F482883

General Info

Members Datasets Scaffolds Average Seq Length
836 250 835 173

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_11080176|Ga0157369_110801761
Length 204
Sequence VRLLGASANAQRFFAAPNISSTVCKDSIMADQEPTPGGNGSGEPGDEPQVSILAQYIKDLSVENPSAPQVFQWQVQPTLDVQFNINLEKVADDVHEIMLKIEVTARSENGVHFVVDLSYAGLFGLRNMPEEALPPFLLIEAPRLMFPFVRQIIADAVINTGFPPLLLDPIDFASAYVAQLQAAQQGGESNGSDEQSASDSPSEA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
216 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
220 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
242 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
243 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
244 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 4.55
Rhizosphere 94.98
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4799473 2162886012 Bacteria 1343
2 JGI24746J21847_1002084 3300001977 Bacteria 3196
3 JGI24740J21852_10096864 3300001979 Bacteria 755
4 JGI24739J22299_10003420 3300001989 Bacteria 6056
5 JGI24735J21928_10013884 3300002067 Bacteria 2527
6 JGI24738J21930_10000035 3300002075 Bacteria 25714
7 JGI24749J21850_1003195 3300002076 Bacteria 2288
8 JGI24033J26618_1020308 3300002155 Bacteria 847
9 JGI24034J26672_10026050 3300002239 Bacteria 937
10 JGI24742J22300_10063245 3300002244 Bacteria 682
11 JGI24751J29686_10030402 3300002459 Bacteria 1120
12 Ga0065165_1007899 3300005262 Bacteria 5103
13 Ga0065712_10152941 3300005290 Bacteria 1356
14 Ga0065715_10000359 3300005293 Bacteria 22373
15 Ga0065707_10246837 3300005295 Bacteria 1138
16 Ga0070658_10039227 3300005327 Bacteria 3820
17 Ga0070658_10042549 3300005327 Bacteria 3669
18 Ga0070658_10080678 3300005327 Bacteria 2672
19 Ga0070658_10090495 3300005327 Bacteria 2521
20 Ga0070658_10189446 3300005327 Bacteria 1733
21 Ga0070658_10267703 3300005327 Bacteria 1452
22 Ga0070676_10020596 3300005328 Bacteria 3685
23 Ga0070676_10134996 3300005328 Bacteria 1564
24 Ga0070676_10193920 3300005328 Bacteria 1328
25 Ga0070676_10203435 3300005328 Bacteria 1299
26 Ga0070676_10265174 3300005328 Bacteria 1151
27 Ga0070676_10314617 3300005328 Bacteria 1066
28 Ga0070683_100514256 3300005329 Bacteria 1144
29 Ga0070690_100233144 3300005330 Bacteria 1295
30 Ga0070690_100387312 3300005330 Bacteria 1023
31 Ga0070690_100529427 3300005330 Bacteria 886
32 Ga0070670_100021668 3300005331 Bacteria 5525
33 Ga0070670_100023463 3300005331 Bacteria 5310
34 Ga0070670_100151406 3300005331 Bacteria 2007
35 Ga0070670_100401835 3300005331 Bacteria 1209
36 Ga0070670_100645807 3300005331 Bacteria 949
37 Ga0070677_10000999 3300005333 Bacteria 9157
38 Ga0070677_10208222 3300005333 Bacteria 948
39 Ga0068869_100045744 3300005334 Bacteria 3153
40 Ga0068869_100091921 3300005334 Bacteria 2283
41 Ga0068869_100455567 3300005334 Bacteria 1061
42 Ga0068869_100916811 3300005334 Bacteria 759
43 Ga0070666_10043591 3300005335 Bacteria 3004
44 Ga0070666_10120410 3300005335 Bacteria 1820
45 Ga0070680_100168601 3300005336 Bacteria 1842
46 Ga0070680_101512107 3300005336 Bacteria 581
47 Ga0070682_100286970 3300005337 Bacteria 1202
48 Ga0068868_100000881 3300005338 Bacteria 20375
49 Ga0068868_100165723 3300005338 Bacteria 1828
50 Ga0068868_100316980 3300005338 Bacteria 1328
51 Ga0070660_100004031 3300005339 Bacteria 10144
52 Ga0070660_100006513 3300005339 Bacteria 8099
53 Ga0070660_100010556 3300005339 Bacteria 6527
54 Ga0070660_100022082 3300005339 Bacteria 4702
55 Ga0070660_100080308 3300005339 Bacteria 2559
56 Ga0070660_100121153 3300005339 Bacteria 2088
57 Ga0070660_100306187 3300005339 Bacteria 1303
58 Ga0070689_100237840 3300005340 Bacteria 1499
59 Ga0070689_100874312 3300005340 Bacteria 794
60 Ga0070687_100294506 3300005343 Bacteria 1027
61 Ga0070687_100378139 3300005343 Bacteria 922
62 Ga0070661_100077892 3300005344 Bacteria 2445
63 Ga0070661_100079500 3300005344 Bacteria 2420
64 Ga0070661_100092146 3300005344 Bacteria 2245
65 Ga0070661_100118586 3300005344 Bacteria 1980
66 Ga0070661_100221448 3300005344 Bacteria 1451
67 Ga0070661_100414310 3300005344 Bacteria 1067
68 Ga0070661_100453561 3300005344 Bacteria 1020
69 Ga0070661_100775135 3300005344 Bacteria 785
70 Ga0070661_100940087 3300005344 Bacteria 715
71 Ga0070692_10024658 3300005345 Bacteria 2958
72 Ga0070692_10064690 3300005345 Bacteria 1934
73 Ga0070692_10462774 3300005345 Bacteria 814
74 Ga0070668_100010358 3300005347 Bacteria 6924
75 Ga0070668_100027610 3300005347 Bacteria 4309
76 Ga0070668_100032292 3300005347 Bacteria 3984
77 Ga0070668_100161674 3300005347 Bacteria 1817
78 Ga0070668_100304141 3300005347 Bacteria 1338
79 Ga0070668_100430959 3300005347 Bacteria 1130
80 Ga0070668_100452668 3300005347 Bacteria 1104
81 Ga0070669_100002615 3300005353 Bacteria 13015
82 Ga0070669_100030619 3300005353 Bacteria 3884
83 Ga0070669_100074454 3300005353 Bacteria 2517
84 Ga0070669_100081765 3300005353 Bacteria 2407
85 Ga0070669_100821550 3300005353 Bacteria 791
86 Ga0070669_101381627 3300005353 Bacteria 611
87 Ga0070675_100004653 3300005354 Bacteria 10479
88 Ga0070675_100163451 3300005354 Bacteria 1916
89 Ga0070675_101107614 3300005354 Bacteria 728
90 Ga0070671_100004406 3300005355 Bacteria 11129
91 Ga0070671_100013680 3300005355 Bacteria 6544
92 Ga0070671_100014729 3300005355 Bacteria 6321
93 Ga0070671_100035593 3300005355 Bacteria 4125
94 Ga0070671_100040586 3300005355 Bacteria 3866
95 Ga0070671_100125193 3300005355 Bacteria 2164
96 Ga0070671_100187950 3300005355 Bacteria 1750
97 Ga0070671_100308212 3300005355 Bacteria 1348
98 Ga0070671_100643322 3300005355 Bacteria 918
99 Ga0070674_100002641 3300005356 Bacteria 9913
100 Ga0070674_100046481 3300005356 Bacteria 2970
101 Ga0070674_100060210 3300005356 Bacteria 2646
102 Ga0070673_100003488 3300005364 Bacteria 9795
103 Ga0070673_100065813 3300005364 Bacteria 2893
104 Ga0070673_100102861 3300005364 Bacteria 2356
105 Ga0070673_100144859 3300005364 Bacteria 2007
106 Ga0070673_100165338 3300005364 Bacteria 1884
107 Ga0070673_100479821 3300005364 Bacteria 1122
108 Ga0070673_101297026 3300005364 Bacteria 684
109 Ga0070688_100171660 3300005365 Bacteria 1497
110 Ga0070659_100001058 3300005366 Bacteria 20125
111 Ga0070659_100001497 3300005366 Bacteria 16828
112 Ga0070659_100001672 3300005366 Bacteria 15938
113 Ga0070659_100197158 3300005366 Bacteria 1656
114 Ga0070659_100329388 3300005366 Bacteria 1278
115 Ga0070659_100335773 3300005366 Bacteria 1265
116 Ga0070659_100355688 3300005366 Bacteria 1229
117 Ga0070667_100003302 3300005367 Bacteria 13792
118 Ga0070667_100003455 3300005367 Bacteria 13460
119 Ga0070667_100040579 3300005367 Bacteria 3903
120 Ga0070667_100056316 3300005367 Bacteria 3321
121 Ga0070667_100063842 3300005367 Bacteria 3122
122 Ga0070667_100068000 3300005367 Bacteria 3030
123 Ga0070667_100073795 3300005367 Bacteria 2909
124 Ga0070667_100331256 3300005367 Bacteria 1375
125 Ga0070667_100588176 3300005367 Bacteria 1025
126 Ga0070709_10004923 3300005434 Bacteria 7213
127 Ga0070714_100045950 3300005435 Bacteria 3702
128 Ga0070714_100048939 3300005435 Bacteria 3597
129 Ga0070714_101222361 3300005435 Bacteria 733
130 Ga0070713_100041173 3300005436 Bacteria 3762
131 Ga0070705_100395338 3300005440 Bacteria 1022
132 Ga0070700_100034056 3300005441 Bacteria 3073
133 Ga0070694_100287168 3300005444 Bacteria 1256
134 Ga0070694_100348458 3300005444 Bacteria 1147
135 Ga0070663_100006460 3300005455 Bacteria 7055
136 Ga0070663_100028142 3300005455 Bacteria 3823
137 Ga0070663_100100509 3300005455 Bacteria 2157
138 Ga0070663_100258189 3300005455 Bacteria 1381
139 Ga0070663_100266408 3300005455 Bacteria 1360
140 Ga0070663_100307328 3300005455 Bacteria 1271
141 Ga0070663_100348667 3300005455 Bacteria 1198
142 Ga0070663_100396648 3300005455 Bacteria 1127
143 Ga0070663_100794110 3300005455 Bacteria 811
144 Ga0070678_100132696 3300005456 Bacteria 1981
145 Ga0070662_100002895 3300005457 Bacteria 10656
146 Ga0070662_100008482 3300005457 Bacteria 6706
147 Ga0070662_100050029 3300005457 Bacteria 3014
148 Ga0070662_100053901 3300005457 Bacteria 2913
149 Ga0070662_100070347 3300005457 Bacteria 2578
150 Ga0070662_100177610 3300005457 Bacteria 1676
151 Ga0070662_100251782 3300005457 Bacteria 1420
152 Ga0070662_100327368 3300005457 Bacteria 1251
153 Ga0070681_10149323 3300005458 Bacteria 2264
154 Ga0070681_10427998 3300005458 Bacteria 1236
155 Ga0068867_100005296 3300005459 Bacteria 9108
156 Ga0068867_100006073 3300005459 Bacteria 8562
157 Ga0068867_100099499 3300005459 Bacteria 2219
158 Ga0068867_100120324 3300005459 Bacteria 2028
159 Ga0068867_100155741 3300005459 Bacteria 1798
160 Ga0068867_100156551 3300005459 Bacteria 1794
161 Ga0068867_100728036 3300005459 Bacteria 878
162 Ga0070685_10131747 3300005466 Bacteria 1564
163 Ga0070679_100129150 3300005530 Bacteria 2508
164 Ga0070679_100303524 3300005530 Bacteria 1547
165 Ga0070679_100418171 3300005530 Bacteria 1286
166 Ga0068853_100007792 3300005539 Bacteria 8589
167 Ga0068853_100033639 3300005539 Bacteria 4350
168 Ga0068853_100118282 3300005539 Bacteria 2361
169 Ga0068853_100185963 3300005539 Bacteria 1886
170 Ga0070672_100003490 3300005543 Bacteria 10188
171 Ga0070672_100008903 3300005543 Bacteria 6895
172 Ga0070672_100081691 3300005543 Bacteria 2591
173 Ga0070672_100109649 3300005543 Bacteria 2248
174 Ga0070672_100457398 3300005543 Bacteria 1100
175 Ga0070672_100482430 3300005543 Bacteria 1071
176 Ga0070672_100619425 3300005543 Bacteria 944
177 Ga0070686_100519189 3300005544 Bacteria 927
178 Ga0070686_100611490 3300005544 Bacteria 860
179 Ga0070695_100329580 3300005545 Bacteria 1137
180 Ga0070696_100271458 3300005546 Bacteria 1290
181 Ga0070693_100060368 3300005547 Bacteria 2201
182 Ga0070693_100075771 3300005547 Bacteria 1993
183 Ga0070693_100183163 3300005547 Bacteria 1350
184 Ga0070693_100782394 3300005547 Bacteria 706
185 Ga0070665_100012854 3300005548 Bacteria 8428
186 Ga0070665_100274026 3300005548 Bacteria 1689
187 Ga0070665_100628837 3300005548 Bacteria 1086
188 Ga0070665_100969566 3300005548 Bacteria 863
189 Ga0070665_101347760 3300005548 Bacteria 723
190 Ga0068855_100031999 3300005563 Bacteria 6280
191 Ga0068855_100554548 3300005563 Bacteria 1244
192 Ga0070664_100025432 3300005564 Bacteria 4907
193 Ga0070664_100029545 3300005564 Bacteria 4570
194 Ga0070664_100035533 3300005564 Bacteria 4183
195 Ga0070664_100039633 3300005564 Bacteria 3970
196 Ga0070664_100047598 3300005564 Bacteria 3623
197 Ga0070664_100066220 3300005564 Bacteria 3084
198 Ga0070664_100115285 3300005564 Bacteria 2348
199 Ga0070664_100135938 3300005564 Bacteria 2161
200 Ga0070664_100175131 3300005564 Bacteria 1904
201 Ga0070664_100182252 3300005564 Bacteria 1867
202 Ga0068857_100003503 3300005577 Bacteria 13106
203 Ga0068857_100045474 3300005577 Bacteria 3895
204 Ga0068857_100051053 3300005577 Bacteria 3667
205 Ga0068857_100219570 3300005577 Bacteria 1736
206 Ga0068857_101142212 3300005577 Bacteria 753
207 Ga0068854_100004302 3300005578 Bacteria 8970
208 Ga0068854_100037092 3300005578 Bacteria 3419
209 Ga0068854_100071112 3300005578 Bacteria 2544
210 Ga0068854_100100937 3300005578 Bacteria 2163
211 Ga0068854_100388055 3300005578 Bacteria 1152
212 Ga0068854_100545485 3300005578 Bacteria 983
213 Ga0068856_100033259 3300005614 Bacteria 5048
214 Ga0068856_100034293 3300005614 Bacteria 4971
215 Ga0068856_100080624 3300005614 Bacteria 3228
216 Ga0068856_100119211 3300005614 Bacteria 2640
217 Ga0068856_100327431 3300005614 Bacteria 1550
218 Ga0068856_100394677 3300005614 Bacteria 1403
219 Ga0068856_100753644 3300005614 Bacteria 994
220 Ga0070702_100289376 3300005615 Bacteria 1128
221 Ga0070702_100622095 3300005615 Bacteria 813
222 Ga0068852_100001990 3300005616 Bacteria 13925
