F482890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 279 | 1672 | 105 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10088775|Ga0265338_100887753 |
| Length | 113 |
| Sequence | MRCRRCSPLPDEVAHAADLVGRRWVLQIIYAASHSGASRFNEFTQVIVGIPPRTLAQRLVELEEVGVLERTVIDARPPRVEYRLTANGARLIGVVDALQIWSTDQAPARPGRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 53 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 54 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 83 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 124 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 125 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 128 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 130 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 133 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 135 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 142 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 146 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 147 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 152 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 162 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 163 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 172 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 173 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 174 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 178 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 179 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 180 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 181 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 182 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 183 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 184 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 185 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 186 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 187 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 191 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 277 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 278 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 1.32 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 8.01 |
| Rhizosphere | 91.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10088775 | 3300028800 | Bacteria | 2564 |
| 2 | Ga0070658_10110130 | 3300005327 | Bacteria | 2280 |
| 3 | Ga0070683_100114394 | 3300005329 | Bacteria | 2546 |
| 4 | Ga0070683_100191944 | 3300005329 | Bacteria | 1940 |
| 5 | Ga0070683_100197479 | 3300005329 | Bacteria | 1910 |
| 6 | Ga0070683_100213829 | 3300005329 | Bacteria | 1832 |
| 7 | Ga0070680_100092123 | 3300005336 | Bacteria | 2509 |
| 8 | Ga0070680_100170741 | 3300005336 | Bacteria | 1830 |
| 9 | Ga0070680_100243111 | 3300005336 | Bacteria | 1521 |
| 10 | Ga0070680_100784053 | 3300005336 | Bacteria | 821 |
| 11 | Ga0070682_100017584 | 3300005337 | Bacteria | 4170 |
| 12 | Ga0070682_100078157 | 3300005337 | Bacteria | 2134 |
| 13 | Ga0070682_100155009 | 3300005337 | Bacteria | 1576 |
| 14 | Ga0068868_101240115 | 3300005338 | Bacteria | 691 |
| 15 | Ga0070660_100016946 | 3300005339 | Bacteria | 5303 |
| 16 | Ga0070660_100046508 | 3300005339 | Bacteria | 3326 |
| 17 | Ga0070660_100110649 | 3300005339 | Bacteria | 2185 |
| 18 | Ga0070660_100198794 | 3300005339 | Bacteria | 1626 |
| 19 | Ga0070660_100238474 | 3300005339 | Bacteria | 1481 |
| 20 | Ga0070660_100721912 | 3300005339 | Bacteria | 836 |
| 21 | Ga0070660_100795725 | 3300005339 | Bacteria | 795 |
| 22 | Ga0070660_101377928 | 3300005339 | Bacteria | 599 |
| 23 | Ga0070661_100095978 | 3300005344 | Bacteria | 2200 |
| 24 | Ga0070661_100142532 | 3300005344 | Bacteria | 1807 |
| 25 | Ga0070661_100203197 | 3300005344 | Bacteria | 1515 |
| 26 | Ga0070692_10694537 | 3300005345 | Bacteria | 684 |
| 27 | Ga0070674_100933334 | 3300005356 | Bacteria | 758 |
| 28 | Ga0070659_100199728 | 3300005366 | Bacteria | 1646 |
| 29 | Ga0070667_100359177 | 3300005367 | Bacteria | 1320 |
| 30 | Ga0070709_10012797 | 3300005434 | Bacteria | 4702 |
| 31 | Ga0070709_10059965 | 3300005434 | Bacteria | 2417 |
| 32 | Ga0070709_10571167 | 3300005434 | Bacteria | 867 |
| 33 | Ga0070714_100034925 | 3300005435 | Bacteria | 4211 |
| 34 | Ga0070714_100063213 | 3300005435 | Bacteria | 3182 |
| 35 | Ga0070714_100095228 | 3300005435 | Bacteria | 2614 |
| 36 | Ga0070714_100151430 | 3300005435 | Bacteria | 2091 |
| 37 | Ga0070714_100168465 | 3300005435 | Bacteria | 1986 |
| 38 | Ga0070714_100176699 | 3300005435 | Bacteria | 1940 |
| 39 | Ga0070714_100230508 | 3300005435 | Bacteria | 1706 |
| 40 | Ga0070714_100336945 | 3300005435 | Bacteria | 1414 |
| 41 | Ga0070714_100352350 | 3300005435 | Bacteria | 1383 |
| 42 | Ga0070714_100436804 | 3300005435 | Bacteria | 1242 |
| 43 | Ga0070714_100442492 | 3300005435 | Bacteria | 1234 |
| 44 | Ga0070714_100625813 | 3300005435 | Bacteria | 1035 |
| 45 | Ga0070714_100802714 | 3300005435 | Bacteria | 911 |
| 46 | Ga0070714_100921048 | 3300005435 | Bacteria | 849 |
| 47 | Ga0070714_101217598 | 3300005435 | Bacteria | 734 |
| 48 | Ga0070714_101603783 | 3300005435 | Bacteria | 636 |
| 49 | Ga0070714_101614243 | 3300005435 | Bacteria | 633 |
| 50 | Ga0070714_101932718 | 3300005435 | Bacteria | 576 |
| 51 | Ga0070713_100025851 | 3300005436 | Bacteria | 4598 |
| 52 | Ga0070713_100312945 | 3300005436 | Bacteria | 1448 |
| 53 | Ga0070713_100363264 | 3300005436 | Bacteria | 1345 |
| 54 | Ga0070713_101930704 | 3300005436 | Bacteria | 573 |
| 55 | Ga0070713_102429511 | 3300005436 | Bacteria | 507 |
| 56 | Ga0070710_10011319 | 3300005437 | Bacteria | 4407 |
| 57 | Ga0070710_10131683 | 3300005437 | Bacteria | 1525 |
| 58 | Ga0070710_10434212 | 3300005437 | Unclassified | 887 |
| 59 | Ga0070711_100095512 | 3300005439 | Bacteria | 2151 |
| 60 | Ga0070711_100171299 | 3300005439 | Bacteria | 1655 |
| 61 | Ga0070711_100398363 | 3300005439 | Bacteria | 1117 |
| 62 | Ga0070711_101344298 | 3300005439 | Bacteria | 621 |
| 63 | Ga0070711_101487111 | 3300005439 | Unclassified | 591 |
| 64 | Ga0070705_100127643 | 3300005440 | Bacteria | 1653 |
| 65 | Ga0070705_100871400 | 3300005440 | Bacteria | 722 |
| 66 | Ga0070694_100619521 | 3300005444 | Bacteria | 873 |
| 67 | Ga0070694_101291571 | 3300005444 | Bacteria | 614 |
| 68 | Ga0070708_100151810 | 3300005445 | Bacteria | 2155 |
| 69 | Ga0070708_100695088 | 3300005445 | Bacteria | 957 |
| 70 | Ga0070708_100810922 | 3300005445 | Bacteria | 880 |
| 71 | Ga0070708_101319930 | 3300005445 | Bacteria | 674 |
| 72 | Ga0070708_101324150 | 3300005445 | Bacteria | 673 |
| 73 | Ga0070708_101405254 | 3300005445 | Bacteria | 651 |
| 74 | Ga0070708_101673635 | 3300005445 | Bacteria | 592 |
| 75 | Ga0070663_100683628 | 3300005455 | Bacteria | 871 |
| 76 | Ga0070678_100365260 | 3300005456 | Bacteria | 1245 |
| 77 | Ga0070662_101341925 | 3300005457 | Bacteria | 616 |
| 78 | Ga0070681_10029010 | 3300005458 | Bacteria | 5556 |
| 79 | Ga0070681_10038474 | 3300005458 | Bacteria | 4797 |
| 80 | Ga0070681_10067920 | 3300005458 | Bacteria | 3532 |
| 81 | Ga0070681_10142211 | 3300005458 | Bacteria | 2329 |
| 82 | Ga0070681_10178328 | 3300005458 | Bacteria | 2046 |
| 83 | Ga0070681_10210846 | 3300005458 | Bacteria | 1859 |
| 84 | Ga0070681_10323960 | 3300005458 | Bacteria | 1450 |
| 85 | Ga0070681_10328144 | 3300005458 | Bacteria | 1440 |
| 86 | Ga0070681_10444799 | 3300005458 | Bacteria | 1208 |
| 87 | Ga0070681_10620908 | 3300005458 | Bacteria | 995 |
| 88 | Ga0070681_10882177 | 3300005458 | Bacteria | 813 |
| 89 | Ga0070681_11478947 | 3300005458 | Bacteria | 604 |
| 90 | Ga0070706_100039423 | 3300005467 | Bacteria | 4361 |
| 91 | Ga0070706_100131903 | 3300005467 | Bacteria | 2332 |
| 92 | Ga0070706_100637351 | 3300005467 | Bacteria | 989 |
| 93 | Ga0070706_100932559 | 3300005467 | Bacteria | 801 |
| 94 | Ga0070707_100000441 | 3300005468 | Bacteria | 41190 |
| 95 | Ga0070707_100008363 | 3300005468 | Bacteria | 9607 |
| 96 | Ga0070707_100788672 | 3300005468 | Bacteria | 914 |
| 97 | Ga0070698_100069724 | 3300005471 | Bacteria | 3528 |
| 98 | Ga0070698_100285768 | 3300005471 | Bacteria | 1581 |
| 99 | Ga0070698_100307235 | 3300005471 | Bacteria | 1517 |
| 100 | Ga0070698_100599884 | 3300005471 | Unclassified | 1041 |
| 101 | Ga0070698_100652479 | 3300005471 | Bacteria | 993 |
| 102 | Ga0070699_100041932 | 3300005518 | Bacteria | 3960 |
| 103 | Ga0070699_100344624 | 3300005518 | Bacteria | 1341 |
| 104 | Ga0070699_101005141 | 3300005518 | Bacteria | 765 |
| 105 | Ga0070699_101147231 | 3300005518 | Bacteria | 713 |
| 106 | Ga0070699_101179069 | 3300005518 | Bacteria | 703 |
| 107 | Ga0070699_101834349 | 3300005518 | Bacteria | 555 |
| 108 | Ga0070679_100019782 | 3300005530 | Bacteria | 6554 |
| 109 | Ga0070679_100094255 | 3300005530 | Bacteria | 2980 |
| 110 | Ga0070679_100141314 | 3300005530 | Bacteria | 2387 |
| 111 | Ga0070679_100165784 | 3300005530 | Bacteria | 2183 |
| 112 | Ga0070679_100206505 | 3300005530 | Bacteria | 1929 |
| 113 | Ga0070679_100216922 | 3300005530 | Bacteria | 1875 |
| 114 | Ga0070679_100327030 | 3300005530 | Bacteria | 1482 |
| 115 | Ga0070679_100778800 | 3300005530 | Bacteria | 900 |
| 116 | Ga0070684_100165660 | 3300005535 | Bacteria | 2006 |
| 117 | Ga0070684_100818678 | 3300005535 | Bacteria | 871 |
| 118 | Ga0070684_101536341 | 3300005535 | Bacteria | 628 |
| 119 | Ga0070697_100363044 | 3300005536 | Bacteria | 1252 |
| 120 | Ga0070697_101498480 | 3300005536 | Bacteria | 603 |
| 121 | Ga0070697_101940437 | 3300005536 | Bacteria | 527 |
| 122 | Ga0068853_100453815 | 3300005539 | Bacteria | 1206 |
| 123 | Ga0068853_102435219 | 3300005539 | Bacteria | 507 |
| 124 | Ga0070695_100000005 | 3300005545 | Bacteria | 97484 |
| 125 | Ga0070695_101872971 | 3300005545 | Bacteria | 504 |
| 126 | Ga0070696_101479494 | 3300005546 | Unclassified | 581 |
| 127 | Ga0070693_100113615 | 3300005547 | Bacteria | 1670 |
| 128 | Ga0070693_100311372 | 3300005547 | Bacteria | 1065 |
| 129 | Ga0070704_102083735 | 3300005549 | Unclassified | 527 |
| 130 | Ga0068855_100115927 | 3300005563 | Bacteria | 3070 |
| 131 | Ga0068855_100601691 | 3300005563 | Bacteria | 1185 |
| 132 | Ga0068855_101818330 | 3300005563 | Bacteria | 619 |
