F482890

General Info

Members Datasets Scaffolds Average Seq Length
836 279 1672 105

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10088775|Ga0265338_100887753
Length 113
Sequence MRCRRCSPLPDEVAHAADLVGRRWVLQIIYAASHSGASRFNEFTQVIVGIPPRTLAQRLVELEEVGVLERTVIDARPPRVEYRLTANGARLIGVVDALQIWSTDQAPARPGRA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
128 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
278 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 1.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 8.01
Rhizosphere 91.51
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10088775 3300028800 Bacteria 2564
2 Ga0070658_10110130 3300005327 Bacteria 2280
3 Ga0070683_100114394 3300005329 Bacteria 2546
4 Ga0070683_100191944 3300005329 Bacteria 1940
5 Ga0070683_100197479 3300005329 Bacteria 1910
6 Ga0070683_100213829 3300005329 Bacteria 1832
7 Ga0070680_100092123 3300005336 Bacteria 2509
8 Ga0070680_100170741 3300005336 Bacteria 1830
9 Ga0070680_100243111 3300005336 Bacteria 1521
10 Ga0070680_100784053 3300005336 Bacteria 821
11 Ga0070682_100017584 3300005337 Bacteria 4170
12 Ga0070682_100078157 3300005337 Bacteria 2134
13 Ga0070682_100155009 3300005337 Bacteria 1576
14 Ga0068868_101240115 3300005338 Bacteria 691
15 Ga0070660_100016946 3300005339 Bacteria 5303
16 Ga0070660_100046508 3300005339 Bacteria 3326
17 Ga0070660_100110649 3300005339 Bacteria 2185
18 Ga0070660_100198794 3300005339 Bacteria 1626
19 Ga0070660_100238474 3300005339 Bacteria 1481
20 Ga0070660_100721912 3300005339 Bacteria 836
21 Ga0070660_100795725 3300005339 Bacteria 795
22 Ga0070660_101377928 3300005339 Bacteria 599
23 Ga0070661_100095978 3300005344 Bacteria 2200
24 Ga0070661_100142532 3300005344 Bacteria 1807
25 Ga0070661_100203197 3300005344 Bacteria 1515
26 Ga0070692_10694537 3300005345 Bacteria 684
27 Ga0070674_100933334 3300005356 Bacteria 758
28 Ga0070659_100199728 3300005366 Bacteria 1646
29 Ga0070667_100359177 3300005367 Bacteria 1320
30 Ga0070709_10012797 3300005434 Bacteria 4702
31 Ga0070709_10059965 3300005434 Bacteria 2417
32 Ga0070709_10571167 3300005434 Bacteria 867
33 Ga0070714_100034925 3300005435 Bacteria 4211
34 Ga0070714_100063213 3300005435 Bacteria 3182
35 Ga0070714_100095228 3300005435 Bacteria 2614
36 Ga0070714_100151430 3300005435 Bacteria 2091
37 Ga0070714_100168465 3300005435 Bacteria 1986
38 Ga0070714_100176699 3300005435 Bacteria 1940
39 Ga0070714_100230508 3300005435 Bacteria 1706
40 Ga0070714_100336945 3300005435 Bacteria 1414
41 Ga0070714_100352350 3300005435 Bacteria 1383
42 Ga0070714_100436804 3300005435 Bacteria 1242
43 Ga0070714_100442492 3300005435 Bacteria 1234
44 Ga0070714_100625813 3300005435 Bacteria 1035
45 Ga0070714_100802714 3300005435 Bacteria 911
46 Ga0070714_100921048 3300005435 Bacteria 849
47 Ga0070714_101217598 3300005435 Bacteria 734
48 Ga0070714_101603783 3300005435 Bacteria 636
49 Ga0070714_101614243 3300005435 Bacteria 633
50 Ga0070714_101932718 3300005435 Bacteria 576
51 Ga0070713_100025851 3300005436 Bacteria 4598
52 Ga0070713_100312945 3300005436 Bacteria 1448
53 Ga0070713_100363264 3300005436 Bacteria 1345
54 Ga0070713_101930704 3300005436 Bacteria 573
55 Ga0070713_102429511 3300005436 Bacteria 507
56 Ga0070710_10011319 3300005437 Bacteria 4407
57 Ga0070710_10131683 3300005437 Bacteria 1525
58 Ga0070710_10434212 3300005437 Unclassified 887
59 Ga0070711_100095512 3300005439 Bacteria 2151
60 Ga0070711_100171299 3300005439 Bacteria 1655
61 Ga0070711_100398363 3300005439 Bacteria 1117
62 Ga0070711_101344298 3300005439 Bacteria 621
63 Ga0070711_101487111 3300005439 Unclassified 591
64 Ga0070705_100127643 3300005440 Bacteria 1653
65 Ga0070705_100871400 3300005440 Bacteria 722
66 Ga0070694_100619521 3300005444 Bacteria 873
67 Ga0070694_101291571 3300005444 Bacteria 614
68 Ga0070708_100151810 3300005445 Bacteria 2155
69 Ga0070708_100695088 3300005445 Bacteria 957
70 Ga0070708_100810922 3300005445 Bacteria 880
71 Ga0070708_101319930 3300005445 Bacteria 674
72 Ga0070708_101324150 3300005445 Bacteria 673
73 Ga0070708_101405254 3300005445 Bacteria 651
74 Ga0070708_101673635 3300005445 Bacteria 592
75 Ga0070663_100683628 3300005455 Bacteria 871
76 Ga0070678_100365260 3300005456 Bacteria 1245
77 Ga0070662_101341925 3300005457 Bacteria 616
78 Ga0070681_10029010 3300005458 Bacteria 5556
79 Ga0070681_10038474 3300005458 Bacteria 4797
80 Ga0070681_10067920 3300005458 Bacteria 3532
81 Ga0070681_10142211 3300005458 Bacteria 2329
82 Ga0070681_10178328 3300005458 Bacteria 2046
83 Ga0070681_10210846 3300005458 Bacteria 1859
84 Ga0070681_10323960 3300005458 Bacteria 1450
85 Ga0070681_10328144 3300005458 Bacteria 1440
86 Ga0070681_10444799 3300005458 Bacteria 1208
87 Ga0070681_10620908 3300005458 Bacteria 995
88 Ga0070681_10882177 3300005458 Bacteria 813
89 Ga0070681_11478947 3300005458 Bacteria 604
90 Ga0070706_100039423 3300005467 Bacteria 4361
91 Ga0070706_100131903 3300005467 Bacteria 2332
92 Ga0070706_100637351 3300005467 Bacteria 989
93 Ga0070706_100932559 3300005467 Bacteria 801
94 Ga0070707_100000441 3300005468 Bacteria 41190
95 Ga0070707_100008363 3300005468 Bacteria 9607
96 Ga0070707_100788672 3300005468 Bacteria 914
97 Ga0070698_100069724 3300005471 Bacteria 3528
98 Ga0070698_100285768 3300005471 Bacteria 1581
99 Ga0070698_100307235 3300005471 Bacteria 1517
100 Ga0070698_100599884 3300005471 Unclassified 1041
101 Ga0070698_100652479 3300005471 Bacteria 993
102 Ga0070699_100041932 3300005518 Bacteria 3960
103 Ga0070699_100344624 3300005518 Bacteria 1341
104 Ga0070699_101005141 3300005518 Bacteria 765
105 Ga0070699_101147231 3300005518 Bacteria 713
106 Ga0070699_101179069 3300005518 Bacteria 703
107 Ga0070699_101834349 3300005518 Bacteria 555
108 Ga0070679_100019782 3300005530 Bacteria 6554
109 Ga0070679_100094255 3300005530 Bacteria 2980
110 Ga0070679_100141314 3300005530 Bacteria 2387
111 Ga0070679_100165784 3300005530 Bacteria 2183
112 Ga0070679_100206505 3300005530 Bacteria 1929
113 Ga0070679_100216922 3300005530 Bacteria 1875
114 Ga0070679_100327030 3300005530 Bacteria 1482
115 Ga0070679_100778800 3300005530 Bacteria 900
116 Ga0070684_100165660 3300005535 Bacteria 2006
117 Ga0070684_100818678 3300005535 Bacteria 871
118 Ga0070684_101536341 3300005535 Bacteria 628
119 Ga0070697_100363044 3300005536 Bacteria 1252
120 Ga0070697_101498480 3300005536 Bacteria 603
121 Ga0070697_101940437 3300005536 Bacteria 527
122 Ga0068853_100453815 3300005539 Bacteria 1206
123 Ga0068853_102435219 3300005539 Bacteria 507
124 Ga0070695_100000005 3300005545 Bacteria 97484
125 Ga0070695_101872971 3300005545 Bacteria 504
126 Ga0070696_101479494 3300005546 Unclassified 581
127 Ga0070693_100113615 3300005547 Bacteria 1670
128 Ga0070693_100311372 3300005547 Bacteria 1065
129 Ga0070704_102083735 3300005549 Unclassified 527
130 Ga0068855_100115927 3300005563 Bacteria 3070
131 Ga0068855_100601691 3300005563 Bacteria 1185
132 Ga0068855_101818330 3300005563 Bacteria 619
133 Ga0070664_100521248 3300005564 Bacteria 1097
134 Ga0070664_101993341 3300005564 Bacteria 551
135 Ga0068857_102364261 3300005577 Unclassified 522
136 Ga0068854_101819459 3300005578 Bacteria 559
137 Ga0068856_100034191 3300005614 Bacteria 4979
138 Ga0068856_100105784 3300005614 Bacteria 2808
139 Ga0068856_100241933 3300005614 Bacteria 1820
140 Ga0068856_100319082 3300005614 Bacteria 1571
141 Ga0068856_101295325 3300005614 Bacteria 744
142 Ga0068856_101986718 3300005614 Unclassified 592
143 Ga0070702_101783009 3300005615 Unclassified 514
144 Ga0070717_10003490 3300006028 Bacteria 11255
145 Ga0070717_10009086 3300006028 Bacteria 7462
146 Ga0070717_10010124 3300006028 Bacteria 7099
147 Ga0070717_10018995 3300006028 Bacteria 5382