223 Ga0068852_100024314 3300005616 Bacteria 4894
224 Ga0068852_100050120 3300005616 Bacteria 3576
225 Ga0068852_100068158 3300005616 Bacteria 3113
226 Ga0068852_100256482 3300005616 Bacteria 1677
227 Ga0068852_100722874 3300005616 Bacteria 1007
228 Ga0068859_100008163 3300005617 Bacteria 10621
229 Ga0068859_100012474 3300005617 Bacteria 8547
230 Ga0068859_100036370 3300005617 Bacteria 4943
231 Ga0068859_100142831 3300005617 Bacteria 2467
232 Ga0068859_100162923 3300005617 Bacteria 2309
233 Ga0068859_100164555 3300005617 Bacteria 2298
234 Ga0068859_101131378 3300005617 Bacteria 862
235 Ga0068859_101265103 3300005617 Bacteria 813
236 Ga0068864_100003128 3300005618 Bacteria 13675
237 Ga0068864_100221533 3300005618 Bacteria 1746
238 Ga0068864_100290357 3300005618 Bacteria 1529
239 Ga0068866_10137169 3300005718 Bacteria 1399
240 Ga0068866_10348395 3300005718 Bacteria 940
241 Ga0068866_10412079 3300005718 Bacteria 874
242 Ga0068861_100004768 3300005719 Bacteria 9116
243 Ga0068861_100320117 3300005719 Bacteria 1350
244 Ga0068861_100326971 3300005719 Bacteria 1337
245 Ga0068861_100414096 3300005719 Bacteria 1199
246 Ga0068861_100440753 3300005719 Bacteria 1165
247 Ga0068861_100602286 3300005719 Bacteria 1009
248 Ga0068851_10024620 3300005834 Bacteria 2948
249 Ga0068851_10069144 3300005834 Bacteria 1823
250 Ga0068851_10099492 3300005834 Bacteria 1541
251 Ga0068851_10107123 3300005834 Bacteria 1489
252 Ga0068870_10073710 3300005840 Bacteria 1868
253 Ga0068870_10129155 3300005840 Bacteria 1466
254 Ga0068863_100037056 3300005841 Bacteria 4644
255 Ga0068863_100082035 3300005841 Bacteria 3055
256 Ga0068863_100411949 3300005841 Bacteria 1323
257 Ga0068863_100502325 3300005841 Bacteria 1194
258 Ga0068863_100528036 3300005841 Bacteria 1164
259 Ga0068863_100546393 3300005841 Bacteria 1143
260 Ga0068858_100005468 3300005842 Bacteria 12438
261 Ga0068858_100005690 3300005842 Bacteria 12183
262 Ga0068858_100015129 3300005842 Bacteria 7256
263 Ga0068858_100017238 3300005842 Bacteria 6776
264 Ga0068858_100022221 3300005842 Bacteria 5923
265 Ga0068860_100012703 3300005843 Bacteria 8285
266 Ga0068860_100059624 3300005843 Bacteria 3628
267 Ga0068860_100388980 3300005843 Bacteria 1378
268 Ga0068860_100697212 3300005843 Bacteria 1025
269 Ga0068862_100005443 3300005844 Bacteria 10639
270 Ga0068862_100009248 3300005844 Bacteria 8159
271 Ga0068862_100009717 3300005844 Bacteria 7951
272 Ga0068862_100063009 3300005844 Bacteria 3190
273 Ga0068862_100128028 3300005844 Bacteria 2243
274 Ga0068862_100721894 3300005844 Bacteria 967
275 Ga0070716_100044247 3300006173 Bacteria 2493
276 Ga0070712_100619233 3300006175 Bacteria 917
277 Ga0097621_100014323 3300006237 Bacteria 5932
278 Ga0097621_100218325 3300006237 Bacteria 1660
279 Ga0068871_100006417 3300006358 Bacteria 8321
280 Ga0068871_100105553 3300006358 Bacteria 2364
281 Ga0068871_100112809 3300006358 Bacteria 2288
282 Ga0068871_100125634 3300006358 Bacteria 2171
283 Ga0075433_10011424 3300006852 Bacteria 7152
284 Ga0075434_100510961 3300006871 Bacteria 1222
285 Ga0075434_100791979 3300006871 Bacteria 964
286 Ga0068865_100033541 3300006881 Bacteria 3438
287 Ga0068865_100157238 3300006881 Bacteria 1730
288 Ga0068865_100251528 3300006881 Bacteria 1395
289 Ga0068865_100329609 3300006881 Bacteria 1230
290 Ga0068865_100731295 3300006881 Bacteria 848
291 Ga0075436_100213878 3300006914 Bacteria 1367
292 Ga0097620_100008163 3300006931 Bacteria 10621
293 Ga0097620_100012475 3300006931 Bacteria 8547
294 Ga0097620_100036370 3300006931 Bacteria 4943
295 Ga0097620_100142837 3300006931 Bacteria 2467
296 Ga0097620_100162921 3300006931 Bacteria 2309
297 Ga0097620_100164561 3300006931 Bacteria 2298
298 Ga0097620_101131388 3300006931 Bacteria 862
299 Ga0097620_101264927 3300006931 Bacteria 813
300 Ga0075435_100261170 3300007076 Bacteria 1476
301 Ga0105240_10109964 3300009093 Bacteria 3336
302 Ga0111539_10072986 3300009094 Bacteria 4046
303 Ga0111539_10736500 3300009094 Bacteria 1147
304 Ga0105245_10000285 3300009098 Bacteria 48237
305 Ga0105245_10021177 3300009098 Bacteria 5701
306 Ga0114129_10357020 3300009147 Bacteria 1935
307 Ga0105241_10042296 3300009174 Bacteria 3446
308 Ga0105241_10144371 3300009174 Bacteria 1941
309 Ga0105248_10020125 3300009177 Bacteria 7394
310 Ga0105248_10046924 3300009177 Bacteria 4843
311 Ga0105248_10051371 3300009177 Bacteria 4625
312 Ga0105248_10088873 3300009177 Bacteria 3477
313 Ga0105248_10197743 3300009177 Bacteria 2265
314 Ga0105248_10608041 3300009177 Bacteria 1233
315 Ga0105248_11964412 3300009177 Bacteria 664
316 Ga0105237_10024240 3300009545 Bacteria 6208
317 Ga0105238_10110443 3300009551 Bacteria 2730
318 Ga0105238_10611228 3300009551 Bacteria 1098
319 Ga0105238_10743978 3300009551 Bacteria 994
320 Ga0105249_10010129 3300009553 Bacteria 8276
321 Ga0105249_10024423 3300009553 Bacteria 5432
322 Ga0105249_10113737 3300009553 Bacteria 2562
323 Ga0105249_10125011 3300009553 Bacteria 2448
324 Ga0105249_10309443 3300009553 Bacteria 1587
325 Ga0105249_10338919 3300009553 Bacteria 1520
326 Ga0105249_10384045 3300009553 Bacteria 1431
327 Ga0105239_10064925 3300010375 Bacteria 4008
328 Ga0105239_11480589 3300010375 Unclassified 784
329 Ga0105246_10012160 3300011119 Bacteria 5365
330 Ga0105246_10156921 3300011119 Bacteria 1729
331 Ga0157373_10011849 3300013100 Bacteria 6405
332 Ga0157373_10012019 3300013100 Bacteria 6364
333 Ga0157373_10016553 3300013100 Bacteria 5376
334 Ga0157373_10030375 3300013100 Bacteria 3888
335 Ga0157373_10116265 3300013100 Bacteria 1880
336 Ga0157373_10185086 3300013100 Bacteria 1467
337 Ga0157371_10002316 3300013102 Bacteria 18311
338 Ga0157371_10263314 3300013102 Bacteria 1243
339 Ga0157371_10366232 3300013102 Bacteria 1051
340 Ga0157370_10134409 3300013104 Bacteria 2306
341 Ga0157370_10619460 3300013104 Bacteria 990
342 Ga0157370_11060271 3300013104 Bacteria 733
343 Ga0157369_10048804 3300013105 Bacteria 4592
344 Ga0157369_10100375 3300013105 Bacteria 3085
345 Ga0157369_11080176 3300013105 Bacteria 820
346 Ga0157374_10054329 3300013296 Bacteria 3736
347 Ga0157374_10867581 3300013296 Bacteria 920
348 Ga0157378_10001258 3300013297 Bacteria 22842
349 Ga0157378_10186971 3300013297 Bacteria 1951
350 Ga0157378_10482727 3300013297 Bacteria 1235
351 Ga0163162_10037174 3300013306 Bacteria 4857
352 Ga0163162_10161998 3300013306 Bacteria 2359
353 Ga0163162_10391485 3300013306 Bacteria 1522
354 Ga0163162_10437872 3300013306 Bacteria 1439
355 Ga0163162_10820375 3300013306 Bacteria 1047
356 Ga0163162_11016229 3300013306 Bacteria 938
357 Ga0157372_10031246 3300013307 Bacteria 5830
358 Ga0157372_10317258 3300013307 Bacteria 1814
359 Ga0157372_10619193 3300013307 Bacteria 1261
360 Ga0157372_10734106 3300013307 Bacteria 1148
361 Ga0157375_10004348 3300013308 Bacteria 12300
362 Ga0157375_10058033 3300013308 Bacteria 3828
363 Ga0157375_10205827 3300013308 Bacteria 2124
364 Ga0157375_10398105 3300013308 Bacteria 1544
365 Ga0157375_10875080 3300013308 Bacteria 1044
366 Ga0157375_12579454 3300013308 Bacteria 607
367 Ga0163163_10091516 3300014325 Bacteria 3056
368 Ga0163163_10189906 3300014325 Bacteria 2103
369 Ga0157380_10005051 3300014326 Bacteria 9205
370 Ga0157380_10108324 3300014326 Bacteria 2329
371 Ga0157380_10226606 3300014326 Bacteria 1676
372 Ga0157379_10125893 3300014968 Bacteria 2305
373 Ga0163161_10000753 3300017792 Bacteria 25411
374 Ga0163161_10210395 3300017792 Bacteria 1502
375 Ga0207666_1004870 3300025271 Bacteria 1697
376 Ga0207673_1003610 3300025290 Bacteria 1818
377 Ga0207697_10000158 3300025315 Bacteria 33821
378 Ga0207697_10002568 3300025315 Bacteria 9344
379 Ga0207697_10035271 3300025315 Bacteria 2047
380 Ga0207697_10068977 3300025315 Bacteria 1480
381 Ga0207656_10015597 3300025321 Bacteria 2943
382 Ga0207682_10001693 3300025893 Bacteria 10102
383 Ga0207682_10093071 3300025893 Bacteria 1309
384 Ga0207642_10391403 3300025899 Bacteria 830
385 Ga0207710_10139445 3300025900 Bacteria 1170
386 Ga0207688_10000317 3300025901 Bacteria 22230
387 Ga0207688_10024903 3300025901 Bacteria 3283
388 Ga0207688_10081281 3300025901 Bacteria 1851
389 Ga0207688_10278317 3300025901 Bacteria 1019
390 Ga0207688_10325488 3300025901 Bacteria 944
391 Ga0207680_10023816 3300025903 Bacteria 3350
392 Ga0207680_10083708 3300025903 Bacteria 2011
393 Ga0207680_10451379 3300025903 Bacteria 912
394 Ga0207680_10688954 3300025903 Bacteria 732
395 Ga0207647_10000253 3300025904 Bacteria 43758
396 Ga0207647_10083225 3300025904 Bacteria 1916
397 Ga0207645_10002074 3300025907 Bacteria 16043
398 Ga0207645_10026481 3300025907 Bacteria 3746
399 Ga0207645_10027619 3300025907 Bacteria 3663
400 Ga0207645_10035096 3300025907 Bacteria 3220
401 Ga0207645_10128078 3300025907 Bacteria 1651
402 Ga0207645_10138155 3300025907 Bacteria 1587
403 Ga0207645_10159546 3300025907 Bacteria 1475
404 Ga0207645_10214075 3300025907 Bacteria 1269
405 Ga0207643_10052521 3300025908 Bacteria 2315
406 Ga0207643_10418670 3300025908 Bacteria 849
407 Ga0207705_10016274 3300025909 Bacteria 5334
408 Ga0207705_10039435 3300025909 Bacteria 3385
409 Ga0207705_10043066 3300025909 Bacteria 3242
410 Ga0207705_10046964 3300025909 Bacteria 3104
411 Ga0207705_10097504 3300025909 Bacteria 2159
412 Ga0207705_10108167 3300025909 Bacteria 2052
413 Ga0207705_10145067 3300025909 Bacteria 1775
414 Ga0207705_10170976 3300025909 Bacteria 1636
415 Ga0207705_10362739 3300025909 Bacteria 1117
416 Ga0207705_10724521 3300025909 Bacteria 773
417 Ga0207654_10152514 3300025911 Bacteria 1484
418 Ga0207707_10169859 3300025912 Bacteria 1906
419 Ga0207707_10992692 3300025912 Bacteria 689
420 Ga0207671_10195065 3300025914 Bacteria 1580
421 Ga0207693_10058526 3300025915 Bacteria 3018
422 Ga0207660_10243517 3300025917 Bacteria 1417
423 Ga0207662_10213130 3300025918 Bacteria 1254
424 Ga0207662_10286789 3300025918 Bacteria 1091
425 Ga0207657_10002291 3300025919 Bacteria 20732
426 Ga0207657_10011406 3300025919 Bacteria 8823
427 Ga0207657_10019294 3300025919 Bacteria 6479
428 Ga0207657_10030898 3300025919 Bacteria 4855
429 Ga0207657_10042043 3300025919 Bacteria 4036
430 Ga0207657_10045766 3300025919 Bacteria 3837
431 Ga0207657_10047166 3300025919 Bacteria 3769
432 Ga0207657_10059739 3300025919 Bacteria 3274
433 Ga0207657_10065000 3300025919 Bacteria 3111
434 Ga0207657_10068358 3300025919 Bacteria 3018
435 Ga0207649_10018682 3300025920 Bacteria 3948
436 Ga0207649_10043290 3300025920 Bacteria 2752
437 Ga0207649_10103742 3300025920 Bacteria 1887
438 Ga0207649_10146307 3300025920 Bacteria 1622
439 Ga0207649_10210951 3300025920 Bacteria 1378
440 Ga0207649_10290304 3300025920 Bacteria 1192
441 Ga0207649_10325052 3300025920 Bacteria 1131
442 Ga0207649_10341208 3300025920 Bacteria 1106
443 Ga0207649_10342527 3300025920 Bacteria 1104
444 Ga0207649_10970190 3300025920 Bacteria 668
445 Ga0207652_10220732 3300025921 Bacteria 1708
446 Ga0207652_10375825 3300025921 Bacteria 1283
447 Ga0207652_10537128 3300025921 Bacteria 1051
448 Ga0207681_10027069 3300025923 Bacteria 3705
449 Ga0207681_10030507 3300025923 Bacteria 3515
450 Ga0207681_10061807 3300025923 Bacteria 2576
451 Ga0207681_10213239 3300025923 Bacteria 1489
452 Ga0207694_10392709 3300025924 Bacteria 1153
453 Ga0207650_10003054 3300025925 Bacteria 11531
454 Ga0207650_10018631 3300025925 Bacteria 4873
455 Ga0207650_10101953 3300025925 Bacteria 2210
456 Ga0207650_10279773 3300025925 Bacteria 1358
457 Ga0207650_10520785 3300025925 Bacteria 995
458 Ga0207659_10018172 3300025926 Bacteria 4605
459 Ga0207659_10127013 3300025926 Bacteria 1963
460 Ga0207659_10300153 3300025926 Bacteria 1319
461 Ga0207687_10031400 3300025927 Bacteria 3589
462 Ga0207664_10021302 3300025929 Bacteria 4817