| 133 | Ga0070664_100521248 | 3300005564 | Bacteria | 1097 |
| 134 | Ga0070664_101993341 | 3300005564 | Bacteria | 551 |
| 135 | Ga0068857_102364261 | 3300005577 | Unclassified | 522 |
| 136 | Ga0068854_101819459 | 3300005578 | Bacteria | 559 |
| 137 | Ga0068856_100034191 | 3300005614 | Bacteria | 4979 |
| 138 | Ga0068856_100105784 | 3300005614 | Bacteria | 2808 |
| 139 | Ga0068856_100241933 | 3300005614 | Bacteria | 1820 |
| 140 | Ga0068856_100319082 | 3300005614 | Bacteria | 1571 |
| 141 | Ga0068856_101295325 | 3300005614 | Bacteria | 744 |
| 142 | Ga0068856_101986718 | 3300005614 | Unclassified | 592 |
| 143 | Ga0070702_101783009 | 3300005615 | Unclassified | 514 |
| 144 | Ga0070717_10003490 | 3300006028 | Bacteria | 11255 |
| 145 | Ga0070717_10009086 | 3300006028 | Bacteria | 7462 |
| 146 | Ga0070717_10010124 | 3300006028 | Bacteria | 7099 |
| 147 | Ga0070717_10018995 | 3300006028 | Bacteria | 5382 |
| 148 | Ga0070717_10023944 | 3300006028 | Bacteria | 4844 |
| 149 | Ga0070717_11040412 | 3300006028 | Bacteria | 746 |
| 150 | Ga0070717_11439119 | 3300006028 | Bacteria | 626 |
| 151 | Ga0070715_10002925 | 3300006163 | Bacteria | 5335 |
| 152 | Ga0070716_100003114 | 3300006173 | Bacteria | 7748 |
| 153 | Ga0070716_101266223 | 3300006173 | Bacteria | 595 |
| 154 | Ga0070712_100093194 | 3300006175 | Bacteria | 2211 |
| 155 | Ga0070712_100522054 | 3300006175 | Bacteria | 998 |
| 156 | Ga0070712_100986329 | 3300006175 | Bacteria | 729 |
| 157 | Ga0068871_101266838 | 3300006358 | Bacteria | 693 |
| 158 | Ga0075431_100286588 | 3300006847 | Bacteria | 1667 |
| 159 | Ga0075433_11378457 | 3300006852 | Bacteria | 610 |
| 160 | Ga0068865_101585680 | 3300006881 | Bacteria | 588 |
| 161 | Ga0075436_100078580 | 3300006914 | Bacteria | 2286 |
| 162 | Ga0075436_100326519 | 3300006914 | Bacteria | 1103 |
| 163 | Ga0075435_101067483 | 3300007076 | Bacteria | 706 |
| 164 | Ga0099794_10152949 | 3300007265 | Bacteria | 1171 |
| 165 | Ga0105251_10260024 | 3300009011 | Bacteria | 783 |
| 166 | Ga0105244_10280068 | 3300009036 | Bacteria | 774 |
| 167 | Ga0105240_10068476 | 3300009093 | Bacteria | 4395 |
| 168 | Ga0105240_10343779 | 3300009093 | Bacteria | 1694 |
| 169 | Ga0105240_10463202 | 3300009093 | Bacteria | 1416 |
| 170 | Ga0105240_10860212 | 3300009093 | Bacteria | 978 |
| 171 | Ga0111539_10705619 | 3300009094 | Bacteria | 1174 |
| 172 | Ga0105245_10095149 | 3300009098 | Bacteria | 2747 |
| 173 | Ga0105245_12808556 | 3300009098 | Bacteria | 540 |
| 174 | Ga0105247_10318638 | 3300009101 | Bacteria | 1084 |
| 175 | Ga0105241_10425701 | 3300009174 | Bacteria | 1169 |
| 176 | Ga0105241_10635277 | 3300009174 | Bacteria | 968 |
| 177 | Ga0105241_10638703 | 3300009174 | Bacteria | 966 |
| 178 | Ga0105242_10218700 | 3300009176 | Bacteria | 1701 |
| 179 | Ga0105248_13023167 | 3300009177 | Bacteria | 536 |
| 180 | Ga0105237_10765828 | 3300009545 | Bacteria | 972 |
| 181 | Ga0105237_11460098 | 3300009545 | Bacteria | 690 |
| 182 | Ga0105238_10190608 | 3300009551 | Bacteria | 2026 |
| 183 | Ga0105238_10646122 | 3300009551 | Bacteria | 1068 |
| 184 | Ga0105238_11237850 | 3300009551 | Bacteria | 771 |
| 185 | Ga0105249_12631836 | 3300009553 | Bacteria | 575 |
| 186 | Ga0105239_11546027 | 3300010375 | Bacteria | 767 |
| 187 | Ga0105239_12080474 | 3300010375 | Bacteria | 659 |
| 188 | Ga0105239_13166758 | 3300010375 | Bacteria | 536 |
| 189 | Ga0157371_10098212 | 3300013102 | Bacteria | 2076 |
| 190 | Ga0157370_10030952 | 3300013104 | Bacteria | 5241 |
| 191 | Ga0157370_10032439 | 3300013104 | Bacteria | 5101 |
| 192 | Ga0157370_10930696 | 3300013104 | Bacteria | 788 |
| 193 | Ga0157369_10005310 | 3300013105 | Bacteria | 15015 |
| 194 | Ga0157369_10055843 | 3300013105 | Bacteria | 4262 |
| 195 | Ga0157369_10060388 | 3300013105 | Bacteria | 4088 |
| 196 | Ga0157369_10589353 | 3300013105 | Bacteria | 1148 |
| 197 | Ga0157369_10737767 | 3300013105 | Bacteria | 1014 |
| 198 | Ga0157369_10844256 | 3300013105 | Bacteria | 940 |
| 199 | Ga0157369_11424561 | 3300013105 | Bacteria | 705 |
| 200 | Ga0157374_10062661 | 3300013296 | Bacteria | 3486 |
| 201 | Ga0157374_10521287 | 3300013296 | Bacteria | 1194 |
| 202 | Ga0163162_11007731 | 3300013306 | Bacteria | 942 |
| 203 | Ga0157372_10324865 | 3300013307 | Bacteria | 1791 |
| 204 | Ga0157372_10415359 | 3300013307 | Bacteria | 1568 |
| 205 | Ga0157372_10845511 | 3300013307 | Bacteria | 1062 |
| 206 | Ga0157372_11025496 | 3300013307 | Bacteria | 955 |
| 207 | Ga0157372_11621058 | 3300013307 | Bacteria | 745 |
| 208 | Ga0157372_11994478 | 3300013307 | Bacteria | 667 |
| 209 | Ga0157372_13040708 | 3300013307 | Unclassified | 536 |
| 210 | Ga0157375_12195108 | 3300013308 | Bacteria | 658 |
| 211 | Ga0163163_10220187 | 3300014325 | Bacteria | 1947 |
| 212 | Ga0182008_10026892 | 3300014497 | Bacteria | 2916 |
| 213 | Ga0182008_10067443 | 3300014497 | Bacteria | 1760 |
| 214 | Ga0182008_10084534 | 3300014497 | Bacteria | 1563 |
| 215 | Ga0182008_10176996 | 3300014497 | Bacteria | 1078 |
| 216 | Ga0157379_10983604 | 3300014968 | Bacteria | 804 |
| 217 | Ga0182006_1147036 | 3300015261 | Bacteria | 801 |
| 218 | Ga0182005_1042110 | 3300015265 | Bacteria | 1241 |
| 219 | Ga0206356_10081141 | 3300020070 | Bacteria | 3494 |
| 220 | Ga0206356_11407641 | 3300020070 | Bacteria | 1957 |
| 221 | Ga0206354_10889251 | 3300020081 | Bacteria | 2909 |
| 222 | Ga0206354_10939662 | 3300020081 | Bacteria | 1456 |
| 223 | Ga0206353_11095863 | 3300020082 | Bacteria | 1729 |
| 224 | Ga0206353_11266715 | 3300020082 | Bacteria | 644 |
| 225 | Ga0206353_11931666 | 3300020082 | Bacteria | 2703 |
| 226 | Ga0206353_12038425 | 3300020082 | Bacteria | 1867 |
| 227 | Ga0213871_10094165 | 3300021441 | Bacteria | 871 |
| 228 | Ga0224712_10007888 | 3300022467 | Bacteria | 3121 |
| 229 | Ga0224712_10010076 | 3300022467 | Bacteria | 2874 |
| 230 | Ga0224712_10032792 | 3300022467 | Bacteria | 1896 |
| 231 | Ga0207692_10012830 | 3300025898 | Bacteria | 3613 |
| 232 | Ga0207692_10057104 | 3300025898 | Bacteria | 2005 |
| 233 | Ga0207692_10689477 | 3300025898 | Bacteria | 662 |
| 234 | Ga0207692_11063344 | 3300025898 | Bacteria | 535 |
| 235 | Ga0207692_11166398 | 3300025898 | Bacteria | 511 |
| 236 | Ga0207710_10103294 | 3300025900 | Bacteria | 1347 |
| 237 | Ga0207685_10034599 | 3300025905 | Bacteria | 1837 |
| 238 | Ga0207699_10008519 | 3300025906 | Bacteria | 5068 |
| 239 | Ga0207699_10074107 | 3300025906 | Bacteria | 2090 |
| 240 | Ga0207699_10343596 | 3300025906 | Bacteria | 1052 |
| 241 | Ga0207699_11234192 | 3300025906 | Bacteria | 553 |
| 242 | Ga0207705_10127391 | 3300025909 | Bacteria | 1893 |
| 243 | Ga0207705_10134122 | 3300025909 | Bacteria | 1845 |
| 244 | Ga0207705_10624982 | 3300025909 | Bacteria | 838 |
| 245 | Ga0207705_10803325 | 3300025909 | Bacteria | 730 |
| 246 | Ga0207705_11309990 | 3300025909 | Bacteria | 553 |
| 247 | Ga0207684_10034486 | 3300025910 | Bacteria | 4300 |
| 248 | Ga0207684_10502579 | 3300025910 | Bacteria | 1039 |
| 249 | Ga0207684_11035254 | 3300025910 | Bacteria | 685 |
| 250 | Ga0207654_10621316 | 3300025911 | Bacteria | 772 |
| 251 | Ga0207654_10651867 | 3300025911 | Bacteria | 754 |
| 252 | Ga0207707_10029444 | 3300025912 | Bacteria | 4800 |
| 253 | Ga0207707_10079072 | 3300025912 | Bacteria | 2872 |
| 254 | Ga0207707_10149398 | 3300025912 | Bacteria | 2043 |
| 255 | Ga0207707_10200294 | 3300025912 | Bacteria | 1741 |
| 256 | Ga0207707_10317286 | 3300025912 | Bacteria | 1346 |
| 257 | Ga0207707_10366719 | 3300025912 | Bacteria | 1239 |
| 258 | Ga0207707_10482079 | 3300025912 | Bacteria | 1059 |
| 259 | Ga0207707_10602676 | 3300025912 | Bacteria | 930 |
| 260 | Ga0207695_10037785 | 3300025913 | Bacteria | 5207 |
| 261 | Ga0207695_11369134 | 3300025913 | Unclassified | 588 |
| 262 | Ga0207693_10001187 | 3300025915 | Bacteria | 23272 |
| 263 | Ga0207693_10012498 | 3300025915 | Bacteria | 6857 |
| 264 | Ga0207693_10117503 | 3300025915 | Bacteria | 2088 |
| 265 | Ga0207693_10226626 | 3300025915 | Bacteria | 1468 |
| 266 | Ga0207693_10434236 | 3300025915 | Bacteria | 1026 |
| 267 | Ga0207693_10988249 | 3300025915 | Unclassified | 643 |
| 268 | Ga0207693_11057359 | 3300025915 | Bacteria | 618 |
| 269 | Ga0207693_11123783 | 3300025915 | Bacteria | 596 |
| 270 | Ga0207663_10080778 | 3300025916 | Bacteria | 2127 |
| 271 | Ga0207663_10429328 | 3300025916 | Bacteria | 1016 |
| 272 | Ga0207663_10451602 | 3300025916 | Bacteria | 991 |
| 273 | Ga0207663_10457611 | 3300025916 | Bacteria | 985 |
| 274 | Ga0207660_10013044 | 3300025917 | Bacteria | 5442 |
| 275 | Ga0207660_10469867 | 3300025917 | Bacteria | 1018 |
| 276 | Ga0207660_10651383 | 3300025917 | Bacteria | 859 |
| 277 | Ga0207660_11696001 | 3300025917 | Unclassified | 508 |
| 278 | Ga0207662_11331123 | 3300025918 | Bacteria | 510 |
| 279 | Ga0207657_10026118 | 3300025919 | Bacteria | 5372 |
| 280 | Ga0207657_10102594 | 3300025919 | Bacteria | 2372 |
| 281 | Ga0207657_10233784 | 3300025919 | Bacteria | 1469 |
| 282 | Ga0207657_10244459 | 3300025919 | Bacteria | 1432 |
| 283 | Ga0207657_10345115 | 3300025919 | Bacteria | 1175 |
| 284 | Ga0207657_10840713 | 3300025919 | Bacteria | 709 |
| 285 | Ga0207649_10160888 | 3300025920 | Bacteria | 1555 |
| 286 | Ga0207652_10046072 | 3300025921 | Bacteria | 3719 |
| 287 | Ga0207652_10074559 | 3300025921 | Bacteria | 2955 |
| 288 | Ga0207652_10099081 | 3300025921 | Bacteria | 2571 |
| 289 | Ga0207652_10117179 | 3300025921 | Bacteria | 2366 |
| 290 | Ga0207652_10158009 | 3300025921 | Bacteria | 2031 |
| 291 | Ga0207652_10410621 | 3300025921 | Bacteria | 1221 |
| 292 | Ga0207652_10514381 | 3300025921 | Bacteria | 1077 |
| 293 | Ga0207652_10566361 | 3300025921 | Bacteria | 1020 |
| 294 | Ga0207652_11053056 | 3300025921 | Bacteria | 713 |
| 295 | Ga0207652_11088442 | 3300025921 | Bacteria | 700 |
| 296 | Ga0207652_11460999 | 3300025921 | Bacteria | 587 |
| 297 | Ga0207646_10001597 | 3300025922 | Bacteria | 27663 |
| 298 | Ga0207694_11374866 | 3300025924 | Bacteria | 597 |
| 299 | Ga0207694_11491845 | 3300025924 | Bacteria | 571 |
| 300 | Ga0207700_10090757 | 3300025928 | Bacteria | 2412 |
| 301 | Ga0207700_10265700 | 3300025928 | Bacteria | 1471 |
| 302 | Ga0207700_10295143 | 3300025928 | Bacteria | 1398 |