148 Ga0070717_10023944 3300006028 Bacteria 4844
149 Ga0070717_11040412 3300006028 Bacteria 746
150 Ga0070717_11439119 3300006028 Bacteria 626
151 Ga0070715_10002925 3300006163 Bacteria 5335
152 Ga0070716_100003114 3300006173 Bacteria 7748
153 Ga0070716_101266223 3300006173 Bacteria 595
154 Ga0070712_100093194 3300006175 Bacteria 2211
155 Ga0070712_100522054 3300006175 Bacteria 998
156 Ga0070712_100986329 3300006175 Bacteria 729
157 Ga0068871_101266838 3300006358 Bacteria 693
158 Ga0075431_100286588 3300006847 Bacteria 1667
159 Ga0075433_11378457 3300006852 Bacteria 610
160 Ga0068865_101585680 3300006881 Bacteria 588
161 Ga0075436_100078580 3300006914 Bacteria 2286
162 Ga0075436_100326519 3300006914 Bacteria 1103
163 Ga0075435_101067483 3300007076 Bacteria 706
164 Ga0099794_10152949 3300007265 Bacteria 1171
165 Ga0105251_10260024 3300009011 Bacteria 783
166 Ga0105244_10280068 3300009036 Bacteria 774
167 Ga0105240_10068476 3300009093 Bacteria 4395
168 Ga0105240_10343779 3300009093 Bacteria 1694
169 Ga0105240_10463202 3300009093 Bacteria 1416
170 Ga0105240_10860212 3300009093 Bacteria 978
171 Ga0111539_10705619 3300009094 Bacteria 1174
172 Ga0105245_10095149 3300009098 Bacteria 2747
173 Ga0105245_12808556 3300009098 Bacteria 540
174 Ga0105247_10318638 3300009101 Bacteria 1084
175 Ga0105241_10425701 3300009174 Bacteria 1169
176 Ga0105241_10635277 3300009174 Bacteria 968
177 Ga0105241_10638703 3300009174 Bacteria 966
178 Ga0105242_10218700 3300009176 Bacteria 1701
179 Ga0105248_13023167 3300009177 Bacteria 536
180 Ga0105237_10765828 3300009545 Bacteria 972
181 Ga0105237_11460098 3300009545 Bacteria 690
182 Ga0105238_10190608 3300009551 Bacteria 2026
183 Ga0105238_10646122 3300009551 Bacteria 1068
184 Ga0105238_11237850 3300009551 Bacteria 771
185 Ga0105249_12631836 3300009553 Bacteria 575
186 Ga0105239_11546027 3300010375 Bacteria 767
187 Ga0105239_12080474 3300010375 Bacteria 659
188 Ga0105239_13166758 3300010375 Bacteria 536
189 Ga0157371_10098212 3300013102 Bacteria 2076
190 Ga0157370_10030952 3300013104 Bacteria 5241
191 Ga0157370_10032439 3300013104 Bacteria 5101
192 Ga0157370_10930696 3300013104 Bacteria 788
193 Ga0157369_10005310 3300013105 Bacteria 15015
194 Ga0157369_10055843 3300013105 Bacteria 4262
195 Ga0157369_10060388 3300013105 Bacteria 4088
196 Ga0157369_10589353 3300013105 Bacteria 1148
197 Ga0157369_10737767 3300013105 Bacteria 1014
198 Ga0157369_10844256 3300013105 Bacteria 940
199 Ga0157369_11424561 3300013105 Bacteria 705
200 Ga0157374_10062661 3300013296 Bacteria 3486
201 Ga0157374_10521287 3300013296 Bacteria 1194
202 Ga0163162_11007731 3300013306 Bacteria 942
203 Ga0157372_10324865 3300013307 Bacteria 1791
204 Ga0157372_10415359 3300013307 Bacteria 1568
205 Ga0157372_10845511 3300013307 Bacteria 1062
206 Ga0157372_11025496 3300013307 Bacteria 955
207 Ga0157372_11621058 3300013307 Bacteria 745
208 Ga0157372_11994478 3300013307 Bacteria 667
209 Ga0157372_13040708 3300013307 Unclassified 536
210 Ga0157375_12195108 3300013308 Bacteria 658
211 Ga0163163_10220187 3300014325 Bacteria 1947
212 Ga0182008_10026892 3300014497 Bacteria 2916
213 Ga0182008_10067443 3300014497 Bacteria 1760
214 Ga0182008_10084534 3300014497 Bacteria 1563
215 Ga0182008_10176996 3300014497 Bacteria 1078
216 Ga0157379_10983604 3300014968 Bacteria 804
217 Ga0182006_1147036 3300015261 Bacteria 801
218 Ga0182005_1042110 3300015265 Bacteria 1241
219 Ga0206356_10081141 3300020070 Bacteria 3494
220 Ga0206356_11407641 3300020070 Bacteria 1957
221 Ga0206354_10889251 3300020081 Bacteria 2909
222 Ga0206354_10939662 3300020081 Bacteria 1456
223 Ga0206353_11095863 3300020082 Bacteria 1729
224 Ga0206353_11266715 3300020082 Bacteria 644
225 Ga0206353_11931666 3300020082 Bacteria 2703
226 Ga0206353_12038425 3300020082 Bacteria 1867
227 Ga0213871_10094165 3300021441 Bacteria 871
228 Ga0224712_10007888 3300022467 Bacteria 3121
229 Ga0224712_10010076 3300022467 Bacteria 2874
230 Ga0224712_10032792 3300022467 Bacteria 1896
231 Ga0207692_10012830 3300025898 Bacteria 3613
232 Ga0207692_10057104 3300025898 Bacteria 2005
233 Ga0207692_10689477 3300025898 Bacteria 662
234 Ga0207692_11063344 3300025898 Bacteria 535
235 Ga0207692_11166398 3300025898 Bacteria 511
236 Ga0207710_10103294 3300025900 Bacteria 1347
237 Ga0207685_10034599 3300025905 Bacteria 1837
238 Ga0207699_10008519 3300025906 Bacteria 5068
239 Ga0207699_10074107 3300025906 Bacteria 2090
240 Ga0207699_10343596 3300025906 Bacteria 1052
241 Ga0207699_11234192 3300025906 Bacteria 553
242 Ga0207705_10127391 3300025909 Bacteria 1893
243 Ga0207705_10134122 3300025909 Bacteria 1845
244 Ga0207705_10624982 3300025909 Bacteria 838
245 Ga0207705_10803325 3300025909 Bacteria 730
246 Ga0207705_11309990 3300025909 Bacteria 553
247 Ga0207684_10034486 3300025910 Bacteria 4300
248 Ga0207684_10502579 3300025910 Bacteria 1039
249 Ga0207684_11035254 3300025910 Bacteria 685
250 Ga0207654_10621316 3300025911 Bacteria 772
251 Ga0207654_10651867 3300025911 Bacteria 754
252 Ga0207707_10029444 3300025912 Bacteria 4800
253 Ga0207707_10079072 3300025912 Bacteria 2872
254 Ga0207707_10149398 3300025912 Bacteria 2043
255 Ga0207707_10200294 3300025912 Bacteria 1741
256 Ga0207707_10317286 3300025912 Bacteria 1346
257 Ga0207707_10366719 3300025912 Bacteria 1239
258 Ga0207707_10482079 3300025912 Bacteria 1059
259 Ga0207707_10602676 3300025912 Bacteria 930
260 Ga0207695_10037785 3300025913 Bacteria 5207
261 Ga0207695_11369134 3300025913 Unclassified 588
262 Ga0207693_10001187 3300025915 Bacteria 23272
263 Ga0207693_10012498 3300025915 Bacteria 6857
264 Ga0207693_10117503 3300025915 Bacteria 2088
265 Ga0207693_10226626 3300025915 Bacteria 1468
266 Ga0207693_10434236 3300025915 Bacteria 1026
267 Ga0207693_10988249 3300025915 Unclassified 643
268 Ga0207693_11057359 3300025915 Bacteria 618
269 Ga0207693_11123783 3300025915 Bacteria 596
270 Ga0207663_10080778 3300025916 Bacteria 2127
271 Ga0207663_10429328 3300025916 Bacteria 1016
272 Ga0207663_10451602 3300025916 Bacteria 991
273 Ga0207663_10457611 3300025916 Bacteria 985
274 Ga0207660_10013044 3300025917 Bacteria 5442
275 Ga0207660_10469867 3300025917 Bacteria 1018
276 Ga0207660_10651383 3300025917 Bacteria 859
277 Ga0207660_11696001 3300025917 Unclassified 508
278 Ga0207662_11331123 3300025918 Bacteria 510
279 Ga0207657_10026118 3300025919 Bacteria 5372
280 Ga0207657_10102594 3300025919 Bacteria 2372
281 Ga0207657_10233784 3300025919 Bacteria 1469
282 Ga0207657_10244459 3300025919 Bacteria 1432
283 Ga0207657_10345115 3300025919 Bacteria 1175
284 Ga0207657_10840713 3300025919 Bacteria 709
285 Ga0207649_10160888 3300025920 Bacteria 1555
286 Ga0207652_10046072 3300025921 Bacteria 3719
287 Ga0207652_10074559 3300025921 Bacteria 2955
288 Ga0207652_10099081 3300025921 Bacteria 2571
289 Ga0207652_10117179 3300025921 Bacteria 2366
290 Ga0207652_10158009 3300025921 Bacteria 2031
291 Ga0207652_10410621 3300025921 Bacteria 1221
292 Ga0207652_10514381 3300025921 Bacteria 1077
293 Ga0207652_10566361 3300025921 Bacteria 1020
294 Ga0207652_11053056 3300025921 Bacteria 713
295 Ga0207652_11088442 3300025921 Bacteria 700
296 Ga0207652_11460999 3300025921 Bacteria 587
297 Ga0207646_10001597 3300025922 Bacteria 27663
298 Ga0207694_11374866 3300025924 Bacteria 597
299 Ga0207694_11491845 3300025924 Bacteria 571
300 Ga0207700_10090757 3300025928 Bacteria 2412
301 Ga0207700_10265700 3300025928 Bacteria 1471
302 Ga0207700_10295143 3300025928 Bacteria 1398
303 Ga0207700_10829426 3300025928 Bacteria 827
304 Ga0207700_10830660 3300025928 Bacteria 827
305 Ga0207664_10006165 3300025929 Bacteria 8223
306 Ga0207664_10006213 3300025929 Bacteria 8203
307 Ga0207664_10016767 3300025929 Bacteria 5352
308 Ga0207664_10028936 3300025929 Bacteria 4217