463 Ga0207664_10041131 3300025929 Bacteria 3600
464 Ga0207664_10993026 3300025929 Bacteria 752
465 Ga0207664_11547157 3300025929 Bacteria 585
466 Ga0207644_10005273 3300025931 Bacteria 8437
467 Ga0207644_10007766 3300025931 Bacteria 7003
468 Ga0207644_10010963 3300025931 Bacteria 5987
469 Ga0207644_10020310 3300025931 Bacteria 4516
470 Ga0207644_10030225 3300025931 Bacteria 3765
471 Ga0207644_10108980 3300025931 Bacteria 2091
472 Ga0207644_10566374 3300025931 Bacteria 941
473 Ga0207690_10011180 3300025932 Bacteria 5358
474 Ga0207690_10057356 3300025932 Bacteria 2631
475 Ga0207690_10096713 3300025932 Bacteria 2100
476 Ga0207690_10201824 3300025932 Bacteria 1511
477 Ga0207690_10300446 3300025932 Bacteria 1256
478 Ga0207690_10459685 3300025932 Bacteria 1024
479 Ga0207690_10486476 3300025932 Bacteria 997
480 Ga0207706_10000434 3300025933 Bacteria 44818
481 Ga0207706_10000643 3300025933 Bacteria 37034
482 Ga0207706_10035989 3300025933 Bacteria 4399
483 Ga0207706_10044379 3300025933 Bacteria 3940
484 Ga0207706_10046085 3300025933 Bacteria 3861
485 Ga0207706_10139178 3300025933 Bacteria 2135
486 Ga0207706_10219339 3300025933 Bacteria 1665
487 Ga0207709_10253862 3300025935 Bacteria 1286
488 Ga0207669_10013845 3300025937 Bacteria 4024
489 Ga0207669_10091532 3300025937 Bacteria 1981
490 Ga0207704_10126284 3300025938 Bacteria 1762
491 Ga0207704_10580661 3300025938 Bacteria 915
492 Ga0207665_10043994 3300025939 Bacteria 2987
493 Ga0207691_10000848 3300025940 Bacteria 30357
494 Ga0207691_10000852 3300025940 Bacteria 30260
495 Ga0207691_10019525 3300025940 Bacteria 6412
496 Ga0207691_10107428 3300025940 Bacteria 2484
497 Ga0207691_10156533 3300025940 Bacteria 2001
498 Ga0207691_10538504 3300025940 Bacteria 990
499 Ga0207691_10816601 3300025940 Bacteria 783
500 Ga0207711_10003912 3300025941 Bacteria 12815
501 Ga0207711_10018660 3300025941 Bacteria 5767
502 Ga0207711_10071281 3300025941 Bacteria 3015
503 Ga0207689_10000017 3300025942 Bacteria 117159
504 Ga0207689_10030990 3300025942 Bacteria 4455
505 Ga0207689_10035239 3300025942 Bacteria 4158
506 Ga0207689_10044482 3300025942 Bacteria 3671
507 Ga0207661_10297569 3300025944 Bacteria 1446
508 Ga0207661_10750479 3300025944 Bacteria 898
509 Ga0207679_10046450 3300025945 Bacteria 3148
510 Ga0207679_10057851 3300025945 Bacteria 2870
511 Ga0207679_10129703 3300025945 Bacteria 2021
512 Ga0207679_10239311 3300025945 Bacteria 1537
513 Ga0207679_10291908 3300025945 Bacteria 1402
514 Ga0207679_10347057 3300025945 Bacteria 1292
515 Ga0207679_10433273 3300025945 Bacteria 1163
516 Ga0207679_10596421 3300025945 Bacteria 995
517 Ga0207679_10622649 3300025945 Bacteria 974
518 Ga0207679_10670877 3300025945 Bacteria 939
519 Ga0207667_10040202 3300025949 Bacteria 4980
520 Ga0207667_10144280 3300025949 Bacteria 2451
521 Ga0207667_10258564 3300025949 Bacteria 1780
522 Ga0207651_10006199 3300025960 Bacteria 6227
523 Ga0207651_10105685 3300025960 Bacteria 2101
524 Ga0207651_10126106 3300025960 Bacteria 1951
525 Ga0207651_10144365 3300025960 Bacteria 1843
526 Ga0207651_10178665 3300025960 Bacteria 1681
527 Ga0207651_10186524 3300025960 Bacteria 1651
528 Ga0207651_11025459 3300025960 Bacteria 738
529 Ga0207712_10008327 3300025961 Bacteria 6555
530 Ga0207712_10116830 3300025961 Bacteria 2011
531 Ga0207712_10520344 3300025961 Bacteria 1019
532 Ga0207668_10000223 3300025972 Bacteria 38523
533 Ga0207668_10002049 3300025972 Bacteria 11759
534 Ga0207668_10013108 3300025972 Bacteria 5096
535 Ga0207668_10157443 3300025972 Bacteria 1766
536 Ga0207668_10173511 3300025972 Bacteria 1693
537 Ga0207668_10179524 3300025972 Bacteria 1668
538 Ga0207668_10259117 3300025972 Bacteria 1416
539 Ga0207640_10003828 3300025981 Bacteria 8117
540 Ga0207640_10065521 3300025981 Bacteria 2424
541 Ga0207640_10286453 3300025981 Bacteria 1297
542 Ga0207640_10353592 3300025981 Bacteria 1181
543 Ga0207658_10008048 3300025986 Bacteria 7182
544 Ga0207658_10034535 3300025986 Bacteria 3615
545 Ga0207658_10035614 3300025986 Bacteria 3566
546 Ga0207658_10068482 3300025986 Bacteria 2678
547 Ga0207658_10104199 3300025986 Bacteria 2228
548 Ga0207658_10173408 3300025986 Bacteria 1779
549 Ga0207658_10238712 3300025986 Bacteria 1538
550 Ga0207658_10558136 3300025986 Bacteria 1025
551 Ga0207658_10643497 3300025986 Bacteria 955
552 Ga0207677_10042390 3300026023 Bacteria 3017
553 Ga0207703_10002927 3300026035 Bacteria 14530
554 Ga0207703_10057641 3300026035 Bacteria 3168
555 Ga0207639_10040564 3300026041 Bacteria 3475
556 Ga0207639_10055955 3300026041 Bacteria 3021
557 Ga0207639_10186625 3300026041 Bacteria 1768
558 Ga0207639_10234929 3300026041 Bacteria 1591
559 Ga0207639_10304656 3300026041 Bacteria 1409
560 Ga0207639_10386680 3300026041 Bacteria 1258
561 Ga0207678_10009957 3300026067 Bacteria 8340
562 Ga0207678_10014935 3300026067 Bacteria 6832
563 Ga0207678_10028426 3300026067 Bacteria 4882
564 Ga0207678_10029181 3300026067 Bacteria 4815
565 Ga0207678_10083355 3300026067 Bacteria 2735
566 Ga0207678_10108507 3300026067 Bacteria 2368
567 Ga0207678_10200088 3300026067 Bacteria 1708
568 Ga0207678_10459229 3300026067 Bacteria 1108
569 Ga0207702_10012040 3300026078 Bacteria 7192
570 Ga0207702_10196688 3300026078 Bacteria 1866
571 Ga0207702_10227452 3300026078 Bacteria 1741
572 Ga0207702_10881061 3300026078 Bacteria 887
573 Ga0207702_11485388 3300026078 Bacteria 671
574 Ga0207641_10016993 3300026088 Bacteria 5956
575 Ga0207641_10019912 3300026088 Bacteria 5508
576 Ga0207641_10113956 3300026088 Bacteria 2401
577 Ga0207641_10649009 3300026088 Bacteria 1036
578 Ga0207641_10653234 3300026088 Bacteria 1033
579 Ga0207648_10001216 3300026089 Bacteria 28854
580 Ga0207648_10006444 3300026089 Bacteria 11662
581 Ga0207648_10097123 3300026089 Bacteria 2578
582 Ga0207648_10106101 3300026089 Bacteria 2465
583 Ga0207648_10532373 3300026089 Bacteria 1077
584 Ga0207676_10003642 3300026095 Bacteria 10901
585 Ga0207676_10005620 3300026095 Bacteria 8874
586 Ga0207676_10012995 3300026095 Bacteria 5978
587 Ga0207676_10606861 3300026095 Bacteria 1052
588 Ga0207676_10866113 3300026095 Bacteria 884
589 Ga0207674_10004077 3300026116 Bacteria 17703
590 Ga0207674_10007596 3300026116 Bacteria 12631
591 Ga0207674_10044074 3300026116 Bacteria 4597
592 Ga0207674_10052412 3300026116 Bacteria 4162
593 Ga0207674_10196538 3300026116 Bacteria 1966
594 Ga0207675_100025642 3300026118 Bacteria 5486
595 Ga0207675_100387047 3300026118 Bacteria 1376
596 Ga0207675_100493467 3300026118 Bacteria 1218
597 Ga0207675_100520192 3300026118 Bacteria 1186
598 Ga0207675_100538729 3300026118 Bacteria 1165
599 Ga0207683_10006197 3300026121 Bacteria 10251
600 Ga0207683_10092191 3300026121 Bacteria 2700
601 Ga0207698_10018409 3300026142 Bacteria 4758
602 Ga0207698_10020485 3300026142 Bacteria 4554
603 Ga0207698_10184857 3300026142 Bacteria 1850
604 Ga0207698_10411484 3300026142 Bacteria 1295
605 Ga0209974_10121778 3300027876 Bacteria 925
606 Ga0207428_10462014 3300027907 Bacteria 925
607 Ga0268266_10005814 3300028379 Bacteria 11417
608 Ga0268266_10009325 3300028379 Bacteria 8653
609 Ga0268266_10156875 3300028379 Bacteria 2056
610 Ga0268266_10264521 3300028379 Bacteria 1595
611 Ga0268265_10001836 3300028380 Bacteria 16950
612 Ga0268265_10004795 3300028380 Bacteria 9321
613 Ga0268265_10023329 3300028380 Bacteria 4360
614 Ga0268265_10024003 3300028380 Bacteria 4307
615 Ga0268265_10119081 3300028380 Bacteria 2172
616 Ga0268265_10323675 3300028380 Bacteria 1397
617 Ga0268265_10432723 3300028380 Bacteria 1224
618 Ga0268265_10727765 3300028380 Bacteria 961
619 Ga0268265_11977389 3300028380 Bacteria 590
620 Ga0268264_10008809 3300028381 Bacteria 8368
621 Ga0268264_10112581 3300028381 Bacteria 2386
622 Ga0268264_10126648 3300028381 Bacteria 2258
623 Ga0268264_10419922 3300028381 Bacteria 1289
624 Ga0268264_10795517 3300028381 Bacteria 944
625 Ga0307408_100017171 3300031548 Bacteria 4842
626 Ga0307408_100162669 3300031548 Bacteria 1774
627 Ga0307405_10027843 3300031731 Bacteria 3283
628 Ga0307405_10035968 3300031731 Bacteria 2963
629 Ga0307405_10068674 3300031731 Bacteria 2269
630 Ga0307413_10001438 3300031824 Bacteria 9021
631 Ga0307413_10018300 3300031824 Bacteria 3672
632 Ga0307413_10036235 3300031824 Bacteria 2838
633 Ga0307413_10061660 3300031824 Bacteria 2315
634 Ga0307413_10099897 3300031824 Bacteria 1914
635 Ga0307413_10272732 3300031824 Bacteria 1267
636 Ga0307413_10584816 3300031824 Bacteria 911
637 Ga0307413_10664031 3300031824 Unclassified 861
638 Ga0307413_11634054 3300031824 Bacteria 573
639 Ga0307410_10003596 3300031852 Bacteria 7809
640 Ga0307410_10102415 3300031852 Bacteria 2054
641 Ga0307410_10107957 3300031852 Bacteria 2009
642 Ga0307410_10120784 3300031852 Bacteria 1910
643 Ga0307410_10292254 3300031852 Bacteria 1283
644 Ga0307410_10323010 3300031852 Bacteria 1225
645 Ga0307410_10903272 3300031852 Bacteria 757
646 Ga0307406_10023830 3300031901 Bacteria 3647
647 Ga0307406_10028520 3300031901 Bacteria 3373
648 Ga0307406_10049479 3300031901 Bacteria 2660
649 Ga0307406_10879292 3300031901 Bacteria 761
650 Ga0307407_10031384 3300031903 Bacteria 2877
651 Ga0307407_10079831 3300031903 Bacteria 1975
652 Ga0307407_10154385 3300031903 Bacteria 1495
653 Ga0307407_10437810 3300031903 Bacteria 946
654 Ga0307407_10468582 3300031903 Bacteria 918
655 Ga0307407_10626557 3300031903 Bacteria 803
656 Ga0307412_10003166 3300031911 Bacteria 9145
657 Ga0307412_10021619 3300031911 Bacteria 3933
658 Ga0307412_10040504 3300031911 Bacteria 3014
659 Ga0307412_10040782 3300031911 Bacteria 3005
660 Ga0307412_10123510 3300031911 Bacteria 1868
661 Ga0307412_10126569 3300031911 Bacteria 1849
662 Ga0307412_10139254 3300031911 Bacteria 1775
663 Ga0307412_10145585 3300031911 Bacteria 1741
664 Ga0307409_100012427 3300031995 Bacteria 5425
665 Ga0307409_100071970 3300031995 Bacteria 2751
666 Ga0307409_100092353 3300031995 Bacteria 2483
667 Ga0307409_100110065 3300031995 Bacteria 2308
668 Ga0307409_100206867 3300031995 Bacteria 1760
669 Ga0307409_100248552 3300031995 Bacteria 1624
670 Ga0307409_100261875 3300031995 Bacteria 1587
671 Ga0307409_100512531 3300031995 Bacteria 1170
672 Ga0307409_100940745 3300031995 Bacteria 880
673 Ga0307416_100019713 3300032002 Bacteria 4790
674 Ga0307416_100069269 3300032002 Bacteria 2919
675 Ga0307416_100095314 3300032002 Bacteria 2569
676 Ga0307416_100110262 3300032002 Bacteria 2423
677 Ga0307416_100251120 3300032002 Bacteria 1721
678 Ga0307416_100269105 3300032002 Bacteria 1671
679 Ga0307416_100323330 3300032002 Bacteria 1546
680 Ga0307416_100342345 3300032002 Bacteria 1509
681 Ga0307416_100393236 3300032002 Bacteria 1421
682 Ga0307416_100754779 3300032002 Bacteria 1066
683 Ga0307416_101098934 3300032002 Bacteria 900
684 Ga0307414_10011458 3300032004 Bacteria 5201
685 Ga0307414_10062534 3300032004 Bacteria 2642
686 Ga0307414_10076654 3300032004 Bacteria 2430
687 Ga0307414_10112593 3300032004 Bacteria 2075
688 Ga0307414_10184606 3300032004 Bacteria 1681
689 Ga0307414_10215482 3300032004 Bacteria 1573
690 Ga0307414_10316850 3300032004 Bacteria 1326
691 Ga0307414_10416692 3300032004 Bacteria 1170
692 Ga0307414_10442417 3300032004 Bacteria 1138
693 Ga0307414_10500915 3300032004 Bacteria 1075
694 Ga0307414_11823705 3300032004 Bacteria 567
695 Ga0307411_10010399 3300032005 Bacteria 4957
696 Ga0307411_10010853 3300032005 Bacteria 4881
697 Ga0307411_10034033 3300032005 Bacteria 3166
698 Ga0307411_10060334 3300032005 Bacteria 2518
699 Ga0307411_10067388 3300032005 Bacteria 2408
700 Ga0307411_10186000 3300032005 Bacteria 1581
701 Ga0307411_10605556 3300032005 Bacteria 942
702 Ga0307411_11497776 3300032005 Unclassified 620
