | 3300005354 | Bacteria | 670 |
| 21 | Ga0070671_100584040 | 3300005355 | Bacteria | 965 |
| 22 | Ga0070709_10063805 | 3300005434 | Bacteria | 2354 |
| 23 | Ga0070709_10111954 | 3300005434 | Bacteria | 1836 |
| 24 | Ga0070709_10142527 | 3300005434 | Bacteria | 1648 |
| 25 | Ga0070709_10226933 | 3300005434 | Bacteria | 1334 |
| 26 | Ga0070714_100000300 | 3300005435 | Bacteria | 37538 |
| 27 | Ga0070714_100045116 | 3300005435 | Bacteria | 3734 |
| 28 | Ga0070714_100066294 | 3300005435 | Bacteria | 3112 |
| 29 | Ga0070714_100153000 | 3300005435 | Bacteria | 2080 |
| 30 | Ga0070714_100155580 | 3300005435 | Bacteria | 2063 |
| 31 | Ga0070714_100350755 | 3300005435 | Bacteria | 1386 |
| 32 | Ga0070714_100488487 | 3300005435 | Bacteria | 1173 |
| 33 | Ga0070714_100967969 | 3300005435 | Bacteria | 827 |
| 34 | Ga0070713_100024601 | 3300005436 | Bacteria | 4694 |
| 35 | Ga0070713_100063879 | 3300005436 | Bacteria | 3088 |
| 36 | Ga0070713_100378789 | 3300005436 | Bacteria | 1318 |
| 37 | Ga0070713_100438671 | 3300005436 | Bacteria | 1225 |
| 38 | Ga0070713_101668982 | 3300005436 | Bacteria | 618 |
| 39 | Ga0070710_10115447 | 3300005437 | Bacteria | 1618 |
| 40 | Ga0070710_10125952 | 3300005437 | Bacteria | 1556 |
| 41 | Ga0070710_10249480 | 3300005437 | Bacteria | 1140 |
| 42 | Ga0070711_100521718 | 3300005439 | Bacteria | 982 |
| 43 | Ga0070700_100708573 | 3300005441 | Bacteria | 801 |
| 44 | Ga0070708_100092705 | 3300005445 | Bacteria | 2752 |
| 45 | Ga0070708_100126480 | 3300005445 | Bacteria | 2363 |
| 46 | Ga0070663_101933320 | 3300005455 | Bacteria | 530 |
| 47 | Ga0070706_100525362 | 3300005467 | Bacteria | 1101 |
| 48 | Ga0070706_100588249 | 3300005467 | Bacteria | 1034 |
| 49 | Ga0070706_100608847 | 3300005467 | Bacteria | 1015 |
| 50 | Ga0070707_100000443 | 3300005468 | Bacteria | 41092 |
| 51 | Ga0070707_100007603 | 3300005468 | Bacteria | 10065 |
| 52 | Ga0070707_100064205 | 3300005468 | Bacteria | 3525 |
| 53 | Ga0070707_100314156 | 3300005468 | Bacteria | 1523 |
| 54 | Ga0070698_100009111 | 3300005471 | Bacteria | 10659 |
| 55 | Ga0070698_100045746 | 3300005471 | Bacteria | 4478 |
| 56 | Ga0070698_100236237 | 3300005471 | Bacteria | 1761 |
| 57 | Ga0070698_100472074 | 3300005471 | Bacteria | 1191 |
| 58 | Ga0070684_100003402 | 3300005535 | Bacteria | 11937 |
| 59 | Ga0070684_100051692 | 3300005535 | Bacteria | 3571 |
| 60 | Ga0070684_100123607 | 3300005535 | Bacteria | 2329 |
| 61 | Ga0070684_101430143 | 3300005535 | Bacteria | 651 |
| 62 | Ga0070684_101668642 | 3300005535 | Bacteria | 601 |
| 63 | Ga0070697_100036139 | 3300005536 | Bacteria | 3989 |
| 64 | Ga0068853_102167446 | 3300005539 | Bacteria | 539 |
| 65 | Ga0070672_100641471 | 3300005543 | Bacteria | 927 |
| 66 | Ga0070693_100650629 | 3300005547 | Bacteria | 766 |
| 67 | Ga0070704_101613626 | 3300005549 | Bacteria | 598 |
| 68 | Ga0068855_100437349 | 3300005563 | Bacteria | 1429 |
| 69 | Ga0068855_101156141 | 3300005563 | Bacteria | 807 |
| 70 | Ga0070664_100088613 | 3300005564 | Bacteria | 2676 |
| 71 | Ga0070664_100145904 | 3300005564 | Bacteria | 2087 |
| 72 | Ga0070664_100235497 | 3300005564 | Bacteria | 1642 |
| 73 | Ga0070664_100306138 | 3300005564 | Bacteria | 1437 |
| 74 | Ga0068857_100059449 | 3300005577 | Bacteria | 3395 |
| 75 | Ga0068857_100383853 | 3300005577 | Bacteria | 1305 |
| 76 | Ga0068857_100426872 | 3300005577 | Bacteria | 1236 |
| 77 | Ga0068857_100494570 | 3300005577 | Bacteria | 1147 |
| 78 | Ga0068857_100910787 | 3300005577 | Unclassified | 843 |
| 79 | Ga0068857_101317747 | 3300005577 | Bacteria | 701 |
| 80 | Ga0068856_100112083 | 3300005614 | Bacteria | 2725 |
| 81 | Ga0068856_101803321 | 3300005614 | Bacteria | 623 |
| 82 | Ga0068852_101756371 | 3300005616 | Bacteria | 643 |
| 83 | Ga0068859_100013820 | 3300005617 | Bacteria | 8096 |
| 84 | Ga0068859_100348684 | 3300005617 | Bacteria | 1575 |
| 85 | Ga0068859_102097484 | 3300005617 | Bacteria | 624 |
| 86 | Ga0068864_100013574 | 3300005618 | Bacteria | 6753 |
| 87 | Ga0068864_100068828 | 3300005618 | Bacteria | 3076 |
| 88 | Ga0068864_100264281 | 3300005618 | Bacteria | 1601 |
| 89 | Ga0068866_11040061 | 3300005718 | Bacteria | 584 |
| 90 | Ga0068863_100000700 | 3300005841 | Bacteria | 33726 |
| 91 | Ga0068863_100077869 | 3300005841 | Bacteria | 3138 |
| 92 | Ga0068863_100126249 | 3300005841 | Bacteria | 2441 |
| 93 | Ga0068863_100332931 | 3300005841 | Bacteria | 1476 |
| 94 | Ga0068863_100677529 | 3300005841 | Bacteria | 1024 |
| 95 | Ga0068858_100090244 | 3300005842 | Bacteria | 2851 |
| 96 | Ga0068858_100111496 | 3300005842 | Bacteria | 2555 |
| 97 | Ga0068858_100123563 | 3300005842 | Bacteria | 2422 |
| 98 | Ga0068858_100221015 | 3300005842 | Bacteria | 1794 |
| 99 | Ga0068862_100000496 | 3300005844 | Bacteria | 41859 |
| 100 | Ga0068862_100238953 | 3300005844 | Bacteria | 1651 |
| 101 | Ga0068862_101843964 | 3300005844 | Bacteria | 614 |
| 102 | Ga0081455_10209483 | 3300005937 | Bacteria | 1453 |
| 103 | Ga0081455_10374734 | 3300005937 | Bacteria | 996 |
| 104 | Ga0081539_10037493 | 3300005985 | Bacteria | 2888 |
| 105 | Ga0070717_10014741 | 3300006028 | Bacteria | 6014 |
| 106 | Ga0070717_10042179 | 3300006028 | Bacteria | 3722 |
| 107 | Ga0070717_10838179 | 3300006028 | Bacteria | 836 |
| 108 | Ga0075363_100025241 | 3300006048 | Bacteria | 3029 |
| 109 | Ga0070715_10006050 | 3300006163 | Bacteria | 4083 |
| 110 | Ga0070715_10369146 | 3300006163 | Bacteria | 789 |
| 111 | Ga0070716_100392659 | 3300006173 | Bacteria | 995 |
| 112 | Ga0070712_100132989 | 3300006175 | Bacteria | 1888 |
| 113 | Ga0070712_100186608 | 3300006175 | Bacteria | 1619 |
| 114 | Ga0070712_100259735 | 3300006175 | Bacteria | 1391 |
| 115 | Ga0097621_101155991 | 3300006237 | Bacteria | 728 |
| 116 | Ga0075370_10195739 | 3300006353 | Bacteria | 1192 |
| 117 | Ga0075428_100000410 | 3300006844 | Bacteria | 42619 |
| 118 | Ga0075428_100084277 | 3300006844 | Bacteria | 3468 |
| 119 | Ga0075428_100086491 | 3300006844 | Bacteria | 3419 |
| 120 | Ga0075428_100091820 | 3300006844 | Bacteria | 3311 |
| 121 | Ga0075428_100103739 | 3300006844 | Bacteria | 3101 |
| 122 | Ga0075428_100625413 | 3300006844 | Bacteria | 1149 |
| 123 | Ga0075428_100689374 | 3300006844 | Bacteria | 1088 |
| 124 | Ga0075428_101630888 | 3300006844 | Bacteria | 674 |
| 125 | Ga0075430_100037253 | 3300006846 | Bacteria | 4123 |
| 126 | Ga0075430_100382671 | 3300006846 | Bacteria | 1161 |
| 127 | Ga0075431_100002781 | 3300006847 | Bacteria | 16939 |
| 128 | Ga0075431_100078274 | 3300006847 | Bacteria | 3413 |
| 129 | Ga0075431_100175579 | 3300006847 | Bacteria | 2201 |
| 130 | Ga0075431_100182905 | 3300006847 | Bacteria | 2151 |
| 131 | Ga0075431_101331442 | 3300006847 | Bacteria | 679 |
| 132 | Ga0075434_100225156 | 3300006871 | Bacteria | 1895 |
| 133 | Ga0075429_100005553 | 3300006880 | Bacteria | 10865 |
| 134 | Ga0075429_100052579 | 3300006880 | Bacteria | 3544 |
| 135 | Ga0075429_100857265 | 3300006880 | Bacteria | 795 |
| 136 | Ga0075436_100164328 | 3300006914 | Bacteria | 1566 |
| 137 | Ga0097620_100000147 | 3300006931 | Bacteria | 66782 |
| 138 | Ga0097620_100013820 | 3300006931 | Bacteria | 8096 |
| 139 | Ga0097620_100348668 | 3300006931 | Bacteria | 1575 |
| 140 | Ga0097620_102097190 | 3300006931 | Bacteria | 624 |
| 141 | Ga0075435_100221168 | 3300007076 | Bacteria | 1608 |
| 142 | Ga0105251_10091925 | 3300009011 | Bacteria | 1393 |
| 143 | Ga0111539_10671224 | 3300009094 | Bacteria | 1207 |
| 144 | Ga0111539_10889792 | 3300009094 | Bacteria | 1036 |
| 145 | Ga0105247_11171757 | 3300009101 | Bacteria | 610 |
| 146 | Ga0114129_10000074 | 3300009147 | Bacteria | 92340 |
| 147 | Ga0114129_10011584 | 3300009147 | Bacteria | 12556 |
| 148 | Ga0114129_10196033 | 3300009147 | Bacteria | 2739 |
| 149 | Ga0105243_12568365 | 3300009148 | Bacteria | 549 |
| 150 | Ga0105248_10000140 | 3300009177 | Bacteria | 82939 |
| 151 | Ga0105248_10018715 | 3300009177 | Bacteria | 7657 |
| 152 | Ga0105248_10063798 | 3300009177 | Bacteria | 4135 |
| 153 | Ga0105237_10174445 | 3300009545 | Bacteria | 2150 |
| 154 | Ga0105249_10221928 | 3300009553 | Bacteria | 1860 |
| 155 | Ga0105239_11087192 | 3300010375 | Bacteria | 920 |
| 156 | Ga0105246_10999714 | 3300011119 | Bacteria | 757 |
| 157 | Ga0105246_11675819 | 3300011119 | Bacteria | 603 |
| 158 | Ga0163162_11469355 | 3300013306 | Bacteria | 776 |
| 159 | Ga0157375_10531883 | 3300013308 | Bacteria | 1338 |
| 160 | Ga0157375_11402215 | 3300013308 | Bacteria | 823 |
| 161 | Ga0157375_12164131 | 3300013308 | Bacteria | 662 |
| 162 | Ga0163163_10005388 | 3300014325 | Bacteria | 11058 |
| 163 | Ga0163163_10031208 | 3300014325 | Bacteria | 5142 |
| 164 | Ga0163163_10310199 | 3300014325 | Bacteria | 1630 |
| 165 | Ga0163163_10403430 | 3300014325 | Bacteria | 1425 |
| 166 | Ga0163163_12839450 | 3300014325 | Bacteria | 540 |
| 167 | Ga0157380_10220725 | 3300014326 | Bacteria | 1696 |
| 168 | Ga0157379_10026081 | 3300014968 | Bacteria | 5200 |
| 169 | Ga0157379_10185479 | 3300014968 | Bacteria | 1880 |
| 170 | Ga0157379_10339279 | 3300014968 | Bacteria | 1374 |
| 171 | Ga0157379_11864873 | 3300014968 | Bacteria | 592 |
| 172 | Ga0213875_10000434 | 3300021388 | Bacteria | 36586 |
| 173 | Ga0213875_10011254 | 3300021388 | Bacteria | 4456 |
| 174 | Ga0209758_1001975 | 3300025297 | Bacteria | 22162 |
| 175 | Ga0207426_1001521 | 3300025302 | Bacteria | 18901 |
| 176 | Ga0207426_1002500 | 3300025302 | Bacteria | 11622 |
| 177 | Ga0207426_1009989 | 3300025302 | Bacteria | 3714 |
| 178 | Ga0207426_1086150 | 3300025302 | Bacteria | 841 |
| 179 | Ga0207713_1047887 | 3300025735 | Bacteria | 1726 |
| 180 | Ga0207713_1090628 | 3300025735 | Bacteria | 1075 |
| 181 | Ga0207692_10008020 | 3300025898 | Bacteria | 4356 |