| 303 | Ga0207700_10829426 | 3300025928 | Bacteria | 827 |
| 304 | Ga0207700_10830660 | 3300025928 | Bacteria | 827 |
| 305 | Ga0207664_10006165 | 3300025929 | Bacteria | 8223 |
| 306 | Ga0207664_10006213 | 3300025929 | Bacteria | 8203 |
| 307 | Ga0207664_10016767 | 3300025929 | Bacteria | 5352 |
| 308 | Ga0207664_10028936 | 3300025929 | Bacteria | 4217 |
| 309 | Ga0207664_10149942 | 3300025929 | Bacteria | 1980 |
| 310 | Ga0207664_10186495 | 3300025929 | Bacteria | 1784 |
| 311 | Ga0207664_10275574 | 3300025929 | Bacteria | 1475 |
| 312 | Ga0207664_10359393 | 3300025929 | Bacteria | 1290 |
| 313 | Ga0207664_10379586 | 3300025929 | Bacteria | 1255 |
| 314 | Ga0207664_10427776 | 3300025929 | Bacteria | 1180 |
| 315 | Ga0207664_10612251 | 3300025929 | Bacteria | 978 |
| 316 | Ga0207664_10723154 | 3300025929 | Bacteria | 895 |
| 317 | Ga0207664_10793518 | 3300025929 | Bacteria | 852 |
| 318 | Ga0207690_10395457 | 3300025932 | Bacteria | 1101 |
| 319 | Ga0207706_10931825 | 3300025933 | Bacteria | 732 |
| 320 | Ga0207686_10984417 | 3300025934 | Bacteria | 684 |
| 321 | Ga0207665_10000058 | 3300025939 | Bacteria | 72882 |
| 322 | Ga0207665_10032871 | 3300025939 | Bacteria | 3435 |
| 323 | Ga0207665_10239935 | 3300025939 | Bacteria | 1335 |
| 324 | Ga0207665_11402783 | 3300025939 | Bacteria | 556 |
| 325 | Ga0207711_10542256 | 3300025941 | Bacteria | 1085 |
| 326 | Ga0207711_12026139 | 3300025941 | Bacteria | 518 |
| 327 | Ga0207661_10013337 | 3300025944 | Bacteria | 6003 |
| 328 | Ga0207661_10043491 | 3300025944 | Bacteria | 3545 |
| 329 | Ga0207661_10357139 | 3300025944 | Bacteria | 1319 |
| 330 | Ga0207661_10415553 | 3300025944 | Bacteria | 1221 |
| 331 | Ga0207679_10623723 | 3300025945 | Bacteria | 973 |
| 332 | Ga0207679_11517636 | 3300025945 | Bacteria | 614 |
| 333 | Ga0207667_10267320 | 3300025949 | Unclassified | 1748 |
| 334 | Ga0207667_10358667 | 3300025949 | Bacteria | 1487 |
| 335 | Ga0207667_10379678 | 3300025949 | Bacteria | 1440 |
| 336 | Ga0207667_10628149 | 3300025949 | Bacteria | 1081 |
| 337 | Ga0207667_10699886 | 3300025949 | Bacteria | 1016 |
| 338 | Ga0207667_11564708 | 3300025949 | Bacteria | 629 |
| 339 | Ga0207640_10552644 | 3300025981 | Bacteria | 967 |
| 340 | Ga0207640_12126129 | 3300025981 | Bacteria | 509 |
| 341 | Ga0207658_10308758 | 3300025986 | Bacteria | 1365 |
| 342 | Ga0207677_11157105 | 3300026023 | Bacteria | 707 |
| 343 | Ga0207678_10210673 | 3300026067 | Bacteria | 1662 |
| 344 | Ga0207702_10171687 | 3300026078 | Bacteria | 1989 |
| 345 | Ga0207702_10295377 | 3300026078 | Bacteria | 1536 |
| 346 | Ga0207702_10307601 | 3300026078 | Bacteria | 1506 |
| 347 | Ga0207702_10471847 | 3300026078 | Bacteria | 1220 |
| 348 | Ga0207702_11706308 | 3300026078 | Bacteria | 623 |
| 349 | Ga0207641_11465967 | 3300026088 | Bacteria | 684 |
| 350 | Ga0207674_10105204 | 3300026116 | Bacteria | 2801 |
| 351 | Ga0207683_10178496 | 3300026121 | Bacteria | 1925 |
| 352 | Ga0207698_10699438 | 3300026142 | Unclassified | 1008 |
| 353 | Ga0268266_11022330 | 3300028379 | Bacteria | 800 |
| 354 | Ga0265337_1077593 | 3300028556 | Bacteria | 910 |
| 355 | Ga0265326_10029888 | 3300028558 | Bacteria | 1552 |
| 356 | Ga0265326_10056070 | 3300028558 | Bacteria | 1115 |
| 357 | Ga0265326_10182952 | 3300028558 | Bacteria | 601 |
| 358 | Ga0265319_1006086 | 3300028563 | Bacteria | 5652 |
| 359 | Ga0265319_1015560 | 3300028563 | Bacteria | 2946 |
| 360 | Ga0265319_1054021 | 3300028563 | Bacteria | 1318 |
| 361 | Ga0265334_10001373 | 3300028573 | Bacteria | 11729 |
| 362 | Ga0265334_10041503 | 3300028573 | Bacteria | 1798 |
| 363 | Ga0265334_10343968 | 3300028573 | Bacteria | 510 |
| 364 | Ga0265318_10000445 | 3300028577 | Bacteria | 31168 |
| 365 | Ga0265318_10022330 | 3300028577 | Bacteria | 2531 |
| 366 | Ga0265318_10131928 | 3300028577 | Bacteria | 918 |
| 367 | Ga0265318_10173927 | 3300028577 | Bacteria | 789 |
| 368 | Ga0265322_10017548 | 3300028654 | Bacteria | 2060 |
| 369 | Ga0265322_10018713 | 3300028654 | Bacteria | 1990 |
| 370 | Ga0265322_10139951 | 3300028654 | Bacteria | 691 |
| 371 | Ga0265336_10022376 | 3300028666 | Bacteria | 2012 |
| 372 | Ga0265336_10067211 | 3300028666 | Bacteria | 1072 |
| 373 | Ga0265336_10208154 | 3300028666 | Bacteria | 581 |
| 374 | Ga0265338_10005247 | 3300028800 | Bacteria | 16991 |
| 375 | Ga0265338_10012217 | 3300028800 | Bacteria | 9808 |
| 376 | Ga0265338_10054285 | 3300028800 | Bacteria | 3575 |
| 377 | Ga0265338_10949954 | 3300028800 | Bacteria | 583 |
| 378 | Ga0265338_11178258 | 3300028800 | Bacteria | 514 |
| 379 | Ga0265324_10017637 | 3300029957 | Bacteria | 2595 |
| 380 | Ga0265324_10064889 | 3300029957 | Bacteria | 1246 |
| 381 | Ga0265324_10268394 | 3300029957 | Bacteria | 580 |
| 382 | Ga0265330_10000848 | 3300031235 | Bacteria | 19175 |
| 383 | Ga0265330_10080129 | 3300031235 | Bacteria | 1407 |
| 384 | Ga0265330_10352814 | 3300031235 | Bacteria | 621 |
| 385 | Ga0265332_10022081 | 3300031238 | Bacteria | 2808 |
| 386 | Ga0265332_10083172 | 3300031238 | Bacteria | 1357 |
| 387 | Ga0265328_10020190 | 3300031239 | Bacteria | 2552 |
| 388 | Ga0265328_10176962 | 3300031239 | Bacteria | 806 |
| 389 | Ga0265320_10029937 | 3300031240 | Bacteria | 2813 |
| 390 | Ga0265320_10354939 | 3300031240 | Bacteria | 648 |
| 391 | Ga0265325_10002030 | 3300031241 | Bacteria | 13911 |
| 392 | Ga0265325_10010380 | 3300031241 | Bacteria | 5397 |
| 393 | Ga0265325_10276341 | 3300031241 | Bacteria | 754 |
| 394 | Ga0265329_10011823 | 3300031242 | Bacteria | 3161 |
| 395 | Ga0265329_10300107 | 3300031242 | Unclassified | 543 |
| 396 | Ga0265340_10011912 | 3300031247 | Bacteria | 4605 |
| 397 | Ga0265339_10007564 | 3300031249 | Bacteria | 7001 |
| 398 | Ga0265339_10030343 | 3300031249 | Bacteria | 3061 |
| 399 | Ga0265331_10000672 | 3300031250 | Bacteria | 29378 |
| 400 | Ga0265327_10005507 | 3300031251 | Bacteria | 10528 |
| 401 | Ga0265327_10064446 | 3300031251 | Bacteria | 1856 |
| 402 | Ga0265327_10292339 | 3300031251 | Bacteria | 718 |
| 403 | Ga0265316_10012345 | 3300031344 | Bacteria | 7666 |
| 404 | Ga0265316_10063567 | 3300031344 | Bacteria | 2861 |
| 405 | Ga0265316_10259669 | 3300031344 | Bacteria | 1274 |
| 406 | Ga0265316_10500916 | 3300031344 | Bacteria | 867 |
| 407 | Ga0265316_11159953 | 3300031344 | Bacteria | 535 |
| 408 | Ga0265313_10001111 | 3300031595 | Bacteria | 25728 |
| 409 | Ga0265313_10012231 | 3300031595 | Bacteria | 5256 |
| 410 | Ga0265314_10005359 | 3300031711 | Bacteria | 11592 |
| 411 | Ga0265314_10008168 | 3300031711 | Bacteria | 9003 |
| 412 | Ga0265314_10060908 | 3300031711 | Bacteria | 2573 |
| 413 | Ga0265342_10019007 | 3300031712 | Bacteria | 4436 |
| 414 | Ga0265342_10552246 | 3300031712 | Bacteria | 584 |
| 415 | Ga0307407_10010933 | 3300031903 | Bacteria | 4300 |
| 416 | Ga0316583_10040598 | 3300032133 | Bacteria | 1648 |
| 417 | Ga0373926_0056595 | 3300035083 | Bacteria | 1423 |
| 418 | Ga0373940_0063553 | 3300035088 | Bacteria | 1061 |
| 419 | Ga0373944_0004379 | 3300035089 | Bacteria | 3675 |
| 420 | Ga0373923_0056394 | 3300035111 | Bacteria | 1659 |
| 421 | Ga0373945_0006378 | 3300035116 | Bacteria | 3805 |
| 422 | Ga0373953_0148036 | 3300035117 | Bacteria | 1006 |
| 423 | Ga0373954_0393033 | 3300035118 | Bacteria | 686 |
| 424 | Ga0373956_0069795 | 3300035119 | Bacteria | 1602 |
| 425 | Ga0373956_0479841 | 3300035119 | Bacteria | 593 |
| 426 | Ga0373957_0332505 | 3300035120 | Bacteria | 647 |
| 427 | Ga0373943_0001502 | 3300035170 | Bacteria | 10554 |
| 428 | Ga0373946_0007649 | 3300035171 | Bacteria | 3959 |
| 429 | Ga0373942_0098359 | 3300035207 | Bacteria | 891 |
| 430 | Ga0373924_0047791 | 3300035410 | Bacteria | 1766 |
| 431 | Ga0373924_0363138 | 3300035410 | Bacteria | 646 |
| 432 | Ga0373931_0015830 | 3300035691 | Bacteria | 3703 |
| 433 | Ga0373935_0115286 | 3300035692 | Bacteria | 1789 |
| 434 | Ga0373927_0006226 | 3300035695 | Bacteria | 8146 |
| 435 | Ga0373933_0049201 | 3300035724 | Bacteria | 2513 |
| 436 | Ga0373933_0156228 | 3300035724 | Bacteria | 1447 |
| 437 | Ga0373933_0624684 | 3300035724 | Unclassified | 708 |
| 438 | Ga0373947_0000205 | 3300035725 | Bacteria | 32976 |
| 439 | Ga0373937_0001260 | 3300036401 | Bacteria | 21239 |
| 440 | Ga0373937_0099169 | 3300036401 | Bacteria | 2702 |
| 441 | Ga0373937_1340066 | 3300036401 | Bacteria | 664 |
| 442 | Ga0373925_0000604 | 3300037068 | Bacteria | 34210 |
| 443 | Ga0395899_0028938 | 3300037312 | Bacteria | 4169 |
| 444 | Ga0395899_0765033 | 3300037312 | Bacteria | 600 |
| 445 | Ga0395899_0874161 | 3300037312 | Bacteria | 550 |
| 446 | Ga0395900_0277671 | 3300037418 | Bacteria | 1668 |
| 447 | Ga0395900_0568823 | 3300037418 | Bacteria | 1076 |
| 448 | Ga0395900_0687863 | 3300037418 | Bacteria | 957 |
| 449 | Ga0395900_0790608 | 3300037418 | Bacteria | 877 |
| 450 | Ga0395900_1565799 | 3300037418 | Bacteria | 571 |
| 451 | Ga0395900_1672757 | 3300037418 | Unclassified | 547 |
| 452 | Ga0395898_0015109 | 3300037466 | Bacteria | 7925 |
| 453 | Ga0395898_0036162 | 3300037466 | Bacteria | 4905 |
| 454 | Ga0395898_0096550 | 3300037466 | Bacteria | 2839 |
| 455 | Ga0395898_0100823 | 3300037466 | Bacteria | 2773 |
| 456 | Ga0395898_0269006 | 3300037466 | Bacteria | 1625 |
| 457 | Ga0395898_0558757 | 3300037466 | Bacteria | 1087 |
| 458 | Ga0395898_1386555 | 3300037466 | Bacteria | 631 |
| 459 | Ga0395905_0041141 | 3300037471 | Bacteria | 4336 |
| 460 | Ga0395905_0344636 | 3300037471 | Bacteria | 1381 |
| 461 | Ga0395905_0665010 | 3300037471 | Bacteria | 944 |
| 462 | Ga0395901_0018078 | 3300038443 | Bacteria | 7195 |
| 463 | Ga0395901_0135019 | 3300038443 | Bacteria | 2593 |
| 464 | Ga0395901_0322376 | 3300038443 | Bacteria | 1598 |
| 465 | Ga0395901_0577064 | 3300038443 | Bacteria | 1137 |
| 466 | Ga0395901_0900131 | 3300038443 | Bacteria | 867 |
| 467 | Ga0436365_1007593 | 3300039437 | Bacteria | 544 |
| 468 | Ga0436360_0811625 | 3300039438 | Bacteria | 4098 |
| 469 | Ga0436360_1150404 | 3300039438 | Bacteria | 2476 |
| 470 | Ga0436363_0341490 | 3300039450 | Bacteria | 650 |
| 471 | Ga0439448_0137390 | 3300042005 | Bacteria | 845 |
| 472 | Ga0466969_0000355 | 3300044656 | Bacteria | 25185 |
| 473 | Ga0466972_0025573 | 3300044658 | Bacteria | 2925 |