309 Ga0207664_10149942 3300025929 Bacteria 1980
310 Ga0207664_10186495 3300025929 Bacteria 1784
311 Ga0207664_10275574 3300025929 Bacteria 1475
312 Ga0207664_10359393 3300025929 Bacteria 1290
313 Ga0207664_10379586 3300025929 Bacteria 1255
314 Ga0207664_10427776 3300025929 Bacteria 1180
315 Ga0207664_10612251 3300025929 Bacteria 978
316 Ga0207664_10723154 3300025929 Bacteria 895
317 Ga0207664_10793518 3300025929 Bacteria 852
318 Ga0207690_10395457 3300025932 Bacteria 1101
319 Ga0207706_10931825 3300025933 Bacteria 732
320 Ga0207686_10984417 3300025934 Bacteria 684
321 Ga0207665_10000058 3300025939 Bacteria 72882
322 Ga0207665_10032871 3300025939 Bacteria 3435
323 Ga0207665_10239935 3300025939 Bacteria 1335
324 Ga0207665_11402783 3300025939 Bacteria 556
325 Ga0207711_10542256 3300025941 Bacteria 1085
326 Ga0207711_12026139 3300025941 Bacteria 518
327 Ga0207661_10013337 3300025944 Bacteria 6003
328 Ga0207661_10043491 3300025944 Bacteria 3545
329 Ga0207661_10357139 3300025944 Bacteria 1319
330 Ga0207661_10415553 3300025944 Bacteria 1221
331 Ga0207679_10623723 3300025945 Bacteria 973
332 Ga0207679_11517636 3300025945 Bacteria 614
333 Ga0207667_10267320 3300025949 Unclassified 1748
334 Ga0207667_10358667 3300025949 Bacteria 1487
335 Ga0207667_10379678 3300025949 Bacteria 1440
336 Ga0207667_10628149 3300025949 Bacteria 1081
337 Ga0207667_10699886 3300025949 Bacteria 1016
338 Ga0207667_11564708 3300025949 Bacteria 629
339 Ga0207640_10552644 3300025981 Bacteria 967
340 Ga0207640_12126129 3300025981 Bacteria 509
341 Ga0207658_10308758 3300025986 Bacteria 1365
342 Ga0207677_11157105 3300026023 Bacteria 707
343 Ga0207678_10210673 3300026067 Bacteria 1662
344 Ga0207702_10171687 3300026078 Bacteria 1989
345 Ga0207702_10295377 3300026078 Bacteria 1536
346 Ga0207702_10307601 3300026078 Bacteria 1506
347 Ga0207702_10471847 3300026078 Bacteria 1220
348 Ga0207702_11706308 3300026078 Bacteria 623
349 Ga0207641_11465967 3300026088 Bacteria 684
350 Ga0207674_10105204 3300026116 Bacteria 2801
351 Ga0207683_10178496 3300026121 Bacteria 1925
352 Ga0207698_10699438 3300026142 Unclassified 1008
353 Ga0268266_11022330 3300028379 Bacteria 800
354 Ga0265337_1077593 3300028556 Bacteria 910
355 Ga0265326_10029888 3300028558 Bacteria 1552
356 Ga0265326_10056070 3300028558 Bacteria 1115
357 Ga0265326_10182952 3300028558 Bacteria 601
358 Ga0265319_1006086 3300028563 Bacteria 5652
359 Ga0265319_1015560 3300028563 Bacteria 2946
360 Ga0265319_1054021 3300028563 Bacteria 1318
361 Ga0265334_10001373 3300028573 Bacteria 11729
362 Ga0265334_10041503 3300028573 Bacteria 1798
363 Ga0265334_10343968 3300028573 Bacteria 510
364 Ga0265318_10000445 3300028577 Bacteria 31168
365 Ga0265318_10022330 3300028577 Bacteria 2531
366 Ga0265318_10131928 3300028577 Bacteria 918
367 Ga0265318_10173927 3300028577 Bacteria 789
368 Ga0265322_10017548 3300028654 Bacteria 2060
369 Ga0265322_10018713 3300028654 Bacteria 1990
370 Ga0265322_10139951 3300028654 Bacteria 691
371 Ga0265336_10022376 3300028666 Bacteria 2012
372 Ga0265336_10067211 3300028666 Bacteria 1072
373 Ga0265336_10208154 3300028666 Bacteria 581
374 Ga0265338_10005247 3300028800 Bacteria 16991
375 Ga0265338_10012217 3300028800 Bacteria 9808
376 Ga0265338_10054285 3300028800 Bacteria 3575
377 Ga0265338_10949954 3300028800 Bacteria 583
378 Ga0265338_11178258 3300028800 Bacteria 514
379 Ga0265324_10017637 3300029957 Bacteria 2595
380 Ga0265324_10064889 3300029957 Bacteria 1246
381 Ga0265324_10268394 3300029957 Bacteria 580
382 Ga0265330_10000848 3300031235 Bacteria 19175
383 Ga0265330_10080129 3300031235 Bacteria 1407
384 Ga0265330_10352814 3300031235 Bacteria 621
385 Ga0265332_10022081 3300031238 Bacteria 2808
386 Ga0265332_10083172 3300031238 Bacteria 1357
387 Ga0265328_10020190 3300031239 Bacteria 2552
388 Ga0265328_10176962 3300031239 Bacteria 806
389 Ga0265320_10029937 3300031240 Bacteria 2813
390 Ga0265320_10354939 3300031240 Bacteria 648
391 Ga0265325_10002030 3300031241 Bacteria 13911
392 Ga0265325_10010380 3300031241 Bacteria 5397
393 Ga0265325_10276341 3300031241 Bacteria 754
394 Ga0265329_10011823 3300031242 Bacteria 3161
395 Ga0265329_10300107 3300031242 Unclassified 543
396 Ga0265340_10011912 3300031247 Bacteria 4605
397 Ga0265339_10007564 3300031249 Bacteria 7001
398 Ga0265339_10030343 3300031249 Bacteria 3061
399 Ga0265331_10000672 3300031250 Bacteria 29378
400 Ga0265327_10005507 3300031251 Bacteria 10528
401 Ga0265327_10064446 3300031251 Bacteria 1856
402 Ga0265327_10292339 3300031251 Bacteria 718
403 Ga0265316_10012345 3300031344 Bacteria 7666
404 Ga0265316_10063567 3300031344 Bacteria 2861
405 Ga0265316_10259669 3300031344 Bacteria 1274
406 Ga0265316_10500916 3300031344 Bacteria 867
407 Ga0265316_11159953 3300031344 Bacteria 535
408 Ga0265313_10001111 3300031595 Bacteria 25728
409 Ga0265313_10012231 3300031595 Bacteria 5256
410 Ga0265314_10005359 3300031711 Bacteria 11592
411 Ga0265314_10008168 3300031711 Bacteria 9003
412 Ga0265314_10060908 3300031711 Bacteria 2573
413 Ga0265342_10019007 3300031712 Bacteria 4436
414 Ga0265342_10552246 3300031712 Bacteria 584
415 Ga0307407_10010933 3300031903 Bacteria 4300
416 Ga0316583_10040598 3300032133 Bacteria 1648
417 Ga0373926_0056595 3300035083 Bacteria 1423
418 Ga0373940_0063553 3300035088 Bacteria 1061
419 Ga0373944_0004379 3300035089 Bacteria 3675
420 Ga0373923_0056394 3300035111 Bacteria 1659
421 Ga0373945_0006378 3300035116 Bacteria 3805
422 Ga0373953_0148036 3300035117 Bacteria 1006
423 Ga0373954_0393033 3300035118 Bacteria 686
424 Ga0373956_0069795 3300035119 Bacteria 1602
425 Ga0373956_0479841 3300035119 Bacteria 593
426 Ga0373957_0332505 3300035120 Bacteria 647
427 Ga0373943_0001502 3300035170 Bacteria 10554
428 Ga0373946_0007649 3300035171 Bacteria 3959
429 Ga0373942_0098359 3300035207 Bacteria 891
430 Ga0373924_0047791 3300035410 Bacteria 1766
431 Ga0373924_0363138 3300035410 Bacteria 646
432 Ga0373931_0015830 3300035691 Bacteria 3703
433 Ga0373935_0115286 3300035692 Bacteria 1789
434 Ga0373927_0006226 3300035695 Bacteria 8146
435 Ga0373933_0049201 3300035724 Bacteria 2513
436 Ga0373933_0156228 3300035724 Bacteria 1447
437 Ga0373933_0624684 3300035724 Unclassified 708
438 Ga0373947_0000205 3300035725 Bacteria 32976
439 Ga0373937_0001260 3300036401 Bacteria 21239
440 Ga0373937_0099169 3300036401 Bacteria 2702
441 Ga0373937_1340066 3300036401 Bacteria 664
442 Ga0373925_0000604 3300037068 Bacteria 34210
443 Ga0395899_0028938 3300037312 Bacteria 4169
444 Ga0395899_0765033 3300037312 Bacteria 600
445 Ga0395899_0874161 3300037312 Bacteria 550
446 Ga0395900_0277671 3300037418 Bacteria 1668
447 Ga0395900_0568823 3300037418 Bacteria 1076
448 Ga0395900_0687863 3300037418 Bacteria 957
449 Ga0395900_0790608 3300037418 Bacteria 877
450 Ga0395900_1565799 3300037418 Bacteria 571
451 Ga0395900_1672757 3300037418 Unclassified 547
452 Ga0395898_0015109 3300037466 Bacteria 7925
453 Ga0395898_0036162 3300037466 Bacteria 4905
454 Ga0395898_0096550 3300037466 Bacteria 2839
455 Ga0395898_0100823 3300037466 Bacteria 2773
456 Ga0395898_0269006 3300037466 Bacteria 1625
457 Ga0395898_0558757 3300037466 Bacteria 1087
458 Ga0395898_1386555 3300037466 Bacteria 631
459 Ga0395905_0041141 3300037471 Bacteria 4336
460 Ga0395905_0344636 3300037471 Bacteria 1381
461 Ga0395905_0665010 3300037471 Bacteria 944
462 Ga0395901_0018078 3300038443 Bacteria 7195
463 Ga0395901_0135019 3300038443 Bacteria 2593
464 Ga0395901_0322376 3300038443 Bacteria 1598
465 Ga0395901_0577064 3300038443 Bacteria 1137
466 Ga0395901_0900131 3300038443 Bacteria 867
467 Ga0436365_1007593 3300039437 Bacteria 544
468 Ga0436360_0811625 3300039438 Bacteria 4098
469 Ga0436360_1150404 3300039438 Bacteria 2476
