F482883
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 836 | 250 | 835 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_11080176|Ga0157369_110801761 |
| Length | 204 |
| Sequence | VRLLGASANAQRFFAAPNISSTVCKDSIMADQEPTPGGNGSGEPGDEPQVSILAQYIKDLSVENPSAPQVFQWQVQPTLDVQFNINLEKVADDVHEIMLKIEVTARSENGVHFVVDLSYAGLFGLRNMPEEALPPFLLIEAPRLMFPFVRQIIADAVINTGFPPLLLDPIDFASAYVAQLQAAQQGGESNGSDEQSASDSPSEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 181 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 182 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 185 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 198 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 205 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 206 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 243 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 244 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 245 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 4.55 |
| Rhizosphere | 94.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_4799473 | 2162886012 | Bacteria | 1343 |
| 2 | JGI24746J21847_1002084 | 3300001977 | Bacteria | 3196 |
| 3 | JGI24740J21852_10096864 | 3300001979 | Bacteria | 755 |
| 4 | JGI24739J22299_10003420 | 3300001989 | Bacteria | 6056 |
| 5 | JGI24735J21928_10013884 | 3300002067 | Bacteria | 2527 |
| 6 | JGI24738J21930_10000035 | 3300002075 | Bacteria | 25714 |
| 7 | JGI24749J21850_1003195 | 3300002076 | Bacteria | 2288 |
| 8 | JGI24033J26618_1020308 | 3300002155 | Bacteria | 847 |
| 9 | JGI24034J26672_10026050 | 3300002239 | Bacteria | 937 |
| 10 | JGI24742J22300_10063245 | 3300002244 | Bacteria | 682 |
| 11 | JGI24751J29686_10030402 | 3300002459 | Bacteria | 1120 |
| 12 | Ga0065165_1007899 | 3300005262 | Bacteria | 5103 |
| 13 | Ga0065712_10152941 | 3300005290 | Bacteria | 1356 |
| 14 | Ga0065715_10000359 | 3300005293 | Bacteria | 22373 |
| 15 | Ga0065707_10246837 | 3300005295 | Bacteria | 1138 |
| 16 | Ga0070658_10039227 | 3300005327 | Bacteria | 3820 |
| 17 | Ga0070658_10042549 | 3300005327 | Bacteria | 3669 |
| 18 | Ga0070658_10080678 | 3300005327 | Bacteria | 2672 |
| 19 | Ga0070658_10090495 | 3300005327 | Bacteria | 2521 |
| 20 | Ga0070658_10189446 | 3300005327 | Bacteria | 1733 |
| 21 | Ga0070658_10267703 | 3300005327 | Bacteria | 1452 |
| 22 | Ga0070676_10020596 | 3300005328 | Bacteria | 3685 |
| 23 | Ga0070676_10134996 | 3300005328 | Bacteria | 1564 |
| 24 | Ga0070676_10193920 | 3300005328 | Bacteria | 1328 |
| 25 | Ga0070676_10203435 | 3300005328 | Bacteria | 1299 |
| 26 | Ga0070676_10265174 | 3300005328 | Bacteria | 1151 |
| 27 | Ga0070676_10314617 | 3300005328 | Bacteria | 1066 |
| 28 | Ga0070683_100514256 | 3300005329 | Bacteria | 1144 |
| 29 | Ga0070690_100233144 | 3300005330 | Bacteria | 1295 |
| 30 | Ga0070690_100387312 | 3300005330 | Bacteria | 1023 |