| 474 | Ga0466972_0285894 | 3300044658 | Bacteria | 771 |
| 475 | Ga0466965_0134583 | 3300044683 | Bacteria | 1283 |
| 476 | Ga0466965_0210503 | 3300044683 | Bacteria | 1034 |
| 477 | Ga0466966_0562047 | 3300044684 | Unclassified | 686 |
| 478 | Ga0466961_0022159 | 3300044693 | Bacteria | 4087 |
| 479 | Ga0466961_0032460 | 3300044693 | Bacteria | 3355 |
| 480 | Ga0466961_0071190 | 3300044693 | Bacteria | 2207 |
| 481 | Ga0466961_0526187 | 3300044693 | Bacteria | 713 |
| 482 | Ga0466961_0768929 | 3300044693 | Bacteria | 575 |
| 483 | Ga0466963_0000681 | 3300044694 | Bacteria | 16505 |
| 484 | Ga0466963_0003498 | 3300044694 | Bacteria | 9014 |
| 485 | Ga0466963_0006622 | 3300044694 | Bacteria | 6873 |
| 486 | Ga0466963_0008446 | 3300044694 | Bacteria | 6171 |
| 487 | Ga0466963_0012574 | 3300044694 | Bacteria | 5185 |
| 488 | Ga0466963_0013056 | 3300044694 | Bacteria | 5093 |
| 489 | Ga0466963_0016805 | 3300044694 | Bacteria | 4554 |
| 490 | Ga0466963_0027798 | 3300044694 | Bacteria | 3626 |
| 491 | Ga0466963_0029203 | 3300044694 | Bacteria | 3547 |
| 492 | Ga0466963_0040197 | 3300044694 | Bacteria | 3065 |
| 493 | Ga0466963_0063100 | 3300044694 | Bacteria | 2479 |
| 494 | Ga0466963_0064023 | 3300044694 | Bacteria | 2462 |
| 495 | Ga0466963_0102972 | 3300044694 | Bacteria | 1955 |
| 496 | Ga0466963_0168839 | 3300044694 | Bacteria | 1524 |
| 497 | Ga0466963_0191919 | 3300044694 | Bacteria | 1427 |
| 498 | Ga0466963_0197925 | 3300044694 | Bacteria | 1405 |
| 499 | Ga0466963_0463265 | 3300044694 | Bacteria | 894 |
| 500 | Ga0466964_0007474 | 3300044706 | Bacteria | 4089 |
| 501 | Ga0466964_0011008 | 3300044706 | Bacteria | 3417 |
| 502 | Ga0466964_0011587 | 3300044706 | Bacteria | 3332 |
| 503 | Ga0466964_0027489 | 3300044706 | Bacteria | 2234 |
| 504 | Ga0466964_0040009 | 3300044706 | Bacteria | 1891 |
| 505 | Ga0466964_0177589 | 3300044706 | Bacteria | 1007 |
| 506 | Ga0466964_0210240 | 3300044706 | Bacteria | 939 |
| 507 | Ga0466964_0542382 | 3300044706 | Bacteria | 630 |
| 508 | Ga0466971_0000871 | 3300044719 | Bacteria | 12335 |
| 509 | Ga0466971_0008263 | 3300044719 | Bacteria | 4539 |
| 510 | Ga0466971_0027045 | 3300044719 | Bacteria | 2568 |
| 511 | Ga0466971_0064017 | 3300044719 | Bacteria | 1665 |
| 512 | Ga0466971_0065501 | 3300044719 | Bacteria | 1645 |
| 513 | Ga0466971_0144480 | 3300044719 | Bacteria | 1109 |
| 514 | Ga0466971_0272952 | 3300044719 | Bacteria | 808 |
| 515 | Ga0466971_0344814 | 3300044719 | Bacteria | 720 |
| 516 | Ga0466968_0000558 | 3300044735 | Bacteria | 12664 |
| 517 | Ga0466968_0001940 | 3300044735 | Bacteria | 7493 |
| 518 | Ga0466968_0010694 | 3300044735 | Bacteria | 3564 |
| 519 | Ga0466968_0031839 | 3300044735 | Bacteria | 2190 |
| 520 | Ga0466968_0129463 | 3300044735 | Bacteria | 1147 |
| 521 | Ga0466968_0141543 | 3300044735 | Bacteria | 1100 |
| 522 | Ga0466968_0293966 | 3300044735 | Bacteria | 780 |
| 523 | Ga0466968_0702111 | 3300044735 | Bacteria | 516 |
| 524 | Ga0466970_0007395 | 3300044765 | Bacteria | 5503 |
| 525 | Ga0466970_0013020 | 3300044765 | Bacteria | 4262 |
| 526 | Ga0466970_0950967 | 3300044765 | Unclassified | 506 |
| 527 | Ga0466970_0971116 | 3300044765 | Bacteria | 501 |
| 528 | Ga0466957_0007410 | 3300044842 | Bacteria | 6200 |
| 529 | Ga0466957_0010582 | 3300044842 | Bacteria | 5301 |
| 530 | Ga0466957_0037247 | 3300044842 | Bacteria | 2928 |
| 531 | Ga0466957_0037331 | 3300044842 | Bacteria | 2925 |
| 532 | Ga0466957_0052052 | 3300044842 | Bacteria | 2492 |
| 533 | Ga0466957_0058957 | 3300044842 | Bacteria | 2352 |
| 534 | Ga0466957_0062153 | 3300044842 | Bacteria | 2293 |
| 535 | Ga0466957_0125057 | 3300044842 | Bacteria | 1642 |
| 536 | Ga0466957_0187904 | 3300044842 | Bacteria | 1352 |
| 537 | Ga0466957_0252888 | 3300044842 | Bacteria | 1172 |
| 538 | Ga0466957_1130571 | 3300044842 | Bacteria | 565 |
| 539 | Ga0466960_0268796 | 3300044901 | Bacteria | 952 |
| 540 | Ga0466960_0298831 | 3300044901 | Bacteria | 907 |
| 541 | Ga0466959_0044699 | 3300045049 | Bacteria | 3262 |
| 542 | Ga0466959_0068671 | 3300045049 | Bacteria | 2568 |
| 543 | Ga0466959_0078203 | 3300045049 | Bacteria | 2386 |
| 544 | Ga0466959_0081667 | 3300045049 | Bacteria | 2329 |
| 545 | Ga0451576_0801762 | 3300045051 | Bacteria | 989 |
| 546 | Ga0466958_0000764 | 3300045836 | Bacteria | 14134 |
| 547 | Ga0466958_0001752 | 3300045836 | Bacteria | 10505 |
| 548 | Ga0466958_0002962 | 3300045836 | Bacteria | 8696 |
| 549 | Ga0466958_0017695 | 3300045836 | Bacteria | 4126 |
| 550 | Ga0466958_0018345 | 3300045836 | Bacteria | 4060 |
| 551 | Ga0466958_0106076 | 3300045836 | Bacteria | 1751 |
| 552 | Ga0466958_0108075 | 3300045836 | Bacteria | 1735 |
| 553 | Ga0466958_0229024 | 3300045836 | Bacteria | 1186 |
| 554 | Ga0466958_0266778 | 3300045836 | Bacteria | 1096 |
| 555 | Ga0466958_0361546 | 3300045836 | Bacteria | 935 |
| 556 | Ga0466967_0000389 | 3300045976 | Bacteria | 20536 |
| 557 | Ga0466967_0000731 | 3300045976 | Bacteria | 16819 |
| 558 | Ga0466967_0005921 | 3300045976 | Bacteria | 8572 |
| 559 | Ga0466967_0006226 | 3300045976 | Bacteria | 8413 |
| 560 | Ga0466967_0007562 | 3300045976 | Bacteria | 7851 |
| 561 | Ga0466967_0009002 | 3300045976 | Bacteria | 7375 |
| 562 | Ga0466967_0012850 | 3300045976 | Bacteria | 6434 |
| 563 | Ga0466967_0021569 | 3300045976 | Bacteria | 5237 |
| 564 | Ga0466967_0025723 | 3300045976 | Bacteria | 4857 |
| 565 | Ga0466967_0034428 | 3300045976 | Bacteria | 4299 |
| 566 | Ga0466967_0038192 | 3300045976 | Bacteria | 4116 |
| 567 | Ga0466967_0046237 | 3300045976 | Bacteria | 3788 |
| 568 | Ga0466967_0053380 | 3300045976 | Bacteria | 3551 |
| 569 | Ga0466967_0060300 | 3300045976 | Bacteria | 3361 |
| 570 | Ga0466967_0065924 | 3300045976 | Bacteria | 3225 |
| 571 | Ga0466967_0099253 | 3300045976 | Bacteria | 2659 |
| 572 | Ga0466967_0171992 | 3300045976 | Bacteria | 2039 |
| 573 | Ga0466967_0219687 | 3300045976 | Bacteria | 1805 |
| 574 | Ga0466967_0258561 | 3300045976 | Bacteria | 1665 |
| 575 | Ga0466967_0271724 | 3300045976 | Bacteria | 1624 |
| 576 | Ga0466967_0396511 | 3300045976 | Bacteria | 1342 |
| 577 | Ga0466967_0493491 | 3300045976 | Bacteria | 1201 |
| 578 | Ga0466967_0500396 | 3300045976 | Bacteria | 1192 |
| 579 | Ga0466967_0579086 | 3300045976 | Bacteria | 1106 |
| 580 | Ga0466967_0665714 | 3300045976 | Bacteria | 1030 |
| 581 | Ga0466967_0678237 | 3300045976 | Bacteria | 1020 |
| 582 | Ga0466967_0836289 | 3300045976 | Bacteria | 914 |
| 583 | Ga0466967_1737071 | 3300045976 | Bacteria | 621 |
| 584 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 585 | Ga0495592_0011130 | 3300046454 | Bacteria | 6794 |
| 586 | Ga0495592_0046987 | 3300046454 | Bacteria | 3216 |
| 587 | Ga0495592_0167204 | 3300046454 | Bacteria | 1508 |
| 588 | Ga0495592_0541453 | 3300046454 | Bacteria | 717 |
| 589 | Ga0495603_0005733 | 3300046455 | Bacteria | 7428 |
| 590 | Ga0495629_0014936 | 3300046459 | Bacteria | 5580 |
| 591 | Ga0495629_0030567 | 3300046459 | Bacteria | 3818 |
| 592 | Ga0495629_0070915 | 3300046459 | Bacteria | 2431 |
| 593 | Ga0495629_0087154 | 3300046459 | Bacteria | 2178 |
| 594 | Ga0495629_0124488 | 3300046459 | Bacteria | 1796 |
| 595 | Ga0495629_0247643 | 3300046459 | Bacteria | 1226 |
| 596 | Ga0495641_0002942 | 3300046461 | Bacteria | 13119 |
| 597 | Ga0495641_0043279 | 3300046461 | Bacteria | 2083 |
| 598 | Ga0495651_0000080 | 3300046462 | Bacteria | 70453 |
| 599 | Ga0495651_0348977 | 3300046462 | Bacteria | 978 |
| 600 | Ga0495651_1021676 | 3300046462 | Bacteria | 501 |
| 601 | Ga0495653_0015820 | 3300046463 | Bacteria | 6150 |
| 602 | Ga0495653_0026113 | 3300046463 | Bacteria | 4687 |
| 603 | Ga0495653_0320313 | 3300046463 | Bacteria | 1005 |
| 604 | Ga0495580_0013385 | 3300046472 | Bacteria | 6263 |
| 605 | Ga0495582_0000542 | 3300046473 | Bacteria | 20867 |
| 606 | Ga0495582_0051670 | 3300046473 | Bacteria | 2266 |
| 607 | Ga0495582_0128507 | 3300046473 | Bacteria | 1431 |
| 608 | Ga0495639_0017281 | 3300046475 | Bacteria | 3132 |
| 609 | Ga0495662_0000865 | 3300046476 | Bacteria | 14771 |
| 610 | Ga0495662_0402041 | 3300046476 | Bacteria | 673 |
| 611 | Ga0495664_0003565 | 3300046477 | Bacteria | 8486 |
| 612 | Ga0495664_0072238 | 3300046477 | Bacteria | 2061 |
| 613 | Ga0495664_0072944 | 3300046477 | Bacteria | 2052 |
| 614 | Ga0495664_0503693 | 3300046477 | Bacteria | 723 |
| 615 | Ga0495594_0119730 | 3300046499 | Bacteria | 1488 |
| 616 | Ga0495608_0045059 | 3300046511 | Bacteria | 2942 |
| 617 | Ga0495608_0073099 | 3300046511 | Bacteria | 2236 |
| 618 | Ga0495608_0225488 | 3300046511 | Bacteria | 1174 |
| 619 | Ga0495608_0584575 | 3300046511 | Bacteria | 671 |
| 620 | Ga0495618_0002207 | 3300046514 | Bacteria | 12729 |
| 621 | Ga0495618_0017806 | 3300046514 | Bacteria | 4359 |
| 622 | Ga0495618_0266850 | 3300046514 | Bacteria | 1071 |
| 623 | Ga0495618_0331381 | 3300046514 | Bacteria | 941 |
| 624 | Ga0495618_0419152 | 3300046514 | Bacteria | 816 |
| 625 | Ga0495618_0731731 | 3300046514 | Bacteria | 580 |
| 626 | Ga0495628_0000292 | 3300046516 | Bacteria | 45065 |
| 627 | Ga0495628_0015841 | 3300046516 | Bacteria | 6293 |
| 628 | Ga0495628_0193418 | 3300046516 | Bacteria | 1535 |
| 629 | Ga0495628_0425100 | 3300046516 | Bacteria | 968 |
| 630 | Ga0495630_0024662 | 3300046517 | Bacteria | 4444 |
| 631 | Ga0495630_0145538 | 3300046517 | Bacteria | 1802 |
| 632 | Ga0495630_0318690 | 3300046517 | Bacteria | 1188 |
| 633 | Ga0495630_1465434 | 3300046517 | Bacteria | 512 |
| 634 | Ga0495644_0024379 | 3300046523 | Bacteria | 2301 |
| 635 | Ga0495666_0000436 | 3300046526 | Bacteria | 18500 |
| 636 | Ga0495652_0016575 | 3300046529 | Bacteria | 6589 |
| 637 | Ga0495652_0044483 | 3300046529 | Bacteria | 3823 |
| 638 | Ga0495652_0171146 | 3300046529 | Bacteria | 1676 |
| 639 | Ga0495652_0229467 | 3300046529 | Bacteria | 1389 |
| 640 | Ga0495652_0444543 | 3300046529 | Bacteria | 909 |
| 641 | Ga0495652_0555673 | 3300046529 | Bacteria | 789 |
| 642 | Ga0495665_0000038 | 3300046531 | Bacteria | 51967 |
| 643 | Ga0495640_0003773 | 3300046533 | Bacteria | 12155 |
| 644 | Ga0495640_0175938 | 3300046533 | Bacteria | 1366 |
| 645 | Ga0495640_0272433 | 3300046533 | Bacteria | 1055 |
| 646 | Ga0495586_0341814 | 3300046535 | Bacteria | 859 |