470 Ga0436363_0341490 3300039450 Bacteria 650
471 Ga0439448_0137390 3300042005 Bacteria 845
472 Ga0466969_0000355 3300044656 Bacteria 25185
473 Ga0466972_0025573 3300044658 Bacteria 2925
474 Ga0466972_0285894 3300044658 Bacteria 771
475 Ga0466965_0134583 3300044683 Bacteria 1283
476 Ga0466965_0210503 3300044683 Bacteria 1034
477 Ga0466966_0562047 3300044684 Unclassified 686
478 Ga0466961_0022159 3300044693 Bacteria 4087
479 Ga0466961_0032460 3300044693 Bacteria 3355
480 Ga0466961_0071190 3300044693 Bacteria 2207
481 Ga0466961_0526187 3300044693 Bacteria 713
482 Ga0466961_0768929 3300044693 Bacteria 575
483 Ga0466963_0000681 3300044694 Bacteria 16505
484 Ga0466963_0003498 3300044694 Bacteria 9014
485 Ga0466963_0006622 3300044694 Bacteria 6873
486 Ga0466963_0008446 3300044694 Bacteria 6171
487 Ga0466963_0012574 3300044694 Bacteria 5185
488 Ga0466963_0013056 3300044694 Bacteria 5093
489 Ga0466963_0016805 3300044694 Bacteria 4554
490 Ga0466963_0027798 3300044694 Bacteria 3626
491 Ga0466963_0029203 3300044694 Bacteria 3547
492 Ga0466963_0040197 3300044694 Bacteria 3065
493 Ga0466963_0063100 3300044694 Bacteria 2479
494 Ga0466963_0064023 3300044694 Bacteria 2462
495 Ga0466963_0102972 3300044694 Bacteria 1955
496 Ga0466963_0168839 3300044694 Bacteria 1524
497 Ga0466963_0191919 3300044694 Bacteria 1427
498 Ga0466963_0197925 3300044694 Bacteria 1405
499 Ga0466963_0463265 3300044694 Bacteria 894
500 Ga0466964_0007474 3300044706 Bacteria 4089
501 Ga0466964_0011008 3300044706 Bacteria 3417
502 Ga0466964_0011587 3300044706 Bacteria 3332
503 Ga0466964_0027489 3300044706 Bacteria 2234
504 Ga0466964_0040009 3300044706 Bacteria 1891
505 Ga0466964_0177589 3300044706 Bacteria 1007
506 Ga0466964_0210240 3300044706 Bacteria 939
507 Ga0466964_0542382 3300044706 Bacteria 630
508 Ga0466971_0000871 3300044719 Bacteria 12335
509 Ga0466971_0008263 3300044719 Bacteria 4539
510 Ga0466971_0027045 3300044719 Bacteria 2568
511 Ga0466971_0064017 3300044719 Bacteria 1665
512 Ga0466971_0065501 3300044719 Bacteria 1645
513 Ga0466971_0144480 3300044719 Bacteria 1109
514 Ga0466971_0272952 3300044719 Bacteria 808
515 Ga0466971_0344814 3300044719 Bacteria 720
516 Ga0466968_0000558 3300044735 Bacteria 12664
517 Ga0466968_0001940 3300044735 Bacteria 7493
518 Ga0466968_0010694 3300044735 Bacteria 3564
519 Ga0466968_0031839 3300044735 Bacteria 2190
520 Ga0466968_0129463 3300044735 Bacteria 1147
521 Ga0466968_0141543 3300044735 Bacteria 1100
522 Ga0466968_0293966 3300044735 Bacteria 780
523 Ga0466968_0702111 3300044735 Bacteria 516
524 Ga0466970_0007395 3300044765 Bacteria 5503
525 Ga0466970_0013020 3300044765 Bacteria 4262
526 Ga0466970_0950967 3300044765 Unclassified 506
527 Ga0466970_0971116 3300044765 Bacteria 501
528 Ga0466957_0007410 3300044842 Bacteria 6200
529 Ga0466957_0010582 3300044842 Bacteria 5301
530 Ga0466957_0037247 3300044842 Bacteria 2928
531 Ga0466957_0037331 3300044842 Bacteria 2925
532 Ga0466957_0052052 3300044842 Bacteria 2492
533 Ga0466957_0058957 3300044842 Bacteria 2352
534 Ga0466957_0062153 3300044842 Bacteria 2293
535 Ga0466957_0125057 3300044842 Bacteria 1642
536 Ga0466957_0187904 3300044842 Bacteria 1352
537 Ga0466957_0252888 3300044842 Bacteria 1172
538 Ga0466957_1130571 3300044842 Bacteria 565
539 Ga0466960_0268796 3300044901 Bacteria 952
540 Ga0466960_0298831 3300044901 Bacteria 907
541 Ga0466959_0044699 3300045049 Bacteria 3262
542 Ga0466959_0068671 3300045049 Bacteria 2568
543 Ga0466959_0078203 3300045049 Bacteria 2386
544 Ga0466959_0081667 3300045049 Bacteria 2329
545 Ga0451576_0801762 3300045051 Bacteria 989
546 Ga0466958_0000764 3300045836 Bacteria 14134
547 Ga0466958_0001752 3300045836 Bacteria 10505
548 Ga0466958_0002962 3300045836 Bacteria 8696
549 Ga0466958_0017695 3300045836 Bacteria 4126
550 Ga0466958_0018345 3300045836 Bacteria 4060
551 Ga0466958_0106076 3300045836 Bacteria 1751
552 Ga0466958_0108075 3300045836 Bacteria 1735
553 Ga0466958_0229024 3300045836 Bacteria 1186
554 Ga0466958_0266778 3300045836 Bacteria 1096
555 Ga0466958_0361546 3300045836 Bacteria 935
556 Ga0466967_0000389 3300045976 Bacteria 20536
557 Ga0466967_0000731 3300045976 Bacteria 16819
558 Ga0466967_0005921 3300045976 Bacteria 8572
559 Ga0466967_0006226 3300045976 Bacteria 8413
560 Ga0466967_0007562 3300045976 Bacteria 7851
561 Ga0466967_0009002 3300045976 Bacteria 7375
562 Ga0466967_0012850 3300045976 Bacteria 6434
563 Ga0466967_0021569 3300045976 Bacteria 5237
564 Ga0466967_0025723 3300045976 Bacteria 4857
565 Ga0466967_0034428 3300045976 Bacteria 4299
566 Ga0466967_0038192 3300045976 Bacteria 4116
567 Ga0466967_0046237 3300045976 Bacteria 3788
568 Ga0466967_0053380 3300045976 Bacteria 3551
569 Ga0466967_0060300 3300045976 Bacteria 3361
570 Ga0466967_0065924 3300045976 Bacteria 3225
571 Ga0466967_0099253 3300045976 Bacteria 2659
572 Ga0466967_0171992 3300045976 Bacteria 2039
573 Ga0466967_0219687 3300045976 Bacteria 1805
574 Ga0466967_0258561 3300045976 Bacteria 1665
575 Ga0466967_0271724 3300045976 Bacteria 1624
576 Ga0466967_0396511 3300045976 Bacteria 1342
577 Ga0466967_0493491 3300045976 Bacteria 1201
578 Ga0466967_0500396 3300045976 Bacteria 1192
579 Ga0466967_0579086 3300045976 Bacteria 1106
580 Ga0466967_0665714 3300045976 Bacteria 1030
581 Ga0466967_0678237 3300045976 Bacteria 1020
582 Ga0466967_0836289 3300045976 Bacteria 914
583 Ga0466967_1737071 3300045976 Bacteria 621
584 Ga0495592_0000082 3300046454 Bacteria 83312
585 Ga0495592_0011130 3300046454 Bacteria 6794
586 Ga0495592_0046987 3300046454 Bacteria 3216
587 Ga0495592_0167204 3300046454 Bacteria 1508
588 Ga0495592_0541453 3300046454 Bacteria 717
589 Ga0495603_0005733 3300046455 Bacteria 7428
590 Ga0495629_0014936 3300046459 Bacteria 5580
591 Ga0495629_0030567 3300046459 Bacteria 3818
592 Ga0495629_0070915 3300046459 Bacteria 2431
593 Ga0495629_0087154 3300046459 Bacteria 2178
594 Ga0495629_0124488 3300046459 Bacteria 1796
595 Ga0495629_0247643 3300046459 Bacteria 1226
596 Ga0495641_0002942 3300046461 Bacteria 13119
597 Ga0495641_0043279 3300046461 Bacteria 2083
598 Ga0495651_0000080 3300046462 Bacteria 70453
599 Ga0495651_0348977 3300046462 Bacteria 978
600 Ga0495651_1021676 3300046462 Bacteria 501
601 Ga0495653_0015820 3300046463 Bacteria 6150
602 Ga0495653_0026113 3300046463 Bacteria 4687
603 Ga0495653_0320313 3300046463 Bacteria 1005
604 Ga0495580_0013385 3300046472 Bacteria 6263
605 Ga0495582_0000542 3300046473 Bacteria 20867
606 Ga0495582_0051670 3300046473 Bacteria 2266
607 Ga0495582_0128507 3300046473 Bacteria 1431
608 Ga0495639_0017281 3300046475 Bacteria 3132
609 Ga0495662_0000865 3300046476 Bacteria 14771
610 Ga0495662_0402041 3300046476 Bacteria 673
611 Ga0495664_0003565 3300046477 Bacteria 8486
612 Ga0495664_0072238 3300046477 Bacteria 2061
613 Ga0495664_0072944 3300046477 Bacteria 2052
614 Ga0495664_0503693 3300046477 Bacteria 723
615 Ga0495594_0119730 3300046499 Bacteria 1488
616 Ga0495608_0045059 3300046511 Bacteria 2942
617 Ga0495608_0073099 3300046511 Bacteria 2236
618 Ga0495608_0225488 3300046511 Bacteria 1174
619 Ga0495608_0584575 3300046511 Bacteria 671
620 Ga0495618_0002207 3300046514 Bacteria 12729
621 Ga0495618_0017806 3300046514 Bacteria 4359
622 Ga0495618_0266850 3300046514 Bacteria 1071
623 Ga0495618_0331381 3300046514 Bacteria 941
624 Ga0495618_0419152 3300046514 Bacteria 816
625 Ga0495618_0731731 3300046514 Bacteria 580
626 Ga0495628_0000292 3300046516 Bacteria 45065
627 Ga0495628_0015841 3300046516 Bacteria 6293
628 Ga0495628_0193418 3300046516 Bacteria 1535
629 Ga0495628_0425100 3300046516 Bacteria 968
630 Ga0495630_0024662 3300046517 Bacteria 4444
631 Ga0495630_0145538 3300046517 Bacteria 1802
632 Ga0495630_0318690 3300046517 Bacteria 1188