| 31 | Ga0070690_100529427 | 3300005330 | Bacteria | 886 |
| 32 | Ga0070670_100021668 | 3300005331 | Bacteria | 5525 |
| 33 | Ga0070670_100023463 | 3300005331 | Bacteria | 5310 |
| 34 | Ga0070670_100151406 | 3300005331 | Bacteria | 2007 |
| 35 | Ga0070670_100401835 | 3300005331 | Bacteria | 1209 |
| 36 | Ga0070670_100645807 | 3300005331 | Bacteria | 949 |
| 37 | Ga0070677_10000999 | 3300005333 | Bacteria | 9157 |
| 38 | Ga0070677_10208222 | 3300005333 | Bacteria | 948 |
| 39 | Ga0068869_100045744 | 3300005334 | Bacteria | 3153 |
| 40 | Ga0068869_100091921 | 3300005334 | Bacteria | 2283 |
| 41 | Ga0068869_100455567 | 3300005334 | Bacteria | 1061 |
| 42 | Ga0068869_100916811 | 3300005334 | Bacteria | 759 |
| 43 | Ga0070666_10043591 | 3300005335 | Bacteria | 3004 |
| 44 | Ga0070666_10120410 | 3300005335 | Bacteria | 1820 |
| 45 | Ga0070680_100168601 | 3300005336 | Bacteria | 1842 |
| 46 | Ga0070680_101512107 | 3300005336 | Bacteria | 581 |
| 47 | Ga0070682_100286970 | 3300005337 | Bacteria | 1202 |
| 48 | Ga0068868_100000881 | 3300005338 | Bacteria | 20375 |
| 49 | Ga0068868_100165723 | 3300005338 | Bacteria | 1828 |
| 50 | Ga0068868_100316980 | 3300005338 | Bacteria | 1328 |
| 51 | Ga0070660_100004031 | 3300005339 | Bacteria | 10144 |
| 52 | Ga0070660_100006513 | 3300005339 | Bacteria | 8099 |
| 53 | Ga0070660_100010556 | 3300005339 | Bacteria | 6527 |
| 54 | Ga0070660_100022082 | 3300005339 | Bacteria | 4702 |
| 55 | Ga0070660_100080308 | 3300005339 | Bacteria | 2559 |
| 56 | Ga0070660_100121153 | 3300005339 | Bacteria | 2088 |
| 57 | Ga0070660_100306187 | 3300005339 | Bacteria | 1303 |
| 58 | Ga0070689_100237840 | 3300005340 | Bacteria | 1499 |
| 59 | Ga0070689_100874312 | 3300005340 | Bacteria | 794 |
| 60 | Ga0070687_100294506 | 3300005343 | Bacteria | 1027 |
| 61 | Ga0070687_100378139 | 3300005343 | Bacteria | 922 |
| 62 | Ga0070661_100077892 | 3300005344 | Bacteria | 2445 |
| 63 | Ga0070661_100079500 | 3300005344 | Bacteria | 2420 |
| 64 | Ga0070661_100092146 | 3300005344 | Bacteria | 2245 |
| 65 | Ga0070661_100118586 | 3300005344 | Bacteria | 1980 |
| 66 | Ga0070661_100221448 | 3300005344 | Bacteria | 1451 |
| 67 | Ga0070661_100414310 | 3300005344 | Bacteria | 1067 |
| 68 | Ga0070661_100453561 | 3300005344 | Bacteria | 1020 |
| 69 | Ga0070661_100775135 | 3300005344 | Bacteria | 785 |
| 70 | Ga0070661_100940087 | 3300005344 | Bacteria | 715 |
| 71 | Ga0070692_10024658 | 3300005345 | Bacteria | 2958 |
| 72 | Ga0070692_10064690 | 3300005345 | Bacteria | 1934 |
| 73 | Ga0070692_10462774 | 3300005345 | Bacteria | 814 |
| 74 | Ga0070668_100010358 | 3300005347 | Bacteria | 6924 |
| 75 | Ga0070668_100027610 | 3300005347 | Bacteria | 4309 |
| 76 | Ga0070668_100032292 | 3300005347 | Bacteria | 3984 |
| 77 | Ga0070668_100161674 | 3300005347 | Bacteria | 1817 |