| 647 | Ga0495587_0000270 | 3300046536 | Bacteria | 37255 |
| 648 | Ga0495609_0263120 | 3300046538 | Bacteria | 708 |
| 649 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 650 | Ga0495645_0022830 | 3300046543 | Bacteria | 4527 |
| 651 | Ga0495645_0699421 | 3300046543 | Bacteria | 615 |
| 652 | Ga0495667_0001874 | 3300046559 | Bacteria | 13948 |
| 653 | Ga0495667_0048333 | 3300046559 | Bacteria | 2809 |
| 654 | Ga0495667_0373639 | 3300046559 | Bacteria | 899 |
| 655 | Ga0495667_0491046 | 3300046559 | Bacteria | 769 |
| 656 | Ga0495656_0014109 | 3300046615 | Bacteria | 2989 |
| 657 | Ga0495634_0058051 | 3300046642 | Bacteria | 2580 |
| 658 | Ga0495634_0060577 | 3300046642 | Bacteria | 2518 |
| 659 | Ga0495634_0686377 | 3300046642 | Bacteria | 589 |
| 660 | Ga0495611_0118897 | 3300046648 | Bacteria | 1232 |
| 661 | Ga0495635_0011919 | 3300046663 | Bacteria | 6091 |
| 662 | Ga0495635_0022423 | 3300046663 | Bacteria | 4396 |
| 663 | Ga0495635_0131687 | 3300046663 | Bacteria | 1705 |
| 664 | Ga0495635_0195306 | 3300046663 | Bacteria | 1373 |
| 665 | Ga0495635_0223171 | 3300046663 | Bacteria | 1274 |
| 666 | Ga0495635_0635875 | 3300046663 | Bacteria | 695 |
| 667 | Ga0495657_0009237 | 3300046675 | Bacteria | 7481 |
| 668 | Ga0495657_0014834 | 3300046675 | Bacteria | 5717 |
| 669 | Ga0495599_0000142 | 3300046678 | Bacteria | 46621 |
| 670 | Ga0495599_0009522 | 3300046678 | Bacteria | 5940 |
| 671 | Ga0495599_0114963 | 3300046678 | Bacteria | 1674 |
| 672 | Ga0495623_0000210 | 3300046679 | Bacteria | 37384 |
| 673 | Ga0495623_0167622 | 3300046679 | Bacteria | 1285 |
| 674 | Ga0495646_0000729 | 3300046680 | Bacteria | 18267 |
| 675 | Ga0495646_0191919 | 3300046680 | Bacteria | 1116 |
| 676 | Ga0495646_0210616 | 3300046680 | Bacteria | 1055 |
| 677 | Ga0495646_0294802 | 3300046680 | Bacteria | 859 |
| 678 | Ga0495647_0000362 | 3300046681 | Bacteria | 12846 |
| 679 | Ga0495647_0076252 | 3300046681 | Bacteria | 1351 |
| 680 | Ga0495647_0478771 | 3300046681 | Bacteria | 578 |
| 681 | Ga0495658_0000950 | 3300046683 | Bacteria | 15450 |
| 682 | Ga0495658_0039510 | 3300046683 | Bacteria | 2618 |
| 683 | Ga0495658_0271355 | 3300046683 | Bacteria | 1069 |
| 684 | Ga0495613_0003038 | 3300046689 | Bacteria | 12549 |
| 685 | Ga0495613_0135818 | 3300046689 | Bacteria | 1760 |
| 686 | Ga0495613_0336305 | 3300046689 | Bacteria | 1040 |
| 687 | Ga0495613_0482618 | 3300046689 | Bacteria | 836 |
| 688 | Ga0495624_0003198 | 3300046690 | Bacteria | 12201 |
| 689 | Ga0495600_0072378 | 3300046809 | Bacteria | 2252 |
| 690 | Ga0495600_0103629 | 3300046809 | Bacteria | 1854 |
| 691 | Ga0495600_0243982 | 3300046809 | Bacteria | 1144 |
| 692 | Ga0495600_0383877 | 3300046809 | Bacteria | 876 |
| 693 | Ga0495600_0539647 | 3300046809 | Bacteria | 713 |
| 694 | Ga0495581_0000231 | 3300047315 | Bacteria | 26359 |
| 695 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 696 | Ga0495604_0150391 | 3300047317 | Bacteria | 1655 |
| 697 | Ga0495636_0101452 | 3300047318 | Bacteria | 1259 |
| 698 | Ga0495674_0135341 | 3300047319 | Bacteria | 2074 |
| 699 | Ga0495674_0245792 | 3300047319 | Bacteria | 1473 |
| 700 | Ga0495674_0262865 | 3300047319 | Bacteria | 1417 |
| 701 | Ga0495674_0268781 | 3300047319 | Bacteria | 1399 |
| 702 | Ga0495676_0007522 | 3300047321 | Bacteria | 9986 |
| 703 | Ga0495676_0083877 | 3300047321 | Bacteria | 2406 |
| 704 | Ga0495676_0243477 | 3300047321 | Bacteria | 1230 |
| 705 | Ga0495680_0029866 | 3300047322 | Bacteria | 4459 |
| 706 | Ga0495680_0046561 | 3300047322 | Bacteria | 3419 |
| 707 | Ga0495680_0125776 | 3300047322 | Bacteria | 1888 |
| 708 | Ga0495680_0323544 | 3300047322 | Bacteria | 1079 |
| 709 | Ga0495680_0391241 | 3300047322 | Bacteria | 961 |
| 710 | Ga0495675_0826210 | 3300047444 | Unclassified | 511 |
| 711 | Ga0495677_0058436 | 3300047445 | Bacteria | 1427 |
| 712 | Ga0495684_0022803 | 3300047471 | Bacteria | 4814 |
| 713 | Ga0495684_0035692 | 3300047471 | Bacteria | 3811 |
| 714 | Ga0495684_0073967 | 3300047471 | Bacteria | 2588 |
| 715 | Ga0495684_0084343 | 3300047471 | Bacteria | 2410 |
| 716 | Ga0495684_0132819 | 3300047471 | Bacteria | 1868 |
| 717 | Ga0495684_0259566 | 3300047471 | Bacteria | 1261 |
| 718 | Ga0495593_0001951 | 3300047673 | Bacteria | 12308 |
| 719 | Ga0495593_0176567 | 3300047673 | Unclassified | 1076 |
| 720 | Ga0495602_0007946 | 3300048088 | Bacteria | 11086 |
| 721 | Ga0495602_0009850 | 3300048088 | Bacteria | 9917 |
| 722 | Ga0495602_0934739 | 3300048088 | Bacteria | 575 |
| 723 | Ga0495614_0000113 | 3300048089 | Bacteria | 27871 |
| 724 | Ga0496100_0017052 | 3300048903 | Bacteria | 4279 |
| 725 | Ga0496100_0092606 | 3300048903 | Bacteria | 2066 |
| 726 | Ga0496100_0101807 | 3300048903 | Bacteria | 1981 |
| 727 | Ga0496101_0002780 | 3300048904 | Bacteria | 10726 |
| 728 | Ga0496101_0093389 | 3300048904 | Bacteria | 2241 |
| 729 | Ga0496101_0099239 | 3300048904 | Bacteria | 2177 |
| 730 | Ga0496101_0365561 | 3300048904 | Bacteria | 1134 |
| 731 | Ga0496102_0017437 | 3300048905 | Bacteria | 6290 |
| 732 | Ga0496102_0113263 | 3300048905 | Bacteria | 2530 |
| 733 | Ga0496102_0486672 | 3300048905 | Bacteria | 1155 |
| 734 | Ga0496102_0789359 | 3300048905 | Bacteria | 872 |
| 735 | Ga0496102_1870604 | 3300048905 | Bacteria | 517 |
| 736 | Ga0496103_0004195 | 3300048906 | Bacteria | 8746 |
| 737 | Ga0496103_0061563 | 3300048906 | Bacteria | 2334 |
| 738 | Ga0496103_1032950 | 3300048906 | Bacteria | 511 |
| 739 | Ga0496104_0005694 | 3300048907 | Bacteria | 10905 |
| 740 | Ga0496104_0044993 | 3300048907 | Bacteria | 4149 |
| 741 | Ga0496104_0163692 | 3300048907 | Bacteria | 2133 |
| 742 | Ga0496105_0004010 | 3300048908 | Bacteria | 11014 |
| 743 | Ga0496105_0009335 | 3300048908 | Bacteria | 7668 |
| 744 | Ga0496105_0127767 | 3300048908 | Bacteria | 2095 |
| 745 | Ga0496105_0157182 | 3300048908 | Bacteria | 1867 |
| 746 | Ga0496105_0199059 | 3300048908 | Bacteria | 1635 |
| 747 | Ga0496106_0003405 | 3300048909 | Bacteria | 11848 |
| 748 | Ga0496106_0005415 | 3300048909 | Bacteria | 9437 |
| 749 | Ga0496106_0228123 | 3300048909 | Bacteria | 1486 |
| 750 | Ga0496106_1358096 | 3300048909 | Bacteria | 550 |
| 751 | Ga0496107_0000477 | 3300048910 | Bacteria | 22008 |
| 752 | Ga0496107_0105416 | 3300048910 | Bacteria | 2069 |
| 753 | Ga0496107_0292411 | 3300048910 | Bacteria | 1213 |
| 754 | Ga0496107_0850012 | 3300048910 | Bacteria | 667 |
| 755 | Ga0496108_0015425 | 3300048911 | Bacteria | 6233 |
| 756 | Ga0496108_0113425 | 3300048911 | Bacteria | 2319 |
| 757 | Ga0496108_0307247 | 3300048911 | Bacteria | 1382 |
| 758 | Ga0496108_0382636 | 3300048911 | Bacteria | 1229 |
| 759 | Ga0496109_0049137 | 3300048912 | Bacteria | 3839 |
| 760 | Ga0496109_0105869 | 3300048912 | Bacteria | 2612 |
| 761 | Ga0496109_0123648 | 3300048912 | Bacteria | 2412 |
| 762 | Ga0496109_0208516 | 3300048912 | Bacteria | 1837 |
| 763 | Ga0496109_0416383 | 3300048912 | Bacteria | 1269 |
| 764 | Ga0496110_0007150 | 3300048913 | Bacteria | 8887 |
| 765 | Ga0496110_0273171 | 3300048913 | Bacteria | 1539 |
| 766 | Ga0496110_0974690 | 3300048913 | Bacteria | 755 |
| 767 | Ga0496111_0028127 | 3300048914 | Bacteria | 3982 |
| 768 | Ga0496111_0067102 | 3300048914 | Bacteria | 2606 |
| 769 | Ga0496111_0121050 | 3300048914 | Bacteria | 1933 |
| 770 | Ga0496111_0340912 | 3300048914 | Bacteria | 1109 |
| 771 | Ga0496112_0035466 | 3300048915 | Bacteria | 4859 |
| 772 | Ga0496112_0041789 | 3300048915 | Bacteria | 4486 |
| 773 | Ga0496112_0110285 | 3300048915 | Bacteria | 2722 |
| 774 | Ga0496112_0150282 | 3300048915 | Bacteria | 2296 |
| 775 | Ga0496112_0154045 | 3300048915 | Bacteria | 2265 |
| 776 | Ga0496112_0175058 | 3300048915 | Bacteria | 2111 |
| 777 | Ga0496112_0404329 | 3300048915 | Bacteria | 1305 |
| 778 | Ga0496112_0463572 | 3300048915 | Bacteria | 1204 |
| 779 | Ga0496112_0605156 | 3300048915 | Bacteria | 1028 |
| 780 | Ga0496112_1053679 | 3300048915 | Unclassified | 732 |
| 781 | Ga0496113_0034002 | 3300048916 | Bacteria | 3717 |
| 782 | Ga0496113_0066331 | 3300048916 | Bacteria | 2733 |
| 783 | Ga0496113_0821813 | 3300048916 | Bacteria | 738 |
| 784 | Ga0496114_0046993 | 3300048917 | Bacteria | 3588 |
| 785 | Ga0496114_0263395 | 3300048917 | Bacteria | 1518 |
| 786 | Ga0496115_0016183 | 3300048918 | Bacteria | 5674 |
| 787 | Ga0496115_0044693 | 3300048918 | Bacteria | 3534 |
| 788 | Ga0496115_0135626 | 3300048918 | Bacteria | 2029 |
| 789 | Ga0496115_0152340 | 3300048918 | Bacteria | 1909 |
| 790 | Ga0496115_0590015 | 3300048918 | Bacteria | 884 |
| 791 | Ga0501067_0010948 | 3300049583 | Bacteria | 5022 |
| 792 | Ga0501067_0021693 | 3300049583 | Bacteria | 3554 |
| 793 | Ga0501067_0208348 | 3300049583 | Bacteria | 1089 |
| 794 | Ga0501067_0345387 | 3300049583 | Bacteria | 829 |
| 795 | Ga0501069_0077838 | 3300049585 | Bacteria | 1864 |
| 796 | Ga0501069_0634238 | 3300049585 | Unclassified | 642 |
| 797 | Ga0501070_0037683 | 3300049586 | Bacteria | 4036 |
| 798 | Ga0501070_0051589 | 3300049586 | Bacteria | 3414 |
| 799 | Ga0501070_0373503 | 3300049586 | Bacteria | 1156 |
| 800 | Ga0501072_0018261 | 3300049588 | Bacteria | 5396 |
| 801 | Ga0501073_0058214 | 3300049589 | Bacteria | 2701 |
| 802 | Ga0501073_0067035 | 3300049589 | Bacteria | 2502 |
| 803 | Ga0501074_0013035 | 3300049590 | Bacteria | 6045 |
| 804 | Ga0501079_0011330 | 3300049741 | Bacteria | 6802 |
| 805 | Ga0501080_0078654 | 3300049742 | Bacteria | 3066 |
| 806 | Ga0501083_0000576 | 3300049744 | Bacteria | 23532 |
| 807 | Ga0501044_0567080 | 3300049823 | Bacteria | 1031 |
| 808 | nmdc:mga08y16_138966_c1 | 3300050511 | Bacteria | 2525 |
| 809 | nmdc:mga0n895_1676_c1 | 3300050512 | Bacteria | 16730 |
| 810 | nmdc:mga08x19_66461_c1 | 3300050514 | Bacteria | 2343 |
| 811 | nmdc:mga0a205_468051_c1 | 3300050515 | Bacteria | 1119 |
| 812 | Ga0495601_0013020 | 3300053077 | Bacteria | 4997 |
| 813 | Ga0495601_0018667 | 3300053077 | Bacteria | 4222 |
| 814 | Ga0495601_0108968 | 3300053077 | Bacteria | 1792 |
| 815 | Ga0495601_0137719 | 3300053077 | Bacteria | 1591 |
| 816 | Ga0495612_0021958 | 3300053078 | Bacteria | 2559 |
| 817 | Ga0495612_0047744 | 3300053078 | Bacteria | 1754 |
| 818 | Ga0495612_0179862 | 3300053078 | Bacteria | 928 |