| 182 | Ga0207692_10055607 | 3300025898 | Bacteria | 2027 |
| 183 | Ga0207642_10951580 | 3300025899 | Bacteria | 552 |
| 184 | Ga0207699_10003758 | 3300025906 | Bacteria | 7250 |
| 185 | Ga0207699_10033859 | 3300025906 | Bacteria | 2892 |
| 186 | Ga0207699_10159314 | 3300025906 | Bacteria | 1501 |
| 187 | Ga0207699_10192299 | 3300025906 | Bacteria | 1378 |
| 188 | Ga0207699_10214783 | 3300025906 | Bacteria | 1310 |
| 189 | Ga0207684_10001900 | 3300025910 | Bacteria | 21709 |
| 190 | Ga0207684_10004260 | 3300025910 | Bacteria | 13564 |
| 191 | Ga0207684_11012994 | 3300025910 | Bacteria | 694 |
| 192 | Ga0207684_11474564 | 3300025910 | Bacteria | 554 |
| 193 | Ga0207671_10925576 | 3300025914 | Bacteria | 689 |
| 194 | Ga0207693_10014261 | 3300025915 | Bacteria | 6392 |
| 195 | Ga0207693_10022909 | 3300025915 | Bacteria | 4959 |
| 196 | Ga0207693_10474331 | 3300025915 | Bacteria | 977 |
| 197 | Ga0207663_10001437 | 3300025916 | Bacteria | 11071 |
| 198 | Ga0207663_10072007 | 3300025916 | Bacteria | 2232 |
| 199 | Ga0207649_11108857 | 3300025920 | Bacteria | 624 |
| 200 | Ga0207646_10000315 | 3300025922 | Bacteria | 65468 |
| 201 | Ga0207646_10042871 | 3300025922 | Bacteria | 4065 |
| 202 | Ga0207646_10072110 | 3300025922 | Bacteria | 3085 |
| 203 | Ga0207646_10077738 | 3300025922 | Bacteria | 2965 |
| 204 | Ga0207700_10000906 | 3300025928 | Bacteria | 17010 |
| 205 | Ga0207700_10013663 | 3300025928 | Bacteria | 5292 |
| 206 | Ga0207700_10034548 | 3300025928 | Bacteria | 3631 |
| 207 | Ga0207700_10519990 | 3300025928 | Bacteria | 1054 |
| 208 | Ga0207700_10539611 | 3300025928 | Bacteria | 1034 |
| 209 | Ga0207664_10004526 | 3300025929 | Bacteria | 9420 |
| 210 | Ga0207664_10051928 | 3300025929 | Bacteria | 3240 |
| 211 | Ga0207664_10106654 | 3300025929 | Bacteria | 2323 |
| 212 | Ga0207664_10129564 | 3300025929 | Bacteria | 2122 |
| 213 | Ga0207664_10135937 | 3300025929 | Bacteria | 2074 |
| 214 | Ga0207664_10208306 | 3300025929 | Bacteria | 1691 |
| 215 | Ga0207664_10243531 | 3300025929 | Bacteria | 1567 |
| 216 | Ga0207664_10348587 | 3300025929 | Bacteria | 1310 |
| 217 | Ga0207644_10288266 | 3300025931 | Bacteria | 1320 |
| 218 | Ga0207644_10288742 | 3300025931 | Bacteria | 1319 |
| 219 | Ga0207670_10335133 | 3300025936 | Bacteria | 1194 |
| 220 | Ga0207670_10399493 | 3300025936 | Bacteria | 1098 |
| 221 | Ga0207665_10005666 | 3300025939 | Bacteria | 8320 |
| 222 | Ga0207665_10014454 | 3300025939 | Bacteria | 5199 |
| 223 | Ga0207665_10617839 | 3300025939 | Bacteria | 847 |
| 224 | Ga0207691_10592044 | 3300025940 | Bacteria | 939 |
| 225 | Ga0207711_10000182 | 3300025941 | Bacteria | 67307 |
| 226 | Ga0207711_10068651 | 3300025941 | Bacteria | 3070 |
| 227 | Ga0207711_10092030 | 3300025941 | Bacteria | 2668 |
| 228 | Ga0207711_10110324 | 3300025941 | Bacteria | 2446 |
| 229 | Ga0207689_10094420 | 3300025942 | Bacteria | 2456 |
| 230 | Ga0207689_10257265 | 3300025942 | Bacteria | 1444 |
| 231 | Ga0207689_10907337 | 3300025942 | Bacteria | 743 |
| 232 | Ga0207689_11105795 | 3300025942 | Bacteria | 668 |
| 233 | Ga0207661_10000353 | 3300025944 | Bacteria | 29617 |
| 234 | Ga0207661_10221146 | 3300025944 | Bacteria | 1674 |
| 235 | Ga0207661_12009053 | 3300025944 | Bacteria | 524 |
| 236 | Ga0207679_10176781 | 3300025945 | Bacteria | 1763 |
| 237 | Ga0207679_10189485 | 3300025945 | Bacteria | 1709 |
| 238 | Ga0207679_10197476 | 3300025945 | Bacteria | 1678 |
| 239 | Ga0207679_10431965 | 3300025945 | Bacteria | 1164 |
| 240 | Ga0207667_10298566 | 3300025949 | Bacteria | 1646 |
| 241 | Ga0207712_10012209 | 3300025961 | Bacteria | 5488 |
| 242 | Ga0207658_11550570 | 3300025986 | Bacteria | 606 |
| 243 | Ga0207703_10105706 | 3300026035 | Bacteria | 2393 |
| 244 | Ga0207703_10167299 | 3300026035 | Bacteria | 1931 |
| 245 | Ga0207703_10727640 | 3300026035 | Bacteria | 945 |
| 246 | Ga0207639_11986656 | 3300026041 | Bacteria | 543 |
| 247 | Ga0207708_10282058 | 3300026075 | Bacteria | 1346 |
| 248 | Ga0207708_10689509 | 3300026075 | Bacteria | 872 |
| 249 | Ga0207702_10323577 | 3300026078 | Bacteria | 1469 |
| 250 | Ga0207702_10937147 | 3300026078 | Bacteria | 858 |
| 251 | Ga0207641_10079947 | 3300026088 | Bacteria | 2835 |
| 252 | Ga0207641_10145659 | 3300026088 | Bacteria | 2141 |
| 253 | Ga0207641_11047976 | 3300026088 | Bacteria | 813 |
| 254 | Ga0207676_10219173 | 3300026095 | Bacteria | 1693 |
| 255 | Ga0207674_10195154 | 3300026116 | Bacteria | 1974 |
| 256 | Ga0207674_10443182 | 3300026116 | Bacteria | 1255 |
| 257 | Ga0207674_10498325 | 3300026116 | Bacteria | 1177 |
| 258 | Ga0207674_11389826 | 3300026116 | Bacteria | 671 |
| 259 | Ga0268265_10000413 | 3300028380 | Bacteria | 45876 |
| 260 | Ga0268265_10183111 | 3300028380 | Bacteria | 1802 |
| 261 | Ga0265337_1000568 | 3300028556 | Bacteria | 19391 |
| 262 | Ga0265326_10000761 | 3300028558 | Bacteria | 11931 |
| 263 | Ga0265319_1001323 | 3300028563 | Bacteria | 14960 |
| 264 | Ga0265334_10000557 | 3300028573 | Bacteria | 19003 |
| 265 | Ga0265323_10004390 | 3300028653 | Bacteria | 6077 |
| 266 | Ga0265322_10090262 | 3300028654 | Bacteria | 870 |
| 267 | Ga0265336_10017992 | 3300028666 | Bacteria | 2294 |
| 268 | Ga0307515_10206083 | 3300028794 | Bacteria | 1826 |
| 269 | Ga0265338_10000144 | 3300028800 | Bacteria | 131848 |
| 270 | Ga0265324_10003399 | 3300029957 | Bacteria | 7603 |
| 271 | Ga0307511_10183370 | 3300030521 | Bacteria | 1123 |
| 272 | Ga0307512_10001813 | 3300030522 | Bacteria | 28864 |
| 273 | Ga0265763_1000467 | 3300030763 | Bacteria | 2448 |
| 274 | Ga0265773_1035420 | 3300031018 | Unclassified | 554 |
| 275 | Ga0265332_10000695 | 3300031238 | Bacteria | 21472 |
| 276 | Ga0265320_10001390 | 3300031240 | Bacteria | 17603 |
| 277 | Ga0265325_10006817 | 3300031241 | Bacteria | 6905 |
| 278 | Ga0265329_10176844 | 3300031242 | Bacteria | 697 |
| 279 | Ga0265340_10200463 | 3300031247 | Bacteria | 897 |
| 280 | Ga0265339_10023336 | 3300031249 | Bacteria | 3578 |
| 281 | Ga0265331_10097117 | 3300031250 | Bacteria | 1358 |
| 282 | Ga0265316_10028372 | 3300031344 | Bacteria | 4618 |
| 283 | Ga0307509_10101912 | 3300031507 | Bacteria | 2904 |
| 284 | Ga0307408_100086481 | 3300031548 | Bacteria | 2357 |
| 285 | Ga0307408_101791612 | 3300031548 | Bacteria | 587 |
| 286 | Ga0265313_10011165 | 3300031595 | Bacteria | 5600 |
| 287 | Ga0307508_10040997 | 3300031616 | Bacteria | 4156 |
| 288 | Ga0307508_10075180 | 3300031616 | Bacteria | 2955 |
| 289 | Ga0307508_10098242 | 3300031616 | Bacteria | 2520 |
| 290 | Ga0265314_10003956 | 3300031711 | Bacteria | 14048 |
| 291 | Ga0265342_10002972 | 3300031712 | Bacteria | 14234 |
| 292 | Ga0307516_10126922 | 3300031730 | Bacteria | 2335 |
| 293 | Ga0307405_10000189 | 3300031731 | Bacteria | 22844 |
| 294 | Ga0307405_10013891 | 3300031731 | Bacteria | 4310 |
| 295 | Ga0307405_10360160 | 3300031731 | Bacteria | 1125 |
| 296 | Ga0307413_10060315 | 3300031824 | Bacteria | 2335 |
| 297 | Ga0307413_10097148 | 3300031824 | Bacteria | 1936 |
| 298 | Ga0307413_11487363 | 3300031824 | Bacteria | 598 |
| 299 | Ga0307410_10001690 | 3300031852 | Bacteria | 10154 |
| 300 | Ga0307410_10010542 | 3300031852 | Bacteria | 5243 |
| 301 | Ga0307406_10002418 | 3300031901 | Bacteria | 10151 |
| 302 | Ga0307406_10007926 | 3300031901 | Bacteria | 5913 |
| 303 | Ga0307406_10111703 | 3300031901 | Bacteria | 1883 |
| 304 | Ga0307406_10178473 | 3300031901 | Bacteria | 1544 |
| 305 | Ga0307406_10316027 | 3300031901 | Bacteria | 1206 |
| 306 | Ga0307406_10813212 | 3300031901 | Bacteria | 789 |
| 307 | Ga0307407_10051555 | 3300031903 | Bacteria | 2359 |
| 308 | Ga0307407_10088296 | 3300031903 | Bacteria | 1894 |
| 309 | Ga0307412_10046314 | 3300031911 | Bacteria | 2849 |
| 310 | Ga0307412_10240343 | 3300031911 | Bacteria | 1400 |
| 311 | Ga0307412_11843828 | 3300031911 | Bacteria | 557 |
| 312 | Ga0307409_100000338 | 3300031995 | Bacteria | 19399 |
| 313 | Ga0307409_100002075 | 3300031995 | Bacteria | 10304 |
| 314 | Ga0307409_100170281 | 3300031995 | Bacteria | 1916 |
| 315 | Ga0307416_100000376 | 3300032002 | Bacteria | 23110 |
| 316 | Ga0307416_100001743 | 3300032002 | Bacteria | 12038 |
| 317 | Ga0307416_101840992 | 3300032002 | Bacteria | 709 |
| 318 | Ga0307411_10298405 | 3300032005 | Bacteria | 1291 |
| 319 | Ga0307415_100000002 | 3300032126 | Bacteria | 133560 |
| 320 | Ga0307415_100000098 | 3300032126 | Bacteria | 36905 |
| 321 | Ga0307415_100037428 | 3300032126 | Bacteria | 3189 |
| 322 | Ga0307415_100038750 | 3300032126 | Bacteria | 3144 |
| 323 | Ga0307415_100099327 | 3300032126 | Bacteria | 2130 |
| 324 | Ga0307415_101308253 | 3300032126 | Bacteria | 687 |
| 325 | Ga0307415_101492403 | 3300032126 | Bacteria | 646 |
| 326 | Ga0307507_10012369 | 3300033179 | Bacteria | 10552 |
| 327 | Ga0307507_10200254 | 3300033179 | Bacteria | 1383 |
| 328 | Ga0316214_1069526 | 3300033545 | Bacteria | 519 |
| 329 | Ga0373926_0003191 | 3300035083 | Bacteria | 5267 |
| 330 | Ga0373926_0298621 | 3300035083 | Bacteria | 628 |
| 331 | Ga0373934_0034051 | 3300035086 | Bacteria | 2001 |
| 332 | Ga0373944_0000521 | 3300035089 | Bacteria | 9004 |
| 333 | Ga0373923_0044000 | 3300035111 | Bacteria | 1849 |
| 334 | Ga0373923_0095632 | 3300035111 | Bacteria | 1304 |
| 335 | Ga0373936_0000194 | 3300035113 | Bacteria | 20266 |
| 336 | Ga0373936_0005154 | 3300035113 | Bacteria | 4919 |
| 337 | Ga0373936_0142741 | 3300035113 | Bacteria | 1034 |
| 338 | Ga0373945_0000440 | 3300035116 | Bacteria | 11738 |
| 339 | Ga0373945_0133515 | 3300035116 | Bacteria | 996 |
| 340 | Ga0373953_0002891 | 3300035117 | Bacteria | 5243 |
| 341 | Ga0373953_0003111 | 3300035117 | Bacteria | 5113 |
| 342 | Ga0373954_0012385 | 3300035118 | Bacteria | 3791 |