| 78 | Ga0070668_100304141 | 3300005347 | Bacteria | 1338 |
| 79 | Ga0070668_100430959 | 3300005347 | Bacteria | 1130 |
| 80 | Ga0070668_100452668 | 3300005347 | Bacteria | 1104 |
| 81 | Ga0070669_100002615 | 3300005353 | Bacteria | 13015 |
| 82 | Ga0070669_100030619 | 3300005353 | Bacteria | 3884 |
| 83 | Ga0070669_100074454 | 3300005353 | Bacteria | 2517 |
| 84 | Ga0070669_100081765 | 3300005353 | Bacteria | 2407 |
| 85 | Ga0070669_100821550 | 3300005353 | Bacteria | 791 |
| 86 | Ga0070669_101381627 | 3300005353 | Bacteria | 611 |
| 87 | Ga0070675_100004653 | 3300005354 | Bacteria | 10479 |
| 88 | Ga0070675_100163451 | 3300005354 | Bacteria | 1916 |
| 89 | Ga0070675_101107614 | 3300005354 | Bacteria | 728 |
| 90 | Ga0070671_100004406 | 3300005355 | Bacteria | 11129 |
| 91 | Ga0070671_100013680 | 3300005355 | Bacteria | 6544 |
| 92 | Ga0070671_100014729 | 3300005355 | Bacteria | 6321 |
| 93 | Ga0070671_100035593 | 3300005355 | Bacteria | 4125 |
| 94 | Ga0070671_100040586 | 3300005355 | Bacteria | 3866 |
| 95 | Ga0070671_100125193 | 3300005355 | Bacteria | 2164 |
| 96 | Ga0070671_100187950 | 3300005355 | Bacteria | 1750 |
| 97 | Ga0070671_100308212 | 3300005355 | Bacteria | 1348 |
| 98 | Ga0070671_100643322 | 3300005355 | Bacteria | 918 |
| 99 | Ga0070674_100002641 | 3300005356 | Bacteria | 9913 |
| 100 | Ga0070674_100046481 | 3300005356 | Bacteria | 2970 |
| 101 | Ga0070674_100060210 | 3300005356 | Bacteria | 2646 |
| 102 | Ga0070673_100003488 | 3300005364 | Bacteria | 9795 |
| 103 | Ga0070673_100065813 | 3300005364 | Bacteria | 2893 |
| 104 | Ga0070673_100102861 | 3300005364 | Bacteria | 2356 |
| 105 | Ga0070673_100144859 | 3300005364 | Bacteria | 2007 |
| 106 | Ga0070673_100165338 | 3300005364 | Bacteria | 1884 |
| 107 | Ga0070673_100479821 | 3300005364 | Bacteria | 1122 |
| 108 | Ga0070673_101297026 | 3300005364 | Bacteria | 684 |
| 109 | Ga0070688_100171660 | 3300005365 | Bacteria | 1497 |
| 110 | Ga0070659_100001058 | 3300005366 | Bacteria | 20125 |
| 111 | Ga0070659_100001497 | 3300005366 | Bacteria | 16828 |
| 112 | Ga0070659_100001672 | 3300005366 | Bacteria | 15938 |
| 113 | Ga0070659_100197158 | 3300005366 | Bacteria | 1656 |
| 114 | Ga0070659_100329388 | 3300005366 | Bacteria | 1278 |
| 115 | Ga0070659_100335773 | 3300005366 | Bacteria | 1265 |
| 116 | Ga0070659_100355688 | 3300005366 | Bacteria | 1229 |
| 117 | Ga0070667_100003302 | 3300005367 | Bacteria | 13792 |
| 118 | Ga0070667_100003455 | 3300005367 | Bacteria | 13460 |
| 119 | Ga0070667_100040579 | 3300005367 | Bacteria | 3903 |
| 120 | Ga0070667_100056316 | 3300005367 | Bacteria | 3321 |
| 121 | Ga0070667_100063842 | 3300005367 | Bacteria | 3122 |
| 122 | Ga0070667_100068000 | 3300005367 | Bacteria | 3030 |
| 123 | Ga0070667_100073795 | 3300005367 | Bacteria | 2909 |
| 124 | Ga0070667_100331256 | 3300005367 | Bacteria | 1375 |