| 819 | Ga0495595_0056434 | 3300053084 | Bacteria | 1830 |
| 820 | Ga0495595_0096164 | 3300053084 | Bacteria | 1425 |
| 821 | Ga0495595_0604938 | 3300053084 | Bacteria | 561 |
| 822 | Ga0495619_0011810 | 3300053085 | Bacteria | 5501 |
| 823 | Ga0495619_0037711 | 3300053085 | Bacteria | 3151 |
| 824 | Ga0495619_0191282 | 3300053085 | Bacteria | 1416 |
| 825 | Ga0495619_0216313 | 3300053085 | Bacteria | 1327 |
| 826 | Ga0495619_1205494 | 3300053085 | Bacteria | 501 |
| 827 | Ga0500566_0051165 | 3300053094 | Bacteria | 2363 |
| 828 | Ga0500657_177642 | 3300053728 | Bacteria | 744 |
| 829 | Ga0501082_0304960 | 3300060353 | Bacteria | 1387 |
| 830 | Ga0466962_0000600 | 3300061719 | Bacteria | 15915 |
| 831 | Ga0466962_0001813 | 3300061719 | Bacteria | 10055 |
| 832 | Ga0466962_0002868 | 3300061719 | Bacteria | 8219 |
| 833 | Ga0466962_0025185 | 3300061719 | Bacteria | 2856 |
| 834 | Ga0466962_0052078 | 3300061719 | Bacteria | 1957 |
| 835 | Ga0466962_0081677 | 3300061719 | Bacteria | 1546 |
| 836 | Ga0466962_0278524 | 3300061719 | Bacteria | 825 |
| 837 | Ga0265338_10088775 | |||
| 838 | Ga0070658_10110130 | |||
| 839 | Ga0070683_100114394 | |||
| 840 | Ga0070683_100191944 | |||
| 841 | Ga0070683_100197479 | |||
| 842 | Ga0070683_100213829 | |||
| 843 | Ga0070680_100092123 | |||
| 844 | Ga0070680_100170741 | |||
| 845 | Ga0070680_100243111 | |||
| 846 | Ga0070680_100784053 | |||
| 847 | Ga0070682_100017584 | |||
| 848 | Ga0070682_100078157 | |||
| 849 | Ga0070682_100155009 | |||
| 850 | Ga0068868_101240115 | |||
| 851 | Ga0070660_100016946 | |||
| 852 | Ga0070660_100046508 | |||
| 853 | Ga0070660_100110649 | |||
| 854 | Ga0070660_100198794 | |||
| 855 | Ga0070660_100238474 | |||
| 856 | Ga0070660_100721912 | |||
| 857 | Ga0070660_100795725 | |||
| 858 | Ga0070660_101377928 | |||
| 859 | Ga0070661_100095978 | |||
| 860 | Ga0070661_100142532 | |||
| 861 | Ga0070661_100203197 | |||
| 862 | Ga0070692_10694537 | |||
| 863 | Ga0070674_100933334 | |||
| 864 | Ga0070659_100199728 | |||
| 865 | Ga0070667_100359177 | |||
| 866 | Ga0070709_10012797 | |||
| 867 | Ga0070709_10059965 | |||
| 868 | Ga0070709_10571167 | |||
| 869 | Ga0070714_100034925 | |||
| 870 | Ga0070714_100063213 | |||
| 871 | Ga0070714_100095228 | |||
| 872 | Ga0070714_100151430 | |||
| 873 | Ga0070714_100168465 | |||
| 874 | Ga0070714_100176699 | |||
| 875 | Ga0070714_100230508 | |||
| 876 | Ga0070714_100336945 | |||
| 877 | Ga0070714_100352350 | |||
| 878 | Ga0070714_100436804 | |||
| 879 | Ga0070714_100442492 | |||
| 880 | Ga0070714_100625813 | |||
| 881 | Ga0070714_100802714 | |||
| 882 | Ga0070714_100921048 | |||
| 883 | Ga0070714_101217598 | |||
| 884 | Ga0070714_101603783 | |||
| 885 | Ga0070714_101614243 | |||
| 886 | Ga0070714_101932718 | |||
| 887 | Ga0070713_100025851 | |||
| 888 | Ga0070713_100312945 | |||
| 889 | Ga0070713_100363264 | |||
| 890 | Ga0070713_101930704 | |||
| 891 | Ga0070713_102429511 | |||
| 892 | Ga0070710_10011319 | |||
| 893 | Ga0070710_10131683 | |||
| 894 | Ga0070710_10434212 | |||
| 895 | Ga0070711_100095512 | |||
| 896 | Ga0070711_100171299 | |||
| 897 | Ga0070711_100398363 | |||
| 898 | Ga0070711_101344298 | |||
| 899 | Ga0070711_101487111 | |||
| 900 | Ga0070705_100127643 | |||
| 901 | Ga0070705_100871400 | |||
| 902 | Ga0070694_100619521 | |||
| 903 | Ga0070694_101291571 | |||
| 904 | Ga0070708_100151810 | |||
| 905 | Ga0070708_100695088 | |||
| 906 | Ga0070708_100810922 | |||
| 907 | Ga0070708_101319930 | |||
| 908 | Ga0070708_101324150 | |||
| 909 | Ga0070708_101405254 | |||
| 910 | Ga0070708_101673635 | |||
| 911 | Ga0070663_100683628 | |||
| 912 | Ga0070678_100365260 | |||
| 913 | Ga0070662_101341925 | |||
| 914 | Ga0070681_10029010 | |||
| 915 | Ga0070681_10038474 | |||
| 916 | Ga0070681_10067920 | |||
| 917 | Ga0070681_10142211 | |||
| 918 | Ga0070681_10178328 | |||
| 919 | Ga0070681_10210846 | |||
| 920 | Ga0070681_10323960 | |||
| 921 | Ga0070681_10328144 | |||
| 922 | Ga0070681_10444799 | |||
| 923 | Ga0070681_10620908 | |||
| 924 | Ga0070681_10882177 | |||
| 925 | Ga0070681_11478947 | |||
| 926 | Ga0070706_100039423 | |||
| 927 | Ga0070706_100131903 | |||
| 928 | Ga0070706_100637351 | |||
| 929 | Ga0070706_100932559 | |||
| 930 | Ga0070707_100000441 | |||
| 931 | Ga0070707_100008363 | |||
| 932 | Ga0070707_100788672 | |||
| 933 | Ga0070698_100069724 | |||
| 934 | Ga0070698_100285768 | |||
| 935 | Ga0070698_100307235 | |||
| 936 | Ga0070698_100599884 | |||
| 937 | Ga0070698_100652479 | |||
| 938 | Ga0070699_100041932 | |||
| 939 | Ga0070699_100344624 | |||
| 940 | Ga0070699_101005141 | |||
| 941 | Ga0070699_101147231 | |||
| 942 | Ga0070699_101179069 | |||
| 943 | Ga0070699_101834349 | |||
| 944 | Ga0070679_100019782 | |||
| 945 | Ga0070679_100094255 | |||
| 946 | Ga0070679_100141314 | |||
| 947 | Ga0070679_100165784 | |||
| 948 | Ga0070679_100206505 | |||
| 949 | Ga0070679_100216922 | |||
| 950 | Ga0070679_100327030 | |||
| 951 | Ga0070679_100778800 | |||
| 952 | Ga0070684_100165660 | |||
| 953 | Ga0070684_100818678 | |||
| 954 | Ga0070684_101536341 | |||
| 955 | Ga0070697_100363044 | |||
| 956 | Ga0070697_101498480 | |||
| 957 | Ga0070697_101940437 | |||
| 958 | Ga0068853_100453815 | |||
| 959 | Ga0068853_102435219 | |||
| 960 | Ga0070695_100000005 | |||
| 961 | Ga0070695_101872971 | |||
| 962 | Ga0070696_101479494 | |||
| 963 | Ga0070693_100113615 | |||
| 964 | Ga0070693_100311372 | |||
| 965 | Ga0070704_102083735 | |||
| 966 | Ga0068855_100115927 | |||
| 967 | Ga0068855_100601691 | |||
| 968 | Ga0068855_101818330 | |||
| 969 | Ga0070664_100521248 | |||
| 970 | Ga0070664_101993341 | |||
| 971 | Ga0068857_102364261 | |||
| 972 | Ga0068854_101819459 | |||
| 973 | Ga0068856_100034191 | |||
| 974 | Ga0068856_100105784 | |||
| 975 | Ga0068856_100241933 | |||
| 976 | Ga0068856_100319082 | |||
| 977 | Ga0068856_101295325 | |||
| 978 | Ga0068856_101986718 | |||
| 979 | Ga0070702_101783009 | |||
| 980 | Ga0070717_10003490 | |||
| 981 | Ga0070717_10009086 | |||
| 982 | Ga0070717_10010124 | |||
| 983 | Ga0070717_10018995 | |||
| 984 | Ga0070717_10023944 | |||
| 985 | Ga0070717_11040412 | |||
| 986 | Ga0070717_11439119 | |||
| 987 | Ga0070715_10002925 | |||
| 988 | Ga0070716_100003114 | |||
| 989 | Ga0070716_101266223 | |||
| 990 | Ga0070712_100093194 | |||
| 991 | Ga0070712_100522054 | |||
| 992 | Ga0070712_100986329 | |||
| 993 | Ga0068871_101266838 | |||
| 994 | Ga0075431_100286588 | |||
| 995 | Ga0075433_11378457 | |||
| 996 | Ga0068865_101585680 | |||
| 997 | Ga0075436_100078580 | |||
| 998 | Ga0075436_100326519 | |||
| 999 | Ga0075435_101067483 | |||
| 1000 | Ga0099794_10152949 | |||
| 1001 | Ga0105251_10260024 | |||
| 1002 | Ga0105244_10280068 | |||
| 1003 | Ga0105240_10068476 | |||
| 1004 | Ga0105240_10343779 | |||
| 1005 | Ga0105240_10463202 | |||
| 1006 | Ga0105240_10860212 | |||
| 1007 | Ga0111539_10705619 | |||
| 1008 | Ga0105245_10095149 | |||
| 1009 | Ga0105245_12808556 | |||
| 1010 | Ga0105247_10318638 | |||
| 1011 | Ga0105241_10425701 | |||
| 1012 | Ga0105241_10635277 | |||
| 1013 | Ga0105241_10638703 | |||
| 1014 | Ga0105242_10218700 | |||
| 1015 | Ga0105248_13023167 | |||
| 1016 | Ga0105237_10765828 | |||
| 1017 | Ga0105237_11460098 | |||
| 1018 | Ga0105238_10190608 | |||
| 1019 | Ga0105238_10646122 | |||
| 1020 | Ga0105238_11237850 | |||
| 1021 | Ga0105249_12631836 | |||
| 1022 | Ga0105239_11546027 | |||
| 1023 | Ga0105239_12080474 | |||
| 1024 | Ga0105239_13166758 | |||
| 1025 | Ga0157371_10098212 | |||
| 1026 | Ga0157370_10030952 | |||
| 1027 | Ga0157370_10032439 | |||
| 1028 | Ga0157370_10930696 | |||
| 1029 | Ga0157369_10005310 | |||
| 1030 | Ga0157369_10055843 | |||
| 1031 | Ga0157369_10060388 | |||
| 1032 | Ga0157369_10589353 | |||
| 1033 | Ga0157369_10737767 | |||
| 1034 | Ga0157369_10844256 | |||
| 1035 | Ga0157369_11424561 | |||
| 1036 | Ga0157374_10062661 | |||
| 1037 | Ga0157374_10521287 | |||
| 1038 | Ga0163162_11007731 | |||
| 1039 | Ga0157372_10324865 | |||
| 1040 | Ga0157372_10415359 | |||
| 1041 | Ga0157372_10845511 | |||
| 1042 | Ga0157372_11025496 | |||
| 1043 | Ga0157372_11621058 | |||
| 1044 | Ga0157372_11994478 | |||
| 1045 | Ga0157372_13040708 | |||
| 1046 | Ga0157375_12195108 | |||
| 1047 | Ga0163163_10220187 | |||
| 1048 | Ga0182008_10026892 | |||
| 1049 | Ga0182008_10067443 | |||
| 1050 | Ga0182008_10084534 | |||
| 1051 | Ga0182008_10176996 | |||
| 1052 | Ga0157379_10983604 | |||
| 1053 | Ga0182006_1147036 | |||
| 1054 | Ga0182005_1042110 | |||
| 1055 | Ga0206356_10081141 | |||
| 1056 | Ga0206356_11407641 | |||
| 1057 | Ga0206354_10889251 | |||
| 1058 | Ga0206354_10939662 | |||
| 1059 | Ga0206353_11095863 | |||
| 1060 | Ga0206353_11266715 | |||
| 1061 | Ga0206353_11931666 | |||
| 1062 | Ga0206353_12038425 | |||
| 1063 | Ga0213871_10094165 | |||
| 1064 | Ga0224712_10007888 | |||
| 1065 | Ga0224712_10010076 | |||
| 1066 | Ga0224712_10032792 | |||
| 1067 | Ga0207692_10012830 | |||
| 1068 | Ga0207692_10057104 | |||
| 1069 | Ga0207692_10689477 | |||
| 1070 | Ga0207692_11063344 | |||
| 1071 | Ga0207692_11166398 | |||
| 1072 | Ga0207710_10103294 | |||
| 1073 | Ga0207685_10034599 | |||
| 1074 | Ga0207699_10008519 | |||
| 1075 | Ga0207699_10074107 | |||
| 1076 | Ga0207699_10343596 | |||
| 1077 | Ga0207699_11234192 | |||
| 1078 | Ga0207705_10127391 | |||
| 1079 | Ga0207705_10134122 | |||
| 1080 | Ga0207705_10624982 | |||
| 1081 | Ga0207705_10803325 | |||
| 1082 | Ga0207705_11309990 | |||
| 1083 | Ga0207684_10034486 | |||
| 1084 | Ga0207684_10502579 | |||
| 1085 | Ga0207684_11035254 | |||
| 1086 | Ga0207654_10621316 | |||
| 1087 | Ga0207654_10651867 | |||
| 1088 | Ga0207707_10029444 | |||
| 1089 | Ga0207707_10079072 | |||
| 1090 | Ga0207707_10149398 | |||
| 1091 | Ga0207707_10200294 | |||
| 1092 | Ga0207707_10317286 | |||
| 1093 | Ga0207707_10366719 | |||
| 1094 | Ga0207707_10482079 | |||
| 1095 | Ga0207707_10602676 | |||
| 1096 | Ga0207695_10037785 | |||
| 1097 | Ga0207695_11369134 | |||
| 1098 | Ga0207693_10001187 | |||
| 1099 | Ga0207693_10012498 | |||
| 1100 | Ga0207693_10117503 | |||
| 1101 | Ga0207693_10226626 | |||
| 1102 | Ga0207693_10434236 | |||
| 1103 | Ga0207693_10988249 | |||
| 1104 | Ga0207693_11057359 | |||
| 1105 | Ga0207693_11123783 | |||