633 Ga0495630_1465434 3300046517 Bacteria 512
634 Ga0495644_0024379 3300046523 Bacteria 2301
635 Ga0495666_0000436 3300046526 Bacteria 18500
636 Ga0495652_0016575 3300046529 Bacteria 6589
637 Ga0495652_0044483 3300046529 Bacteria 3823
638 Ga0495652_0171146 3300046529 Bacteria 1676
639 Ga0495652_0229467 3300046529 Bacteria 1389
640 Ga0495652_0444543 3300046529 Bacteria 909
641 Ga0495652_0555673 3300046529 Bacteria 789
642 Ga0495665_0000038 3300046531 Bacteria 51967
643 Ga0495640_0003773 3300046533 Bacteria 12155
644 Ga0495640_0175938 3300046533 Bacteria 1366
645 Ga0495640_0272433 3300046533 Bacteria 1055
646 Ga0495586_0341814 3300046535 Bacteria 859
647 Ga0495587_0000270 3300046536 Bacteria 37255
648 Ga0495609_0263120 3300046538 Bacteria 708
649 Ga0495645_0000038 3300046543 Bacteria 96124
650 Ga0495645_0022830 3300046543 Bacteria 4527
651 Ga0495645_0699421 3300046543 Bacteria 615
652 Ga0495667_0001874 3300046559 Bacteria 13948
653 Ga0495667_0048333 3300046559 Bacteria 2809
654 Ga0495667_0373639 3300046559 Bacteria 899
655 Ga0495667_0491046 3300046559 Bacteria 769
656 Ga0495656_0014109 3300046615 Bacteria 2989
657 Ga0495634_0058051 3300046642 Bacteria 2580
658 Ga0495634_0060577 3300046642 Bacteria 2518
659 Ga0495634_0686377 3300046642 Bacteria 589
660 Ga0495611_0118897 3300046648 Bacteria 1232
661 Ga0495635_0011919 3300046663 Bacteria 6091
662 Ga0495635_0022423 3300046663 Bacteria 4396
663 Ga0495635_0131687 3300046663 Bacteria 1705
664 Ga0495635_0195306 3300046663 Bacteria 1373
665 Ga0495635_0223171 3300046663 Bacteria 1274
666 Ga0495635_0635875 3300046663 Bacteria 695
667 Ga0495657_0009237 3300046675 Bacteria 7481
668 Ga0495657_0014834 3300046675 Bacteria 5717
669 Ga0495599_0000142 3300046678 Bacteria 46621
670 Ga0495599_0009522 3300046678 Bacteria 5940
671 Ga0495599_0114963 3300046678 Bacteria 1674
672 Ga0495623_0000210 3300046679 Bacteria 37384
673 Ga0495623_0167622 3300046679 Bacteria 1285
674 Ga0495646_0000729 3300046680 Bacteria 18267
675 Ga0495646_0191919 3300046680 Bacteria 1116
676 Ga0495646_0210616 3300046680 Bacteria 1055
677 Ga0495646_0294802 3300046680 Bacteria 859
678 Ga0495647_0000362 3300046681 Bacteria 12846
679 Ga0495647_0076252 3300046681 Bacteria 1351
680 Ga0495647_0478771 3300046681 Bacteria 578
681 Ga0495658_0000950 3300046683 Bacteria 15450
682 Ga0495658_0039510 3300046683 Bacteria 2618
683 Ga0495658_0271355 3300046683 Bacteria 1069
684 Ga0495613_0003038 3300046689 Bacteria 12549
685 Ga0495613_0135818 3300046689 Bacteria 1760
686 Ga0495613_0336305 3300046689 Bacteria 1040
687 Ga0495613_0482618 3300046689 Bacteria 836
688 Ga0495624_0003198 3300046690 Bacteria 12201
689 Ga0495600_0072378 3300046809 Bacteria 2252
690 Ga0495600_0103629 3300046809 Bacteria 1854
691 Ga0495600_0243982 3300046809 Bacteria 1144
692 Ga0495600_0383877 3300046809 Bacteria 876
693 Ga0495600_0539647 3300046809 Bacteria 713
694 Ga0495581_0000231 3300047315 Bacteria 26359
695 Ga0495604_0000043 3300047317 Bacteria 116335
696 Ga0495604_0150391 3300047317 Bacteria 1655
697 Ga0495636_0101452 3300047318 Bacteria 1259
698 Ga0495674_0135341 3300047319 Bacteria 2074
699 Ga0495674_0245792 3300047319 Bacteria 1473
700 Ga0495674_0262865 3300047319 Bacteria 1417
701 Ga0495674_0268781 3300047319 Bacteria 1399
702 Ga0495676_0007522 3300047321 Bacteria 9986
703 Ga0495676_0083877 3300047321 Bacteria 2406
704 Ga0495676_0243477 3300047321 Bacteria 1230
705 Ga0495680_0029866 3300047322 Bacteria 4459
706 Ga0495680_0046561 3300047322 Bacteria 3419
707 Ga0495680_0125776 3300047322 Bacteria 1888
708 Ga0495680_0323544 3300047322 Bacteria 1079
709 Ga0495680_0391241 3300047322 Bacteria 961
710 Ga0495675_0826210 3300047444 Unclassified 511
711 Ga0495677_0058436 3300047445 Bacteria 1427
712 Ga0495684_0022803 3300047471 Bacteria 4814
713 Ga0495684_0035692 3300047471 Bacteria 3811
714 Ga0495684_0073967 3300047471 Bacteria 2588
715 Ga0495684_0084343 3300047471 Bacteria 2410
716 Ga0495684_0132819 3300047471 Bacteria 1868
717 Ga0495684_0259566 3300047471 Bacteria 1261
718 Ga0495593_0001951 3300047673 Bacteria 12308
719 Ga0495593_0176567 3300047673 Unclassified 1076
720 Ga0495602_0007946 3300048088 Bacteria 11086
721 Ga0495602_0009850 3300048088 Bacteria 9917
722 Ga0495602_0934739 3300048088 Bacteria 575
723 Ga0495614_0000113 3300048089 Bacteria 27871
724 Ga0496100_0017052 3300048903 Bacteria 4279
725 Ga0496100_0092606 3300048903 Bacteria 2066
726 Ga0496100_0101807 3300048903 Bacteria 1981
727 Ga0496101_0002780 3300048904 Bacteria 10726
728 Ga0496101_0093389 3300048904 Bacteria 2241
729 Ga0496101_0099239 3300048904 Bacteria 2177
730 Ga0496101_0365561 3300048904 Bacteria 1134
731 Ga0496102_0017437 3300048905 Bacteria 6290
732 Ga0496102_0113263 3300048905 Bacteria 2530
733 Ga0496102_0486672 3300048905 Bacteria 1155
734 Ga0496102_0789359 3300048905 Bacteria 872
735 Ga0496102_1870604 3300048905 Bacteria 517
736 Ga0496103_0004195 3300048906 Bacteria 8746
737 Ga0496103_0061563 3300048906 Bacteria 2334
738 Ga0496103_1032950 3300048906 Bacteria 511
739 Ga0496104_0005694 3300048907 Bacteria 10905
740 Ga0496104_0044993 3300048907 Bacteria 4149
741 Ga0496104_0163692 3300048907 Bacteria 2133
742 Ga0496105_0004010 3300048908 Bacteria 11014
743 Ga0496105_0009335 3300048908 Bacteria 7668
744 Ga0496105_0127767 3300048908 Bacteria 2095
745 Ga0496105_0157182 3300048908 Bacteria 1867
746 Ga0496105_0199059 3300048908 Bacteria 1635
747 Ga0496106_0003405 3300048909 Bacteria 11848
748 Ga0496106_0005415 3300048909 Bacteria 9437
749 Ga0496106_0228123 3300048909 Bacteria 1486
750 Ga0496106_1358096 3300048909 Bacteria 550
751 Ga0496107_0000477 3300048910 Bacteria 22008
752 Ga0496107_0105416 3300048910 Bacteria 2069
753 Ga0496107_0292411 3300048910 Bacteria 1213
754 Ga0496107_0850012 3300048910 Bacteria 667
755 Ga0496108_0015425 3300048911 Bacteria 6233
756 Ga0496108_0113425 3300048911 Bacteria 2319
757 Ga0496108_0307247 3300048911 Bacteria 1382
758 Ga0496108_0382636 3300048911 Bacteria 1229
759 Ga0496109_0049137 3300048912 Bacteria 3839
760 Ga0496109_0105869 3300048912 Bacteria 2612
761 Ga0496109_0123648 3300048912 Bacteria 2412
762 Ga0496109_0208516 3300048912 Bacteria 1837
763 Ga0496109_0416383 3300048912 Bacteria 1269
764 Ga0496110_0007150 3300048913 Bacteria 8887
765 Ga0496110_0273171 3300048913 Bacteria 1539
766 Ga0496110_0974690 3300048913 Bacteria 755
767 Ga0496111_0028127 3300048914 Bacteria 3982
768 Ga0496111_0067102 3300048914 Bacteria 2606
769 Ga0496111_0121050 3300048914 Bacteria 1933
770 Ga0496111_0340912 3300048914 Bacteria 1109
771 Ga0496112_0035466 3300048915 Bacteria 4859
772 Ga0496112_0041789 3300048915 Bacteria 4486
773 Ga0496112_0110285 3300048915 Bacteria 2722
774 Ga0496112_0150282 3300048915 Bacteria 2296
775 Ga0496112_0154045 3300048915 Bacteria 2265
776 Ga0496112_0175058 3300048915 Bacteria 2111
777 Ga0496112_0404329 3300048915 Bacteria 1305
778 Ga0496112_0463572 3300048915 Bacteria 1204
779 Ga0496112_0605156 3300048915 Bacteria 1028
780 Ga0496112_1053679 3300048915 Unclassified 732
781 Ga0496113_0034002 3300048916 Bacteria 3717
782 Ga0496113_0066331 3300048916 Bacteria 2733
783 Ga0496113_0821813 3300048916 Bacteria 738
784 Ga0496114_0046993 3300048917 Bacteria 3588
785 Ga0496114_0263395 3300048917 Bacteria 1518
786 Ga0496115_0016183 3300048918 Bacteria 5674
787 Ga0496115_0044693 3300048918 Bacteria 3534
788 Ga0496115_0135626 3300048918 Bacteria 2029
789 Ga0496115_0152340 3300048918 Bacteria 1909
790 Ga0496115_0590015 3300048918 Bacteria 884
791 Ga0501067_0010948 3300049583 Bacteria 5022
792 Ga0501067_0021693 3300049583 Bacteria 3554
793 Ga0501067_0208348 3300049583 Bacteria 1089
794 Ga0501067_0345387 3300049583 Bacteria 829
795 Ga0501069_0077838 3300049585 Bacteria 1864