| 343 | Ga0373954_0036835 | 3300035118 | Bacteria | 2272 |
| 344 | Ga0373956_0008684 | 3300035119 | Bacteria | 4114 |
| 345 | Ga0373956_0047477 | 3300035119 | Bacteria | 1921 |
| 346 | Ga0373957_0000467 | 3300035120 | Bacteria | 10237 |
| 347 | Ga0373957_0472187 | 3300035120 | Bacteria | 544 |
| 348 | Ga0373943_0000238 | 3300035170 | Bacteria | 22659 |
| 349 | Ga0373943_0043119 | 3300035170 | Bacteria | 2190 |
| 350 | Ga0373943_0137194 | 3300035170 | Bacteria | 1315 |
| 351 | Ga0373943_0514688 | 3300035170 | Bacteria | 700 |
| 352 | Ga0373943_0805574 | 3300035170 | Bacteria | 559 |
| 353 | Ga0373955_0040840 | 3300035172 | Bacteria | 2483 |
| 354 | Ga0373955_0062433 | 3300035172 | Bacteria | 2060 |
| 355 | Ga0373955_0175369 | 3300035172 | Bacteria | 1270 |
| 356 | Ga0373955_0883060 | 3300035172 | Bacteria | 550 |
| 357 | Ga0373924_0000923 | 3300035410 | Bacteria | 9270 |
| 358 | Ga0373924_0054879 | 3300035410 | Bacteria | 1657 |
| 359 | Ga0373924_0087775 | 3300035410 | Bacteria | 1328 |
| 360 | Ga0373931_0295606 | 3300035691 | Bacteria | 999 |
| 361 | Ga0373931_0654589 | 3300035691 | Bacteria | 691 |
| 362 | Ga0373935_0008808 | 3300035692 | Bacteria | 6044 |
| 363 | Ga0373935_0011996 | 3300035692 | Bacteria | 5208 |
| 364 | Ga0373935_0096212 | 3300035692 | Bacteria | 1945 |
| 365 | Ga0373935_0174887 | 3300035692 | Bacteria | 1471 |
| 366 | Ga0373927_0002463 | 3300035695 | Bacteria | 13507 |
| 367 | Ga0373927_0064050 | 3300035695 | Bacteria | 2378 |
| 368 | Ga0373933_0011718 | 3300035724 | Bacteria | 4839 |
| 369 | Ga0373933_0090481 | 3300035724 | Bacteria | 1887 |
| 370 | Ga0373947_0003136 | 3300035725 | Bacteria | 9834 |
| 371 | Ga0373947_0053424 | 3300035725 | Bacteria | 2436 |
| 372 | Ga0373947_0125993 | 3300035725 | Bacteria | 1631 |
| 373 | Ga0373937_0008663 | 3300036401 | Bacteria | 8838 |
| 374 | Ga0373937_0027843 | 3300036401 | Bacteria | 5113 |
| 375 | Ga0373937_1652472 | 3300036401 | Bacteria | 587 |
| 376 | Ga0373925_0001666 | 3300037068 | Bacteria | 18705 |
| 377 | Ga0373925_0001907 | 3300037068 | Bacteria | 17309 |
| 378 | Ga0373925_0005446 | 3300037068 | Bacteria | 9479 |
| 379 | Ga0373925_0013568 | 3300037068 | Bacteria | 5898 |
| 380 | Ga0373925_0222442 | 3300037068 | Bacteria | 1507 |
| 381 | Ga0373925_0337781 | 3300037068 | Bacteria | 1221 |
| 382 | Ga0373925_0358839 | 3300037068 | Bacteria | 1184 |
| 383 | Ga0373925_0365485 | 3300037068 | Bacteria | 1173 |
| 384 | Ga0373925_0559486 | 3300037068 | Bacteria | 941 |
| 385 | Ga0395900_0390910 | 3300037418 | Bacteria | 1357 |
| 386 | Ga0395898_0387439 | 3300037466 | Bacteria | 1333 |
| 387 | Ga0436364_0760857 | 3300037853 | Bacteria | 518 |
| 388 | Ga0436364_1031212 | 3300037853 | Bacteria | 64667 |
| 389 | Ga0436364_1365294 | 3300037853 | Bacteria | 7664 |
| 390 | Ga0451853_0365953 | 3300041512 | Bacteria | 4675 |
| 391 | Ga0451853_2760413 | 3300041512 | Bacteria | 1191 |
| 392 | Ga0439449_0000850 | 3300042007 | Bacteria | 11858 |
| 393 | Ga0439457_009351 | 3300042014 | Bacteria | 2284 |
| 394 | Ga0439457_068989 | 3300042014 | Bacteria | 805 |
| 395 | Ga0450894_000021 | 3300042131 | Bacteria | 21934 |
| 396 | Ga0450899_000365 | 3300042135 | Bacteria | 5015 |
| 397 | Ga0450900_062231 | 3300042136 | Bacteria | 584 |
| 398 | Ga0450906_003322 | 3300042145 | Bacteria | 3472 |
| 399 | Ga0450907_008826 | 3300042146 | Bacteria | 1672 |
| 400 | Ga0450908_006277 | 3300042184 | Bacteria | 2262 |
| 401 | Ga0439434_0155705 | 3300042435 | Bacteria | 758 |
| 402 | Ga0466969_0025722 | 3300044656 | Bacteria | 3024 |
| 403 | Ga0466969_0061342 | 3300044656 | Bacteria | 1826 |
| 404 | Ga0466969_0167954 | 3300044656 | Bacteria | 1006 |
| 405 | Ga0466972_0002024 | 3300044658 | Bacteria | 9925 |
| 406 | Ga0466972_0011716 | 3300044658 | Bacteria | 4403 |
| 407 | Ga0466965_0002853 | 3300044683 | Bacteria | 7455 |
| 408 | Ga0466965_0052326 | 3300044683 | Bacteria | 2028 |
| 409 | Ga0466966_0001829 | 3300044684 | Bacteria | 13802 |
| 410 | Ga0466966_0004992 | 3300044684 | Bacteria | 8723 |
| 411 | Ga0466966_0025912 | 3300044684 | Bacteria | 3830 |
| 412 | Ga0466961_0000531 | 3300044693 | Bacteria | 24191 |
| 413 | Ga0466961_0086168 | 3300044693 | Bacteria | 1985 |
| 414 | Ga0466961_0255898 | 3300044693 | Bacteria | 1074 |
| 415 | Ga0466963_0012167 | 3300044694 | Bacteria | 5259 |
| 416 | Ga0466963_0087167 | 3300044694 | Bacteria | 2122 |
| 417 | Ga0466963_0397113 | 3300044694 | Bacteria | 972 |
| 418 | Ga0466963_0727758 | 3300044694 | Bacteria | 700 |
| 419 | Ga0466963_0768842 | 3300044694 | Bacteria | 679 |
| 420 | Ga0466964_0566640 | 3300044706 | Bacteria | 619 |
| 421 | Ga0466971_0000247 | 3300044719 | Bacteria | 20764 |
| 422 | Ga0466971_0084888 | 3300044719 | Bacteria | 1446 |
| 423 | Ga0466971_0094034 | 3300044719 | Bacteria | 1374 |
| 424 | Ga0466970_0008217 | 3300044765 | Bacteria | 5241 |
| 425 | Ga0466957_0016961 | 3300044842 | Bacteria | 4261 |
| 426 | Ga0466957_0086430 | 3300044842 | Bacteria | 1960 |
| 427 | Ga0466957_0126758 | 3300044842 | Bacteria | 1632 |
| 428 | Ga0466957_0353132 | 3300044842 | Bacteria | 998 |
| 429 | Ga0466959_0001026 | 3300045049 | Bacteria | 16663 |
| 430 | Ga0466959_0028003 | 3300045049 | Bacteria | 4178 |
| 431 | Ga0466959_0066583 | 3300045049 | Bacteria | 2613 |
| 432 | Ga0466959_0071062 | 3300045049 | Bacteria | 2521 |
| 433 | Ga0466967_0001642 | 3300045976 | Bacteria | 13215 |
| 434 | Ga0466967_0024496 | 3300045976 | Bacteria | 4963 |
| 435 | Ga0466967_0453382 | 3300045976 | Bacteria | 1254 |
| 436 | Ga0466967_0600944 | 3300045976 | Bacteria | 1086 |
| 437 | Ga0466967_0713157 | 3300045976 | Bacteria | 994 |
| 438 | Ga0466967_1697886 | 3300045976 | Bacteria | 629 |
| 439 | Ga0466967_1796462 | 3300045976 | Bacteria | 610 |
| 440 | Ga0495592_0018609 | 3300046454 | Bacteria | 5286 |
| 441 | Ga0495592_0090365 | 3300046454 | Bacteria | 2197 |
| 442 | Ga0495592_0090977 | 3300046454 | Bacteria | 2188 |
| 443 | Ga0495592_0131686 | 3300046454 | Bacteria | 1748 |
| 444 | Ga0495592_0230873 | 3300046454 | Bacteria | 1232 |
| 445 | Ga0495603_0004349 | 3300046455 | Bacteria | 8451 |
| 446 | Ga0495603_0008962 | 3300046455 | Bacteria | 6048 |
| 447 | Ga0495629_0004766 | 3300046459 | Bacteria | 10168 |
| 448 | Ga0495629_0006156 | 3300046459 | Bacteria | 8908 |
| 449 | Ga0495629_0010472 | 3300046459 | Bacteria | 6746 |
| 450 | Ga0495629_0097843 | 3300046459 | Bacteria | 2047 |
| 451 | Ga0495638_0368646 | 3300046460 | Bacteria | 753 |
| 452 | Ga0495641_0006254 | 3300046461 | Bacteria | 7761 |
| 453 | Ga0495641_0010448 | 3300046461 | Bacteria | 5379 |
| 454 | Ga0495651_0006618 | 3300046462 | Bacteria | 8848 |
| 455 | Ga0495651_0013817 | 3300046462 | Bacteria | 6245 |
| 456 | Ga0495651_0081745 | 3300046462 | Bacteria | 2438 |
| 457 | Ga0495651_0122381 | 3300046462 | Bacteria | 1909 |
| 458 | Ga0495651_0293025 | 3300046462 | Bacteria | 1094 |
| 459 | Ga0495651_0352876 | 3300046462 | Bacteria | 971 |
| 460 | Ga0495653_0001909 | 3300046463 | Bacteria | 16441 |
| 461 | Ga0495653_0021492 | 3300046463 | Bacteria | 5228 |
| 462 | Ga0495653_0022258 | 3300046463 | Bacteria | 5130 |
| 463 | Ga0495653_0023520 | 3300046463 | Bacteria | 4975 |
| 464 | Ga0495580_0060867 | 3300046472 | Bacteria | 2652 |
| 465 | Ga0495582_0003023 | 3300046473 | Bacteria | 9425 |
| 466 | Ga0495582_0151167 | 3300046473 | Bacteria | 1318 |
| 467 | Ga0495639_0004896 | 3300046475 | Bacteria | 5746 |
| 468 | Ga0495639_0053950 | 3300046475 | Bacteria | 1832 |
| 469 | Ga0495639_0270244 | 3300046475 | Bacteria | 843 |
| 470 | Ga0495662_0002214 | 3300046476 | Bacteria | 9803 |
| 471 | Ga0495662_0002353 | 3300046476 | Bacteria | 9525 |
| 472 | Ga0495662_0003118 | 3300046476 | Bacteria | 8358 |
| 473 | Ga0495662_0004039 | 3300046476 | Bacteria | 7389 |
| 474 | Ga0495662_0095975 | 3300046476 | Bacteria | 1449 |
| 475 | Ga0495664_0000247 | 3300046477 | Bacteria | 26024 |
| 476 | Ga0495664_0000316 | 3300046477 | Bacteria | 23212 |
| 477 | Ga0495664_0002335 | 3300046477 | Bacteria | 10163 |
| 478 | Ga0495664_0015093 | 3300046477 | Bacteria | 4388 |
| 479 | Ga0495594_0111957 | 3300046499 | Bacteria | 1539 |
| 480 | Ga0495594_0164692 | 3300046499 | Bacteria | 1261 |
| 481 | Ga0495608_0010772 | 3300046511 | Bacteria | 6373 |
| 482 | Ga0495608_0025446 | 3300046511 | Bacteria | 4040 |
| 483 | Ga0495608_0107372 | 3300046511 | Bacteria | 1796 |
| 484 | Ga0495618_0021245 | 3300046514 | Bacteria | 4001 |
| 485 | Ga0495618_0021603 | 3300046514 | Bacteria | 3968 |
| 486 | Ga0495618_0105798 | 3300046514 | Bacteria | 1801 |
| 487 | Ga0495618_0109315 | 3300046514 | Bacteria | 1770 |
| 488 | Ga0495628_0014905 | 3300046516 | Bacteria | 6500 |
| 489 | Ga0495628_0018429 | 3300046516 | Bacteria | 5782 |
| 490 | Ga0495628_0409051 | 3300046516 | Bacteria | 990 |
| 491 | Ga0495628_1216557 | 3300046516 | Bacteria | 510 |
| 492 | Ga0495630_0044758 | 3300046517 | Bacteria | 3308 |
| 493 | Ga0495630_0047829 | 3300046517 | Bacteria | 3200 |
| 494 | Ga0495630_0119896 | 3300046517 | Bacteria | 1996 |
| 495 | Ga0495630_0144420 | 3300046517 | Bacteria | 1809 |
| 496 | Ga0495630_0207819 | 3300046517 | Bacteria | 1494 |
| 497 | Ga0495630_0209003 | 3300046517 | Bacteria | 1489 |
| 498 | Ga0495630_0234413 | 3300046517 | Bacteria | 1402 |
| 499 | Ga0495630_0293546 | 3300046517 | Bacteria | 1242 |
| 500 | Ga0495666_0000742 | 3300046526 | Bacteria | 14986 |
| 501 | Ga0495666_0188388 | 3300046526 | Bacteria | 951 |
| 502 | Ga0495666_0202819 | 3300046526 | Bacteria | 911 |
| 503 | Ga0495652_0001917 | 3300046529 | Bacteria | 22128 |
| 504 | Ga0495652_0066412 | 3300046529 | Bacteria | 3027 |
| 505 | Ga0495652_0201992 | 3300046529 | Bacteria | 1507 |
| 506 | Ga0495665_0003609 | 3300046531 | Bacteria | 8402 |