| 1106 | Ga0207663_10080778 | |||
| 1107 | Ga0207663_10429328 | |||
| 1108 | Ga0207663_10451602 | |||
| 1109 | Ga0207663_10457611 | |||
| 1110 | Ga0207660_10013044 | |||
| 1111 | Ga0207660_10469867 | |||
| 1112 | Ga0207660_10651383 | |||
| 1113 | Ga0207660_11696001 | |||
| 1114 | Ga0207662_11331123 | |||
| 1115 | Ga0207657_10026118 | |||
| 1116 | Ga0207657_10102594 | |||
| 1117 | Ga0207657_10233784 | |||
| 1118 | Ga0207657_10244459 | |||
| 1119 | Ga0207657_10345115 | |||
| 1120 | Ga0207657_10840713 | |||
| 1121 | Ga0207649_10160888 | |||
| 1122 | Ga0207652_10046072 | |||
| 1123 | Ga0207652_10074559 | |||
| 1124 | Ga0207652_10099081 | |||
| 1125 | Ga0207652_10117179 | |||
| 1126 | Ga0207652_10158009 | |||
| 1127 | Ga0207652_10410621 | |||
| 1128 | Ga0207652_10514381 | |||
| 1129 | Ga0207652_10566361 | |||
| 1130 | Ga0207652_11053056 | |||
| 1131 | Ga0207652_11088442 | |||
| 1132 | Ga0207652_11460999 | |||
| 1133 | Ga0207646_10001597 | |||
| 1134 | Ga0207694_11374866 | |||
| 1135 | Ga0207694_11491845 | |||
| 1136 | Ga0207700_10090757 | |||
| 1137 | Ga0207700_10265700 | |||
| 1138 | Ga0207700_10295143 | |||
| 1139 | Ga0207700_10829426 | |||
| 1140 | Ga0207700_10830660 | |||
| 1141 | Ga0207664_10006165 | |||
| 1142 | Ga0207664_10006213 | |||
| 1143 | Ga0207664_10016767 | |||
| 1144 | Ga0207664_10028936 | |||
| 1145 | Ga0207664_10149942 | |||
| 1146 | Ga0207664_10186495 | |||
| 1147 | Ga0207664_10275574 | |||
| 1148 | Ga0207664_10359393 | |||
| 1149 | Ga0207664_10379586 | |||
| 1150 | Ga0207664_10427776 | |||
| 1151 | Ga0207664_10612251 | |||
| 1152 | Ga0207664_10723154 | |||
| 1153 | Ga0207664_10793518 | |||
| 1154 | Ga0207690_10395457 | |||
| 1155 | Ga0207706_10931825 | |||
| 1156 | Ga0207686_10984417 | |||
| 1157 | Ga0207665_10000058 | |||
| 1158 | Ga0207665_10032871 | |||
| 1159 | Ga0207665_10239935 | |||
| 1160 | Ga0207665_11402783 | |||
| 1161 | Ga0207711_10542256 | |||
| 1162 | Ga0207711_12026139 | |||
| 1163 | Ga0207661_10013337 | |||
| 1164 | Ga0207661_10043491 | |||
| 1165 | Ga0207661_10357139 | |||
| 1166 | Ga0207661_10415553 | |||
| 1167 | Ga0207679_10623723 | |||
| 1168 | Ga0207679_11517636 | |||
| 1169 | Ga0207667_10267320 | |||
| 1170 | Ga0207667_10358667 | |||
| 1171 | Ga0207667_10379678 | |||
| 1172 | Ga0207667_10628149 | |||
| 1173 | Ga0207667_10699886 | |||
| 1174 | Ga0207667_11564708 | |||
| 1175 | Ga0207640_10552644 | |||
| 1176 | Ga0207640_12126129 | |||
| 1177 | Ga0207658_10308758 | |||
| 1178 | Ga0207677_11157105 | |||
| 1179 | Ga0207678_10210673 | |||
| 1180 | Ga0207702_10171687 | |||
| 1181 | Ga0207702_10295377 | |||
| 1182 | Ga0207702_10307601 | |||
| 1183 | Ga0207702_10471847 | |||
| 1184 | Ga0207702_11706308 | |||
| 1185 | Ga0207641_11465967 | |||
| 1186 | Ga0207674_10105204 | |||
| 1187 | Ga0207683_10178496 | |||
| 1188 | Ga0207698_10699438 | |||
| 1189 | Ga0268266_11022330 | |||
| 1190 | Ga0265337_1077593 | |||
| 1191 | Ga0265326_10029888 | |||
| 1192 | Ga0265326_10056070 | |||
| 1193 | Ga0265326_10182952 | |||
| 1194 | Ga0265319_1006086 | |||
| 1195 | Ga0265319_1015560 | |||
| 1196 | Ga0265319_1054021 | |||
| 1197 | Ga0265334_10001373 | |||
| 1198 | Ga0265334_10041503 | |||
| 1199 | Ga0265334_10343968 | |||
| 1200 | Ga0265318_10000445 | |||
| 1201 | Ga0265318_10022330 | |||
| 1202 | Ga0265318_10131928 | |||
| 1203 | Ga0265318_10173927 | |||
| 1204 | Ga0265322_10017548 | |||
| 1205 | Ga0265322_10018713 | |||
| 1206 | Ga0265322_10139951 | |||
| 1207 | Ga0265336_10022376 | |||
| 1208 | Ga0265336_10067211 | |||
| 1209 | Ga0265336_10208154 | |||
| 1210 | Ga0265338_10005247 | |||
| 1211 | Ga0265338_10012217 | |||
| 1212 | Ga0265338_10054285 | |||
| 1213 | Ga0265338_10949954 | |||
| 1214 | Ga0265338_11178258 | |||
| 1215 | Ga0265324_10017637 | |||
| 1216 | Ga0265324_10064889 | |||
| 1217 | Ga0265324_10268394 | |||
| 1218 | Ga0265330_10000848 | |||
| 1219 | Ga0265330_10080129 | |||
| 1220 | Ga0265330_10352814 | |||
| 1221 | Ga0265332_10022081 | |||
| 1222 | Ga0265332_10083172 | |||
| 1223 | Ga0265328_10020190 | |||
| 1224 | Ga0265328_10176962 | |||
| 1225 | Ga0265320_10029937 | |||
| 1226 | Ga0265320_10354939 | |||
| 1227 | Ga0265325_10002030 | |||
| 1228 | Ga0265325_10010380 | |||
| 1229 | Ga0265325_10276341 | |||
| 1230 | Ga0265329_10011823 | |||
| 1231 | Ga0265329_10300107 | |||
| 1232 | Ga0265340_10011912 | |||
| 1233 | Ga0265339_10007564 | |||
| 1234 | Ga0265339_10030343 | |||
| 1235 | Ga0265331_10000672 | |||
| 1236 | Ga0265327_10005507 | |||
| 1237 | Ga0265327_10064446 | |||
| 1238 | Ga0265327_10292339 | |||
| 1239 | Ga0265316_10012345 | |||
| 1240 | Ga0265316_10063567 | |||
| 1241 | Ga0265316_10259669 | |||
| 1242 | Ga0265316_10500916 | |||
| 1243 | Ga0265316_11159953 | |||
| 1244 | Ga0265313_10001111 | |||
| 1245 | Ga0265313_10012231 | |||
| 1246 | Ga0265314_10005359 | |||
| 1247 | Ga0265314_10008168 | |||
| 1248 | Ga0265314_10060908 | |||
| 1249 | Ga0265342_10019007 | |||
| 1250 | Ga0265342_10552246 | |||
| 1251 | Ga0307407_10010933 | |||
| 1252 | Ga0316583_10040598 | |||
| 1253 | Ga0373926_0056595 | |||
| 1254 | Ga0373940_0063553 | |||
| 1255 | Ga0373944_0004379 | |||
| 1256 | Ga0373923_0056394 | |||
| 1257 | Ga0373945_0006378 | |||
| 1258 | Ga0373953_0148036 | |||
| 1259 | Ga0373954_0393033 | |||
| 1260 | Ga0373956_0069795 | |||
| 1261 | Ga0373956_0479841 | |||
| 1262 | Ga0373957_0332505 | |||
| 1263 | Ga0373943_0001502 | |||
| 1264 | Ga0373946_0007649 | |||
| 1265 | Ga0373942_0098359 | |||
| 1266 | Ga0373924_0047791 | |||
| 1267 | Ga0373924_0363138 | |||
| 1268 | Ga0373931_0015830 | |||
| 1269 | Ga0373935_0115286 | |||
| 1270 | Ga0373927_0006226 | |||
| 1271 | Ga0373933_0049201 | |||
| 1272 | Ga0373933_0156228 | |||
| 1273 | Ga0373933_0624684 | |||
| 1274 | Ga0373947_0000205 | |||
| 1275 | Ga0373937_0001260 | |||
| 1276 | Ga0373937_0099169 | |||
| 1277 | Ga0373937_1340066 | |||
| 1278 | Ga0373925_0000604 | |||
| 1279 | Ga0395899_0028938 | |||
| 1280 | Ga0395899_0765033 | |||
| 1281 | Ga0395899_0874161 | |||
| 1282 | Ga0395900_0277671 | |||
| 1283 | Ga0395900_0568823 | |||
| 1284 | Ga0395900_0687863 | |||
| 1285 | Ga0395900_0790608 | |||
| 1286 | Ga0395900_1565799 | |||
| 1287 | Ga0395900_1672757 | |||
| 1288 | Ga0395898_0015109 | |||
| 1289 | Ga0395898_0036162 | |||
| 1290 | Ga0395898_0096550 | |||
| 1291 | Ga0395898_0100823 | |||
| 1292 | Ga0395898_0269006 | |||
| 1293 | Ga0395898_0558757 | |||
| 1294 | Ga0395898_1386555 | |||
| 1295 | Ga0395905_0041141 | |||
| 1296 | Ga0395905_0344636 | |||
| 1297 | Ga0395905_0665010 | |||
| 1298 | Ga0395901_0018078 | |||
| 1299 | Ga0395901_0135019 | |||
| 1300 | Ga0395901_0322376 | |||
| 1301 | Ga0395901_0577064 | |||
| 1302 | Ga0395901_0900131 | |||
| 1303 | Ga0436365_1007593 | |||
| 1304 | Ga0436360_0811625 | |||
| 1305 | Ga0436360_1150404 | |||
| 1306 | Ga0436363_0341490 | |||
| 1307 | Ga0439448_0137390 | |||
| 1308 | Ga0466969_0000355 | |||
| 1309 | Ga0466972_0025573 | |||
| 1310 | Ga0466972_0285894 | |||
| 1311 | Ga0466965_0134583 | |||
| 1312 | Ga0466965_0210503 | |||
| 1313 | Ga0466966_0562047 | |||
| 1314 | Ga0466961_0022159 | |||
| 1315 | Ga0466961_0032460 | |||
| 1316 | Ga0466961_0071190 | |||
| 1317 | Ga0466961_0526187 | |||
| 1318 | Ga0466961_0768929 | |||
| 1319 | Ga0466963_0000681 | |||
| 1320 | Ga0466963_0003498 | |||
| 1321 | Ga0466963_0006622 | |||
| 1322 | Ga0466963_0008446 | |||
| 1323 | Ga0466963_0012574 | |||
| 1324 | Ga0466963_0013056 | |||
| 1325 | Ga0466963_0016805 | |||
| 1326 | Ga0466963_0027798 | |||
| 1327 | Ga0466963_0029203 | |||
| 1328 | Ga0466963_0040197 | |||
| 1329 | Ga0466963_0063100 | |||
| 1330 | Ga0466963_0064023 | |||
| 1331 | Ga0466963_0102972 | |||
| 1332 | Ga0466963_0168839 | |||
| 1333 | Ga0466963_0191919 | |||
| 1334 | Ga0466963_0197925 | |||
| 1335 | Ga0466963_0463265 | |||
| 1336 | Ga0466964_0007474 | |||
| 1337 | Ga0466964_0011008 | |||
| 1338 | Ga0466964_0011587 | |||
| 1339 | Ga0466964_0027489 | |||
| 1340 | Ga0466964_0040009 | |||
| 1341 | Ga0466964_0177589 | |||
| 1342 | Ga0466964_0210240 | |||
| 1343 | Ga0466964_0542382 | |||
| 1344 | Ga0466971_0000871 | |||
| 1345 | Ga0466971_0008263 | |||
| 1346 | Ga0466971_0027045 | |||
| 1347 | Ga0466971_0064017 | |||
| 1348 | Ga0466971_0065501 | |||
| 1349 | Ga0466971_0144480 | |||
| 1350 | Ga0466971_0272952 | |||
| 1351 | Ga0466971_0344814 | |||
| 1352 | Ga0466968_0000558 | |||
| 1353 | Ga0466968_0001940 | |||
| 1354 | Ga0466968_0010694 | |||
| 1355 | Ga0466968_0031839 | |||
| 1356 | Ga0466968_0129463 | |||
| 1357 | Ga0466968_0141543 | |||
| 1358 | Ga0466968_0293966 | |||
| 1359 | Ga0466968_0702111 | |||
| 1360 | Ga0466970_0007395 | |||
| 1361 | Ga0466970_0013020 | |||
| 1362 | Ga0466970_0950967 | |||
| 1363 | Ga0466970_0971116 | |||
| 1364 | Ga0466957_0007410 | |||
| 1365 | Ga0466957_0010582 | |||
| 1366 | Ga0466957_0037247 | |||
| 1367 | Ga0466957_0037331 | |||
| 1368 | Ga0466957_0052052 | |||
| 1369 | Ga0466957_0058957 | |||
| 1370 | Ga0466957_0062153 | |||
| 1371 | Ga0466957_0125057 | |||
| 1372 | Ga0466957_0187904 | |||
| 1373 | Ga0466957_0252888 | |||
| 1374 | Ga0466957_1130571 | |||
| 1375 | Ga0466960_0268796 | |||
| 1376 | Ga0466960_0298831 | |||
| 1377 | Ga0466959_0044699 | |||
| 1378 | Ga0466959_0068671 | |||
| 1379 | Ga0466959_0078203 | |||
| 1380 | Ga0466959_0081667 | |||
| 1381 | Ga0451576_0801762 | |||
| 1382 | Ga0466958_0000764 | |||
| 1383 | Ga0466958_0001752 | |||
| 1384 | Ga0466958_0002962 | |||
| 1385 | Ga0466958_0017695 | |||
| 1386 | Ga0466958_0018345 | |||
| 1387 | Ga0466958_0106076 | |||
| 1388 | Ga0466958_0108075 | |||
| 1389 | Ga0466958_0229024 | |||
| 1390 | Ga0466958_0266778 | |||
| 1391 | Ga0466958_0361546 | |||
| 1392 | Ga0466967_0000389 | |||
| 1393 | Ga0466967_0000731 | |||
| 1394 | Ga0466967_0005921 | |||
| 1395 | Ga0466967_0006226 | |||
| 1396 | Ga0466967_0007562 | |||
| 1397 | Ga0466967_0009002 | |||
| 1398 | Ga0466967_0012850 | |||
| 1399 | Ga0466967_0021569 | |||
| 1400 | Ga0466967_0025723 | |||
| 1401 | Ga0466967_0034428 | |||
| 1402 | Ga0466967_0038192 | |||
| 1403 | Ga0466967_0046237 | |||
| 1404 | Ga0466967_0053380 | |||
| 1405 | Ga0466967_0060300 | |||
| 1406 | Ga0466967_0065924 | |||
| 1407 | Ga0466967_0099253 | |||
| 1408 | Ga0466967_0171992 | |||
| 1409 | Ga0466967_0219687 | |||