| 125 | Ga0070667_100588176 | 3300005367 | Bacteria | 1025 |
| 126 | Ga0070709_10004923 | 3300005434 | Bacteria | 7213 |
| 127 | Ga0070714_100045950 | 3300005435 | Bacteria | 3702 |
| 128 | Ga0070714_100048939 | 3300005435 | Bacteria | 3597 |
| 129 | Ga0070714_101222361 | 3300005435 | Bacteria | 733 |
| 130 | Ga0070713_100041173 | 3300005436 | Bacteria | 3762 |
| 131 | Ga0070705_100395338 | 3300005440 | Bacteria | 1022 |
| 132 | Ga0070700_100034056 | 3300005441 | Bacteria | 3073 |
| 133 | Ga0070694_100287168 | 3300005444 | Bacteria | 1256 |
| 134 | Ga0070694_100348458 | 3300005444 | Bacteria | 1147 |
| 135 | Ga0070663_100006460 | 3300005455 | Bacteria | 7055 |
| 136 | Ga0070663_100028142 | 3300005455 | Bacteria | 3823 |
| 137 | Ga0070663_100100509 | 3300005455 | Bacteria | 2157 |
| 138 | Ga0070663_100258189 | 3300005455 | Bacteria | 1381 |
| 139 | Ga0070663_100266408 | 3300005455 | Bacteria | 1360 |
| 140 | Ga0070663_100307328 | 3300005455 | Bacteria | 1271 |
| 141 | Ga0070663_100348667 | 3300005455 | Bacteria | 1198 |
| 142 | Ga0070663_100396648 | 3300005455 | Bacteria | 1127 |
| 143 | Ga0070663_100794110 | 3300005455 | Bacteria | 811 |
| 144 | Ga0070678_100132696 | 3300005456 | Bacteria | 1981 |
| 145 | Ga0070662_100002895 | 3300005457 | Bacteria | 10656 |
| 146 | Ga0070662_100008482 | 3300005457 | Bacteria | 6706 |
| 147 | Ga0070662_100050029 | 3300005457 | Bacteria | 3014 |
| 148 | Ga0070662_100053901 | 3300005457 | Bacteria | 2913 |
| 149 | Ga0070662_100070347 | 3300005457 | Bacteria | 2578 |
| 150 | Ga0070662_100177610 | 3300005457 | Bacteria | 1676 |
| 151 | Ga0070662_100251782 | 3300005457 | Bacteria | 1420 |
| 152 | Ga0070662_100327368 | 3300005457 | Bacteria | 1251 |
| 153 | Ga0070681_10149323 | 3300005458 | Bacteria | 2264 |
| 154 | Ga0070681_10427998 | 3300005458 | Bacteria | 1236 |
| 155 | Ga0068867_100005296 | 3300005459 | Bacteria | 9108 |
| 156 | Ga0068867_100006073 | 3300005459 | Bacteria | 8562 |
| 157 | Ga0068867_100099499 | 3300005459 | Bacteria | 2219 |
| 158 | Ga0068867_100120324 | 3300005459 | Bacteria | 2028 |
| 159 | Ga0068867_100155741 | 3300005459 | Bacteria | 1798 |
| 160 | Ga0068867_100156551 | 3300005459 | Bacteria | 1794 |
| 161 | Ga0068867_100728036 | 3300005459 | Bacteria | 878 |
| 162 | Ga0070685_10131747 | 3300005466 | Bacteria | 1564 |
| 163 | Ga0070679_100129150 | 3300005530 | Bacteria | 2508 |
| 164 | Ga0070679_100303524 | 3300005530 | Bacteria | 1547 |
| 165 | Ga0070679_100418171 | 3300005530 | Bacteria | 1286 |
| 166 | Ga0068853_100007792 | 3300005539 | Bacteria | 8589 |
| 167 | Ga0068853_100033639 | 3300005539 | Bacteria | 4350 |
| 168 | Ga0068853_100118282 | 3300005539 | Bacteria | 2361 |
| 169 | Ga0068853_100185963 | 3300005539 | Bacteria | 1886 |
| 170 | Ga0070672_100003490 | 3300005543 | Bacteria | 10188 |
| 171 | Ga0070672_100008903 | 3300005543 | Bacteria | 6895 |