703 Ga0307415_100015345 3300032126 Bacteria 4533
704 Ga0307415_100042531 3300032126 Bacteria 3024
705 Ga0307415_100087449 3300032126 Bacteria 2245
706 Ga0307415_100097844 3300032126 Bacteria 2143
707 Ga0307415_100157722 3300032126 Bacteria 1755
708 Ga0307415_100176127 3300032126 Bacteria 1673
709 Ga0307415_100275699 3300032126 Bacteria 1380
710 Ga0307415_101111476 3300032126 Bacteria 740
711 Ga0373928_0120256 3300035084 Bacteria 703
712 Ga0373940_0039047 3300035088 Bacteria 1298
713 Ga0373943_0379166 3300035170 Bacteria 814
714 Ga0373961_0134814 3300035241 Bacteria 830
715 Ga0373931_0106924 3300035691 Bacteria 1582
716 Ga0373935_0104235 3300035692 Bacteria 1874
717 Ga0395899_0018993 3300037312 Bacteria 5223
718 Ga0395899_0426216 3300037312 Bacteria 873
719 Ga0395900_0000995 3300037418 Bacteria 36856
720 Ga0395900_0959091 3300037418 Bacteria 776
721 Ga0395898_0139400 3300037466 Bacteria 2322
722 Ga0395905_0000538 3300037471 Bacteria 51665
723 Ga0395905_0001688 3300037471 Bacteria 26037
724 Ga0395905_0070915 3300037471 Bacteria 3266
725 Ga0395905_0072272 3300037471 Bacteria 3234
726 Ga0395905_0206676 3300037471 Bacteria 1840
727 Ga0395905_0238254 3300037471 Bacteria 1700
728 Ga0395905_0272120 3300037471 Bacteria 1580
729 Ga0395905_0273431 3300037471 Bacteria 1575
730 Ga0395905_0416594 3300037471 Bacteria 1239
731 Ga0436364_0996148 3300037853 Bacteria 15568
732 Ga0395901_0002926 3300038443 Bacteria 17249
733 Ga0395901_0075005 3300038443 Bacteria 3528
734 Ga0395901_0129440 3300038443 Bacteria 2652
735 Ga0395901_0345500 3300038443 Bacteria 1536
736 Ga0395901_0362197 3300038443 Bacteria 1495
737 Ga0436363_0512431 3300039450 Bacteria 739
738 Ga0439455_0206100 3300042012 Bacteria 570
739 Ga0439464_0011183 3300042439 Bacteria 2374
740 Ga0466972_0060740 3300044658 Bacteria 1813
741 Ga0466966_0006596 3300044684 Bacteria 7685
742 Ga0466966_0109592 3300044684 Bacteria 1703
743 Ga0466961_0086810 3300044693 Bacteria 1977
744 Ga0466963_0013165 3300044694 Bacteria 5075
745 Ga0466963_0255861 3300044694 Bacteria 1229
746 Ga0466963_0644470 3300044694 Bacteria 748
747 Ga0466964_0177765 3300044706 Bacteria 1007
748 Ga0466970_0036271 3300044765 Bacteria 2612
749 Ga0466970_0082363 3300044765 Bacteria 1740
750 Ga0466957_0057200 3300044842 Bacteria 2386
751 Ga0466957_0101764 3300044842 Bacteria 1812
752 Ga0466957_0103953 3300044842 Bacteria 1794
753 Ga0466957_0256232 3300044842 Bacteria 1165
754 Ga0466957_0304485 3300044842 Bacteria 1072
755 Ga0466959_0052885 3300045049 Bacteria 2972
756 Ga0466958_0087472 3300045836 Bacteria 1924
757 Ga0466958_0142901 3300045836 Bacteria 1507
758 Ga0466967_0057824 3300045976 Bacteria 3425
759 Ga0466967_0058464 3300045976 Bacteria 3408
760 Ga0466967_0193286 3300045976 Bacteria 1924
761 Ga0466967_0195336 3300045976 Bacteria 1914
762 Ga0466967_0245626 3300045976 Bacteria 1708
763 Ga0466967_0598131 3300045976 Bacteria 1088
764 Ga0495596_0051414 3300046500 Bacteria 1614
765 Ga0495643_0173046 3300046522 Bacteria 1055
766 Ga0495663_0003697 3300046525 Bacteria 4375
767 Ga0495663_0045954 3300046525 Bacteria 1340
768 Ga0495663_0123884 3300046525 Bacteria 867
769 Ga0495598_0019117 3300046537 Bacteria 1791
770 Ga0495621_0000350 3300046539 Bacteria 11260
771 Ga0495621_0005701 3300046539 Bacteria 3597
772 Ga0495633_0031633 3300046558 Bacteria 2563
773 Ga0495668_0077947 3300046616 Bacteria 1819
774 Ga0495659_0024873 3300046664 Bacteria 2045
775 Ga0495669_0032311 3300046684 Bacteria 2300
776 Ga0495669_0156759 3300046684 Bacteria 1079
777 Ga0495669_0204177 3300046684 Bacteria 945
778 Ga0495669_0283457 3300046684 Bacteria 797
779 Ga0495669_0438175 3300046684 Bacteria 634
780 Ga0495670_0010361 3300046691 Bacteria 4580
781 Ga0495670_0012515 3300046691 Bacteria 4175
782 Ga0495672_0287285 3300047320 Bacteria 784
783 Ga0495677_0024518 3300047445 Bacteria 2188
784 Ga0495677_0165252 3300047445 Bacteria 855
785 Ga0495685_090595 3300047447 Bacteria 1014
786 Ga0495615_0021854 3300048090 Bacteria 1448
787 Ga0496100_0978721 3300048903 Bacteria 665
788 Ga0496101_0065195 3300048904 Bacteria 2655
789 Ga0496102_0286092 3300048905 Unclassified 1554
790 Ga0496102_0708678 3300048905 Bacteria 929
791 Ga0496102_0744269 3300048905 Bacteria 903
792 Ga0496104_0288642 3300048907 Bacteria 1553
793 Ga0496104_0483621 3300048907 Bacteria 1149
794 Ga0496106_0021199 3300048909 Bacteria 4824
795 Ga0496106_0641263 3300048909 Bacteria 849
796 Ga0496106_1045706 3300048909 Bacteria 641
797 Ga0496107_0006978 3300048910 Bacteria 7784
798 Ga0496107_0145011 3300048910 Unclassified 1755
799 Ga0496107_0188797 3300048910 Unclassified 1531
800 Ga0496107_0358123 3300048910 Bacteria 1086
801 Ga0496107_0435222 3300048910 Bacteria 975
802 Ga0496107_0487973 3300048910 Bacteria 914
803 Ga0496108_0011900 3300048911 Bacteria 7078
804 Ga0496108_0044078 3300048911 Bacteria 3725
805 Ga0496109_0020941 3300048912 Bacteria 5780
806 Ga0496109_0024307 3300048912 Bacteria 5385
807 Ga0496109_0556202 3300048912 Bacteria 1082
808 Ga0496109_0896009 3300048912 Bacteria 825
809 Ga0496109_1091865 3300048912 Bacteria 735
810 Ga0496109_1187975 3300048912 Bacteria 700
811 Ga0496110_0010516 3300048913 Bacteria 7533
812 Ga0496110_0055960 3300048913 Bacteria 3471
813 Ga0496111_0018962 3300048914 Bacteria 4769
814 Ga0496111_0053188 3300048914 Bacteria 2925
815 Ga0496111_0085906 3300048914 Bacteria 2301
816 Ga0496111_0816828 3300048914 Bacteria 674
817 Ga0496112_0136255 3300048915 Bacteria 2425
818 Ga0496112_0146453 3300048915 Bacteria 2330
819 Ga0496112_0239961 3300048915 Bacteria 1765
820 Ga0496113_0086813 3300048916 Bacteria 2404
821 Ga0496113_0222581 3300048916 Bacteria 1504
822 Ga0496114_0005747 3300048917 Bacteria 9734
823 Ga0496114_0271573 3300048917 Bacteria 1494
824 Ga0496115_0001982 3300048918 Bacteria 14619
825 Ga0501225_0062255 3300049705 Bacteria 1051
826 Ga0501225_0086878 3300049705 Bacteria 903
827 Ga0501268_002439 3300049765 Bacteria 2450
828 Ga0501273_010716 3300049770 Bacteria 1131
829 Ga0501204_014099 3300049850 Bacteria 978
830 nmdc:mga05p37_388427_c1 3300050507 Bacteria 1633
831 nmdc:mga08y16_987285_c1 3300050511 Bacteria 823
832 nmdc:mga0n895_435921_c1 3300050512 Bacteria 1324
833 nmdc:mga0rr50_229314_c1 3300050513 Bacteria 1536
834 nmdc:mga0a205_5296_c1 3300050515 Bacteria 11612
835 Ga0500658_0000073 3300053134 Bacteria 46171

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100162669 Ga0307408_1001626691 155
2 3300031731 Ga0307405_10027843 Ga0307405_100278433 155
3 3300031824 Ga0307413_10018300 Ga0307413_100183003 155
4 3300031852 Ga0307410_10120784 Ga0307410_101207842 155
5 3300031901 Ga0307406_10028520 Ga0307406_100285203 155
6 3300031911 Ga0307412_10040782 Ga0307412_100407822 155
7 3300031995 Ga0307409_100092353 Ga0307409_1000923532 155
8 3300032002 Ga0307416_100251120 Ga0307416_1002511202 155
9 3300032004 Ga0307414_10076654 Ga0307414_100766542 155
10 3300013308 Ga0157375_10058033 Ga0157375_100580333 157
11 3300005327 Ga0070658_10042549 Ga0070658_100425493 158
12 3300005355 Ga0070671_100187950 Ga0070671_1001879502 158
13 3300005614 Ga0068856_100034293 Ga0068856_1000342935 158
14 3300005841 Ga0068863_100411949 Ga0068863_1004119492 158
15 3300009177 Ga0105248_10046924 Ga0105248_100469241 158
16 3300013102 Ga0157371_10263314 Ga0157371_102633142 158
17 3300037471 Ga0395905_0001688 Ga0395905_0001688_17458_18006 158
18 3300005455 Ga0070663_100396648 Ga0070663_1003966482 159
19 3300005543 Ga0070672_100619425 Ga0070672_1006194252 159
20 3300005718 Ga0068866_10137169 Ga0068866_101371692 159
21 3300025909 Ga0207705_10016274 Ga0207705_100162745 159
22 3300025931 Ga0207644_10010963 Ga0207644_100109632 159
23 3300026078 Ga0207702_10196688 Ga0207702_101966882 159
24 3300026142 Ga0207698_10018409 Ga0207698_100184093 159
25 3300037471 Ga0395905_0273431 Ga0395905_0273431_474_1016 159
26 3300044842 Ga0466957_0256232 Ga0466957_0256232_367_903 159
27 3300045976 Ga0466967_0598131 Ga0466967_0598131_95_631 159
28 3300048905 Ga0496102_0286092 Ga0496102_0286092_878_1420 159
29 3300048907 Ga0496104_0483621 Ga0496104_0483621_249_791 159
30 3300048910 Ga0496107_0145011 Ga0496107_0145011_176_718 159
31 3300048911 Ga0496108_0011900 Ga0496108_0011900_3163_3705 159
32 3300048912 Ga0496109_0024307 Ga0496109_0024307_3454_3996 159
33 3300048913 Ga0496110_0055960 Ga0496110_0055960_470_1012 159
34 3300048914 Ga0496111_0018962 Ga0496111_0018962_2427_2969 159
35 3300048915 Ga0496112_0239961 Ga0496112_0239961_671_1213 159
36 3300048916 Ga0496113_0086813 Ga0496113_0086813_470_1012 159
37 3300050513 nmdc:mga0rr50_229314_c1 nmdc:mga0rr50_229314_c1_144_692 159
38 3300005340 Ga0070689_100237840 Ga0070689_1002378401 160
39 3300005364 Ga0070673_100479821 Ga0070673_1004798212 160
40 3300005457 Ga0070662_100070347 Ga0070662_1000703473 160
41 3300005546 Ga0070696_100271458 Ga0070696_1002714582 160
42 3300005548 Ga0070665_100628837 Ga0070665_1006288372 160
43 3300005719 Ga0068861_100440753 Ga0068861_1004407532 160
44 3300005842 Ga0068858_100005690 Ga0068858_10000569011 160
45 3300005844 Ga0068862_100063009 Ga0068862_1000630093 160
46 3300025901 Ga0207688_10278317 Ga0207688_102783172 160
47 3300026118 Ga0207675_100538729 Ga0207675_1005387291 160
48 3300028380 Ga0268265_10323675 Ga0268265_103236752 160
49 3300031901 Ga0307406_10049479 Ga0307406_100494792 160
50 3300031911 Ga0307412_10040504 Ga0307412_100405043 160
51 3300031995 Ga0307409_100248552 Ga0307409_1002485522 160
52 3300032002 Ga0307416_100095314 Ga0307416_1000953142 160
53 3300032004 Ga0307414_10442417 Ga0307414_104424172 160
54 3300032126 Ga0307415_100042531 Ga0307415_1000425312 160
55 3300044684 Ga0466966_0006596 Ga0466966_0006596_6379_6909 160
56 3300044693 Ga0466961_0086810 Ga0466961_0086810_398_928 160
57 3300044765 Ga0466970_0082363 Ga0466970_0082363_467_997 160
58 3300044842 Ga0466957_0101764 Ga0466957_0101764_155_685 160
59 3300045049 Ga0466959_0052885 Ga0466959_0052885_348_878 160
60 3300045836 Ga0466958_0087472 Ga0466958_0087472_1322_1852 160
61 3300046522 Ga0495643_0173046 Ga0495643_0173046_56_583 160
62 3300048907 Ga0496104_0288642 Ga0496104_0288642_773_1306 160
63 3300049705 Ga0501225_0062255 Ga0501225_0062255_323_871 160
64 3300049705 Ga0501225_0086878 Ga0501225_0086878_252_794 160
65 3300049765 Ga0501268_002439 Ga0501268_002439_1448_1990 160
66 3300049850 Ga0501204_014099 Ga0501204_014099_222_764 160
67 3300005328 Ga0070676_10265174 Ga0070676_102651742 161
68 3300005331 Ga0070670_100645807 Ga0070670_1006458072 161
69 3300005337 Ga0070682_100286970 Ga0070682_1002869702 161
70 3300005343 Ga0070687_100294506 Ga0070687_1002945061 161
71 3300005347 Ga0070668_100430959 Ga0070668_1004309592 161
72 3300005364 Ga0070673_100144859 Ga0070673_1001448592 161
73 3300005366 Ga0070659_100329388 Ga0070659_1003293882 161
74 3300005455 Ga0070663_100028142 Ga0070663_1000281422 161
75 3300005539 Ga0068853_100185963 Ga0068853_1001859632 161
76 3300005547 Ga0070693_100060368 Ga0070693_1000603683 161
77 3300005564 Ga0070664_100047598 Ga0070664_1000475982 161
78 3300005577 Ga0068857_100051053 Ga0068857_1000510533 161
79 3300005578 Ga0068854_100037092 Ga0068854_1000370922 161
80 3300005617 Ga0068859_100012474 Ga0068859_1000124747 161
81 3300005834 Ga0068851_10024620 Ga0068851_100246202 161
82 3300005841 Ga0068863_100082035 Ga0068863_1000820352 161
83 3300005842 Ga0068858_100015129 Ga0068858_1000151291 161
84 3300006852 Ga0075433_10011424 Ga0075433_100114247 161
85 3300006931 Ga0097620_100012475 Ga0097620_1000124753 161
86 3300009098 Ga0105245_10021177 Ga0105245_100211771 161
87 3300009553 Ga0105249_10024423 Ga0105249_100244233 161
88 3300009553 Ga0105249_10384045 Ga0105249_103840452 161