| 507 | Ga0495665_0004092 | 3300046531 | Bacteria | 7858 |
| 508 | Ga0495665_0543568 | 3300046531 | Bacteria | 583 |
| 509 | Ga0495640_0017843 | 3300046533 | Bacteria | 5278 |
| 510 | Ga0495640_0038410 | 3300046533 | Bacteria | 3367 |
| 511 | Ga0495640_0115938 | 3300046533 | Bacteria | 1745 |
| 512 | Ga0495640_0342323 | 3300046533 | Bacteria | 924 |
| 513 | Ga0495640_0773630 | 3300046533 | Bacteria | 573 |
| 514 | Ga0495586_0006159 | 3300046535 | Bacteria | 6415 |
| 515 | Ga0495586_0069625 | 3300046535 | Bacteria | 1920 |
| 516 | Ga0495586_0103792 | 3300046535 | Bacteria | 1579 |
| 517 | Ga0495586_0166944 | 3300046535 | Bacteria | 1243 |
| 518 | Ga0495587_0001362 | 3300046536 | Bacteria | 16198 |
| 519 | Ga0495587_0033397 | 3300046536 | Bacteria | 3106 |
| 520 | Ga0495587_0048122 | 3300046536 | Bacteria | 2526 |
| 521 | Ga0495587_0166307 | 3300046536 | Bacteria | 1254 |
| 522 | Ga0495587_0674119 | 3300046536 | Bacteria | 567 |
| 523 | Ga0495645_0030273 | 3300046543 | Bacteria | 3941 |
| 524 | Ga0495645_0037276 | 3300046543 | Bacteria | 3543 |
| 525 | Ga0495645_0063365 | 3300046543 | Bacteria | 2677 |
| 526 | Ga0495645_0176786 | 3300046543 | Bacteria | 1465 |
| 527 | Ga0495645_0816324 | 3300046543 | Bacteria | 558 |
| 528 | Ga0495633_0359551 | 3300046558 | Bacteria | 659 |
| 529 | Ga0495667_0004115 | 3300046559 | Bacteria | 9774 |
| 530 | Ga0495667_0007662 | 3300046559 | Bacteria | 7325 |
| 531 | Ga0495667_0025011 | 3300046559 | Bacteria | 4024 |
| 532 | Ga0495667_0087561 | 3300046559 | Bacteria | 2019 |
| 533 | Ga0495667_0321133 | 3300046559 | Bacteria | 980 |
| 534 | Ga0495667_0387061 | 3300046559 | Bacteria | 881 |
| 535 | Ga0495656_0137023 | 3300046615 | Bacteria | 1170 |
| 536 | Ga0495634_0005386 | 3300046642 | Bacteria | 9858 |
| 537 | Ga0495634_0025122 | 3300046642 | Bacteria | 4173 |
| 538 | Ga0495634_0090445 | 3300046642 | Bacteria | 1988 |
| 539 | Ga0495634_0186145 | 3300046642 | Bacteria | 1297 |
| 540 | Ga0495634_0243754 | 3300046642 | Bacteria | 1101 |
| 541 | Ga0495634_0609373 | 3300046642 | Bacteria | 633 |
| 542 | Ga0495635_0000167 | 3300046663 | Bacteria | 40888 |
| 543 | Ga0495635_0003202 | 3300046663 | Bacteria | 11285 |
| 544 | Ga0495635_0008825 | 3300046663 | Bacteria | 7040 |
| 545 | Ga0495635_0042469 | 3300046663 | Bacteria | 3139 |
| 546 | Ga0495635_0052118 | 3300046663 | Bacteria | 2818 |
| 547 | Ga0495635_0075774 | 3300046663 | Bacteria | 2304 |
| 548 | Ga0495635_0396581 | 3300046663 | Bacteria | 917 |
| 549 | Ga0495661_0107077 | 3300046665 | Bacteria | 1563 |
| 550 | Ga0495588_0002910 | 3300046674 | Bacteria | 7383 |
| 551 | Ga0495657_0000773 | 3300046675 | Bacteria | 28412 |
| 552 | Ga0495657_0001338 | 3300046675 | Bacteria | 21439 |
| 553 | Ga0495657_0018126 | 3300046675 | Bacteria | 5100 |
| 554 | Ga0495657_0030586 | 3300046675 | Bacteria | 3769 |
| 555 | Ga0495657_0061939 | 3300046675 | Bacteria | 2473 |
| 556 | Ga0495657_0318688 | 3300046675 | Bacteria | 924 |
| 557 | Ga0495599_0034805 | 3300046678 | Bacteria | 3163 |
| 558 | Ga0495599_0075500 | 3300046678 | Bacteria | 2104 |
| 559 | Ga0495599_0318435 | 3300046678 | Bacteria | 936 |
| 560 | Ga0495623_0031456 | 3300046679 | Bacteria | 3411 |
| 561 | Ga0495623_0066758 | 3300046679 | Bacteria | 2247 |
| 562 | Ga0495623_0083640 | 3300046679 | Bacteria | 1970 |
| 563 | Ga0495623_0149472 | 3300046679 | Bacteria | 1382 |
| 564 | Ga0495623_0263528 | 3300046679 | Bacteria | 964 |
| 565 | Ga0495646_0001609 | 3300046680 | Bacteria | 13429 |
| 566 | Ga0495646_0005504 | 3300046680 | Bacteria | 8009 |
| 567 | Ga0495646_0029330 | 3300046680 | Bacteria | 3439 |
| 568 | Ga0495646_0044251 | 3300046680 | Bacteria | 2722 |
| 569 | Ga0495647_0040917 | 3300046681 | Bacteria | 1763 |
| 570 | Ga0495658_0005075 | 3300046683 | Bacteria | 6469 |
| 571 | Ga0495658_0036706 | 3300046683 | Bacteria | 2705 |
| 572 | Ga0495613_0032948 | 3300046689 | Bacteria | 3849 |
| 573 | Ga0495613_0043331 | 3300046689 | Bacteria | 3329 |
| 574 | Ga0495613_0115006 | 3300046689 | Bacteria | 1936 |
| 575 | Ga0495613_0236408 | 3300046689 | Bacteria | 1278 |
| 576 | Ga0495613_1093319 | 3300046689 | Bacteria | 509 |
| 577 | Ga0495624_0007830 | 3300046690 | Bacteria | 7498 |
| 578 | Ga0495624_0014916 | 3300046690 | Bacteria | 5262 |
| 579 | Ga0495624_0565966 | 3300046690 | Bacteria | 678 |
| 580 | Ga0495671_0192197 | 3300046692 | Bacteria | 991 |
| 581 | Ga0495589_0246121 | 3300046794 | Bacteria | 836 |
| 582 | Ga0495600_0012852 | 3300046809 | Bacteria | 5244 |
| 583 | Ga0495600_0032630 | 3300046809 | Bacteria | 3379 |
| 584 | Ga0495600_0054189 | 3300046809 | Bacteria | 2619 |
| 585 | Ga0495600_0104179 | 3300046809 | Bacteria | 1848 |
| 586 | Ga0495600_0177786 | 3300046809 | Bacteria | 1372 |
| 587 | Ga0495581_0009288 | 3300047315 | Bacteria | 5691 |
| 588 | Ga0495581_0017432 | 3300047315 | Bacteria | 4171 |
| 589 | Ga0495581_0021811 | 3300047315 | Bacteria | 3711 |
| 590 | Ga0495581_0174472 | 3300047315 | Bacteria | 1257 |
| 591 | Ga0495604_0001147 | 3300047317 | Bacteria | 21946 |
| 592 | Ga0495604_0016962 | 3300047317 | Bacteria | 5824 |
| 593 | Ga0495604_0031311 | 3300047317 | Bacteria | 4219 |
| 594 | Ga0495604_0069299 | 3300047317 | Bacteria | 2674 |
| 595 | Ga0495636_0001180 | 3300047318 | Bacteria | 9852 |
| 596 | Ga0495636_0018480 | 3300047318 | Bacteria | 2797 |
| 597 | Ga0495674_0003289 | 3300047319 | Bacteria | 15694 |
| 598 | Ga0495674_0079561 | 3300047319 | Bacteria | 2814 |
| 599 | Ga0495674_0297551 | 3300047319 | Bacteria | 1318 |
| 600 | Ga0495674_0808380 | 3300047319 | Bacteria | 729 |
| 601 | Ga0495676_0002649 | 3300047321 | Bacteria | 16011 |
| 602 | Ga0495676_0008469 | 3300047321 | Bacteria | 9423 |
| 603 | Ga0495676_0252125 | 3300047321 | Bacteria | 1203 |
| 604 | Ga0495680_0015558 | 3300047322 | Bacteria | 6562 |
| 605 | Ga0495680_0016758 | 3300047322 | Bacteria | 6282 |
| 606 | Ga0495680_0033499 | 3300047322 | Bacteria | 4157 |
| 607 | Ga0495680_0420955 | 3300047322 | Bacteria | 919 |
| 608 | Ga0495675_0010973 | 3300047444 | Bacteria | 5679 |
| 609 | Ga0495675_0013249 | 3300047444 | Bacteria | 5204 |
| 610 | Ga0495675_0018093 | 3300047444 | Bacteria | 4468 |
| 611 | Ga0495675_0018701 | 3300047444 | Bacteria | 4399 |
| 612 | Ga0495675_0196034 | 3300047444 | Bacteria | 1231 |
| 613 | Ga0495675_0207583 | 3300047444 | Bacteria | 1190 |
| 614 | Ga0495685_007593 | 3300047447 | Bacteria | 3586 |
| 615 | Ga0495685_008397 | 3300047447 | Bacteria | 3428 |
| 616 | Ga0495685_144024 | 3300047447 | Bacteria | 775 |
| 617 | Ga0495681_0382553 | 3300047470 | Bacteria | 529 |
| 618 | Ga0495684_0002297 | 3300047471 | Bacteria | 15309 |
| 619 | Ga0495684_0109541 | 3300047471 | Bacteria | 2085 |
| 620 | Ga0495684_0127937 | 3300047471 | Bacteria | 1909 |
| 621 | Ga0495684_0176061 | 3300047471 | Bacteria | 1588 |
| 622 | Ga0495593_0005070 | 3300047673 | Bacteria | 7786 |
| 623 | Ga0495593_0009211 | 3300047673 | Bacteria | 5725 |
| 624 | Ga0495593_0086836 | 3300047673 | Bacteria | 1613 |
| 625 | Ga0495602_0022314 | 3300048088 | Bacteria | 6200 |
| 626 | Ga0495602_0051532 | 3300048088 | Bacteria | 3664 |
| 627 | Ga0495602_0082563 | 3300048088 | Bacteria | 2696 |
| 628 | Ga0495602_0110354 | 3300048088 | Bacteria | 2236 |
| 629 | Ga0495602_0422344 | 3300048088 | Bacteria | 946 |
| 630 | Ga0495614_0008778 | 3300048089 | Bacteria | 4488 |
| 631 | Ga0495614_0046986 | 3300048089 | Bacteria | 1851 |
| 632 | Ga0496100_0714994 | 3300048903 | Bacteria | 782 |
| 633 | Ga0496102_0613448 | 3300048905 | Bacteria | 1011 |
| 634 | Ga0496104_0012898 | 3300048907 | Bacteria | 7528 |
| 635 | Ga0496105_0026628 | 3300048908 | Bacteria | 4720 |
| 636 | Ga0496106_0211570 | 3300048909 | Bacteria | 1545 |
| 637 | Ga0496107_1102612 | 3300048910 | Bacteria | 573 |
| 638 | Ga0496108_0071721 | 3300048911 | Bacteria | 2923 |
| 639 | Ga0496108_0207793 | 3300048911 | Bacteria | 1699 |
| 640 | Ga0496109_0069627 | 3300048912 | Bacteria | 3227 |
| 641 | Ga0496109_0869981 | 3300048912 | Bacteria | 839 |
| 642 | Ga0496110_0006856 | 3300048913 | Bacteria | 9053 |
| 643 | Ga0496110_0254089 | 3300048913 | Bacteria | 1600 |
| 644 | Ga0496112_0078594 | 3300048915 | Bacteria | 3262 |
| 645 | Ga0496112_0458038 | 3300048915 | Bacteria | 1213 |
| 646 | Ga0496113_0185806 | 3300048916 | Bacteria | 1648 |
| 647 | Ga0496113_0661526 | 3300048916 | Bacteria | 835 |
| 648 | Ga0496118_0050726 | 3300048921 | Bacteria | 3181 |
| 649 | Ga0501031_0003919 | 3300049568 | Bacteria | 9577 |
| 650 | Ga0501031_0106523 | 3300049568 | Bacteria | 1830 |
| 651 | Ga0501031_0356150 | 3300049568 | Bacteria | 947 |
| 652 | Ga0501032_0001291 | 3300049569 | Bacteria | 20081 |
| 653 | Ga0501032_0068418 | 3300049569 | Bacteria | 2370 |
| 654 | Ga0501033_0016210 | 3300049570 | Bacteria | 5643 |
| 655 | Ga0501033_0026945 | 3300049570 | Bacteria | 4323 |
| 656 | Ga0501033_0069408 | 3300049570 | Bacteria | 2590 |
| 657 | Ga0501033_0225042 | 3300049570 | Bacteria | 1334 |
| 658 | Ga0501033_0254674 | 3300049570 | Bacteria | 1243 |
| 659 | Ga0501034_0006043 | 3300049571 | Bacteria | 13079 |
| 660 | Ga0501034_0009322 | 3300049571 | Bacteria | 10286 |
| 661 | Ga0501034_0050027 | 3300049571 | Bacteria | 4216 |
| 662 | Ga0501034_0061081 | 3300049571 | Bacteria | 3785 |
| 663 | Ga0501034_1226948 | 3300049571 | Bacteria | 628 |
| 664 | Ga0501036_0016208 | 3300049572 | Bacteria | 6223 |
| 665 | Ga0501036_0135360 | 3300049572 | Bacteria | 2080 |
| 666 | Ga0501037_0010214 | 3300049573 | Bacteria | 6887 |
| 667 | Ga0501037_0010871 | 3300049573 | Bacteria | 6687 |
| 668 | Ga0501037_0028282 | 3300049573 | Bacteria | 4141 |
| 669 | Ga0501037_0228408 | 3300049573 | Bacteria | 1307 |
| 670 | Ga0501037_0594567 | 3300049573 | Bacteria | 743 |
| 671 | Ga0501038_0009661 | 3300049574 | Bacteria | 8847 |