| 172 | Ga0070672_100081691 | 3300005543 | Bacteria | 2591 |
| 173 | Ga0070672_100109649 | 3300005543 | Bacteria | 2248 |
| 174 | Ga0070672_100457398 | 3300005543 | Bacteria | 1100 |
| 175 | Ga0070672_100482430 | 3300005543 | Bacteria | 1071 |
| 176 | Ga0070672_100619425 | 3300005543 | Bacteria | 944 |
| 177 | Ga0070686_100519189 | 3300005544 | Bacteria | 927 |
| 178 | Ga0070686_100611490 | 3300005544 | Bacteria | 860 |
| 179 | Ga0070695_100329580 | 3300005545 | Bacteria | 1137 |
| 180 | Ga0070696_100271458 | 3300005546 | Bacteria | 1290 |
| 181 | Ga0070693_100060368 | 3300005547 | Bacteria | 2201 |
| 182 | Ga0070693_100075771 | 3300005547 | Bacteria | 1993 |
| 183 | Ga0070693_100183163 | 3300005547 | Bacteria | 1350 |
| 184 | Ga0070693_100782394 | 3300005547 | Bacteria | 706 |
| 185 | Ga0070665_100012854 | 3300005548 | Bacteria | 8428 |
| 186 | Ga0070665_100274026 | 3300005548 | Bacteria | 1689 |
| 187 | Ga0070665_100628837 | 3300005548 | Bacteria | 1086 |
| 188 | Ga0070665_100969566 | 3300005548 | Bacteria | 863 |
| 189 | Ga0070665_101347760 | 3300005548 | Bacteria | 723 |
| 190 | Ga0068855_100031999 | 3300005563 | Bacteria | 6280 |
| 191 | Ga0068855_100554548 | 3300005563 | Bacteria | 1244 |
| 192 | Ga0070664_100025432 | 3300005564 | Bacteria | 4907 |
| 193 | Ga0070664_100029545 | 3300005564 | Bacteria | 4570 |
| 194 | Ga0070664_100035533 | 3300005564 | Bacteria | 4183 |
| 195 | Ga0070664_100039633 | 3300005564 | Bacteria | 3970 |
| 196 | Ga0070664_100047598 | 3300005564 | Bacteria | 3623 |
| 197 | Ga0070664_100066220 | 3300005564 | Bacteria | 3084 |
| 198 | Ga0070664_100115285 | 3300005564 | Bacteria | 2348 |
| 199 | Ga0070664_100135938 | 3300005564 | Bacteria | 2161 |
| 200 | Ga0070664_100175131 | 3300005564 | Bacteria | 1904 |
| 201 | Ga0070664_100182252 | 3300005564 | Bacteria | 1867 |
| 202 | Ga0068857_100003503 | 3300005577 | Bacteria | 13106 |
| 203 | Ga0068857_100045474 | 3300005577 | Bacteria | 3895 |
| 204 | Ga0068857_100051053 | 3300005577 | Bacteria | 3667 |
| 205 | Ga0068857_100219570 | 3300005577 | Bacteria | 1736 |
| 206 | Ga0068857_101142212 | 3300005577 | Bacteria | 753 |
| 207 | Ga0068854_100004302 | 3300005578 | Bacteria | 8970 |
| 208 | Ga0068854_100037092 | 3300005578 | Bacteria | 3419 |
| 209 | Ga0068854_100071112 | 3300005578 | Bacteria | 2544 |
| 210 | Ga0068854_100100937 | 3300005578 | Bacteria | 2163 |
| 211 | Ga0068854_100388055 | 3300005578 | Bacteria | 1152 |
| 212 | Ga0068854_100545485 | 3300005578 | Bacteria | 983 |
| 213 | Ga0068856_100033259 | 3300005614 | Bacteria | 5048 |
| 214 | Ga0068856_100034293 | 3300005614 | Bacteria | 4971 |
| 215 | Ga0068856_100080624 | 3300005614 | Bacteria | 3228 |
| 216 | Ga0068856_100119211 | 3300005614 | Bacteria | 2640 |
| 217 | Ga0068856_100327431 | 3300005614 | Bacteria | 1550 |