89 3300011119 Ga0105246_10156921 Ga0105246_101569212 161
90 3300013100 Ga0157373_10030375 Ga0157373_100303752 161
91 3300013306 Ga0163162_10161998 Ga0163162_101619982 161
92 3300013308 Ga0157375_10398105 Ga0157375_103981052 161
93 3300025907 Ga0207645_10026481 Ga0207645_100264812 161
94 3300025907 Ga0207645_10159546 Ga0207645_101595462 161
95 3300025918 Ga0207662_10213130 Ga0207662_102131301 161
96 3300025925 Ga0207650_10520785 Ga0207650_105207852 161
97 3300025932 Ga0207690_10486476 Ga0207690_104864762 161
98 3300025933 Ga0207706_10035989 Ga0207706_100359894 161
99 3300025933 Ga0207706_10046085 Ga0207706_100460854 161
100 3300025933 Ga0207706_10219339 Ga0207706_102193392 161
101 3300025940 Ga0207691_10156533 Ga0207691_101565333 161
102 3300025940 Ga0207691_10538504 Ga0207691_105385042 161
103 3300025945 Ga0207679_10622649 Ga0207679_106226492 161
104 3300025960 Ga0207651_10126106 Ga0207651_101261061 161
105 3300025961 Ga0207712_10116830 Ga0207712_101168303 161
106 3300026035 Ga0207703_10057641 Ga0207703_100576413 161
107 3300026041 Ga0207639_10304656 Ga0207639_103046562 161
108 3300026088 Ga0207641_10113956 Ga0207641_101139562 161
109 3300026095 Ga0207676_10005620 Ga0207676_100056209 161
110 3300026116 Ga0207674_10052412 Ga0207674_100524123 161
111 3300028380 Ga0268265_10024003 Ga0268265_100240034 161
112 3300031903 Ga0307407_10468582 Ga0307407_104685821 161
113 3300035088 Ga0373940_0039047 Ga0373940_0039047_141_677 161
114 3300035241 Ga0373961_0134814 Ga0373961_0134814_156_728 161
115 3300037312 Ga0395899_0426216 Ga0395899_0426216_253_789 161
116 3300037471 Ga0395905_0272120 Ga0395905_0272120_460_996 161
117 3300038443 Ga0395901_0362197 Ga0395901_0362197_632_1168 161
118 3300048909 Ga0496106_0641263 Ga0496106_0641263_45_560 161
119 3300001989 JGI24739J22299_10003420 JGI24739J22299_100034202 162
120 3300002075 JGI24738J21930_10000035 JGI24738J21930_1000003510 162
121 3300005328 Ga0070676_10314617 Ga0070676_103146172 162
122 3300005330 Ga0070690_100233144 Ga0070690_1002331442 162
123 3300005331 Ga0070670_100023463 Ga0070670_1000234634 162
124 3300005333 Ga0070677_10208222 Ga0070677_102082221 162
125 3300005334 Ga0068869_100045744 Ga0068869_1000457443 162
126 3300005338 Ga0068868_100000881 Ga0068868_1000008818 162
127 3300005339 Ga0070660_100004031 Ga0070660_1000040317 162
128 3300005343 Ga0070687_100378139 Ga0070687_1003781391 162
129 3300005344 Ga0070661_100092146 Ga0070661_1000921462 162
130 3300005347 Ga0070668_100032292 Ga0070668_1000322923 162
131 3300005353 Ga0070669_100002615 Ga0070669_1000026158 162
132 3300005354 Ga0070675_100163451 Ga0070675_1001634512 162
133 3300005355 Ga0070671_100040586 Ga0070671_1000405862 162
134 3300005356 Ga0070674_100060210 Ga0070674_1000602102 162
135 3300005364 Ga0070673_100003488 Ga0070673_1000034883 162
136 3300005365 Ga0070688_100171660 Ga0070688_1001716602 162
137 3300005366 Ga0070659_100001672 Ga0070659_1000016725 162
138 3300005367 Ga0070667_100003302 Ga0070667_1000033023 162
139 3300005455 Ga0070663_100307328 Ga0070663_1003073281 162
140 3300005457 Ga0070662_100002895 Ga0070662_1000028955 162
141 3300005459 Ga0068867_100006073 Ga0068867_1000060735 162
142 3300005466 Ga0070685_10131747 Ga0070685_101317472 162
143 3300005539 Ga0068853_100007792 Ga0068853_1000077923 162
144 3300005543 Ga0070672_100008903 Ga0070672_1000089034 162
145 3300005544 Ga0070686_100519189 Ga0070686_1005191892 162
146 3300005547 Ga0070693_100782394 Ga0070693_1007823941 162
147 3300005563 Ga0068855_100031999 Ga0068855_1000319995 162
148 3300005564 Ga0070664_100029545 Ga0070664_1000295452 162
149 3300005577 Ga0068857_100003503 Ga0068857_1000035032 162
150 3300005578 Ga0068854_100004302 Ga0068854_1000043022 162
151 3300005614 Ga0068856_100394677 Ga0068856_1003946772 162
152 3300005616 Ga0068852_100001990 Ga0068852_1000019907 162
153 3300005617 Ga0068859_100008163 Ga0068859_1000081635 162
154 3300005618 Ga0068864_100003128 Ga0068864_10000312812 162
155 3300005718 Ga0068866_10348395 Ga0068866_103483951 162
156 3300005719 Ga0068861_100326971 Ga0068861_1003269712 162
157 3300005841 Ga0068863_100037056 Ga0068863_1000370564 162
158 3300005842 Ga0068858_100005468 Ga0068858_1000054682 162
159 3300005843 Ga0068860_100059624 Ga0068860_1000596242 162
160 3300006358 Ga0068871_100125634 Ga0068871_1001256343 162
161 3300006881 Ga0068865_100033541 Ga0068865_1000335412 162
162 3300006914 Ga0075436_100213878 Ga0075436_1002138781 162
163 3300006931 Ga0097620_100008163 Ga0097620_1000081635 162
164 3300007076 Ga0075435_100261170 Ga0075435_1002611702 162
165 3300009093 Ga0105240_10109964 Ga0105240_101099643 162
166 3300009098 Ga0105245_10000285 Ga0105245_1000028530 162
167 3300009174 Ga0105241_10042296 Ga0105241_100422962 162
168 3300009177 Ga0105248_10020125 Ga0105248_100201255 162
169 3300009551 Ga0105238_10110443 Ga0105238_101104433 162
170 3300009553 Ga0105249_10309443 Ga0105249_103094432 162
171 3300010375 Ga0105239_10064925 Ga0105239_100649253 162
172 3300011119 Ga0105246_10012160 Ga0105246_100121605 162
173 3300013100 Ga0157373_10016553 Ga0157373_100165532 162
174 3300013102 Ga0157371_10002316 Ga0157371_1000231615 162
175 3300013297 Ga0157378_10001258 Ga0157378_1000125822 162
176 3300013306 Ga0163162_10037174 Ga0163162_100371744 162
177 3300013307 Ga0157372_10031246 Ga0157372_100312462 162
178 3300025290 Ga0207673_1003610 Ga0207673_10036102 162
179 3300025315 Ga0207697_10000158 Ga0207697_100001583 162
180 3300025899 Ga0207642_10391403 Ga0207642_103914031 162
181 3300025904 Ga0207647_10000253 Ga0207647_1000025324 162
182 3300025907 Ga0207645_10027619 Ga0207645_100276194 162
183 3300025911 Ga0207654_10152514 Ga0207654_101525142 162
184 3300025918 Ga0207662_10286789 Ga0207662_102867892 162
185 3300025919 Ga0207657_10011406 Ga0207657_100114065 162
186 3300025920 Ga0207649_10103742 Ga0207649_101037422 162
187 3300025923 Ga0207681_10061807 Ga0207681_100618072 162
188 3300025925 Ga0207650_10018631 Ga0207650_100186314 162
189 3300025926 Ga0207659_10127013 Ga0207659_101270132 162
190 3300025927 Ga0207687_10031400 Ga0207687_100314002 162
191 3300025931 Ga0207644_10005273 Ga0207644_100052732 162
192 3300025933 Ga0207706_10000643 Ga0207706_1000064326 162
193 3300025937 Ga0207669_10091532 Ga0207669_100915322 162
194 3300025940 Ga0207691_10000848 Ga0207691_100008489 162
195 3300025941 Ga0207711_10018660 Ga0207711_100186602 162
196 3300025942 Ga0207689_10000017 Ga0207689_1000001732 162
197 3300025945 Ga0207679_10596421 Ga0207679_105964212 162
198 3300025949 Ga0207667_10144280 Ga0207667_101442802 162
199 3300025960 Ga0207651_10006199 Ga0207651_100061992 162
200 3300025972 Ga0207668_10013108 Ga0207668_100131082 162
201 3300025981 Ga0207640_10003828 Ga0207640_100038281 162
202 3300025986 Ga0207658_10238712 Ga0207658_102387122 162
203 3300026023 Ga0207677_10042390 Ga0207677_100423902 162
204 3300026041 Ga0207639_10234929 Ga0207639_102349292 162
205 3300026067 Ga0207678_10459229 Ga0207678_104592292 162
206 3300026078 Ga0207702_10881061 Ga0207702_108810611 162
207 3300026089 Ga0207648_10001216 Ga0207648_100012165 162
208 3300026095 Ga0207676_10003642 Ga0207676_100036423 162
209 3300026116 Ga0207674_10007596 Ga0207674_1000759610 162
210 3300026118 Ga0207675_100520192 Ga0207675_1005201922 162
211 3300028381 Ga0268264_10112581 Ga0268264_101125813 162
212 3300028381 Ga0268264_10126648 Ga0268264_101266481 162
213 3300044842 Ga0466957_0057200 Ga0466957_0057200_629_1144 162
214 3300045836 Ga0466958_0142901 Ga0466958_0142901_584_1102 162
215 3300048909 Ga0496106_1045706 Ga0496106_1045706_21_554 162
216 3300050512 nmdc:mga0n895_435921_c1 nmdc:mga0n895_435921_c1_521_1093 162
217 3300001979 JGI24740J21852_10096864 JGI24740J21852_100968641 163
218 3300005334 Ga0068869_100091921 Ga0068869_1000919212 163
219 3300005340 Ga0070689_100874312 Ga0070689_1008743121 163
220 3300005353 Ga0070669_100074454 Ga0070669_1000744542 163
221 3300005364 Ga0070673_100102861 Ga0070673_1001028611 163
222 3300005444 Ga0070694_100348458 Ga0070694_1003484582 163
223 3300005455 Ga0070663_100348667 Ga0070663_1003486671 163
224 3300005459 Ga0068867_100005296 Ga0068867_1000052962 163
225 3300005543 Ga0070672_100081691 Ga0070672_1000816912 163
226 3300005545 Ga0070695_100329580 Ga0070695_1003295801 163
227 3300005548 Ga0070665_100969566 Ga0070665_1009695662 163
228 3300005616 Ga0068852_100068158 Ga0068852_1000681583 163
229 3300005617 Ga0068859_100162923 Ga0068859_1001629232 163
230 3300005842 Ga0068858_100017238 Ga0068858_1000172385 163
231 3300005844 Ga0068862_100128028 Ga0068862_1001280282 163
232 3300006931 Ga0097620_100162921 Ga0097620_1001629212 163
233 3300010375 Ga0105239_11480589 Ga0105239_114805891 163
234 3300013297 Ga0157378_10482727 Ga0157378_104827272 163
235 3300013306 Ga0163162_10437872 Ga0163162_104378722 163
236 3300013308 Ga0157375_10205827 Ga0157375_102058272 163
237 3300025935 Ga0207709_10253862 Ga0207709_102538622 163
238 3300025940 Ga0207691_10019525 Ga0207691_100195254 163
239 3300025942 Ga0207689_10035239 Ga0207689_100352395 163
240 3300025960 Ga0207651_10144365 Ga0207651_101443652 163
241 3300025960 Ga0207651_10186524 Ga0207651_101865242 163
242 3300026035 Ga0207703_10002927 Ga0207703_100029275 163
243 3300026041 Ga0207639_10055955 Ga0207639_100559553 163
244 3300026088 Ga0207641_10019912 Ga0207641_100199125 163
245 3300026089 Ga0207648_10006444 Ga0207648_100064444 163
246 3300026142 Ga0207698_10020485 Ga0207698_100204853 163
247 3300028380 Ga0268265_10023329 Ga0268265_100233295 163
248 3300037471 Ga0395905_0416594 Ga0395905_0416594_367_912 163
249 3300045976 Ga0466967_0245626 Ga0466967_0245626_236_754 163
250 3300048911 Ga0496108_0044078 Ga0496108_0044078_431_967 163
251 3300048912 Ga0496109_0556202 Ga0496109_0556202_307_852 163
252 3300050515 nmdc:mga0a205_5296_c1 nmdc:mga0a205_5296_c1_2024_2596 163
253 3300005262 Ga0065165_1007899 Ga0065165_10078995 164
254 3300005327 Ga0070658_10090495 Ga0070658_100904953 164
255 3300005327 Ga0070658_10189446 Ga0070658_101894463 164
256 3300005339 Ga0070660_100022082 Ga0070660_1000220822 164
257 3300005339 Ga0070660_100121153 Ga0070660_1001211533 164
258 3300005344 Ga0070661_100118586 Ga0070661_1001185862 164
259 3300005345 Ga0070692_10462774 Ga0070692_104627741 164
260 3300005366 Ga0070659_100001497 Ga0070659_1000014973 164
261 3300005530 Ga0070679_100418171 Ga0070679_1004181711 164
262 3300005547 Ga0070693_100075771 Ga0070693_1000757712 164
263 3300005563 Ga0068855_100554548 Ga0068855_1005545482 164
264 3300005564 Ga0070664_100035533 Ga0070664_1000355333 164
265 3300005564 Ga0070664_100039633 Ga0070664_1000396333 164
266 3300005577 Ga0068857_101142212 Ga0068857_1011422122 164
267 3300005578 Ga0068854_100545485 Ga0068854_1005454852 164
268 3300005614 Ga0068856_100033259 Ga0068856_1000332595 164
269 3300005614 Ga0068856_100080624 Ga0068856_1000806243 164
270 3300005616 Ga0068852_100050120 Ga0068852_1000501202 164
271 3300005616 Ga0068852_100256482 Ga0068852_1002564822 164
272 3300013100 Ga0157373_10011849 Ga0157373_100118492 164
273 3300013104 Ga0157370_10134409 Ga0157370_101344091 164
274 3300013105 Ga0157369_10100375 Ga0157369_101003753 164
275 3300013307 Ga0157372_10619193 Ga0157372_106191932 164
276 3300025901 Ga0207688_10000317 Ga0207688_100003174 164
277 3300025909 Ga0207705_10108167 Ga0207705_101081673 164
278 3300025912 Ga0207707_10992692 Ga0207707_109926921 164
279 3300025919 Ga0207657_10042043 Ga0207657_100420432 164
280 3300025919 Ga0207657_10047166 Ga0207657_100471663 164
281 3300025920 Ga0207649_10043290 Ga0207649_100432903 164
282 3300025920 Ga0207649_10146307 Ga0207649_101463072 164
283 3300025920 Ga0207649_10210951 Ga0207649_102109512 164