796 Ga0501069_0634238 3300049585 Unclassified 642
797 Ga0501070_0037683 3300049586 Bacteria 4036
798 Ga0501070_0051589 3300049586 Bacteria 3414
799 Ga0501070_0373503 3300049586 Bacteria 1156
800 Ga0501072_0018261 3300049588 Bacteria 5396
801 Ga0501073_0058214 3300049589 Bacteria 2701
802 Ga0501073_0067035 3300049589 Bacteria 2502
803 Ga0501074_0013035 3300049590 Bacteria 6045
804 Ga0501079_0011330 3300049741 Bacteria 6802
805 Ga0501080_0078654 3300049742 Bacteria 3066
806 Ga0501083_0000576 3300049744 Bacteria 23532
807 Ga0501044_0567080 3300049823 Bacteria 1031
808 nmdc:mga08y16_138966_c1 3300050511 Bacteria 2525
809 nmdc:mga0n895_1676_c1 3300050512 Bacteria 16730
810 nmdc:mga08x19_66461_c1 3300050514 Bacteria 2343
811 nmdc:mga0a205_468051_c1 3300050515 Bacteria 1119
812 Ga0495601_0013020 3300053077 Bacteria 4997
813 Ga0495601_0018667 3300053077 Bacteria 4222
814 Ga0495601_0108968 3300053077 Bacteria 1792
815 Ga0495601_0137719 3300053077 Bacteria 1591
816 Ga0495612_0021958 3300053078 Bacteria 2559
817 Ga0495612_0047744 3300053078 Bacteria 1754
818 Ga0495612_0179862 3300053078 Bacteria 928
819 Ga0495595_0056434 3300053084 Bacteria 1830
820 Ga0495595_0096164 3300053084 Bacteria 1425
821 Ga0495595_0604938 3300053084 Bacteria 561
822 Ga0495619_0011810 3300053085 Bacteria 5501
823 Ga0495619_0037711 3300053085 Bacteria 3151
824 Ga0495619_0191282 3300053085 Bacteria 1416
825 Ga0495619_0216313 3300053085 Bacteria 1327
826 Ga0495619_1205494 3300053085 Bacteria 501
827 Ga0500566_0051165 3300053094 Bacteria 2363
828 Ga0500657_177642 3300053728 Bacteria 744
829 Ga0501082_0304960 3300060353 Bacteria 1387
830 Ga0466962_0000600 3300061719 Bacteria 15915
831 Ga0466962_0001813 3300061719 Bacteria 10055
832 Ga0466962_0002868 3300061719 Bacteria 8219
833 Ga0466962_0025185 3300061719 Bacteria 2856
834 Ga0466962_0052078 3300061719 Bacteria 1957
835 Ga0466962_0081677 3300061719 Bacteria 1546
836 Ga0466962_0278524 3300061719 Bacteria 825
837 Ga0265338_10088775
838 Ga0070658_10110130
839 Ga0070683_100114394
840 Ga0070683_100191944
841 Ga0070683_100197479
842 Ga0070683_100213829
843 Ga0070680_100092123
844 Ga0070680_100170741
845 Ga0070680_100243111
846 Ga0070680_100784053
847 Ga0070682_100017584
848 Ga0070682_100078157
849 Ga0070682_100155009
850 Ga0068868_101240115
851 Ga0070660_100016946
852 Ga0070660_100046508
853 Ga0070660_100110649
854 Ga0070660_100198794
855 Ga0070660_100238474
856 Ga0070660_100721912
857 Ga0070660_100795725
858 Ga0070660_101377928
859 Ga0070661_100095978
860 Ga0070661_100142532
861 Ga0070661_100203197
862 Ga0070692_10694537
863 Ga0070674_100933334
864 Ga0070659_100199728
865 Ga0070667_100359177
866 Ga0070709_10012797
867 Ga0070709_10059965
868 Ga0070709_10571167
869 Ga0070714_100034925
870 Ga0070714_100063213
871 Ga0070714_100095228
872 Ga0070714_100151430
873 Ga0070714_100168465
874 Ga0070714_100176699
875 Ga0070714_100230508
876 Ga0070714_100336945
877 Ga0070714_100352350
878 Ga0070714_100436804
879 Ga0070714_100442492
880 Ga0070714_100625813
881 Ga0070714_100802714
882 Ga0070714_100921048
883 Ga0070714_101217598
884 Ga0070714_101603783
885 Ga0070714_101614243
886 Ga0070714_101932718
887 Ga0070713_100025851
888 Ga0070713_100312945
889 Ga0070713_100363264
890 Ga0070713_101930704
891 Ga0070713_102429511
892 Ga0070710_10011319
893 Ga0070710_10131683
894 Ga0070710_10434212
895 Ga0070711_100095512
896 Ga0070711_100171299
897 Ga0070711_100398363
898 Ga0070711_101344298
899 Ga0070711_101487111
900 Ga0070705_100127643
901 Ga0070705_100871400
902 Ga0070694_100619521
903 Ga0070694_101291571
904 Ga0070708_100151810
905 Ga0070708_100695088
906 Ga0070708_100810922
907 Ga0070708_101319930
908 Ga0070708_101324150
909 Ga0070708_101405254
910 Ga0070708_101673635
911 Ga0070663_100683628
912 Ga0070678_100365260
913 Ga0070662_101341925
914 Ga0070681_10029010
915 Ga0070681_10038474
916 Ga0070681_10067920
917 Ga0070681_10142211
918 Ga0070681_10178328
919 Ga0070681_10210846
920 Ga0070681_10323960
921 Ga0070681_10328144
922 Ga0070681_10444799
923 Ga0070681_10620908
924 Ga0070681_10882177
925 Ga0070681_11478947
926 Ga0070706_100039423
927 Ga0070706_100131903
928 Ga0070706_100637351
929 Ga0070706_100932559
930 Ga0070707_100000441
931 Ga0070707_100008363
932 Ga0070707_100788672
933 Ga0070698_100069724
934 Ga0070698_100285768
935 Ga0070698_100307235
936 Ga0070698_100599884
937 Ga0070698_100652479
938 Ga0070699_100041932
939 Ga0070699_100344624
940 Ga0070699_101005141
941 Ga0070699_101147231
942 Ga0070699_101179069
943 Ga0070699_101834349
944 Ga0070679_100019782
945 Ga0070679_100094255
946 Ga0070679_100141314
947 Ga0070679_100165784
948 Ga0070679_100206505
949 Ga0070679_100216922
950 Ga0070679_100327030
951 Ga0070679_100778800
952 Ga0070684_100165660
953 Ga0070684_100818678
954 Ga0070684_101536341
955 Ga0070697_100363044
956 Ga0070697_101498480
957 Ga0070697_101940437
958 Ga0068853_100453815
959 Ga0068853_102435219
960 Ga0070695_100000005
961 Ga0070695_101872971
962 Ga0070696_101479494
963 Ga0070693_100113615
964 Ga0070693_100311372
965 Ga0070704_102083735
966 Ga0068855_100115927
967 Ga0068855_100601691
968 Ga0068855_101818330
969 Ga0070664_100521248
970 Ga0070664_101993341
971 Ga0068857_102364261
972 Ga0068854_101819459
973 Ga0068856_100034191
974 Ga0068856_100105784
975 Ga0068856_100241933
976 Ga0068856_100319082
977 Ga0068856_101295325
978 Ga0068856_101986718
979 Ga0070702_101783009
980 Ga0070717_10003490
981 Ga0070717_10009086
982 Ga0070717_10010124
983 Ga0070717_10018995
984 Ga0070717_10023944
985 Ga0070717_11040412
986 Ga0070717_11439119
987 Ga0070715_10002925
988 Ga0070716_100003114
989 Ga0070716_101266223
990 Ga0070712_100093194
991 Ga0070712_100522054
992 Ga0070712_100986329
993 Ga0068871_101266838
994 Ga0075431_100286588
995 Ga0075433_11378457
996 Ga0068865_101585680
997 Ga0075436_100078580
998 Ga0075436_100326519
999 Ga0075435_101067483
1000 Ga0099794_10152949
1001 Ga0105251_10260024
1002 Ga0105244_10280068
1003 Ga0105240_10068476
1004 Ga0105240_10343779
1005 Ga0105240_10463202
1006 Ga0105240_10860212
1007 Ga0111539_10705619
1008 Ga0105245_10095149
1009 Ga0105245_12808556
1010 Ga0105247_10318638
1011 Ga0105241_10425701
1012 Ga0105241_10635277
1013 Ga0105241_10638703
1014 Ga0105242_10218700
1015 Ga0105248_13023167
1016 Ga0105237_10765828
1017 Ga0105237_11460098
1018 Ga0105238_10190608
1019 Ga0105238_10646122
1020 Ga0105238_11237850
1021 Ga0105249_12631836
1022 Ga0105239_11546027
1023 Ga0105239_12080474
1024 Ga0105239_13166758
1025 Ga0157371_10098212
1026 Ga0157370_10030952
1027 Ga0157370_10032439
1028 Ga0157370_10930696
1029 Ga0157369_10005310
1030 Ga0157369_10055843
1031 Ga0157369_10060388
1032 Ga0157369_10589353
1033 Ga0157369_10737767
1034 Ga0157369_10844256
1035 Ga0157369_11424561
1036 Ga0157374_10062661
1037 Ga0157374_10521287
1038 Ga0163162_11007731
1039 Ga0157372_10324865
1040 Ga0157372_10415359
1041 Ga0157372_10845511
1042 Ga0157372_11025496
1043 Ga0157372_11621058
1044 Ga0157372_11994478
1045 Ga0157372_13040708
1046 Ga0157375_12195108
1047 Ga0163163_10220187
1048 Ga0182008_10026892
1049 Ga0182008_10067443
1050 Ga0182008_10084534
1051 Ga0182008_10176996
1052 Ga0157379_10983604
1053 Ga0182006_1147036
1054 Ga0182005_1042110
1055 Ga0206356_10081141
1056 Ga0206356_11407641
1057 Ga0206354_10889251
1058 Ga0206354_10939662
1059 Ga0206353_11095863
1060 Ga0206353_11266715
1061 Ga0206353_11931666
1062 Ga0206353_12038425
1063 Ga0213871_10094165
1064 Ga0224712_10007888
1065 Ga0224712_10010076
1066 Ga0224712_10032792
1067 Ga0207692_10012830
1068 Ga0207692_10057104
1069 Ga0207692_10689477
1070 Ga0207692_11063344
1071 Ga0207692_11166398
1072 Ga0207710_10103294
1073 Ga0207685_10034599
1074 Ga0207699_10008519