| 672 | Ga0501038_0132857 | 3300049574 | Bacteria | 2041 |
| 673 | Ga0501038_0153011 | 3300049574 | Bacteria | 1879 |
| 674 | Ga0501038_0195012 | 3300049574 | Bacteria | 1628 |
| 675 | Ga0501038_0283223 | 3300049574 | Bacteria | 1304 |
| 676 | Ga0501038_0335885 | 3300049574 | Bacteria | 1179 |
| 677 | Ga0501039_0049584 | 3300049575 | Bacteria | 3246 |
| 678 | Ga0501039_0071959 | 3300049575 | Bacteria | 2687 |
| 679 | Ga0501039_0081455 | 3300049575 | Bacteria | 2520 |
| 680 | Ga0501039_0529002 | 3300049575 | Bacteria | 925 |
| 681 | Ga0501042_0003321 | 3300049578 | Bacteria | 10074 |
| 682 | Ga0501042_0018064 | 3300049578 | Bacteria | 4878 |
| 683 | Ga0501042_0036608 | 3300049578 | Bacteria | 3482 |
| 684 | Ga0501043_0000673 | 3300049579 | Bacteria | 30061 |
| 685 | Ga0501043_0001578 | 3300049579 | Bacteria | 19823 |
| 686 | Ga0501043_0002129 | 3300049579 | Bacteria | 16906 |
| 687 | Ga0501043_0126463 | 3300049579 | Bacteria | 2004 |
| 688 | Ga0501043_0537784 | 3300049579 | Bacteria | 869 |
| 689 | Ga0501043_0777207 | 3300049579 | Bacteria | 694 |
| 690 | Ga0501046_0005101 | 3300049580 | Bacteria | 11782 |
| 691 | Ga0501046_0011092 | 3300049580 | Bacteria | 7715 |
| 692 | Ga0501046_0408945 | 3300049580 | Bacteria | 979 |
| 693 | Ga0501047_0000103 | 3300049581 | Bacteria | 104053 |
| 694 | Ga0501047_0000324 | 3300049581 | Bacteria | 55265 |
| 695 | Ga0501047_0002749 | 3300049581 | Bacteria | 16746 |
| 696 | Ga0501047_0004142 | 3300049581 | Bacteria | 13652 |
| 697 | Ga0501047_0064149 | 3300049581 | Bacteria | 3543 |
| 698 | Ga0501047_0254454 | 3300049581 | Bacteria | 1604 |
| 699 | Ga0501047_0259083 | 3300049581 | Bacteria | 1587 |
| 700 | Ga0501047_0553155 | 3300049581 | Bacteria | 975 |
| 701 | Ga0501048_0009631 | 3300049582 | Bacteria | 7248 |
| 702 | Ga0501048_0055495 | 3300049582 | Bacteria | 2812 |
| 703 | Ga0501069_0254695 | 3300049585 | Bacteria | 1024 |
| 704 | Ga0501070_0001568 | 3300049586 | Bacteria | 20323 |
| 705 | Ga0501070_0417303 | 3300049586 | Bacteria | 1084 |
| 706 | Ga0501071_1046348 | 3300049587 | Bacteria | 631 |
| 707 | Ga0501073_0011517 | 3300049589 | Bacteria | 6467 |
| 708 | Ga0501073_0571255 | 3300049589 | Bacteria | 781 |
| 709 | Ga0501074_0003059 | 3300049590 | Bacteria | 11793 |
| 710 | Ga0501074_0003200 | 3300049590 | Bacteria | 11546 |
| 711 | Ga0501080_0362432 | 3300049742 | Bacteria | 1308 |
| 712 | Ga0501083_0428815 | 3300049744 | Bacteria | 860 |
| 713 | Ga0501035_0021129 | 3300049822 | Bacteria | 5983 |
| 714 | Ga0501035_0037973 | 3300049822 | Bacteria | 4361 |
| 715 | Ga0501035_0089351 | 3300049822 | Bacteria | 2713 |
| 716 | Ga0501035_0373759 | 3300049822 | Bacteria | 1189 |
| 717 | Ga0501044_0000489 | 3300049823 | Bacteria | 48052 |
| 718 | Ga0501044_0002151 | 3300049823 | Bacteria | 22603 |
| 719 | Ga0501044_0033756 | 3300049823 | Bacteria | 5373 |
| 720 | Ga0501044_0144941 | 3300049823 | Bacteria | 2361 |
| 721 | Ga0501044_0254599 | 3300049823 | Bacteria | 1695 |
| 722 | Ga0501044_0256880 | 3300049823 | Bacteria | 1686 |
| 723 | Ga0501044_0257162 | 3300049823 | Bacteria | 1685 |
| 724 | Ga0501044_0293754 | 3300049823 | Bacteria | 1556 |
| 725 | Ga0501044_0390713 | 3300049823 | Bacteria | 1305 |
| 726 | Ga0501045_0175405 | 3300049824 | Bacteria | 1597 |
| 727 | Ga0501045_0407841 | 3300049824 | Bacteria | 1011 |
| 728 | nmdc:mga07m45_179045_c1 | 3300050496 | Bacteria | 1233 |
| 729 | nmdc:mga05p37_420_c1 | 3300050507 | Bacteria | 45931 |
| 730 | nmdc:mga09592_13_c1 | 3300050508 | Bacteria | 101979 |
| 731 | nmdc:mga09592_373135_c1 | 3300050508 | Bacteria | 1234 |
| 732 | nmdc:mga09592_48386_c1 | 3300050508 | Bacteria | 3584 |
| 733 | nmdc:mga0qj67_683943_c1 | 3300050509 | Bacteria | 817 |
| 734 | nmdc:mga0qj67_79_c2 | 3300050509 | Bacteria | 27322 |
| 735 | nmdc:mga06r32_1382906_c1 | 3300050510 | Bacteria | 646 |
| 736 | nmdc:mga06r32_182855_c1 | 3300050510 | Bacteria | 2082 |
| 737 | nmdc:mga06r32_475605_c1 | 3300050510 | Bacteria | 1228 |
| 738 | nmdc:mga06r32_493798_c1 | 3300050510 | Bacteria | 1201 |
| 739 | nmdc:mga06r32_839_c1 | 3300050510 | Bacteria | 27208 |
| 740 | nmdc:mga08y16_876828_c1 | 3300050511 | Bacteria | 885 |
| 741 | nmdc:mga0rr50_1212798_c1 | 3300050513 | Bacteria | 641 |
| 742 | nmdc:mga08x19_158905_c1 | 3300050514 | Bacteria | 1534 |
| 743 | nmdc:mga0a205_888322_c1 | 3300050515 | Bacteria | 738 |
| 744 | Ga0495601_0001481 | 3300053077 | Bacteria | 12950 |
| 745 | Ga0495601_0013978 | 3300053077 | Bacteria | 4833 |
| 746 | Ga0495601_0052360 | 3300053077 | Bacteria | 2577 |
| 747 | Ga0495601_1006136 | 3300053077 | Bacteria | 524 |
| 748 | Ga0495612_0003381 | 3300053078 | Bacteria | 6610 |
| 749 | Ga0495612_0059382 | 3300053078 | Bacteria | 1581 |
| 750 | Ga0495655_0137215 | 3300053083 | Bacteria | 758 |
| 751 | Ga0495595_0104458 | 3300053084 | Bacteria | 1369 |
| 752 | Ga0495619_0012562 | 3300053085 | Bacteria | 5333 |
| 753 | Ga0495619_0183718 | 3300053085 | Bacteria | 1447 |
| 754 | Ga0495619_0304285 | 3300053085 | Bacteria | 1104 |
| 755 | Ga0500646_0001692 | 3300053090 | Bacteria | 5824 |
| 756 | Ga0500583_0024134 | 3300053092 | Bacteria | 2576 |
| 757 | Ga0500640_034466 | 3300053095 | Bacteria | 2223 |
| 758 | Ga0500641_0044721 | 3300053096 | Bacteria | 1801 |
| 759 | Ga0500560_000756 | 3300053107 | Bacteria | 4907 |
| 760 | Ga0500572_184658 | 3300053111 | Bacteria | 683 |
| 761 | Ga0500594_0040537 | 3300053118 | Bacteria | 1272 |
| 762 | Ga0500594_0191549 | 3300053118 | Bacteria | 670 |
| 763 | Ga0500573_0012698 | 3300053140 | Bacteria | 4734 |
| 764 | Ga0500573_0055408 | 3300053140 | Bacteria | 2275 |
| 765 | Ga0500573_0300706 | 3300053140 | Bacteria | 802 |
| 766 | Ga0500573_0388632 | 3300053140 | Bacteria | 664 |
| 767 | Ga0500588_0042843 | 3300053146 | Bacteria | 1373 |
| 768 | Ga0500616_0003572 | 3300053153 | Bacteria | 11769 |
| 769 | Ga0500624_001412 | 3300053157 | Bacteria | 3955 |
| 770 | Ga0500627_0234482 | 3300053158 | Bacteria | 816 |
| 771 | Ga0500633_0061389 | 3300053160 | Bacteria | 1323 |
| 772 | Ga0500633_0184354 | 3300053160 | Bacteria | 782 |
| 773 | Ga0466962_0000284 | 3300061719 | Bacteria | 21433 |
| 774 | Ga0466962_0004160 | 3300061719 | Bacteria | 6936 |
| 775 | Ga0466962_0021439 | 3300061719 | Bacteria | 3102 |
| 776 | 2501939941 | 2501939600 | Bacteria | 6907073 |
| 777 | 2515758259 | 2515154137 | Bacteria | 5711575 |
| 778 | 2516091859 | 2515154203 | Bacteria | 5458536 |
| 779 | 2772646956 | 2772190715 | Bacteria | 6959372 |
| 780 | 2776373093 | 2775506925 | Bacteria | 7237746 |
| 781 | 2793976747 | 2791355406 | Bacteria | 11364898 |
| 782 | 2804843633 | 2802429296 | Bacteria | 7227771 |
| 783 | 2831937343 | 2831935698 | Bacteria | 5963223 |
| 784 | 2832010345 | 2832004796 | Bacteria | 6538017 |
| 785 | 2855675395 | 2855670206 | Bacteria | 7120389 |
| 786 | 2855682973 | 2855676851 | Bacteria | 7063653 |
| 787 | 2855688717 | 2855683550 | Bacteria | 7134265 |
| 788 | 2856864285 | 2856858025 | Bacteria | 7255264 |
| 789 | 2857292809 | 2857288857 | Bacteria | 7189066 |
| 790 | 2858853532 | 2858848962 | Bacteria | 6963058 |
| 791 | 2858871157 | 2858868258 | Bacteria | 7683772 |
| 792 | 2858884945 | 2858882152 | Bacteria | 7230291 |
| 793 | 2858891236 | 2858888857 | Bacteria | 7060307 |
| 794 | 2858897284 | 2858895516 | Bacteria | 7378898 |
| 795 | 2858906615 | 2858902515 | Bacteria | 7086037 |
| 796 | 2863069257 | 2863067949 | Bacteria | 8541735 |
| 797 | 2863070821 | 2863067949 | Bacteria | 8541735 |
| 798 | 2863407077 | 2863404153 | Bacteria | 9672205 |
| 799 | 2866065583 | 2866065130 | Bacteria | 6518152 |
| 800 | 2866552845 | 2866552031 | Bacteria | 5824618 |
| 801 | 2866555237 | 2866552031 | Bacteria | 5824618 |
| 802 | 2866557518 | 2866552031 | Bacteria | 5824618 |
| 803 | 2867303721 | 2867302475 | Bacteria | 7087181 |
| 804 | 2867318812 | 2867312974 | Bacteria | 7058875 |
| 805 | 2867320775 | 2867319477 | Bacteria | 7069771 |
| 806 | 2867479835 | 2867475112 | Bacteria | 6909112 |
| 807 | 2867511952 | 2867507094 | Bacteria | 6506033 |
| 808 | 2869048882 | 2869048445 | Bacteria | 6875584 |
| 809 | 2869063320 | 2869061728 | Bacteria | 7112407 |
| 810 | 2869074905 | 2869068681 | Bacteria | 7205615 |
| 811 | 2880489891 | 2880489317 | Bacteria | 7096270 |
| 812 | 2880502678 | 2880495981 | Bacteria | 7340502 |
| 813 | 2902585840 | 2902582711 | Bacteria | 6187705 |
| 814 | 2929224498 | 2929219909 | Bacteria | 6984360 |
| 815 | 2929231101 | 2929226422 | Bacteria | 7248583 |
| 816 | 2990059686 | 2990059506 | Bacteria | 9321252 |
| 817 | 2990090471 | 2990088156 | Bacteria | 6657676 |
| 818 | 2996223082 | 2996221748 | Bacteria | 6799777 |
| 819 | 2996224354 | 2996221748 | Bacteria | 6799777 |
| 820 | 2997453765 | 2997451912 | Bacteria | 8492419 |
| 821 | 3006488268 | 3006486233 | Bacteria | 8157040 |
| 822 | 649813417 | 649633069 | Bacteria | 6962533 |
| 823 | 649814186 | 649633069 | Bacteria | 6962533 |
| 824 | 8003832080 | 8003830390 | Bacteria | 6541657 |
| 825 | 8003856781 | 8003856774 | Bacteria | 7675274 |
| 826 | 8025414764 | 8025413630 | Bacteria | 7014048 |
| 827 | 8047901183 | 8047893842 | Bacteria | 11723082 |
| 828 | 8048357718 | 8048356638 | Bacteria | 11044339 |
| 829 | 8048378122 | 8048369669 | Bacteria | 11666822 |
| 830 | 8048387220 | 8048379754 | Bacteria | 11877923 |
| 831 | 8054731380 | 8054727385 | Bacteria | 7558670 |
| 832 | 8054736627 | 8054734606 | Bacteria | 6947278 |
| 833 | 8055415260 | 8055412473 | Bacteria | 6257500 |
| 834 | 8056066077 | 8056060235 | Bacteria | 7259403 |
| 835 | 8056209290 | 8056207758 | Bacteria | 8639239 |
| 836 | 8056211747 | 8056207758 | Bacteria | 8639239 |
| 837 | nmdc:mga03n38_203827_c1 | |||
| 838 | JGI25160J50197_1022601 | |||
| 839 | JGI25160J50197_1025476 | |||