284 3300025920 Ga0207649_10325052 Ga0207649_103250522 164
285 3300025921 Ga0207652_10375825 Ga0207652_103758251 164
286 3300025925 Ga0207650_10279773 Ga0207650_102797732 164
287 3300025929 Ga0207664_11547157 Ga0207664_115471571 164
288 3300025945 Ga0207679_10046450 Ga0207679_100464503 164
289 3300025945 Ga0207679_10057851 Ga0207679_100578513 164
290 3300025945 Ga0207679_10433273 Ga0207679_104332731 164
291 3300025949 Ga0207667_10040202 Ga0207667_100402025 164
292 3300025981 Ga0207640_10065521 Ga0207640_100655212 164
293 3300026067 Ga0207678_10108507 Ga0207678_101085072 164
294 3300026078 Ga0207702_10012040 Ga0207702_100120402 164
295 3300026078 Ga0207702_11485388 Ga0207702_114853881 164
296 3300026142 Ga0207698_10411484 Ga0207698_104114841 164
297 3300028379 Ga0268266_10005814 Ga0268266_100058147 164
298 3300044658 Ga0466972_0060740 Ga0466972_0060740_287_808 164
299 3300044684 Ga0466966_0109592 Ga0466966_0109592_545_1066 164
300 3300044694 Ga0466963_0255861 Ga0466963_0255861_448_969 164
301 3300044694 Ga0466963_0644470 Ga0466963_0644470_44_562 164
302 3300044706 Ga0466964_0177765 Ga0466964_0177765_112_633 164
303 3300044765 Ga0466970_0036271 Ga0466970_0036271_53_583 164
304 3300045976 Ga0466967_0058464 Ga0466967_0058464_1415_1939 164
305 3300045976 Ga0466967_0195336 Ga0466967_0195336_673_1191 164
306 3300046684 Ga0495669_0032311 Ga0495669_0032311_247_768 164
307 3300048905 Ga0496102_0708678 Ga0496102_0708678_77_601 164
308 3300048910 Ga0496107_0188797 Ga0496107_0188797_794_1318 164
309 3300048914 Ga0496111_0085906 Ga0496111_0085906_217_741 164
310 3300048915 Ga0496112_0136255 Ga0496112_0136255_1882_2406 164
311 3300002459 JGI24751J29686_10030402 JGI24751J29686_100304022 165
312 3300005344 Ga0070661_100940087 Ga0070661_1009400871 165
313 3300005347 Ga0070668_100304141 Ga0070668_1003041412 165
314 3300005353 Ga0070669_101381627 Ga0070669_1013816271 165
315 3300005355 Ga0070671_100004406 Ga0070671_1000044066 165
316 3300005355 Ga0070671_100013680 Ga0070671_1000136803 165
317 3300005355 Ga0070671_100035593 Ga0070671_1000355932 165
318 3300005367 Ga0070667_100040579 Ga0070667_1000405793 165
319 3300005367 Ga0070667_100331256 Ga0070667_1003312562 165
320 3300005434 Ga0070709_10004923 Ga0070709_100049236 165
321 3300005435 Ga0070714_100045950 Ga0070714_1000459502 165
322 3300005435 Ga0070714_100048939 Ga0070714_1000489392 165
323 3300005436 Ga0070713_100041173 Ga0070713_1000411732 165
324 3300005455 Ga0070663_100794110 Ga0070663_1007941101 165
325 3300005457 Ga0070662_100251782 Ga0070662_1002517822 165
326 3300005459 Ga0068867_100155741 Ga0068867_1001557412 165
327 3300005539 Ga0068853_100033639 Ga0068853_1000336394 165
328 3300005543 Ga0070672_100457398 Ga0070672_1004573981 165
329 3300005614 Ga0068856_100753644 Ga0068856_1007536441 165
330 3300005617 Ga0068859_100142831 Ga0068859_1001428312 165
331 3300005618 Ga0068864_100290357 Ga0068864_1002903573 165
332 3300005719 Ga0068861_100414096 Ga0068861_1004140962 165
333 3300005841 Ga0068863_100546393 Ga0068863_1005463932 165
334 3300005843 Ga0068860_100388980 Ga0068860_1003889802 165
335 3300006173 Ga0070716_100044247 Ga0070716_1000442472 165
336 3300006175 Ga0070712_100619233 Ga0070712_1006192332 165
337 3300006237 Ga0097621_100014323 Ga0097621_1000143235 165
338 3300006358 Ga0068871_100105553 Ga0068871_1001055533 165
339 3300006931 Ga0097620_100142837 Ga0097620_1001428372 165
340 3300009177 Ga0105248_10051371 Ga0105248_100513712 165
341 3300009177 Ga0105248_10608041 Ga0105248_106080412 165
342 3300013104 Ga0157370_11060271 Ga0157370_110602711 165
343 3300013105 Ga0157369_10048804 Ga0157369_100488043 165
344 3300013308 Ga0157375_10004348 Ga0157375_100043483 165
345 3300013308 Ga0157375_10875080 Ga0157375_108750802 165
346 3300014325 Ga0163163_10189906 Ga0163163_101899063 165
347 3300017792 Ga0163161_10000753 Ga0163161_1000075319 165
348 3300025271 Ga0207666_1004870 Ga0207666_10048702 165
349 3300025315 Ga0207697_10068977 Ga0207697_100689772 165
350 3300025909 Ga0207705_10724521 Ga0207705_107245212 165
351 3300025915 Ga0207693_10058526 Ga0207693_100585263 165
352 3300025929 Ga0207664_10021302 Ga0207664_100213022 165
353 3300025929 Ga0207664_10041131 Ga0207664_100411312 165
354 3300025931 Ga0207644_10007766 Ga0207644_100077663 165
355 3300025931 Ga0207644_10030225 Ga0207644_100302255 165
356 3300025931 Ga0207644_10108980 Ga0207644_101089802 165
357 3300025933 Ga0207706_10139178 Ga0207706_101391782 165
358 3300025939 Ga0207665_10043994 Ga0207665_100439943 165
359 3300025940 Ga0207691_10816601 Ga0207691_108166012 165
360 3300025941 Ga0207711_10071281 Ga0207711_100712812 165
361 3300025960 Ga0207651_11025459 Ga0207651_110254591 165
362 3300025972 Ga0207668_10259117 Ga0207668_102591171 165
363 3300025986 Ga0207658_10008048 Ga0207658_100080482 165
364 3300025986 Ga0207658_10035614 Ga0207658_100356143 165
365 3300026041 Ga0207639_10040564 Ga0207639_100405643 165
366 3300026088 Ga0207641_10016993 Ga0207641_100169931 165
367 3300027876 Ga0209974_10121778 Ga0209974_101217782 165
368 3300028381 Ga0268264_10419922 Ga0268264_104199222 165
369 3300031824 Ga0307413_10061660 Ga0307413_100616602 165
370 3300031852 Ga0307410_10003596 Ga0307410_100035963 165
371 3300031903 Ga0307407_10031384 Ga0307407_100313843 165
372 3300031995 Ga0307409_100206867 Ga0307409_1002068672 165
373 3300032002 Ga0307416_100069269 Ga0307416_1000692691 165
374 3300032005 Ga0307411_10605556 Ga0307411_106055562 165
375 3300032126 Ga0307415_100097844 Ga0307415_1000978442 165
376 3300035170 Ga0373943_0379166 Ga0373943_0379166_100_612 165
377 3300035691 Ga0373931_0106924 Ga0373931_0106924_398_919 165
378 3300035692 Ga0373935_0104235 Ga0373935_0104235_675_1187 165
379 3300037471 Ga0395905_0072272 Ga0395905_0072272_2140_2658 165
380 3300037471 Ga0395905_0206676 Ga0395905_0206676_455_1003 165
381 3300038443 Ga0395901_0345500 Ga0395901_0345500_790_1308 165
382 3300048903 Ga0496100_0978721 Ga0496100_0978721_62_586 165
383 3300048904 Ga0496101_0065195 Ga0496101_0065195_393_917 165
384 3300048910 Ga0496107_0006978 Ga0496107_0006978_3001_3540 165
385 3300048910 Ga0496107_0358123 Ga0496107_0358123_263_787 165
386 3300048912 Ga0496109_0020941 Ga0496109_0020941_3140_3679 165
387 3300048912 Ga0496109_0896009 Ga0496109_0896009_45_566 165
388 3300048912 Ga0496109_1091865 Ga0496109_1091865_145_654 165
389 3300048913 Ga0496110_0010516 Ga0496110_0010516_3935_4474 165
390 3300048914 Ga0496111_0053188 Ga0496111_0053188_1486_2025 165
391 3300048914 Ga0496111_0816828 Ga0496111_0816828_16_537 165
392 3300048915 Ga0496112_0146453 Ga0496112_0146453_1657_2178 165
393 3300048916 Ga0496113_0222581 Ga0496113_0222581_44_565 165
394 3300048917 Ga0496114_0005747 Ga0496114_0005747_1631_2170 165
395 3300048917 Ga0496114_0271573 Ga0496114_0271573_420_944 165
396 3300048918 Ga0496115_0001982 Ga0496115_0001982_5999_6523 165
397 3300002067 JGI24735J21928_10013884 JGI24735J21928_100138842 166
398 3300005327 Ga0070658_10080678 Ga0070658_100806783 166
399 3300005328 Ga0070676_10193920 Ga0070676_101939201 166
400 3300005328 Ga0070676_10203435 Ga0070676_102034351 166
401 3300005329 Ga0070683_100514256 Ga0070683_1005142562 166
402 3300005331 Ga0070670_100151406 Ga0070670_1001514063 166
403 3300005339 Ga0070660_100080308 Ga0070660_1000803082 166
404 3300005344 Ga0070661_100221448 Ga0070661_1002214482 166
405 3300005354 Ga0070675_101107614 Ga0070675_1011076141 166
406 3300005366 Ga0070659_100335773 Ga0070659_1003357731 166
407 3300005435 Ga0070714_101222361 Ga0070714_1012223611 166
408 3300005457 Ga0070662_100327368 Ga0070662_1003273682 166
409 3300005458 Ga0070681_10149323 Ga0070681_101493233 166
410 3300005530 Ga0070679_100303524 Ga0070679_1003035241 166
411 3300005543 Ga0070672_100482430 Ga0070672_1004824302 166
412 3300005548 Ga0070665_100274026 Ga0070665_1002740262 166
413 3300005564 Ga0070664_100135938 Ga0070664_1001359383 166
414 3300005577 Ga0068857_100045474 Ga0068857_1000454742 166
415 3300005614 Ga0068856_100119211 Ga0068856_1001192113 166
416 3300005616 Ga0068852_100722874 Ga0068852_1007228742 166
417 3300005842 Ga0068858_100022221 Ga0068858_1000222212 166
418 3300005844 Ga0068862_100009248 Ga0068862_1000092482 166
419 3300006358 Ga0068871_100006417 Ga0068871_1000064173 166
420 3300009147 Ga0114129_10357020 Ga0114129_103570202 166
421 3300009545 Ga0105237_10024240 Ga0105237_100242406 166
422 3300013105 Ga0157369_11080176 Ga0157369_110801761 166
423 3300013296 Ga0157374_10867581 Ga0157374_108675812 166
424 3300013307 Ga0157372_10734106 Ga0157372_107341062 166
425 3300014325 Ga0163163_10091516 Ga0163163_100915162 166
426 3300025900 Ga0207710_10139445 Ga0207710_101394452 166
427 3300025904 Ga0207647_10083225 Ga0207647_100832252 166
428 3300025907 Ga0207645_10138155 Ga0207645_101381552 166
429 3300025909 Ga0207705_10046964 Ga0207705_100469641 166
430 3300025912 Ga0207707_10169859 Ga0207707_101698591 166
431 3300025914 Ga0207671_10195065 Ga0207671_101950652 166
432 3300025919 Ga0207657_10065000 Ga0207657_100650002 166
433 3300025919 Ga0207657_10068358 Ga0207657_100683582 166
434 3300025920 Ga0207649_10018682 Ga0207649_100186822 166
435 3300025920 Ga0207649_10341208 Ga0207649_103412082 166
436 3300025929 Ga0207664_10993026 Ga0207664_109930261 166
437 3300025932 Ga0207690_10201824 Ga0207690_102018242 166
438 3300025942 Ga0207689_10030990 Ga0207689_100309902 166
439 3300025944 Ga0207661_10750479 Ga0207661_107504792 166
440 3300025945 Ga0207679_10129703 Ga0207679_101297032 166
441 3300025945 Ga0207679_10670877 Ga0207679_106708771 166
442 3300026067 Ga0207678_10029181 Ga0207678_100291813 166
443 3300026078 Ga0207702_10227452 Ga0207702_102274522 166
444 3300026095 Ga0207676_10606861 Ga0207676_106068612 166
445 3300026095 Ga0207676_10866113 Ga0207676_108661131 166
446 3300026116 Ga0207674_10004077 Ga0207674_1000407716 166
447 3300026118 Ga0207675_100387047 Ga0207675_1003870472 166
448 3300028380 Ga0268265_10432723 Ga0268265_104327231 166
449 3300037312 Ga0395899_0018993 Ga0395899_0018993_234_749 166
450 3300037418 Ga0395900_0959091 Ga0395900_0959091_156_689 166
451 3300037471 Ga0395905_0070915 Ga0395905_0070915_1777_2307 166
452 3300037471 Ga0395905_0238254 Ga0395905_0238254_1053_1568 166
453 3300038443 Ga0395901_0129440 Ga0395901_0129440_839_1354 166
454 3300044694 Ga0466963_0013165 Ga0466963_0013165_3124_3639 166
455 3300045976 Ga0466967_0057824 Ga0466967_0057824_1929_2444 166
456 3300045976 Ga0466967_0193286 Ga0466967_0193286_1070_1594 166
457 3300046684 Ga0495669_0156759 Ga0495669_0156759_167_703 166
458 3300046684 Ga0495669_0438175 Ga0495669_0438175_35_562 166
459 3300048905 Ga0496102_0744269 Ga0496102_0744269_278_811 166
460 3300048909 Ga0496106_0021199 Ga0496106_0021199_312_842 166
461 3300050507 nmdc:mga05p37_388427_c1 nmdc:mga05p37_388427_c1_448_1023 166
462 iso_pu_bacteria 2896429255 2896430587 166
463 3300005290 Ga0065712_10152941 Ga0065712_101529412 167
464 3300005327 Ga0070658_10267703 Ga0070658_102677032 167
465 3300005328 Ga0070676_10134996 Ga0070676_101349962 167
466 3300005330 Ga0070690_100529427 Ga0070690_1005294271 167
467 3300005331 Ga0070670_100401835 Ga0070670_1004018352 167
468 3300005334 Ga0068869_100455567 Ga0068869_1004555671 167
469 3300005335 Ga0070666_10043591 Ga0070666_100435912 167
470 3300005336 Ga0070680_100168601 Ga0070680_1001686012 167
471 3300005338 Ga0068868_100165723 Ga0068868_1001657232 167
472 3300005339 Ga0070660_100306187 Ga0070660_1003061872 167
473 3300005344 Ga0070661_100453561 Ga0070661_1004535612 167
474 3300005353 Ga0070669_100821550 Ga0070669_1008215501 167
475 3300005355 Ga0070671_100125193 Ga0070671_1001251932 167