1075 Ga0207699_10074107
1076 Ga0207699_10343596
1077 Ga0207699_11234192
1078 Ga0207705_10127391
1079 Ga0207705_10134122
1080 Ga0207705_10624982
1081 Ga0207705_10803325
1082 Ga0207705_11309990
1083 Ga0207684_10034486
1084 Ga0207684_10502579
1085 Ga0207684_11035254
1086 Ga0207654_10621316
1087 Ga0207654_10651867
1088 Ga0207707_10029444
1089 Ga0207707_10079072
1090 Ga0207707_10149398
1091 Ga0207707_10200294
1092 Ga0207707_10317286
1093 Ga0207707_10366719
1094 Ga0207707_10482079
1095 Ga0207707_10602676
1096 Ga0207695_10037785
1097 Ga0207695_11369134
1098 Ga0207693_10001187
1099 Ga0207693_10012498
1100 Ga0207693_10117503
1101 Ga0207693_10226626
1102 Ga0207693_10434236
1103 Ga0207693_10988249
1104 Ga0207693_11057359
1105 Ga0207693_11123783
1106 Ga0207663_10080778
1107 Ga0207663_10429328
1108 Ga0207663_10451602
1109 Ga0207663_10457611
1110 Ga0207660_10013044
1111 Ga0207660_10469867
1112 Ga0207660_10651383
1113 Ga0207660_11696001
1114 Ga0207662_11331123
1115 Ga0207657_10026118
1116 Ga0207657_10102594
1117 Ga0207657_10233784
1118 Ga0207657_10244459
1119 Ga0207657_10345115
1120 Ga0207657_10840713
1121 Ga0207649_10160888
1122 Ga0207652_10046072
1123 Ga0207652_10074559
1124 Ga0207652_10099081
1125 Ga0207652_10117179
1126 Ga0207652_10158009
1127 Ga0207652_10410621
1128 Ga0207652_10514381
1129 Ga0207652_10566361
1130 Ga0207652_11053056
1131 Ga0207652_11088442
1132 Ga0207652_11460999
1133 Ga0207646_10001597
1134 Ga0207694_11374866
1135 Ga0207694_11491845
1136 Ga0207700_10090757
1137 Ga0207700_10265700
1138 Ga0207700_10295143
1139 Ga0207700_10829426
1140 Ga0207700_10830660
1141 Ga0207664_10006165
1142 Ga0207664_10006213
1143 Ga0207664_10016767
1144 Ga0207664_10028936
1145 Ga0207664_10149942
1146 Ga0207664_10186495
1147 Ga0207664_10275574
1148 Ga0207664_10359393
1149 Ga0207664_10379586
1150 Ga0207664_10427776
1151 Ga0207664_10612251
1152 Ga0207664_10723154
1153 Ga0207664_10793518
1154 Ga0207690_10395457
1155 Ga0207706_10931825
1156 Ga0207686_10984417
1157 Ga0207665_10000058
1158 Ga0207665_10032871
1159 Ga0207665_10239935
1160 Ga0207665_11402783
1161 Ga0207711_10542256
1162 Ga0207711_12026139
1163 Ga0207661_10013337
1164 Ga0207661_10043491
1165 Ga0207661_10357139
1166 Ga0207661_10415553
1167 Ga0207679_10623723
1168 Ga0207679_11517636
1169 Ga0207667_10267320
1170 Ga0207667_10358667
1171 Ga0207667_10379678
1172 Ga0207667_10628149
1173 Ga0207667_10699886
1174 Ga0207667_11564708
1175 Ga0207640_10552644
1176 Ga0207640_12126129
1177 Ga0207658_10308758
1178 Ga0207677_11157105
1179 Ga0207678_10210673
1180 Ga0207702_10171687
1181 Ga0207702_10295377
1182 Ga0207702_10307601
1183 Ga0207702_10471847
1184 Ga0207702_11706308
1185 Ga0207641_11465967
1186 Ga0207674_10105204
1187 Ga0207683_10178496
1188 Ga0207698_10699438
1189 Ga0268266_11022330
1190 Ga0265337_1077593
1191 Ga0265326_10029888
1192 Ga0265326_10056070
1193 Ga0265326_10182952
1194 Ga0265319_1006086
1195 Ga0265319_1015560
1196 Ga0265319_1054021
1197 Ga0265334_10001373
1198 Ga0265334_10041503
1199 Ga0265334_10343968
1200 Ga0265318_10000445
1201 Ga0265318_10022330
1202 Ga0265318_10131928
1203 Ga0265318_10173927
1204 Ga0265322_10017548
1205 Ga0265322_10018713
1206 Ga0265322_10139951
1207 Ga0265336_10022376
1208 Ga0265336_10067211
1209 Ga0265336_10208154
1210 Ga0265338_10005247
1211 Ga0265338_10012217
1212 Ga0265338_10054285
1213 Ga0265338_10949954
1214 Ga0265338_11178258
1215 Ga0265324_10017637
1216 Ga0265324_10064889
1217 Ga0265324_10268394
1218 Ga0265330_10000848
1219 Ga0265330_10080129
1220 Ga0265330_10352814
1221 Ga0265332_10022081
1222 Ga0265332_10083172
1223 Ga0265328_10020190
1224 Ga0265328_10176962
1225 Ga0265320_10029937
1226 Ga0265320_10354939
1227 Ga0265325_10002030
1228 Ga0265325_10010380
1229 Ga0265325_10276341
1230 Ga0265329_10011823
1231 Ga0265329_10300107
1232 Ga0265340_10011912
1233 Ga0265339_10007564
1234 Ga0265339_10030343
1235 Ga0265331_10000672
1236 Ga0265327_10005507
1237 Ga0265327_10064446
1238 Ga0265327_10292339
1239 Ga0265316_10012345
1240 Ga0265316_10063567
1241 Ga0265316_10259669
1242 Ga0265316_10500916
1243 Ga0265316_11159953
1244 Ga0265313_10001111
1245 Ga0265313_10012231
1246 Ga0265314_10005359
1247 Ga0265314_10008168
1248 Ga0265314_10060908
1249 Ga0265342_10019007
1250 Ga0265342_10552246
1251 Ga0307407_10010933
1252 Ga0316583_10040598
1253 Ga0373926_0056595
1254 Ga0373940_0063553
1255 Ga0373944_0004379
1256 Ga0373923_0056394
1257 Ga0373945_0006378
1258 Ga0373953_0148036
1259 Ga0373954_0393033
1260 Ga0373956_0069795
1261 Ga0373956_0479841
1262 Ga0373957_0332505
1263 Ga0373943_0001502
1264 Ga0373946_0007649
1265 Ga0373942_0098359
1266 Ga0373924_0047791
1267 Ga0373924_0363138
1268 Ga0373931_0015830
1269 Ga0373935_0115286
1270 Ga0373927_0006226
1271 Ga0373933_0049201
1272 Ga0373933_0156228
1273 Ga0373933_0624684
1274 Ga0373947_0000205
1275 Ga0373937_0001260
1276 Ga0373937_0099169
1277 Ga0373937_1340066
1278 Ga0373925_0000604
1279 Ga0395899_0028938
1280 Ga0395899_0765033
1281 Ga0395899_0874161
1282 Ga0395900_0277671
1283 Ga0395900_0568823
1284 Ga0395900_0687863
1285 Ga0395900_0790608
1286 Ga0395900_1565799
1287 Ga0395900_1672757
1288 Ga0395898_0015109
1289 Ga0395898_0036162
1290 Ga0395898_0096550
1291 Ga0395898_0100823
1292 Ga0395898_0269006
1293 Ga0395898_0558757
1294 Ga0395898_1386555
1295 Ga0395905_0041141
1296 Ga0395905_0344636
1297 Ga0395905_0665010
1298 Ga0395901_0018078
1299 Ga0395901_0135019
1300 Ga0395901_0322376
1301 Ga0395901_0577064
1302 Ga0395901_0900131
1303 Ga0436365_1007593
1304 Ga0436360_0811625
1305 Ga0436360_1150404
1306 Ga0436363_0341490
1307 Ga0439448_0137390
1308 Ga0466969_0000355
1309 Ga0466972_0025573
1310 Ga0466972_0285894
1311 Ga0466965_0134583
1312 Ga0466965_0210503
1313 Ga0466966_0562047
1314 Ga0466961_0022159
1315 Ga0466961_0032460
1316 Ga0466961_0071190
1317 Ga0466961_0526187
1318 Ga0466961_0768929
1319 Ga0466963_0000681
1320 Ga0466963_0003498
1321 Ga0466963_0006622
1322 Ga0466963_0008446
1323 Ga0466963_0012574
1324 Ga0466963_0013056
1325 Ga0466963_0016805
1326 Ga0466963_0027798
1327 Ga0466963_0029203
1328 Ga0466963_0040197
1329 Ga0466963_0063100
1330 Ga0466963_0064023
1331 Ga0466963_0102972
1332 Ga0466963_0168839
1333 Ga0466963_0191919
1334 Ga0466963_0197925
1335 Ga0466963_0463265
1336 Ga0466964_0007474
1337 Ga0466964_0011008
1338 Ga0466964_0011587
1339 Ga0466964_0027489
1340 Ga0466964_0040009
1341 Ga0466964_0177589
1342 Ga0466964_0210240
1343 Ga0466964_0542382
1344 Ga0466971_0000871
1345 Ga0466971_0008263
1346 Ga0466971_0027045
1347 Ga0466971_0064017
1348 Ga0466971_0065501
1349 Ga0466971_0144480
1350 Ga0466971_0272952
1351 Ga0466971_0344814
1352 Ga0466968_0000558
1353 Ga0466968_0001940
1354 Ga0466968_0010694
1355 Ga0466968_0031839
1356 Ga0466968_0129463
1357 Ga0466968_0141543
1358 Ga0466968_0293966
1359 Ga0466968_0702111
1360 Ga0466970_0007395
1361 Ga0466970_0013020
1362 Ga0466970_0950967
1363 Ga0466970_0971116
1364 Ga0466957_0007410
1365 Ga0466957_0010582
1366 Ga0466957_0037247
1367 Ga0466957_0037331
1368 Ga0466957_0052052
1369 Ga0466957_0058957
1370 Ga0466957_0062153
1371 Ga0466957_0125057
1372 Ga0466957_0187904
1373 Ga0466957_0252888
1374 Ga0466957_1130571
1375 Ga0466960_0268796
1376 Ga0466960_0298831
1377 Ga0466959_0044699
1378 Ga0466959_0068671
1379 Ga0466959_0078203
1380 Ga0466959_0081667
1381 Ga0451576_0801762
1382 Ga0466958_0000764
1383 Ga0466958_0001752
1384 Ga0466958_0002962
1385 Ga0466958_0017695
1386 Ga0466958_0018345
1387 Ga0466958_0106076
1388 Ga0466958_0108075
1389 Ga0466958_0229024
1390 Ga0466958_0266778
1391 Ga0466958_0361546
1392 Ga0466967_0000389
1393 Ga0466967_0000731
1394 Ga0466967_0005921
1395 Ga0466967_0006226
1396 Ga0466967_0007562
1397 Ga0466967_0009002
1398 Ga0466967_0012850
1399 Ga0466967_0021569
1400 Ga0466967_0025723