| 1410 | Ga0466967_0258561 | |||
| 1411 | Ga0466967_0271724 | |||
| 1412 | Ga0466967_0396511 | |||
| 1413 | Ga0466967_0493491 | |||
| 1414 | Ga0466967_0500396 | |||
| 1415 | Ga0466967_0579086 | |||
| 1416 | Ga0466967_0665714 | |||
| 1417 | Ga0466967_0678237 | |||
| 1418 | Ga0466967_0836289 | |||
| 1419 | Ga0466967_1737071 | |||
| 1420 | Ga0495592_0000082 | |||
| 1421 | Ga0495592_0011130 | |||
| 1422 | Ga0495592_0046987 | |||
| 1423 | Ga0495592_0167204 | |||
| 1424 | Ga0495592_0541453 | |||
| 1425 | Ga0495603_0005733 | |||
| 1426 | Ga0495629_0014936 | |||
| 1427 | Ga0495629_0030567 | |||
| 1428 | Ga0495629_0070915 | |||
| 1429 | Ga0495629_0087154 | |||
| 1430 | Ga0495629_0124488 | |||
| 1431 | Ga0495629_0247643 | |||
| 1432 | Ga0495641_0002942 | |||
| 1433 | Ga0495641_0043279 | |||
| 1434 | Ga0495651_0000080 | |||
| 1435 | Ga0495651_0348977 | |||
| 1436 | Ga0495651_1021676 | |||
| 1437 | Ga0495653_0015820 | |||
| 1438 | Ga0495653_0026113 | |||
| 1439 | Ga0495653_0320313 | |||
| 1440 | Ga0495580_0013385 | |||
| 1441 | Ga0495582_0000542 | |||
| 1442 | Ga0495582_0051670 | |||
| 1443 | Ga0495582_0128507 | |||
| 1444 | Ga0495639_0017281 | |||
| 1445 | Ga0495662_0000865 | |||
| 1446 | Ga0495662_0402041 | |||
| 1447 | Ga0495664_0003565 | |||
| 1448 | Ga0495664_0072238 | |||
| 1449 | Ga0495664_0072944 | |||
| 1450 | Ga0495664_0503693 | |||
| 1451 | Ga0495594_0119730 | |||
| 1452 | Ga0495608_0045059 | |||
| 1453 | Ga0495608_0073099 | |||
| 1454 | Ga0495608_0225488 | |||
| 1455 | Ga0495608_0584575 | |||
| 1456 | Ga0495618_0002207 | |||
| 1457 | Ga0495618_0017806 | |||
| 1458 | Ga0495618_0266850 | |||
| 1459 | Ga0495618_0331381 | |||
| 1460 | Ga0495618_0419152 | |||
| 1461 | Ga0495618_0731731 | |||
| 1462 | Ga0495628_0000292 | |||
| 1463 | Ga0495628_0015841 | |||
| 1464 | Ga0495628_0193418 | |||
| 1465 | Ga0495628_0425100 | |||
| 1466 | Ga0495630_0024662 | |||
| 1467 | Ga0495630_0145538 | |||
| 1468 | Ga0495630_0318690 | |||
| 1469 | Ga0495630_1465434 | |||
| 1470 | Ga0495644_0024379 | |||
| 1471 | Ga0495666_0000436 | |||
| 1472 | Ga0495652_0016575 | |||
| 1473 | Ga0495652_0044483 | |||
| 1474 | Ga0495652_0171146 | |||
| 1475 | Ga0495652_0229467 | |||
| 1476 | Ga0495652_0444543 | |||
| 1477 | Ga0495652_0555673 | |||
| 1478 | Ga0495665_0000038 | |||
| 1479 | Ga0495640_0003773 | |||
| 1480 | Ga0495640_0175938 | |||
| 1481 | Ga0495640_0272433 | |||
| 1482 | Ga0495586_0341814 | |||
| 1483 | Ga0495587_0000270 | |||
| 1484 | Ga0495609_0263120 | |||
| 1485 | Ga0495645_0000038 | |||
| 1486 | Ga0495645_0022830 | |||
| 1487 | Ga0495645_0699421 | |||
| 1488 | Ga0495667_0001874 | |||
| 1489 | Ga0495667_0048333 | |||
| 1490 | Ga0495667_0373639 | |||
| 1491 | Ga0495667_0491046 | |||
| 1492 | Ga0495656_0014109 | |||
| 1493 | Ga0495634_0058051 | |||
| 1494 | Ga0495634_0060577 | |||
| 1495 | Ga0495634_0686377 | |||
| 1496 | Ga0495611_0118897 | |||
| 1497 | Ga0495635_0011919 | |||
| 1498 | Ga0495635_0022423 | |||
| 1499 | Ga0495635_0131687 | |||
| 1500 | Ga0495635_0195306 | |||
| 1501 | Ga0495635_0223171 | |||
| 1502 | Ga0495635_0635875 | |||
| 1503 | Ga0495657_0009237 | |||
| 1504 | Ga0495657_0014834 | |||
| 1505 | Ga0495599_0000142 | |||
| 1506 | Ga0495599_0009522 | |||
| 1507 | Ga0495599_0114963 | |||
| 1508 | Ga0495623_0000210 | |||
| 1509 | Ga0495623_0167622 | |||
| 1510 | Ga0495646_0000729 | |||
| 1511 | Ga0495646_0191919 | |||
| 1512 | Ga0495646_0210616 | |||
| 1513 | Ga0495646_0294802 | |||
| 1514 | Ga0495647_0000362 | |||
| 1515 | Ga0495647_0076252 | |||
| 1516 | Ga0495647_0478771 | |||
| 1517 | Ga0495658_0000950 | |||
| 1518 | Ga0495658_0039510 | |||
| 1519 | Ga0495658_0271355 | |||
| 1520 | Ga0495613_0003038 | |||
| 1521 | Ga0495613_0135818 | |||
| 1522 | Ga0495613_0336305 | |||
| 1523 | Ga0495613_0482618 | |||
| 1524 | Ga0495624_0003198 | |||
| 1525 | Ga0495600_0072378 | |||
| 1526 | Ga0495600_0103629 | |||
| 1527 | Ga0495600_0243982 | |||
| 1528 | Ga0495600_0383877 | |||
| 1529 | Ga0495600_0539647 | |||
| 1530 | Ga0495581_0000231 | |||
| 1531 | Ga0495604_0000043 | |||
| 1532 | Ga0495604_0150391 | |||
| 1533 | Ga0495636_0101452 | |||
| 1534 | Ga0495674_0135341 | |||
| 1535 | Ga0495674_0245792 | |||
| 1536 | Ga0495674_0262865 | |||
| 1537 | Ga0495674_0268781 | |||
| 1538 | Ga0495676_0007522 | |||
| 1539 | Ga0495676_0083877 | |||
| 1540 | Ga0495676_0243477 | |||
| 1541 | Ga0495680_0029866 | |||
| 1542 | Ga0495680_0046561 | |||
| 1543 | Ga0495680_0125776 | |||
| 1544 | Ga0495680_0323544 | |||
| 1545 | Ga0495680_0391241 | |||
| 1546 | Ga0495675_0826210 | |||
| 1547 | Ga0495677_0058436 | |||
| 1548 | Ga0495684_0022803 | |||
| 1549 | Ga0495684_0035692 | |||
| 1550 | Ga0495684_0073967 | |||
| 1551 | Ga0495684_0084343 | |||
| 1552 | Ga0495684_0132819 | |||
| 1553 | Ga0495684_0259566 | |||
| 1554 | Ga0495593_0001951 | |||
| 1555 | Ga0495593_0176567 | |||
| 1556 | Ga0495602_0007946 | |||
| 1557 | Ga0495602_0009850 | |||
| 1558 | Ga0495602_0934739 | |||
| 1559 | Ga0495614_0000113 | |||
| 1560 | Ga0496100_0017052 | |||
| 1561 | Ga0496100_0092606 | |||
| 1562 | Ga0496100_0101807 | |||
| 1563 | Ga0496101_0002780 | |||
| 1564 | Ga0496101_0093389 | |||
| 1565 | Ga0496101_0099239 | |||
| 1566 | Ga0496101_0365561 | |||
| 1567 | Ga0496102_0017437 | |||
| 1568 | Ga0496102_0113263 | |||
| 1569 | Ga0496102_0486672 | |||
| 1570 | Ga0496102_0789359 | |||
| 1571 | Ga0496102_1870604 | |||
| 1572 | Ga0496103_0004195 | |||
| 1573 | Ga0496103_0061563 | |||
| 1574 | Ga0496103_1032950 | |||
| 1575 | Ga0496104_0005694 | |||
| 1576 | Ga0496104_0044993 | |||
| 1577 | Ga0496104_0163692 | |||
| 1578 | Ga0496105_0004010 | |||
| 1579 | Ga0496105_0009335 | |||
| 1580 | Ga0496105_0127767 | |||
| 1581 | Ga0496105_0157182 | |||
| 1582 | Ga0496105_0199059 | |||
| 1583 | Ga0496106_0003405 | |||
| 1584 | Ga0496106_0005415 | |||
| 1585 | Ga0496106_0228123 | |||
| 1586 | Ga0496106_1358096 | |||
| 1587 | Ga0496107_0000477 | |||
| 1588 | Ga0496107_0105416 | |||
| 1589 | Ga0496107_0292411 | |||
| 1590 | Ga0496107_0850012 | |||
| 1591 | Ga0496108_0015425 | |||
| 1592 | Ga0496108_0113425 | |||
| 1593 | Ga0496108_0307247 | |||
| 1594 | Ga0496108_0382636 | |||
| 1595 | Ga0496109_0049137 | |||
| 1596 | Ga0496109_0105869 | |||
| 1597 | Ga0496109_0123648 | |||
| 1598 | Ga0496109_0208516 | |||
| 1599 | Ga0496109_0416383 | |||
| 1600 | Ga0496110_0007150 | |||
| 1601 | Ga0496110_0273171 | |||
| 1602 | Ga0496110_0974690 | |||
| 1603 | Ga0496111_0028127 | |||
| 1604 | Ga0496111_0067102 | |||
| 1605 | Ga0496111_0121050 | |||
| 1606 | Ga0496111_0340912 | |||
| 1607 | Ga0496112_0035466 | |||
| 1608 | Ga0496112_0041789 | |||
| 1609 | Ga0496112_0110285 | |||
| 1610 | Ga0496112_0150282 | |||
| 1611 | Ga0496112_0154045 | |||
| 1612 | Ga0496112_0175058 | |||
| 1613 | Ga0496112_0404329 | |||
| 1614 | Ga0496112_0463572 | |||
| 1615 | Ga0496112_0605156 | |||
| 1616 | Ga0496112_1053679 | |||
| 1617 | Ga0496113_0034002 | |||
| 1618 | Ga0496113_0066331 | |||
| 1619 | Ga0496113_0821813 | |||
| 1620 | Ga0496114_0046993 | |||
| 1621 | Ga0496114_0263395 | |||
| 1622 | Ga0496115_0016183 | |||
| 1623 | Ga0496115_0044693 | |||
| 1624 | Ga0496115_0135626 | |||
| 1625 | Ga0496115_0152340 | |||
| 1626 | Ga0496115_0590015 | |||
| 1627 | Ga0501067_0010948 | |||
| 1628 | Ga0501067_0021693 | |||
| 1629 | Ga0501067_0208348 | |||
| 1630 | Ga0501067_0345387 | |||
| 1631 | Ga0501069_0077838 | |||
| 1632 | Ga0501069_0634238 | |||
| 1633 | Ga0501070_0037683 | |||
| 1634 | Ga0501070_0051589 | |||
| 1635 | Ga0501070_0373503 | |||
| 1636 | Ga0501072_0018261 | |||
| 1637 | Ga0501073_0058214 | |||
| 1638 | Ga0501073_0067035 | |||
| 1639 | Ga0501074_0013035 | |||
| 1640 | Ga0501079_0011330 | |||
| 1641 | Ga0501080_0078654 | |||
| 1642 | Ga0501083_0000576 | |||
| 1643 | Ga0501044_0567080 | |||
| 1644 | nmdc:mga08y16_138966_c1 | |||
| 1645 | nmdc:mga0n895_1676_c1 | |||
| 1646 | nmdc:mga08x19_66461_c1 | |||
| 1647 | nmdc:mga0a205_468051_c1 | |||
| 1648 | Ga0495601_0013020 | |||
| 1649 | Ga0495601_0018667 | |||
| 1650 | Ga0495601_0108968 | |||
| 1651 | Ga0495601_0137719 | |||
| 1652 | Ga0495612_0021958 | |||
| 1653 | Ga0495612_0047744 | |||
| 1654 | Ga0495612_0179862 | |||
| 1655 | Ga0495595_0056434 | |||
| 1656 | Ga0495595_0096164 | |||
| 1657 | Ga0495595_0604938 | |||
| 1658 | Ga0495619_0011810 | |||
| 1659 | Ga0495619_0037711 | |||
| 1660 | Ga0495619_0191282 | |||
| 1661 | Ga0495619_0216313 | |||
| 1662 | Ga0495619_1205494 | |||
| 1663 | Ga0500566_0051165 | |||
| 1664 | Ga0500657_177642 | |||
| 1665 | Ga0501082_0304960 | |||
| 1666 | Ga0466962_0000600 | |||
| 1667 | Ga0466962_0001813 | |||
| 1668 | Ga0466962_0002868 | |||
| 1669 | Ga0466962_0025185 | |||
| 1670 | Ga0466962_0052078 | |||
| 1671 | Ga0466962_0081677 | |||
| 1672 | Ga0466962_0278524 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bze-assembly1.cif.gz_A-2 | structure of bacillus subtilis hxlr, k13a mutant | 0.9252 | 12 | 104 |
| 7bzd-assembly1.cif.gz_A-2 | structure of bacillus subtilis hxlr, wild type | 0.9198 | 12 | 104 |
| 4hqe-assembly1.cif.gz_A | the crystal structure of qsrr-dna complex | 0.9093 | 6 | 105 |
| 5hs9-assembly1.cif.gz_A | crystal structure of the quinone-bound yodb from b. subtilis | 0.909 | 12 | 105 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9057 | 25 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WMG3_11_158_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9157 | 11 | 101 | 1.10.10.10 |
| 5hs9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.909 | 12 | 105 | 1.10.10.10 |
| 5j6xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9057 | 25 | 86 | 1.10.10.10 |
| 5hs7B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8955 | 8 | 102 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8933 | 25 | 85 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522XTI4-F1-model_v4 | Transcriptional regulator | 0.9614 | 21 | 102 |
GO:0003677
|
| AF-A0A2H5XLK3-F1-model_v4 | deleted | 0.9521 | 13 | 101 |
|
| AF-A0A256A6T4-F1-model_v4 | HTH hxlR-type domain-containing protein | 0.9464 | 13 | 103 |
GO:0003677
GO:0005737 GO:0016020 |
| AF-A0A196P6J3-F1-model_v4 | Transcriptional regulator | 0.946 | 14 | 102 |
GO:0003677
|
| AF-A0A2U1EAD0-F1-model_v4 | HxlR family transcriptional regulator | 0.9452 | 13 | 103 |
GO:0003677
|