476 3300005355 Ga0070671_100643322 Ga0070671_1006433221 167
477 3300005364 Ga0070673_100165338 Ga0070673_1001653382 167
478 3300005364 Ga0070673_101297026 Ga0070673_1012970261 167
479 3300005366 Ga0070659_100355688 Ga0070659_1003556882 167
480 3300005367 Ga0070667_100073795 Ga0070667_1000737952 167
481 3300005455 Ga0070663_100100509 Ga0070663_1001005092 167
482 3300005457 Ga0070662_100050029 Ga0070662_1000500292 167
483 3300005458 Ga0070681_10427998 Ga0070681_104279982 167
484 3300005459 Ga0068867_100099499 Ga0068867_1000994992 167
485 3300005530 Ga0070679_100129150 Ga0070679_1001291502 167
486 3300005544 Ga0070686_100611490 Ga0070686_1006114902 167
487 3300005547 Ga0070693_100183163 Ga0070693_1001831632 167
488 3300005548 Ga0070665_100012854 Ga0070665_1000128548 167
489 3300005548 Ga0070665_101347760 Ga0070665_1013477601 167
490 3300005564 Ga0070664_100175131 Ga0070664_1001751312 167
491 3300005578 Ga0068854_100071112 Ga0068854_1000711122 167
492 3300005614 Ga0068856_100327431 Ga0068856_1003274312 167
493 3300005615 Ga0070702_100622095 Ga0070702_1006220951 167
494 3300005617 Ga0068859_100164555 Ga0068859_1001645553 167
495 3300005834 Ga0068851_10069144 Ga0068851_100691442 167
496 3300006931 Ga0097620_100164561 Ga0097620_1001645612 167
497 3300009174 Ga0105241_10144371 Ga0105241_101443712 167
498 3300013100 Ga0157373_10116265 Ga0157373_101162652 167
499 3300013307 Ga0157372_10317258 Ga0157372_103172582 167
500 3300025901 Ga0207688_10024903 Ga0207688_100249033 167
501 3300025901 Ga0207688_10325488 Ga0207688_103254881 167
502 3300025903 Ga0207680_10688954 Ga0207680_106889542 167
503 3300025907 Ga0207645_10035096 Ga0207645_100350962 167
504 3300025909 Ga0207705_10145067 Ga0207705_101450672 167
505 3300025909 Ga0207705_10362739 Ga0207705_103627391 167
506 3300025917 Ga0207660_10243517 Ga0207660_102435172 167
507 3300025919 Ga0207657_10059739 Ga0207657_100597392 167
508 3300025920 Ga0207649_10290304 Ga0207649_102903042 167
509 3300025921 Ga0207652_10537128 Ga0207652_105371282 167
510 3300025925 Ga0207650_10101953 Ga0207650_101019532 167
511 3300025931 Ga0207644_10566374 Ga0207644_105663742 167
512 3300025932 Ga0207690_10459685 Ga0207690_104596852 167
513 3300025933 Ga0207706_10044379 Ga0207706_100443793 167
514 3300025942 Ga0207689_10044482 Ga0207689_100444825 167
515 3300025945 Ga0207679_10291908 Ga0207679_102919082 167
516 3300025960 Ga0207651_10105685 Ga0207651_101056852 167
517 3300025981 Ga0207640_10353592 Ga0207640_103535922 167
518 3300025986 Ga0207658_10173408 Ga0207658_101734082 167
519 3300026041 Ga0207639_10186625 Ga0207639_101866252 167
520 3300026067 Ga0207678_10014935 Ga0207678_100149353 167
521 3300026089 Ga0207648_10097123 Ga0207648_100971233 167
522 3300026116 Ga0207674_10044074 Ga0207674_100440742 167
523 3300028379 Ga0268266_10009325 Ga0268266_100093254 167
524 3300031852 Ga0307410_10292254 Ga0307410_102922541 167
525 3300031911 Ga0307412_10126569 Ga0307412_101265692 167
526 3300031911 Ga0307412_10139254 Ga0307412_101392542 167
527 3300032002 Ga0307416_100323330 Ga0307416_1003233302 167
528 3300032004 Ga0307414_10112593 Ga0307414_101125932 167
529 3300032004 Ga0307414_10215482 Ga0307414_102154822 167
530 3300032005 Ga0307411_10060334 Ga0307411_100603342 167
531 3300032126 Ga0307415_100015345 Ga0307415_1000153454 167
532 3300032126 Ga0307415_100176127 Ga0307415_1001761272 167
533 3300032126 Ga0307415_101111476 Ga0307415_1011114762 167
534 3300038443 Ga0395901_0075005 Ga0395901_0075005_765_1304 167
535 3300039450 Ga0436363_0512431 Ga0436363_0512431_67_585 167
536 3300044842 Ga0466957_0103953 Ga0466957_0103953_919_1443 167
537 3300046616 Ga0495668_0077947 Ga0495668_0077947_297_833 167
538 3300048910 Ga0496107_0435222 Ga0496107_0435222_264_800 167
539 3300053134 Ga0500658_0000073 Ga0500658_0000073_36174_36710 167
540 3300005335 Ga0070666_10120410 Ga0070666_101204102 168
541 3300005338 Ga0068868_100316980 Ga0068868_1003169802 168
542 3300005339 Ga0070660_100010556 Ga0070660_1000105563 168
543 3300005344 Ga0070661_100079500 Ga0070661_1000795003 168
544 3300005344 Ga0070661_100775135 Ga0070661_1007751351 168
545 3300005345 Ga0070692_10064690 Ga0070692_100646902 168
546 3300005347 Ga0070668_100010358 Ga0070668_1000103588 168
547 3300005353 Ga0070669_100081765 Ga0070669_1000817653 168
548 3300005355 Ga0070671_100308212 Ga0070671_1003082122 168
549 3300005356 Ga0070674_100046481 Ga0070674_1000464813 168
550 3300005366 Ga0070659_100197158 Ga0070659_1001971582 168
551 3300005367 Ga0070667_100056316 Ga0070667_1000563162 168
552 3300005367 Ga0070667_100063842 Ga0070667_1000638422 168
553 3300005367 Ga0070667_100068000 Ga0070667_1000680004 168
554 3300005367 Ga0070667_100588176 Ga0070667_1005881762 168
555 3300005455 Ga0070663_100266408 Ga0070663_1002664082 168
556 3300005456 Ga0070678_100132696 Ga0070678_1001326961 168
557 3300005459 Ga0068867_100120324 Ga0068867_1001203242 168
558 3300005459 Ga0068867_100728036 Ga0068867_1007280361 168
559 3300005539 Ga0068853_100118282 Ga0068853_1001182822 168
560 3300005543 Ga0070672_100109649 Ga0070672_1001096493 168
561 3300005564 Ga0070664_100066220 Ga0070664_1000662202 168
562 3300005564 Ga0070664_100182252 Ga0070664_1001822522 168
563 3300005578 Ga0068854_100100937 Ga0068854_1001009372 168
564 3300005616 Ga0068852_100024314 Ga0068852_1000243145 168
565 3300005617 Ga0068859_101131378 Ga0068859_1011313782 168
566 3300005617 Ga0068859_101265103 Ga0068859_1012651031 168
567 3300005719 Ga0068861_100320117 Ga0068861_1003201172 168
568 3300005719 Ga0068861_100602286 Ga0068861_1006022862 168
569 3300005834 Ga0068851_10107123 Ga0068851_101071232 168
570 3300005840 Ga0068870_10129155 Ga0068870_101291552 168
571 3300005841 Ga0068863_100528036 Ga0068863_1005280361 168
572 3300005843 Ga0068860_100012703 Ga0068860_1000127034 168
573 3300005844 Ga0068862_100009717 Ga0068862_1000097178 168
574 3300006237 Ga0097621_100218325 Ga0097621_1002183251 168
575 3300006358 Ga0068871_100112809 Ga0068871_1001128092 168
576 3300006871 Ga0075434_100791979 Ga0075434_1007919792 168
577 3300006881 Ga0068865_100251528 Ga0068865_1002515282 168
578 3300006881 Ga0068865_100329609 Ga0068865_1003296092 168
579 3300006931 Ga0097620_101131388 Ga0097620_1011313882 168
580 3300006931 Ga0097620_101264927 Ga0097620_1012649271 168
581 3300009177 Ga0105248_10088873 Ga0105248_100888733 168
582 3300009177 Ga0105248_10197743 Ga0105248_101977432 168
583 3300009551 Ga0105238_10611228 Ga0105238_106112282 168
584 3300009551 Ga0105238_10743978 Ga0105238_107439782 168
585 3300009553 Ga0105249_10125011 Ga0105249_101250112 168
586 3300013104 Ga0157370_10619460 Ga0157370_106194601 168
587 3300013296 Ga0157374_10054329 Ga0157374_100543292 168
588 3300013297 Ga0157378_10186971 Ga0157378_101869713 168
589 3300013306 Ga0163162_10820375 Ga0163162_108203752 168
590 3300013306 Ga0163162_11016229 Ga0163162_110162291 168
591 3300014968 Ga0157379_10125893 Ga0157379_101258932 168
592 3300025315 Ga0207697_10035271 Ga0207697_100352713 168
593 3300025321 Ga0207656_10015597 Ga0207656_100155973 168
594 3300025893 Ga0207682_10093071 Ga0207682_100930712 168
595 3300025903 Ga0207680_10023816 Ga0207680_100238165 168
596 3300025903 Ga0207680_10083708 Ga0207680_100837082 168
597 3300025903 Ga0207680_10451379 Ga0207680_104513791 168
598 3300025907 Ga0207645_10002074 Ga0207645_100020742 168
599 3300025907 Ga0207645_10214075 Ga0207645_102140752 168
600 3300025908 Ga0207643_10052521 Ga0207643_100525213 168
601 3300025909 Ga0207705_10039435 Ga0207705_100394352 168
602 3300025909 Ga0207705_10043066 Ga0207705_100430662 168
603 3300025919 Ga0207657_10019294 Ga0207657_100192942 168
604 3300025919 Ga0207657_10045766 Ga0207657_100457663 168
605 3300025920 Ga0207649_10342527 Ga0207649_103425271 168
606 3300025921 Ga0207652_10220732 Ga0207652_102207322 168
607 3300025923 Ga0207681_10030507 Ga0207681_100305073 168
608 3300025924 Ga0207694_10392709 Ga0207694_103927092 168
609 3300025926 Ga0207659_10300153 Ga0207659_103001532 168
610 3300025932 Ga0207690_10057356 Ga0207690_100573564 168
611 3300025932 Ga0207690_10096713 Ga0207690_100967132 168
612 3300025932 Ga0207690_10300446 Ga0207690_103004461 168
613 3300025937 Ga0207669_10013845 Ga0207669_100138454 168
614 3300025940 Ga0207691_10107428 Ga0207691_101074282 168
615 3300025941 Ga0207711_10003912 Ga0207711_100039129 168
616 3300025944 Ga0207661_10297569 Ga0207661_102975692 168
617 3300025945 Ga0207679_10239311 Ga0207679_102393112 168
618 3300025972 Ga0207668_10000223 Ga0207668_1000022335 168
619 3300025972 Ga0207668_10173511 Ga0207668_101735112 168
620 3300025986 Ga0207658_10034535 Ga0207658_100345354 168
621 3300025986 Ga0207658_10104199 Ga0207658_101041992 168
622 3300025986 Ga0207658_10558136 Ga0207658_105581362 168
623 3300025986 Ga0207658_10643497 Ga0207658_106434972 168
624 3300026067 Ga0207678_10009957 Ga0207678_100099577 168
625 3300026067 Ga0207678_10083355 Ga0207678_100833553 168
626 3300026088 Ga0207641_10649009 Ga0207641_106490092 168
627 3300026089 Ga0207648_10532373 Ga0207648_105323732 168
628 3300026118 Ga0207675_100493467 Ga0207675_1004934671 168
629 3300026121 Ga0207683_10092191 Ga0207683_100921913 168
630 3300026142 Ga0207698_10184857 Ga0207698_101848572 168
631 3300028379 Ga0268266_10156875 Ga0268266_101568753 168
632 3300028380 Ga0268265_10001836 Ga0268265_100018363 168
633 3300028380 Ga0268265_10119081 Ga0268265_101190812 168
634 3300028381 Ga0268264_10008809 Ga0268264_100088094 168
635 3300031903 Ga0307407_10079831 Ga0307407_100798313 168
636 3300031995 Ga0307409_100012427 Ga0307409_1000124273 168
637 3300032002 Ga0307416_100269105 Ga0307416_1002691052 168
638 3300032004 Ga0307414_10316850 Ga0307414_103168502 168
639 3300037853 Ga0436364_0996148 Ga0436364_0996148_2673_3185 168
640 3300042439 Ga0439464_0011183 Ga0439464_0011183_1529_2068 168
641 3300044842 Ga0466957_0304485 Ga0466957_0304485_165_677 168
642 3300046525 Ga0495663_0123884 Ga0495663_0123884_263_799 168
643 3300046684 Ga0495669_0204177 Ga0495669_0204177_59_595 168
644 3300048910 Ga0496107_0487973 Ga0496107_0487973_185_721 168
645 3300048912 Ga0496109_1187975 Ga0496109_1187975_12_521 168
646 3300049770 Ga0501273_010716 Ga0501273_010716_540_1088 168
647 3300005327 Ga0070658_10039227 Ga0070658_100392274 169
648 3300005339 Ga0070660_100006513 Ga0070660_1000065136 169
649 3300005344 Ga0070661_100077892 Ga0070661_1000778922 169
650 3300005366 Ga0070659_100001058 Ga0070659_10000105814 169
651 3300005440 Ga0070705_100395338 Ga0070705_1003953381 169
652 3300005457 Ga0070662_100053901 Ga0070662_1000539012 169
653 3300005564 Ga0070664_100025432 Ga0070664_1000254326 169
654 3300005834 Ga0068851_10099492 Ga0068851_100994922 169
655 3300013100 Ga0157373_10012019 Ga0157373_100120196 169
656 3300025909 Ga0207705_10170976 Ga0207705_101709762 169
657 3300025919 Ga0207657_10002291 Ga0207657_1000229114 169
658 3300025932 Ga0207690_10011180 Ga0207690_100111802 169
659 3300005457 Ga0070662_100177610 Ga0070662_1001776101 170
660 3300031995 Ga0307409_100110065 Ga0307409_1001100652 170
661 3300032004 Ga0307414_10416692 Ga0307414_104166922 170
662 3300005295 Ga0065707_10246837 Ga0065707_102468372 171
663 3300005345 Ga0070692_10024658 Ga0070692_100246582 171
664 3300005347 Ga0070668_100452668 Ga0070668_1004526681 171
665 3300005455 Ga0070663_100258189 Ga0070663_1002581892 171
666 3300013102 Ga0157371_10366232 Ga0157371_103662322 171
667 3300025909 Ga0207705_10097504 Ga0207705_100975042 171
668 3300025919 Ga0207657_10030898 Ga0207657_100308985 171
669 3300025949 Ga0207667_10258564 Ga0207667_102585642 171
670 3300025972 Ga0207668_10179524 Ga0207668_101795242 171
671 3300026067 Ga0207678_10028426 Ga0207678_100284265 171