| 840 | Ga0070683_100007237 | |||
| 841 | Ga0070683_100152472 | |||
| 842 | Ga0070683_100713239 | |||
| 843 | Ga0070690_101291923 | |||
| 844 | Ga0068869_100087728 | |||
| 845 | Ga0068869_100530155 | |||
| 846 | Ga0068869_100691510 | |||
| 847 | Ga0068869_100908760 | |||
| 848 | Ga0068869_101348292 | |||
| 849 | Ga0070682_100275910 | |||
| 850 | Ga0068868_102246681 | |||
| 851 | Ga0070660_100787906 | |||
| 852 | Ga0070689_100458154 | |||
| 853 | Ga0070687_101529837 | |||
| 854 | Ga0070661_100221310 | |||
| 855 | Ga0070669_101795474 | |||
| 856 | Ga0070675_101300069 | |||
| 857 | Ga0070671_100584040 | |||
| 858 | Ga0070709_10063805 | |||
| 859 | Ga0070709_10111954 | |||
| 860 | Ga0070709_10142527 | |||
| 861 | Ga0070709_10226933 | |||
| 862 | Ga0070714_100000300 | |||
| 863 | Ga0070714_100045116 | |||
| 864 | Ga0070714_100066294 | |||
| 865 | Ga0070714_100153000 | |||
| 866 | Ga0070714_100155580 | |||
| 867 | Ga0070714_100350755 | |||
| 868 | Ga0070714_100488487 | |||
| 869 | Ga0070714_100967969 | |||
| 870 | Ga0070713_100024601 | |||
| 871 | Ga0070713_100063879 | |||
| 872 | Ga0070713_100378789 | |||
| 873 | Ga0070713_100438671 | |||
| 874 | Ga0070713_101668982 | |||
| 875 | Ga0070710_10115447 | |||
| 876 | Ga0070710_10125952 | |||
| 877 | Ga0070710_10249480 | |||
| 878 | Ga0070711_100521718 | |||
| 879 | Ga0070700_100708573 | |||
| 880 | Ga0070708_100092705 | |||
| 881 | Ga0070708_100126480 | |||
| 882 | Ga0070663_101933320 | |||
| 883 | Ga0070706_100525362 | |||
| 884 | Ga0070706_100588249 | |||
| 885 | Ga0070706_100608847 | |||
| 886 | Ga0070707_100000443 | |||
| 887 | Ga0070707_100007603 | |||
| 888 | Ga0070707_100064205 | |||
| 889 | Ga0070707_100314156 | |||
| 890 | Ga0070698_100009111 | |||
| 891 | Ga0070698_100045746 | |||
| 892 | Ga0070698_100236237 | |||
| 893 | Ga0070698_100472074 | |||
| 894 | Ga0070684_100003402 | |||
| 895 | Ga0070684_100051692 | |||
| 896 | Ga0070684_100123607 | |||
| 897 | Ga0070684_101430143 | |||
| 898 | Ga0070684_101668642 | |||
| 899 | Ga0070697_100036139 | |||
| 900 | Ga0068853_102167446 | |||
| 901 | Ga0070672_100641471 | |||
| 902 | Ga0070693_100650629 | |||
| 903 | Ga0070704_101613626 | |||
| 904 | Ga0068855_100437349 | |||
| 905 | Ga0068855_101156141 | |||
| 906 | Ga0070664_100088613 | |||
| 907 | Ga0070664_100145904 | |||
| 908 | Ga0070664_100235497 | |||
| 909 | Ga0070664_100306138 | |||
| 910 | Ga0068857_100059449 | |||
| 911 | Ga0068857_100383853 | |||
| 912 | Ga0068857_100426872 | |||
| 913 | Ga0068857_100494570 | |||
| 914 | Ga0068857_100910787 | |||
| 915 | Ga0068857_101317747 | |||
| 916 | Ga0068856_100112083 | |||
| 917 | Ga0068856_101803321 | |||
| 918 | Ga0068852_101756371 | |||
| 919 | Ga0068859_100013820 | |||
| 920 | Ga0068859_100348684 | |||
| 921 | Ga0068859_102097484 | |||
| 922 | Ga0068864_100013574 | |||
| 923 | Ga0068864_100068828 | |||
| 924 | Ga0068864_100264281 | |||
| 925 | Ga0068866_11040061 | |||
| 926 | Ga0068863_100000700 | |||
| 927 | Ga0068863_100077869 | |||
| 928 | Ga0068863_100126249 | |||
| 929 | Ga0068863_100332931 | |||
| 930 | Ga0068863_100677529 | |||
| 931 | Ga0068858_100090244 | |||
| 932 | Ga0068858_100111496 | |||
| 933 | Ga0068858_100123563 | |||
| 934 | Ga0068858_100221015 | |||
| 935 | Ga0068862_100000496 | |||
| 936 | Ga0068862_100238953 | |||
| 937 | Ga0068862_101843964 | |||
| 938 | Ga0081455_10209483 | |||
| 939 | Ga0081455_10374734 | |||
| 940 | Ga0081539_10037493 | |||
| 941 | Ga0070717_10014741 | |||
| 942 | Ga0070717_10042179 | |||
| 943 | Ga0070717_10838179 | |||
| 944 | Ga0075363_100025241 | |||
| 945 | Ga0070715_10006050 | |||
| 946 | Ga0070715_10369146 | |||
| 947 | Ga0070716_100392659 | |||
| 948 | Ga0070712_100132989 | |||
| 949 | Ga0070712_100186608 | |||
| 950 | Ga0070712_100259735 | |||
| 951 | Ga0097621_101155991 | |||
| 952 | Ga0075370_10195739 | |||
| 953 | Ga0075428_100000410 | |||
| 954 | Ga0075428_100084277 | |||
| 955 | Ga0075428_100086491 | |||
| 956 | Ga0075428_100091820 | |||
| 957 | Ga0075428_100103739 | |||
| 958 | Ga0075428_100625413 | |||
| 959 | Ga0075428_100689374 | |||
| 960 | Ga0075428_101630888 | |||
| 961 | Ga0075430_100037253 | |||
| 962 | Ga0075430_100382671 | |||
| 963 | Ga0075431_100002781 | |||
| 964 | Ga0075431_100078274 | |||
| 965 | Ga0075431_100175579 | |||
| 966 | Ga0075431_100182905 | |||
| 967 | Ga0075431_101331442 | |||
| 968 | Ga0075434_100225156 | |||
| 969 | Ga0075429_100005553 | |||
| 970 | Ga0075429_100052579 | |||
| 971 | Ga0075429_100857265 | |||
| 972 | Ga0075436_100164328 | |||
| 973 | Ga0097620_100000147 | |||
| 974 | Ga0097620_100013820 | |||
| 975 | Ga0097620_100348668 | |||
| 976 | Ga0097620_102097190 | |||
| 977 | Ga0075435_100221168 | |||
| 978 | Ga0105251_10091925 | |||
| 979 | Ga0111539_10671224 | |||
| 980 | Ga0111539_10889792 | |||
| 981 | Ga0105247_11171757 | |||
| 982 | Ga0114129_10000074 | |||
| 983 | Ga0114129_10011584 | |||
| 984 | Ga0114129_10196033 | |||
| 985 | Ga0105243_12568365 | |||
| 986 | Ga0105248_10000140 | |||
| 987 | Ga0105248_10018715 | |||
| 988 | Ga0105248_10063798 | |||
| 989 | Ga0105237_10174445 | |||
| 990 | Ga0105249_10221928 | |||
| 991 | Ga0105239_11087192 | |||
| 992 | Ga0105246_10999714 | |||
| 993 | Ga0105246_11675819 | |||
| 994 | Ga0163162_11469355 | |||
| 995 | Ga0157375_10531883 | |||
| 996 | Ga0157375_11402215 | |||
| 997 | Ga0157375_12164131 | |||
| 998 | Ga0163163_10005388 | |||
| 999 | Ga0163163_10031208 | |||
| 1000 | Ga0163163_10310199 | |||
| 1001 | Ga0163163_10403430 | |||
| 1002 | Ga0163163_12839450 | |||
| 1003 | Ga0157380_10220725 | |||
| 1004 | Ga0157379_10026081 | |||
| 1005 | Ga0157379_10185479 | |||
| 1006 | Ga0157379_10339279 | |||
| 1007 | Ga0157379_11864873 | |||
| 1008 | Ga0213875_10000434 | |||
| 1009 | Ga0213875_10011254 | |||
| 1010 | Ga0209758_1001975 | |||
| 1011 | Ga0207426_1001521 | |||
| 1012 | Ga0207426_1002500 | |||
| 1013 | Ga0207426_1009989 | |||
| 1014 | Ga0207426_1086150 | |||
| 1015 | Ga0207713_1047887 | |||
| 1016 | Ga0207713_1090628 | |||
| 1017 | Ga0207692_10008020 | |||
| 1018 | Ga0207692_10055607 | |||
| 1019 | Ga0207642_10951580 | |||
| 1020 | Ga0207699_10003758 | |||
| 1021 | Ga0207699_10033859 | |||
| 1022 | Ga0207699_10159314 | |||
| 1023 | Ga0207699_10192299 | |||
| 1024 | Ga0207699_10214783 | |||
| 1025 | Ga0207684_10001900 | |||
| 1026 | Ga0207684_10004260 | |||
| 1027 | Ga0207684_11012994 | |||
| 1028 | Ga0207684_11474564 | |||
| 1029 | Ga0207671_10925576 | |||
| 1030 | Ga0207693_10014261 | |||
| 1031 | Ga0207693_10022909 | |||
| 1032 | Ga0207693_10474331 | |||
| 1033 | Ga0207663_10001437 | |||
| 1034 | Ga0207663_10072007 | |||
| 1035 | Ga0207649_11108857 | |||
| 1036 | Ga0207646_10000315 | |||
| 1037 | Ga0207646_10042871 | |||
| 1038 | Ga0207646_10072110 | |||
| 1039 | Ga0207646_10077738 | |||
| 1040 | Ga0207700_10000906 | |||
| 1041 | Ga0207700_10013663 | |||
| 1042 | Ga0207700_10034548 | |||
| 1043 | Ga0207700_10519990 | |||
| 1044 | Ga0207700_10539611 | |||
| 1045 | Ga0207664_10004526 | |||
| 1046 | Ga0207664_10051928 | |||
| 1047 | Ga0207664_10106654 | |||
| 1048 | Ga0207664_10129564 | |||
| 1049 | Ga0207664_10135937 | |||
| 1050 | Ga0207664_10208306 | |||
| 1051 | Ga0207664_10243531 | |||
| 1052 | Ga0207664_10348587 | |||
| 1053 | Ga0207644_10288266 | |||
| 1054 | Ga0207644_10288742 | |||
| 1055 | Ga0207670_10335133 | |||
| 1056 | Ga0207670_10399493 | |||
| 1057 | Ga0207665_10005666 | |||
| 1058 | Ga0207665_10014454 | |||
| 1059 | Ga0207665_10617839 | |||
| 1060 | Ga0207691_10592044 | |||
| 1061 | Ga0207711_10000182 | |||
| 1062 | Ga0207711_10068651 | |||
| 1063 | Ga0207711_10092030 | |||
| 1064 | Ga0207711_10110324 | |||
| 1065 | Ga0207689_10094420 | |||
| 1066 | Ga0207689_10257265 | |||
| 1067 | Ga0207689_10907337 | |||
| 1068 | Ga0207689_11105795 | |||
| 1069 | Ga0207661_10000353 | |||
| 1070 | Ga0207661_10221146 | |||
| 1071 | Ga0207661_12009053 | |||
| 1072 | Ga0207679_10176781 | |||
| 1073 | Ga0207679_10189485 | |||
| 1074 | Ga0207679_10197476 | |||
| 1075 | Ga0207679_10431965 | |||
| 1076 | Ga0207667_10298566 | |||
| 1077 | Ga0207712_10012209 | |||
| 1078 | Ga0207658_11550570 | |||
| 1079 | Ga0207703_10105706 | |||
| 1080 | Ga0207703_10167299 | |||
| 1081 | Ga0207703_10727640 | |||
| 1082 | Ga0207639_11986656 | |||
| 1083 | Ga0207708_10282058 | |||
| 1084 | Ga0207708_10689509 | |||
| 1085 | Ga0207702_10323577 | |||
| 1086 | Ga0207702_10937147 | |||
| 1087 | Ga0207641_10079947 | |||
| 1088 | Ga0207641_10145659 | |||
| 1089 | Ga0207641_11047976 | |||
| 1090 | Ga0207676_10219173 | |||
| 1091 | Ga0207674_10195154 | |||
| 1092 | Ga0207674_10443182 | |||
| 1093 | Ga0207674_10498325 | |||
| 1094 | Ga0207674_11389826 | |||
| 1095 | Ga0268265_10000413 | |||
| 1096 | Ga0268265_10183111 | |||
| 1097 | Ga0265337_1000568 | |||
| 1098 | Ga0265326_10000761 | |||
| 1099 | Ga0265319_1001323 | |||
| 1100 | Ga0265334_10000557 | |||
| 1101 | Ga0265323_10004390 | |||
| 1102 | Ga0265322_10090262 | |||
| 1103 | Ga0265336_10017992 | |||
| 1104 | Ga0307515_10206083 | |||
| 1105 | Ga0265338_10000144 | |||
| 1106 | Ga0265324_10003399 | |||
| 1107 | Ga0307511_10183370 | |||
| 1108 | Ga0307512_10001813 | |||
| 1109 | Ga0265763_1000467 | |||
| 1110 | Ga0265773_1035420 | |||
| 1111 | Ga0265332_10000695 | |||
| 1112 | Ga0265320_10001390 | |||
| 1113 | Ga0265325_10006817 | |||
| 1114 | Ga0265329_10176844 | |||
| 1115 | Ga0265340_10200463 | |||
| 1116 | Ga0265339_10023336 | |||
| 1117 | Ga0265331_10097117 | |||
| 1118 | Ga0265316_10028372 | |||
| 1119 | Ga0307509_10101912 | |||
| 1120 | Ga0307408_100086481 | |||
| 1121 | Ga0307408_101791612 | |||
| 1122 | Ga0265313_10011165 | |||
| 1123 | Ga0307508_10040997 | |||
| 1124 | Ga0307508_10075180 | |||
| 1125 | Ga0307508_10098242 | |||