1401 Ga0466967_0034428
1402 Ga0466967_0038192
1403 Ga0466967_0046237
1404 Ga0466967_0053380
1405 Ga0466967_0060300
1406 Ga0466967_0065924
1407 Ga0466967_0099253
1408 Ga0466967_0171992
1409 Ga0466967_0219687
1410 Ga0466967_0258561
1411 Ga0466967_0271724
1412 Ga0466967_0396511
1413 Ga0466967_0493491
1414 Ga0466967_0500396
1415 Ga0466967_0579086
1416 Ga0466967_0665714
1417 Ga0466967_0678237
1418 Ga0466967_0836289
1419 Ga0466967_1737071
1420 Ga0495592_0000082
1421 Ga0495592_0011130
1422 Ga0495592_0046987
1423 Ga0495592_0167204
1424 Ga0495592_0541453
1425 Ga0495603_0005733
1426 Ga0495629_0014936
1427 Ga0495629_0030567
1428 Ga0495629_0070915
1429 Ga0495629_0087154
1430 Ga0495629_0124488
1431 Ga0495629_0247643
1432 Ga0495641_0002942
1433 Ga0495641_0043279
1434 Ga0495651_0000080
1435 Ga0495651_0348977
1436 Ga0495651_1021676
1437 Ga0495653_0015820
1438 Ga0495653_0026113
1439 Ga0495653_0320313
1440 Ga0495580_0013385
1441 Ga0495582_0000542
1442 Ga0495582_0051670
1443 Ga0495582_0128507
1444 Ga0495639_0017281
1445 Ga0495662_0000865
1446 Ga0495662_0402041
1447 Ga0495664_0003565
1448 Ga0495664_0072238
1449 Ga0495664_0072944
1450 Ga0495664_0503693
1451 Ga0495594_0119730
1452 Ga0495608_0045059
1453 Ga0495608_0073099
1454 Ga0495608_0225488
1455 Ga0495608_0584575
1456 Ga0495618_0002207
1457 Ga0495618_0017806
1458 Ga0495618_0266850
1459 Ga0495618_0331381
1460 Ga0495618_0419152
1461 Ga0495618_0731731
1462 Ga0495628_0000292
1463 Ga0495628_0015841
1464 Ga0495628_0193418
1465 Ga0495628_0425100
1466 Ga0495630_0024662
1467 Ga0495630_0145538
1468 Ga0495630_0318690
1469 Ga0495630_1465434
1470 Ga0495644_0024379
1471 Ga0495666_0000436
1472 Ga0495652_0016575
1473 Ga0495652_0044483
1474 Ga0495652_0171146
1475 Ga0495652_0229467
1476 Ga0495652_0444543
1477 Ga0495652_0555673
1478 Ga0495665_0000038
1479 Ga0495640_0003773
1480 Ga0495640_0175938
1481 Ga0495640_0272433
1482 Ga0495586_0341814
1483 Ga0495587_0000270
1484 Ga0495609_0263120
1485 Ga0495645_0000038
1486 Ga0495645_0022830
1487 Ga0495645_0699421
1488 Ga0495667_0001874
1489 Ga0495667_0048333
1490 Ga0495667_0373639
1491 Ga0495667_0491046
1492 Ga0495656_0014109
1493 Ga0495634_0058051
1494 Ga0495634_0060577
1495 Ga0495634_0686377
1496 Ga0495611_0118897
1497 Ga0495635_0011919
1498 Ga0495635_0022423
1499 Ga0495635_0131687
1500 Ga0495635_0195306
1501 Ga0495635_0223171
1502 Ga0495635_0635875
1503 Ga0495657_0009237
1504 Ga0495657_0014834
1505 Ga0495599_0000142
1506 Ga0495599_0009522
1507 Ga0495599_0114963
1508 Ga0495623_0000210
1509 Ga0495623_0167622
1510 Ga0495646_0000729
1511 Ga0495646_0191919
1512 Ga0495646_0210616
1513 Ga0495646_0294802
1514 Ga0495647_0000362
1515 Ga0495647_0076252
1516 Ga0495647_0478771
1517 Ga0495658_0000950
1518 Ga0495658_0039510
1519 Ga0495658_0271355
1520 Ga0495613_0003038
1521 Ga0495613_0135818
1522 Ga0495613_0336305
1523 Ga0495613_0482618
1524 Ga0495624_0003198
1525 Ga0495600_0072378
1526 Ga0495600_0103629
1527 Ga0495600_0243982
1528 Ga0495600_0383877
1529 Ga0495600_0539647
1530 Ga0495581_0000231
1531 Ga0495604_0000043
1532 Ga0495604_0150391
1533 Ga0495636_0101452
1534 Ga0495674_0135341
1535 Ga0495674_0245792
1536 Ga0495674_0262865
1537 Ga0495674_0268781
1538 Ga0495676_0007522
1539 Ga0495676_0083877
1540 Ga0495676_0243477
1541 Ga0495680_0029866
1542 Ga0495680_0046561
1543 Ga0495680_0125776
1544 Ga0495680_0323544
1545 Ga0495680_0391241
1546 Ga0495675_0826210
1547 Ga0495677_0058436
1548 Ga0495684_0022803
1549 Ga0495684_0035692
1550 Ga0495684_0073967
1551 Ga0495684_0084343
1552 Ga0495684_0132819
1553 Ga0495684_0259566
1554 Ga0495593_0001951
1555 Ga0495593_0176567
1556 Ga0495602_0007946
1557 Ga0495602_0009850
1558 Ga0495602_0934739
1559 Ga0495614_0000113
1560 Ga0496100_0017052
1561 Ga0496100_0092606
1562 Ga0496100_0101807
1563 Ga0496101_0002780
1564 Ga0496101_0093389
1565 Ga0496101_0099239
1566 Ga0496101_0365561
1567 Ga0496102_0017437
1568 Ga0496102_0113263
1569 Ga0496102_0486672
1570 Ga0496102_0789359
1571 Ga0496102_1870604
1572 Ga0496103_0004195
1573 Ga0496103_0061563
1574 Ga0496103_1032950
1575 Ga0496104_0005694
1576 Ga0496104_0044993
1577 Ga0496104_0163692
1578 Ga0496105_0004010
1579 Ga0496105_0009335
1580 Ga0496105_0127767
1581 Ga0496105_0157182
1582 Ga0496105_0199059
1583 Ga0496106_0003405
1584 Ga0496106_0005415
1585 Ga0496106_0228123
1586 Ga0496106_1358096
1587 Ga0496107_0000477
1588 Ga0496107_0105416
1589 Ga0496107_0292411
1590 Ga0496107_0850012
1591 Ga0496108_0015425
1592 Ga0496108_0113425
1593 Ga0496108_0307247
1594 Ga0496108_0382636
1595 Ga0496109_0049137
1596 Ga0496109_0105869
1597 Ga0496109_0123648
1598 Ga0496109_0208516
1599 Ga0496109_0416383
1600 Ga0496110_0007150
1601 Ga0496110_0273171
1602 Ga0496110_0974690
1603 Ga0496111_0028127
1604 Ga0496111_0067102
1605 Ga0496111_0121050
1606 Ga0496111_0340912
1607 Ga0496112_0035466
1608 Ga0496112_0041789
1609 Ga0496112_0110285
1610 Ga0496112_0150282
1611 Ga0496112_0154045
1612 Ga0496112_0175058
1613 Ga0496112_0404329
1614 Ga0496112_0463572
1615 Ga0496112_0605156
1616 Ga0496112_1053679
1617 Ga0496113_0034002
1618 Ga0496113_0066331
1619 Ga0496113_0821813
1620 Ga0496114_0046993
1621 Ga0496114_0263395
1622 Ga0496115_0016183
1623 Ga0496115_0044693
1624 Ga0496115_0135626
1625 Ga0496115_0152340
1626 Ga0496115_0590015
1627 Ga0501067_0010948
1628 Ga0501067_0021693
1629 Ga0501067_0208348
1630 Ga0501067_0345387
1631 Ga0501069_0077838
1632 Ga0501069_0634238
1633 Ga0501070_0037683
1634 Ga0501070_0051589
1635 Ga0501070_0373503
1636 Ga0501072_0018261
1637 Ga0501073_0058214
1638 Ga0501073_0067035
1639 Ga0501074_0013035
1640 Ga0501079_0011330
1641 Ga0501080_0078654
1642 Ga0501083_0000576
1643 Ga0501044_0567080
1644 nmdc:mga08y16_138966_c1
1645 nmdc:mga0n895_1676_c1
1646 nmdc:mga08x19_66461_c1
1647 nmdc:mga0a205_468051_c1
1648 Ga0495601_0013020
1649 Ga0495601_0018667
1650 Ga0495601_0108968
1651 Ga0495601_0137719
1652 Ga0495612_0021958
1653 Ga0495612_0047744
1654 Ga0495612_0179862
1655 Ga0495595_0056434
1656 Ga0495595_0096164
1657 Ga0495595_0604938
1658 Ga0495619_0011810
1659 Ga0495619_0037711
1660 Ga0495619_0191282
1661 Ga0495619_0216313
1662 Ga0495619_1205494
1663 Ga0500566_0051165
1664 Ga0500657_177642
1665 Ga0501082_0304960
1666 Ga0466962_0000600
1667 Ga0466962_0001813
1668 Ga0466962_0002868
1669 Ga0466962_0025185
1670 Ga0466962_0052078
1671 Ga0466962_0081677
1672 Ga0466962_0278524

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

19

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bze-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, k13a mutant 0.9252 12 104
7bzd-assembly1.cif.gz_A-2 structure of bacillus subtilis hxlr, wild type 0.9198 12 104
4hqe-assembly1.cif.gz_A the crystal structure of qsrr-dna complex 0.9093 6 105
5hs9-assembly1.cif.gz_A crystal structure of the quinone-bound yodb from b. subtilis 0.909 12 105
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9057 25 86
ID Description Score Start End Superfamily
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9157 11 101 1.10.10.10
5hs9A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.909 12 105 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9057 25 86 1.10.10.10
5hs7B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8955 8 102 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8933 25 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A522XTI4-F1-model_v4 Transcriptional regulator 0.9614 21 102 GO:0003677
AF-A0A2H5XLK3-F1-model_v4 deleted 0.9521 13 101
AF-A0A256A6T4-F1-model_v4 HTH hxlR-type domain-containing protein 0.9464 13 103 GO:0003677
GO:0005737
GO:0016020
AF-A0A196P6J3-F1-model_v4 Transcriptional regulator 0.946 14 102 GO:0003677
AF-A0A2U1EAD0-F1-model_v4 HxlR family transcriptional regulator 0.9452 13 103 GO:0003677

Map