672 3300028379 Ga0268266_10264521 Ga0268266_102645212 171
673 3300047320 Ga0495672_0287285 Ga0495672_0287285_134_649 171
674 3300031731 Ga0307405_10068674 Ga0307405_100686742 172
675 3300032002 Ga0307416_100110262 Ga0307416_1001102622 172
676 3300035084 Ga0373928_0120256 Ga0373928_0120256_60_617 172
677 3300031995 Ga0307409_100940745 Ga0307409_1009407451 173
678 3300031824 Ga0307413_10099897 Ga0307413_100998972 174
679 3300031824 Ga0307413_10584816 Ga0307413_105848162 174
680 3300031824 Ga0307413_10664031 Ga0307413_106640312 174
681 3300031852 Ga0307410_10903272 Ga0307410_109032722 174
682 3300031901 Ga0307406_10879292 Ga0307406_108792921 174
683 3300031903 Ga0307407_10626557 Ga0307407_106265572 174
684 3300031911 Ga0307412_10123510 Ga0307412_101235101 174
685 3300031911 Ga0307412_10145585 Ga0307412_101455852 174
686 3300031995 Ga0307409_100261875 Ga0307409_1002618752 174
687 3300032002 Ga0307416_100754779 Ga0307416_1007547792 174
688 3300032004 Ga0307414_10184606 Ga0307414_101846062 174
689 3300032005 Ga0307411_11497776 Ga0307411_114977761 174
690 3300032126 Ga0307415_100157722 Ga0307415_1001577222 174
691 2162886012 MBSR1b_contig_4799473 MBSR1b_0004.00006500 175
692 3300001977 JGI24746J21847_1002084 JGI24746J21847_10020842 175
693 3300002076 JGI24749J21850_1003195 JGI24749J21850_10031952 175
694 3300002155 JGI24033J26618_1020308 JGI24033J26618_10203082 175
695 3300002239 JGI24034J26672_10026050 JGI24034J26672_100260502 175
696 3300002244 JGI24742J22300_10063245 JGI24742J22300_100632451 175
697 3300005293 Ga0065715_10000359 Ga0065715_1000035919 175
698 3300005328 Ga0070676_10020596 Ga0070676_100205962 175
699 3300005330 Ga0070690_100387312 Ga0070690_1003873122 175
700 3300005331 Ga0070670_100021668 Ga0070670_1000216686 175
701 3300005333 Ga0070677_10000999 Ga0070677_100009998 175
702 3300005334 Ga0068869_100916811 Ga0068869_1009168111 175
703 3300005336 Ga0070680_101512107 Ga0070680_1015121071 175
704 3300005344 Ga0070661_100414310 Ga0070661_1004143101 175
705 3300005347 Ga0070668_100027610 Ga0070668_1000276104 175
706 3300005347 Ga0070668_100161674 Ga0070668_1001616742 175
707 3300005353 Ga0070669_100030619 Ga0070669_1000306193 175
708 3300005354 Ga0070675_100004653 Ga0070675_10000465310 175
709 3300005355 Ga0070671_100014729 Ga0070671_1000147297 175
710 3300005356 Ga0070674_100002641 Ga0070674_1000026414 175
711 3300005364 Ga0070673_100065813 Ga0070673_1000658134 175
712 3300005367 Ga0070667_100003455 Ga0070667_10000345513 175
713 3300005441 Ga0070700_100034056 Ga0070700_1000340562 175
714 3300005444 Ga0070694_100287168 Ga0070694_1002871682 175
715 3300005455 Ga0070663_100006460 Ga0070663_1000064602 175
716 3300005457 Ga0070662_100008482 Ga0070662_1000084826 175
717 3300005459 Ga0068867_100156551 Ga0068867_1001565512 175
718 3300005543 Ga0070672_100003490 Ga0070672_1000034909 175
719 3300005564 Ga0070664_100115285 Ga0070664_1001152854 175
720 3300005577 Ga0068857_100219570 Ga0068857_1002195702 175
721 3300005578 Ga0068854_100388055 Ga0068854_1003880552 175
722 3300005615 Ga0070702_100289376 Ga0070702_1002893762 175
723 3300005617 Ga0068859_100036370 Ga0068859_1000363704 175
724 3300005618 Ga0068864_100221533 Ga0068864_1002215332 175
725 3300005718 Ga0068866_10412079 Ga0068866_104120791 175
726 3300005719 Ga0068861_100004768 Ga0068861_1000047688 175
727 3300005840 Ga0068870_10073710 Ga0068870_100737102 175
728 3300005841 Ga0068863_100502325 Ga0068863_1005023252 175
729 3300005843 Ga0068860_100697212 Ga0068860_1006972122 175
730 3300005844 Ga0068862_100005443 Ga0068862_1000054433 175
731 3300005844 Ga0068862_100721894 Ga0068862_1007218941 175
732 3300006871 Ga0075434_100510961 Ga0075434_1005109612 175
733 3300006881 Ga0068865_100157238 Ga0068865_1001572382 175
734 3300006881 Ga0068865_100731295 Ga0068865_1007312951 175
735 3300006931 Ga0097620_100036370 Ga0097620_1000363704 175
736 3300009094 Ga0111539_10072986 Ga0111539_100729862 175
737 3300009094 Ga0111539_10736500 Ga0111539_107365001 175
738 3300009177 Ga0105248_11964412 Ga0105248_119644121 175
739 3300009553 Ga0105249_10010129 Ga0105249_100101293 175
740 3300009553 Ga0105249_10113737 Ga0105249_101137373 175
741 3300009553 Ga0105249_10338919 Ga0105249_103389192 175
742 3300013100 Ga0157373_10185086 Ga0157373_101850862 175
743 3300013306 Ga0163162_10391485 Ga0163162_103914852 175
744 3300013308 Ga0157375_12579454 Ga0157375_125794541 175
745 3300014326 Ga0157380_10005051 Ga0157380_100050519 175
746 3300014326 Ga0157380_10108324 Ga0157380_101083243 175
747 3300014326 Ga0157380_10226606 Ga0157380_102266062 175
748 3300017792 Ga0163161_10210395 Ga0163161_102103952 175
749 3300025315 Ga0207697_10002568 Ga0207697_100025689 175
750 3300025893 Ga0207682_10001693 Ga0207682_100016934 175
751 3300025901 Ga0207688_10081281 Ga0207688_100812812 175
752 3300025907 Ga0207645_10128078 Ga0207645_101280782 175
753 3300025908 Ga0207643_10418670 Ga0207643_104186701 175
754 3300025920 Ga0207649_10970190 Ga0207649_109701901 175
755 3300025923 Ga0207681_10027069 Ga0207681_100270692 175
756 3300025923 Ga0207681_10213239 Ga0207681_102132392 175
757 3300025925 Ga0207650_10003054 Ga0207650_100030542 175
758 3300025926 Ga0207659_10018172 Ga0207659_100181722 175
759 3300025931 Ga0207644_10020310 Ga0207644_100203106 175
760 3300025933 Ga0207706_10000434 Ga0207706_1000043432 175
761 3300025938 Ga0207704_10126284 Ga0207704_101262842 175
762 3300025938 Ga0207704_10580661 Ga0207704_105806611 175
763 3300025940 Ga0207691_10000852 Ga0207691_1000085218 175
764 3300025945 Ga0207679_10347057 Ga0207679_103470572 175
765 3300025960 Ga0207651_10178665 Ga0207651_101786652 175
766 3300025961 Ga0207712_10008327 Ga0207712_100083273 175
767 3300025961 Ga0207712_10520344 Ga0207712_105203442 175
768 3300025972 Ga0207668_10002049 Ga0207668_1000204911 175
769 3300025972 Ga0207668_10157443 Ga0207668_101574431 175
770 3300025981 Ga0207640_10286453 Ga0207640_102864532 175
771 3300025986 Ga0207658_10068482 Ga0207658_100684823 175
772 3300026041 Ga0207639_10386680 Ga0207639_103866801 175
773 3300026067 Ga0207678_10200088 Ga0207678_102000882 175
774 3300026088 Ga0207641_10653234 Ga0207641_106532341 175
775 3300026089 Ga0207648_10106101 Ga0207648_101061011 175
776 3300026095 Ga0207676_10012995 Ga0207676_100129955 175
777 3300026116 Ga0207674_10196538 Ga0207674_101965381 175
778 3300026118 Ga0207675_100025642 Ga0207675_1000256421 175
779 3300026121 Ga0207683_10006197 Ga0207683_100061975 175
780 3300027907 Ga0207428_10462014 Ga0207428_104620142 175
781 3300028380 Ga0268265_10004795 Ga0268265_1000479511 175
782 3300028380 Ga0268265_10727765 Ga0268265_107277651 175
783 3300028380 Ga0268265_11977389 Ga0268265_119773891 175
784 3300028381 Ga0268264_10795517 Ga0268264_107955171 175
785 3300031548 Ga0307408_100017171 Ga0307408_1000171716 175
786 3300031731 Ga0307405_10035968 Ga0307405_100359681 175
787 3300031824 Ga0307413_10001438 Ga0307413_100014384 175
788 3300031824 Ga0307413_10036235 Ga0307413_100362352 175
789 3300031824 Ga0307413_10272732 Ga0307413_102727322 175
790 3300031824 Ga0307413_11634054 Ga0307413_116340541 175
791 3300031852 Ga0307410_10102415 Ga0307410_101024152 175
792 3300031852 Ga0307410_10107957 Ga0307410_101079571 175
793 3300031852 Ga0307410_10323010 Ga0307410_103230102 175
794 3300031901 Ga0307406_10023830 Ga0307406_100238303 175
795 3300031903 Ga0307407_10154385 Ga0307407_101543852 175
796 3300031903 Ga0307407_10437810 Ga0307407_104378102 175
797 3300031911 Ga0307412_10003166 Ga0307412_100031662 175
798 3300031911 Ga0307412_10021619 Ga0307412_100216195 175
799 3300031995 Ga0307409_100071970 Ga0307409_1000719703 175
800 3300031995 Ga0307409_100512531 Ga0307409_1005125312 175
801 3300032002 Ga0307416_100019713 Ga0307416_1000197132 175
802 3300032002 Ga0307416_100342345 Ga0307416_1003423452 175
803 3300032002 Ga0307416_100393236 Ga0307416_1003932362 175
804 3300032002 Ga0307416_101098934 Ga0307416_1010989342 175
805 3300032004 Ga0307414_10011458 Ga0307414_100114582 175
806 3300032004 Ga0307414_10062534 Ga0307414_100625343 175
807 3300032004 Ga0307414_10500915 Ga0307414_105009151 175
808 3300032004 Ga0307414_11823705 Ga0307414_118237051 175
809 3300032005 Ga0307411_10010399 Ga0307411_100103992 175
810 3300032005 Ga0307411_10010853 Ga0307411_100108533 175
811 3300032005 Ga0307411_10034033 Ga0307411_100340334 175
812 3300032005 Ga0307411_10067388 Ga0307411_100673881 175
813 3300032005 Ga0307411_10186000 Ga0307411_101860002 175
814 3300032126 Ga0307415_100087449 Ga0307415_1000874492 175
815 3300032126 Ga0307415_100275699 Ga0307415_1002756992 175
816 3300037418 Ga0395900_0000995 Ga0395900_0000995_5968_6495 175
817 3300037466 Ga0395898_0139400 Ga0395898_0139400_547_1074 175
818 3300037471 Ga0395905_0000538 Ga0395905_0000538_41499_42026 175
819 3300038443 Ga0395901_0002926 Ga0395901_0002926_15718_16245 175
820 3300042012 Ga0439455_0206100 Ga0439455_0206100_11_538 175
821 3300046500 Ga0495596_0051414 Ga0495596_0051414_904_1431 175
822 3300046525 Ga0495663_0003697 Ga0495663_0003697_1227_1754 175
823 3300046525 Ga0495663_0045954 Ga0495663_0045954_733_1260 175
824 3300046537 Ga0495598_0019117 Ga0495598_0019117_583_1110 175
825 3300046539 Ga0495621_0000350 Ga0495621_0000350_9481_10008 175
826 3300046539 Ga0495621_0005701 Ga0495621_0005701_2695_3222 175
827 3300046558 Ga0495633_0031633 Ga0495633_0031633_1178_1705 175
828 3300046664 Ga0495659_0024873 Ga0495659_0024873_943_1470 175
829 3300046684 Ga0495669_0283457 Ga0495669_0283457_247_774 175
830 3300046691 Ga0495670_0010361 Ga0495670_0010361_803_1330 175
831 3300046691 Ga0495670_0012515 Ga0495670_0012515_980_1507 175
832 3300047445 Ga0495677_0024518 Ga0495677_0024518_796_1323 175
833 3300047445 Ga0495677_0165252 Ga0495677_0165252_29_556 175
834 3300047447 Ga0495685_090595 Ga0495685_090595_437_964 175
835 3300048090 Ga0495615_0021854 Ga0495615_0021854_449_976 175
836 3300050511 nmdc:mga08y16_987285_c1 nmdc:mga08y16_987285_c1_32_559 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02556

SecB

Preprotein translocase subunit SecB

43

183

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.9598 23 152
1fx3-assembly1.cif.gz_D crystal structure of h. influenzae secb 0.9436 23 154
1qyn-assembly1.cif.gz_C crystal structure of secb from escherichia coli 0.9387 23 152
1ozb-assembly2.cif.gz_G crystal structure of secb complexed with seca c-terminus 0.9341 19 154
1ozb-assembly1.cif.gz_A crystal structure of secb complexed with seca c-terminus 0.9306 23 163
ID Description Score Start End Superfamily
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.9572 23 155 3.10.420.10
1qynD00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.9301 23 155 3.10.420.10
af_P95257_21_163_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7576 24 144 3.10.420.10
5jtlB00 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7576 18 169 3.10.420.10
af_Q57803_2_154_3.10.420.10 Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like 0.7547 24 161 3.10.420.10
ID Description Score Start End GO Terms
AF-A0A2E5NPE3-F1-model_v4 Protein-export chaperone SecB 0.9739 30 163 GO:0015031
GO:0051082
GO:0051262
AF-A0A2E2YF56-F1-model_v4 Protein-export protein SecB 0.9653 25 155 GO:0005737
GO:0006457
GO:0015031
GO:0051082
GO:0051262
AF-A0A5C9CQ51-F1-model_v4 Preprotein translocase subunit SecB 0.9653 35 159 GO:0015031
GO:0051082
GO:0051262
AF-A0A7J6ZP74-F1-model_v4 deleted 0.9648 34 159
AF-A0A7X3LZW4-F1-model_v4 Protein-export protein SecB 0.9646 21 156 GO:0005737
GO:0006457
GO:0015031
GO:0051082
GO:0051262

Feature Viewer

pLDDT pTM Quality
76.85 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map