| 1126 | Ga0265314_10003956 | |||
| 1127 | Ga0265342_10002972 | |||
| 1128 | Ga0307516_10126922 | |||
| 1129 | Ga0307405_10000189 | |||
| 1130 | Ga0307405_10013891 | |||
| 1131 | Ga0307405_10360160 | |||
| 1132 | Ga0307413_10060315 | |||
| 1133 | Ga0307413_10097148 | |||
| 1134 | Ga0307413_11487363 | |||
| 1135 | Ga0307410_10001690 | |||
| 1136 | Ga0307410_10010542 | |||
| 1137 | Ga0307406_10002418 | |||
| 1138 | Ga0307406_10007926 | |||
| 1139 | Ga0307406_10111703 | |||
| 1140 | Ga0307406_10178473 | |||
| 1141 | Ga0307406_10316027 | |||
| 1142 | Ga0307406_10813212 | |||
| 1143 | Ga0307407_10051555 | |||
| 1144 | Ga0307407_10088296 | |||
| 1145 | Ga0307412_10046314 | |||
| 1146 | Ga0307412_10240343 | |||
| 1147 | Ga0307412_11843828 | |||
| 1148 | Ga0307409_100000338 | |||
| 1149 | Ga0307409_100002075 | |||
| 1150 | Ga0307409_100170281 | |||
| 1151 | Ga0307416_100000376 | |||
| 1152 | Ga0307416_100001743 | |||
| 1153 | Ga0307416_101840992 | |||
| 1154 | Ga0307411_10298405 | |||
| 1155 | Ga0307415_100000002 | |||
| 1156 | Ga0307415_100000098 | |||
| 1157 | Ga0307415_100037428 | |||
| 1158 | Ga0307415_100038750 | |||
| 1159 | Ga0307415_100099327 | |||
| 1160 | Ga0307415_101308253 | |||
| 1161 | Ga0307415_101492403 | |||
| 1162 | Ga0307507_10012369 | |||
| 1163 | Ga0307507_10200254 | |||
| 1164 | Ga0316214_1069526 | |||
| 1165 | Ga0373926_0003191 | |||
| 1166 | Ga0373926_0298621 | |||
| 1167 | Ga0373934_0034051 | |||
| 1168 | Ga0373944_0000521 | |||
| 1169 | Ga0373923_0044000 | |||
| 1170 | Ga0373923_0095632 | |||
| 1171 | Ga0373936_0000194 | |||
| 1172 | Ga0373936_0005154 | |||
| 1173 | Ga0373936_0142741 | |||
| 1174 | Ga0373945_0000440 | |||
| 1175 | Ga0373945_0133515 | |||
| 1176 | Ga0373953_0002891 | |||
| 1177 | Ga0373953_0003111 | |||
| 1178 | Ga0373954_0012385 | |||
| 1179 | Ga0373954_0036835 | |||
| 1180 | Ga0373956_0008684 | |||
| 1181 | Ga0373956_0047477 | |||
| 1182 | Ga0373957_0000467 | |||
| 1183 | Ga0373957_0472187 | |||
| 1184 | Ga0373943_0000238 | |||
| 1185 | Ga0373943_0043119 | |||
| 1186 | Ga0373943_0137194 | |||
| 1187 | Ga0373943_0514688 | |||
| 1188 | Ga0373943_0805574 | |||
| 1189 | Ga0373955_0040840 | |||
| 1190 | Ga0373955_0062433 | |||
| 1191 | Ga0373955_0175369 | |||
| 1192 | Ga0373955_0883060 | |||
| 1193 | Ga0373924_0000923 | |||
| 1194 | Ga0373924_0054879 | |||
| 1195 | Ga0373924_0087775 | |||
| 1196 | Ga0373931_0295606 | |||
| 1197 | Ga0373931_0654589 | |||
| 1198 | Ga0373935_0008808 | |||
| 1199 | Ga0373935_0011996 | |||
| 1200 | Ga0373935_0096212 | |||
| 1201 | Ga0373935_0174887 | |||
| 1202 | Ga0373927_0002463 | |||
| 1203 | Ga0373927_0064050 | |||
| 1204 | Ga0373933_0011718 | |||
| 1205 | Ga0373933_0090481 | |||
| 1206 | Ga0373947_0003136 | |||
| 1207 | Ga0373947_0053424 | |||
| 1208 | Ga0373947_0125993 | |||
| 1209 | Ga0373937_0008663 | |||
| 1210 | Ga0373937_0027843 | |||
| 1211 | Ga0373937_1652472 | |||
| 1212 | Ga0373925_0001666 | |||
| 1213 | Ga0373925_0001907 | |||
| 1214 | Ga0373925_0005446 | |||
| 1215 | Ga0373925_0013568 | |||
| 1216 | Ga0373925_0222442 | |||
| 1217 | Ga0373925_0337781 | |||
| 1218 | Ga0373925_0358839 | |||
| 1219 | Ga0373925_0365485 | |||
| 1220 | Ga0373925_0559486 | |||
| 1221 | Ga0395900_0390910 | |||
| 1222 | Ga0395898_0387439 | |||
| 1223 | Ga0436364_0760857 | |||
| 1224 | Ga0436364_1031212 | |||
| 1225 | Ga0436364_1365294 | |||
| 1226 | Ga0451853_0365953 | |||
| 1227 | Ga0451853_2760413 | |||
| 1228 | Ga0439449_0000850 | |||
| 1229 | Ga0439457_009351 | |||
| 1230 | Ga0439457_068989 | |||
| 1231 | Ga0450894_000021 | |||
| 1232 | Ga0450899_000365 | |||
| 1233 | Ga0450900_062231 | |||
| 1234 | Ga0450906_003322 | |||
| 1235 | Ga0450907_008826 | |||
| 1236 | Ga0450908_006277 | |||
| 1237 | Ga0439434_0155705 | |||
| 1238 | Ga0466969_0025722 | |||
| 1239 | Ga0466969_0061342 | |||
| 1240 | Ga0466969_0167954 | |||
| 1241 | Ga0466972_0002024 | |||
| 1242 | Ga0466972_0011716 | |||
| 1243 | Ga0466965_0002853 | |||
| 1244 | Ga0466965_0052326 | |||
| 1245 | Ga0466966_0001829 | |||
| 1246 | Ga0466966_0004992 | |||
| 1247 | Ga0466966_0025912 | |||
| 1248 | Ga0466961_0000531 | |||
| 1249 | Ga0466961_0086168 | |||
| 1250 | Ga0466961_0255898 | |||
| 1251 | Ga0466963_0012167 | |||
| 1252 | Ga0466963_0087167 | |||
| 1253 | Ga0466963_0397113 | |||
| 1254 | Ga0466963_0727758 | |||
| 1255 | Ga0466963_0768842 | |||
| 1256 | Ga0466964_0566640 | |||
| 1257 | Ga0466971_0000247 | |||
| 1258 | Ga0466971_0084888 | |||
| 1259 | Ga0466971_0094034 | |||
| 1260 | Ga0466970_0008217 | |||
| 1261 | Ga0466957_0016961 | |||
| 1262 | Ga0466957_0086430 | |||
| 1263 | Ga0466957_0126758 | |||
| 1264 | Ga0466957_0353132 | |||
| 1265 | Ga0466959_0001026 | |||
| 1266 | Ga0466959_0028003 | |||
| 1267 | Ga0466959_0066583 | |||
| 1268 | Ga0466959_0071062 | |||
| 1269 | Ga0466967_0001642 | |||
| 1270 | Ga0466967_0024496 | |||
| 1271 | Ga0466967_0453382 | |||
| 1272 | Ga0466967_0600944 | |||
| 1273 | Ga0466967_0713157 | |||
| 1274 | Ga0466967_1697886 | |||
| 1275 | Ga0466967_1796462 | |||
| 1276 | Ga0495592_0018609 | |||
| 1277 | Ga0495592_0090365 | |||
| 1278 | Ga0495592_0090977 | |||
| 1279 | Ga0495592_0131686 | |||
| 1280 | Ga0495592_0230873 | |||
| 1281 | Ga0495603_0004349 | |||
| 1282 | Ga0495603_0008962 | |||
| 1283 | Ga0495629_0004766 | |||
| 1284 | Ga0495629_0006156 | |||
| 1285 | Ga0495629_0010472 | |||
| 1286 | Ga0495629_0097843 | |||
| 1287 | Ga0495638_0368646 | |||
| 1288 | Ga0495641_0006254 | |||
| 1289 | Ga0495641_0010448 | |||
| 1290 | Ga0495651_0006618 | |||
| 1291 | Ga0495651_0013817 | |||
| 1292 | Ga0495651_0081745 | |||
| 1293 | Ga0495651_0122381 | |||
| 1294 | Ga0495651_0293025 | |||
| 1295 | Ga0495651_0352876 | |||
| 1296 | Ga0495653_0001909 | |||
| 1297 | Ga0495653_0021492 | |||
| 1298 | Ga0495653_0022258 | |||
| 1299 | Ga0495653_0023520 | |||
| 1300 | Ga0495580_0060867 | |||
| 1301 | Ga0495582_0003023 | |||
| 1302 | Ga0495582_0151167 | |||
| 1303 | Ga0495639_0004896 | |||
| 1304 | Ga0495639_0053950 | |||
| 1305 | Ga0495639_0270244 | |||
| 1306 | Ga0495662_0002214 | |||
| 1307 | Ga0495662_0002353 | |||
| 1308 | Ga0495662_0003118 | |||
| 1309 | Ga0495662_0004039 | |||
| 1310 | Ga0495662_0095975 | |||
| 1311 | Ga0495664_0000247 | |||
| 1312 | Ga0495664_0000316 | |||
| 1313 | Ga0495664_0002335 | |||
| 1314 | Ga0495664_0015093 | |||
| 1315 | Ga0495594_0111957 | |||
| 1316 | Ga0495594_0164692 | |||
| 1317 | Ga0495608_0010772 | |||
| 1318 | Ga0495608_0025446 | |||
| 1319 | Ga0495608_0107372 | |||
| 1320 | Ga0495618_0021245 | |||
| 1321 | Ga0495618_0021603 | |||
| 1322 | Ga0495618_0105798 | |||
| 1323 | Ga0495618_0109315 | |||
| 1324 | Ga0495628_0014905 | |||
| 1325 | Ga0495628_0018429 | |||
| 1326 | Ga0495628_0409051 | |||
| 1327 | Ga0495628_1216557 | |||
| 1328 | Ga0495630_0044758 | |||
| 1329 | Ga0495630_0047829 | |||
| 1330 | Ga0495630_0119896 | |||
| 1331 | Ga0495630_0144420 | |||
| 1332 | Ga0495630_0207819 | |||
| 1333 | Ga0495630_0209003 | |||
| 1334 | Ga0495630_0234413 | |||
| 1335 | Ga0495630_0293546 | |||
| 1336 | Ga0495666_0000742 | |||
| 1337 | Ga0495666_0188388 | |||
| 1338 | Ga0495666_0202819 | |||
| 1339 | Ga0495652_0001917 | |||
| 1340 | Ga0495652_0066412 | |||
| 1341 | Ga0495652_0201992 | |||
| 1342 | Ga0495665_0003609 | |||
| 1343 | Ga0495665_0004092 | |||
| 1344 | Ga0495665_0543568 | |||
| 1345 | Ga0495640_0017843 | |||
| 1346 | Ga0495640_0038410 | |||
| 1347 | Ga0495640_0115938 | |||
| 1348 | Ga0495640_0342323 | |||
| 1349 | Ga0495640_0773630 | |||
| 1350 | Ga0495586_0006159 | |||
| 1351 | Ga0495586_0069625 | |||
| 1352 | Ga0495586_0103792 | |||
| 1353 | Ga0495586_0166944 | |||
| 1354 | Ga0495587_0001362 | |||
| 1355 | Ga0495587_0033397 | |||
| 1356 | Ga0495587_0048122 | |||
| 1357 | Ga0495587_0166307 | |||
| 1358 | Ga0495587_0674119 | |||
| 1359 | Ga0495645_0030273 | |||
| 1360 | Ga0495645_0037276 | |||
| 1361 | Ga0495645_0063365 | |||
| 1362 | Ga0495645_0176786 | |||
| 1363 | Ga0495645_0816324 | |||
| 1364 | Ga0495633_0359551 | |||
| 1365 | Ga0495667_0004115 | |||
| 1366 | Ga0495667_0007662 | |||
| 1367 | Ga0495667_0025011 | |||
| 1368 | Ga0495667_0087561 | |||
| 1369 | Ga0495667_0321133 | |||
| 1370 | Ga0495667_0387061 | |||
| 1371 | Ga0495656_0137023 | |||
| 1372 | Ga0495634_0005386 | |||
| 1373 | Ga0495634_0025122 | |||
| 1374 | Ga0495634_0090445 | |||
| 1375 | Ga0495634_0186145 | |||
| 1376 | Ga0495634_0243754 | |||
| 1377 | Ga0495634_0609373 | |||
| 1378 | Ga0495635_0000167 | |||
| 1379 | Ga0495635_0003202 | |||
| 1380 | Ga0495635_0008825 | |||
| 1381 | Ga0495635_0042469 | |||
| 1382 | Ga0495635_0052118 | |||
| 1383 | Ga0495635_0075774 | |||
| 1384 | Ga0495635_0396581 | |||
| 1385 | Ga0495661_0107077 | |||
| 1386 | Ga0495588_0002910 | |||
| 1387 | Ga0495657_0000773 | |||
| 1388 | Ga0495657_0001338 | |||
| 1389 | Ga0495657_0018126 | |||
| 1390 | Ga0495657_0030586 | |||
| 1391 | Ga0495657_0061939 | |||
| 1392 | Ga0495657_0318688 | |||
| 1393 | Ga0495599_0034805 | |||
| 1394 | Ga0495599_0075500 | |||
| 1395 | Ga0495599_0318435 | |||
| 1396 | Ga0495623_0031456 | |||
| 1397 | Ga0495623_0066758 | |||
| 1398 | Ga0495623_0083640 | |||
| 1399 | Ga0495623_0149472 | |||
| 1400 | Ga0495623_0263528 | |||
| 1401 | Ga0495646_0001609 | |||
| 1402 | Ga0495646_0005504 | |||
| 1403 | Ga0495646_0029330 | |||
| 1404 | Ga0495646_0044251 | |||
| 1405 | Ga0495647_0040917 | |||
| 1406 | Ga0495658_0005075 | |||
| 1407 | Ga0495658_0036706 | |||
| 1408 | Ga0495613_0032948 | |||
| 1409 | Ga0495613_0043331 | |||
| 1410 | Ga0495613_0115006 | |||
| 1411 | Ga0495613_0236408 | |||
| 1412 | Ga0495613_1093319 | |||
| 1413 | Ga0495624_0007830 | |||
| 1414 | Ga0495624_0014916 | |||
| 1415 | Ga0495624_0565966 | |||
| 1416 | Ga0495671_0192197 | |||
| 1417 | Ga0495589_0246121 | |||
| 1418 | Ga0495600_0012852 | |||
| 1419 | Ga0495600_0032630 | |||
| 1420 | Ga0495600_0054189 | |||
| 1421 | Ga0495600_0104179 | |||
| 1422 | Ga0495600_0177786 | |||
| 1423 | Ga0495581_0009288 | |||
| 1424 | Ga0495581_0017432 | |||
| 1425 | Ga0495581_0021811 | |||
| 1426 | Ga0495581_0174472 | |||
| 1427 | Ga0495604_0001147 | |||
| 1428 | Ga0495604_0016962 | |||
| 1429 | Ga0495604_0031311 | |||
| 1430 | Ga0495604_0069299 | |||
| 1431 | Ga0495636_0001180 | |||
| 1432 | Ga0495636_0018480 | |||
| 1433 | Ga0495674_0003289 | |||
| 1434 | Ga0495674_0079561 | |||
| 1435 | Ga0495674_0297551 | |||
| 1436 | Ga0495674_0808380 | |||
| 1437 | Ga0495676_0002649 | |||
| 1438 | Ga0495676_0008469 | |||
| 1439 | Ga0495676_0252125 | |||
| 1440 | Ga0495680_0015558 | |||
| 1441 | Ga0495680_0016758 | |||
| 1442 | Ga0495680_0033499 | |||
| 1443 | Ga0495680_0420955 | |||
| 1444 | Ga0495675_0010973 | |||
| 1445 | Ga0495675_0013249 | |||
| 1446 | Ga0495675_0018093 | |||
| 1447 | Ga0495675_0018701 | |||
| 1448 | Ga0495675_0196034 | |||
| 1449 | Ga0495675_0207583 | |||
| 1450 | Ga0495685_007593 | |||
| 1451 | Ga0495685_008397 | |||
| 1452 | Ga0495685_144024 | |||
| 1453 | Ga0495681_0382553 | |||
| 1454 | Ga0495684_0002297 | |||
| 1455 | Ga0495684_0109541 | |||
| 1456 | Ga0495684_0127937 | |||
| 1457 | Ga0495684_0176061 | |||
| 1458 | Ga0495593_0005070 | |||
| 1459 | Ga0495593_0009211 | |||
| 1460 | Ga0495593_0086836 | |||
| 1461 | Ga0495602_0022314 | |||
| 1462 | Ga0495602_0051532 | |||
| 1463 | Ga0495602_0082563 | |||
| 1464 | Ga0495602_0110354 | |||
| 1465 | Ga0495602_0422344 | |||
| 1466 | Ga0495614_0008778 | |||
| 1467 | Ga0495614_0046986 | |||
| 1468 | Ga0496100_0714994 | |||
| 1469 | Ga0496102_0613448 | |||
| 1470 | Ga0496104_0012898 | |||
| 1471 | Ga0496105_0026628 | |||
| 1472 | Ga0496106_0211570 | |||
| 1473 | Ga0496107_1102612 | |||
| 1474 | Ga0496108_0071721 | |||
| 1475 | Ga0496108_0207793 | |||
| 1476 | Ga0496109_0069627 | |||
| 1477 | Ga0496109_0869981 | |||
| 1478 | Ga0496110_0006856 | |||
| 1479 | Ga0496110_0254089 | |||
| 1480 | Ga0496112_0078594 | |||
| 1481 | Ga0496112_0458038 | |||
| 1482 | Ga0496113_0185806 | |||
| 1483 | Ga0496113_0661526 | |||
| 1484 | Ga0496118_0050726 | |||
| 1485 | Ga0501031_0003919 | |||
| 1486 | Ga0501031_0106523 | |||
| 1487 | Ga0501031_0356150 | |||
| 1488 | Ga0501032_0001291 | |||
| 1489 | Ga0501032_0068418 | |||
| 1490 | Ga0501033_0016210 | |||
| 1491 | Ga0501033_0026945 | |||
| 1492 | Ga0501033_0069408 | |||
| 1493 | Ga0501033_0225042 | |||
| 1494 | Ga0501033_0254674 | |||
| 1495 | Ga0501034_0006043 | |||
| 1496 | Ga0501034_0009322 | |||
| 1497 | Ga0501034_0050027 | |||
| 1498 | Ga0501034_0061081 | |||
| 1499 | Ga0501034_1226948 | |||
| 1500 | Ga0501036_0016208 | |||
| 1501 | Ga0501036_0135360 | |||
| 1502 | Ga0501037_0010214 | |||
| 1503 | Ga0501037_0010871 | |||
| 1504 | Ga0501037_0028282 | |||
| 1505 | Ga0501037_0228408 | |||
| 1506 | Ga0501037_0594567 | |||
| 1507 | Ga0501038_0009661 | |||
| 1508 | Ga0501038_0132857 | |||
| 1509 | Ga0501038_0153011 | |||
| 1510 | Ga0501038_0195012 | |||
| 1511 | Ga0501038_0283223 | |||
| 1512 | Ga0501038_0335885 | |||
| 1513 | Ga0501039_0049584 | |||
| 1514 | Ga0501039_0071959 | |||
| 1515 | Ga0501039_0081455 | |||
| 1516 | Ga0501039_0529002 | |||
| 1517 | Ga0501042_0003321 | |||
| 1518 | Ga0501042_0018064 | |||
| 1519 | Ga0501042_0036608 | |||
| 1520 | Ga0501043_0000673 | |||
| 1521 | Ga0501043_0001578 | |||
| 1522 | Ga0501043_0002129 | |||
| 1523 | Ga0501043_0126463 | |||
| 1524 | Ga0501043_0537784 | |||
| 1525 | Ga0501043_0777207 | |||
| 1526 | Ga0501046_0005101 | |||
| 1527 | Ga0501046_0011092 | |||
| 1528 | Ga0501046_0408945 | |||
| 1529 | Ga0501047_0000103 | |||
| 1530 | Ga0501047_0000324 | |||
| 1531 | Ga0501047_0002749 | |||
| 1532 | Ga0501047_0004142 | |||
| 1533 | Ga0501047_0064149 | |||
| 1534 | Ga0501047_0254454 | |||
| 1535 | Ga0501047_0259083 | |||
| 1536 | Ga0501047_0553155 | |||
| 1537 | Ga0501048_0009631 | |||
| 1538 | Ga0501048_0055495 | |||
| 1539 | Ga0501069_0254695 | |||
| 1540 | Ga0501070_0001568 | |||
| 1541 | Ga0501070_0417303 | |||
| 1542 | Ga0501071_1046348 | |||
| 1543 | Ga0501073_0011517 | |||
| 1544 | Ga0501073_0571255 | |||
| 1545 | Ga0501074_0003059 | |||
| 1546 | Ga0501074_0003200 | |||
| 1547 | Ga0501080_0362432 | |||
| 1548 | Ga0501083_0428815 | |||
| 1549 | Ga0501035_0021129 | |||
| 1550 | Ga0501035_0037973 | |||
| 1551 | Ga0501035_0089351 | |||
| 1552 | Ga0501035_0373759 | |||
| 1553 | Ga0501044_0000489 | |||
| 1554 | Ga0501044_0002151 | |||
| 1555 | Ga0501044_0033756 | |||
| 1556 | Ga0501044_0144941 | |||
| 1557 | Ga0501044_0254599 | |||
| 1558 | Ga0501044_0256880 | |||
| 1559 | Ga0501044_0257162 | |||
| 1560 | Ga0501044_0293754 | |||
| 1561 | Ga0501044_0390713 | |||
| 1562 | Ga0501045_0175405 | |||
| 1563 | Ga0501045_0407841 | |||
| 1564 | nmdc:mga07m45_179045_c1 | |||
| 1565 | nmdc:mga05p37_420_c1 | |||
| 1566 | nmdc:mga09592_13_c1 | |||
| 1567 | nmdc:mga09592_373135_c1 | |||
| 1568 | nmdc:mga09592_48386_c1 | |||
| 1569 | nmdc:mga0qj67_683943_c1 | |||
| 1570 | nmdc:mga0qj67_79_c2 | |||
| 1571 | nmdc:mga06r32_1382906_c1 | |||
| 1572 | nmdc:mga06r32_182855_c1 | |||
| 1573 | nmdc:mga06r32_475605_c1 | |||
| 1574 | nmdc:mga06r32_493798_c1 | |||
| 1575 | nmdc:mga06r32_839_c1 | |||
| 1576 | nmdc:mga08y16_876828_c1 | |||
| 1577 | nmdc:mga0rr50_1212798_c1 | |||
| 1578 | nmdc:mga08x19_158905_c1 | |||
| 1579 | nmdc:mga0a205_888322_c1 | |||
| 1580 | Ga0495601_0001481 | |||
| 1581 | Ga0495601_0013978 | |||
| 1582 | Ga0495601_0052360 | |||
| 1583 | Ga0495601_1006136 | |||
| 1584 | Ga0495612_0003381 | |||
| 1585 | Ga0495612_0059382 | |||
| 1586 | Ga0495655_0137215 | |||
| 1587 | Ga0495595_0104458 | |||
| 1588 | Ga0495619_0012562 | |||
| 1589 | Ga0495619_0183718 | |||
| 1590 | Ga0495619_0304285 | |||
| 1591 | Ga0500646_0001692 | |||
| 1592 | Ga0500583_0024134 | |||
| 1593 | Ga0500640_034466 | |||
| 1594 | Ga0500641_0044721 | |||
| 1595 | Ga0500560_000756 | |||
| 1596 | Ga0500572_184658 | |||
| 1597 | Ga0500594_0040537 | |||
| 1598 | Ga0500594_0191549 | |||
| 1599 | Ga0500573_0012698 | |||
| 1600 | Ga0500573_0055408 | |||
| 1601 | Ga0500573_0300706 | |||
| 1602 | Ga0500573_0388632 | |||
| 1603 | Ga0500588_0042843 | |||
| 1604 | Ga0500616_0003572 | |||
| 1605 | Ga0500624_001412 | |||
| 1606 | Ga0500627_0234482 | |||
| 1607 | Ga0500633_0061389 | |||
| 1608 | Ga0500633_0184354 | |||
| 1609 | Ga0466962_0000284 | |||
| 1610 | Ga0466962_0004160 | |||
| 1611 | Ga0466962_0021439 | |||
| 1612 | 2501939941 | |||
| 1613 | 2515758259 | |||
| 1614 | 2516091859 | |||
| 1615 | 2772646956 | |||
| 1616 | 2776373093 | |||
| 1617 | 2793976747 | |||
| 1618 | 2804843633 | |||
| 1619 | 2831937343 | |||
| 1620 | 2832010345 | |||
| 1621 | 2855675395 | |||
| 1622 | 2855682973 | |||
| 1623 | 2855688717 | |||
| 1624 | 2856864285 | |||
| 1625 | 2857292809 | |||
| 1626 | 2858853532 | |||
| 1627 | 2858871157 | |||
| 1628 | 2858884945 | |||
| 1629 | 2858891236 | |||
| 1630 | 2858897284 | |||
| 1631 | 2858906615 | |||
| 1632 | 2863069257 | |||
| 1633 | 2863070821 | |||
| 1634 | 2863407077 | |||
| 1635 | 2866065583 | |||
| 1636 | 2866552845 | |||
| 1637 | 2866555237 | |||
| 1638 | 2866557518 | |||
| 1639 | 2867303721 | |||
| 1640 | 2867318812 | |||
| 1641 | 2867320775 | |||
| 1642 | 2867479835 | |||
| 1643 | 2867511952 | |||
| 1644 | 2869048882 | |||
| 1645 | 2869063320 | |||
| 1646 | 2869074905 | |||
| 1647 | 2880489891 | |||
| 1648 | 2880502678 | |||
| 1649 | 2902585840 | |||
| 1650 | 2929224498 | |||
| 1651 | 2929231101 | |||
| 1652 | 2990059686 | |||
| 1653 | 2990090471 | |||
| 1654 | 2996223082 | |||
| 1655 | 2996224354 | |||
| 1656 | 2997453765 | |||
| 1657 | 3006488268 | |||
| 1658 | 649813417 | |||
| 1659 | 649814186 | |||
| 1660 | 8003832080 | |||
| 1661 | 8003856781 | |||
| 1662 | 8025414764 | |||
| 1663 | 8047901183 | |||
| 1664 | 8048357718 | |||
| 1665 | 8048378122 | |||
| 1666 | 8048387220 | |||
| 1667 | 8054731380 | |||
| 1668 | 8054736627 | |||
| 1669 | 8055415260 | |||
| 1670 | 8056066077 | |||
| 1671 | 8056209290 | |||
| 1672 | 8056211747 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3leq-assembly1.cif.gz_A | the crystal structure of the roadblock/lc7 domain from streptomyces avermitillis to 1.85a | 0.9402 | 18 | 128 |
| 3kye-assembly2.cif.gz_C | crystal structure of roadblock/lc7 domain from streptomyces avermitilis | 0.9341 | 18 | 133 |
| 5y3a-assembly1.cif.gz_B | crystal structure of ragulator complex (p18 49-161) | 0.9053 | 18 | 130 |
| 5x6u-assembly1.cif.gz_B | crystal structure of human heteropentameric complex | 0.8999 | 18 | 133 |
| 2hz5-assembly2.cif.gz_B | crystal structure of human dynein light chain dnlc2a | 0.8988 | 31 | 110 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O50393_7_130_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.9628 | 18 | 133 | 3.30.450.30 |
| 3kyeD00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.9277 | 18 | 132 | 3.30.450.30 |
| af_Q58736_1_114_3.30.450.30 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.9106 | 18 | 132 | 3.30.450.30 |
| 3leqA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.9071 | 18 | 128 | 3.30.450.30 |
| 3l9kA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic | 0.8956 | 22 | 110 | 3.30.450.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K9XKB1-F1-model_v4 | Dynein regulation protein LC7 | 0.9837 | 18 | 130 |
|
| AF-A0A6B1MQU4-F1-model_v4 | deleted | 0.9776 | 18 | 125 |
|
| AF-A0A349B0G0-F1-model_v4 | Dynein regulation protein LC7 | 0.9731 | 17 | 131 |
|
| AF-A0A6B3I616-F1-model_v4 | Roadblock/LC7 domain-containing protein | 0.9711 | 20 | 133 |
|
| AF-A0A7M3LQV1-F1-model_v4 | Dynein regulation protein LC7 | 0.9704 | 26 | 129 |
|