| 218 | Ga0068856_100394677 | 3300005614 | Bacteria | 1403 |
| 219 | Ga0068856_100753644 | 3300005614 | Bacteria | 994 |
| 220 | Ga0070702_100289376 | 3300005615 | Bacteria | 1128 |
| 221 | Ga0070702_100622095 | 3300005615 | Bacteria | 813 |
| 222 | Ga0068852_100001990 | 3300005616 | Bacteria | 13925 |
| 223 | Ga0068852_100024314 | 3300005616 | Bacteria | 4894 |
| 224 | Ga0068852_100050120 | 3300005616 | Bacteria | 3576 |
| 225 | Ga0068852_100068158 | 3300005616 | Bacteria | 3113 |
| 226 | Ga0068852_100256482 | 3300005616 | Bacteria | 1677 |
| 227 | Ga0068852_100722874 | 3300005616 | Bacteria | 1007 |
| 228 | Ga0068859_100008163 | 3300005617 | Bacteria | 10621 |
| 229 | Ga0068859_100012474 | 3300005617 | Bacteria | 8547 |
| 230 | Ga0068859_100036370 | 3300005617 | Bacteria | 4943 |
| 231 | Ga0068859_100142831 | 3300005617 | Bacteria | 2467 |
| 232 | Ga0068859_100162923 | 3300005617 | Bacteria | 2309 |
| 233 | Ga0068859_100164555 | 3300005617 | Bacteria | 2298 |
| 234 | Ga0068859_101131378 | 3300005617 | Bacteria | 862 |
| 235 | Ga0068859_101265103 | 3300005617 | Bacteria | 813 |
| 236 | Ga0068864_100003128 | 3300005618 | Bacteria | 13675 |
| 237 | Ga0068864_100221533 | 3300005618 | Bacteria | 1746 |
| 238 | Ga0068864_100290357 | 3300005618 | Bacteria | 1529 |
| 239 | Ga0068866_10137169 | 3300005718 | Bacteria | 1399 |
| 240 | Ga0068866_10348395 | 3300005718 | Bacteria | 940 |
| 241 | Ga0068866_10412079 | 3300005718 | Bacteria | 874 |
| 242 | Ga0068861_100004768 | 3300005719 | Bacteria | 9116 |
| 243 | Ga0068861_100320117 | 3300005719 | Bacteria | 1350 |
| 244 | Ga0068861_100326971 | 3300005719 | Bacteria | 1337 |
| 245 | Ga0068861_100414096 | 3300005719 | Bacteria | 1199 |
| 246 | Ga0068861_100440753 | 3300005719 | Bacteria | 1165 |
| 247 | Ga0068861_100602286 | 3300005719 | Bacteria | 1009 |
| 248 | Ga0068851_10024620 | 3300005834 | Bacteria | 2948 |
| 249 | Ga0068851_10069144 | 3300005834 | Bacteria | 1823 |
| 250 | Ga0068851_10099492 | 3300005834 | Bacteria | 1541 |
| 251 | Ga0068851_10107123 | 3300005834 | Bacteria | 1489 |
| 252 | Ga0068870_10073710 | 3300005840 | Bacteria | 1868 |
| 253 | Ga0068870_10129155 | 3300005840 | Bacteria | 1466 |
| 254 | Ga0068863_100037056 | 3300005841 | Bacteria | 4644 |
| 255 | Ga0068863_100082035 | 3300005841 | Bacteria | 3055 |
| 256 | Ga0068863_100411949 | 3300005841 | Bacteria | 1323 |
| 257 | Ga0068863_100502325 | 3300005841 | Bacteria | 1194 |
| 258 | Ga0068863_100528036 | 3300005841 | Bacteria | 1164 |
| 259 | Ga0068863_100546393 | 3300005841 | Bacteria | 1143 |
| 260 | Ga0068858_100005468 | 3300005842 | Bacteria | 12438 |
| 261 | Ga0068858_100005690 | 3300005842 | Bacteria | 12183 |
| 262 | Ga0068858_100015129 | 3300005842 | Bacteria | 7256 |
| 263 | Ga0068858_100017238 | 3300005842 | Bacteria | 6776 |
| 264 | Ga0068858_100022221 | 3300005842 | Bacteria | 5923 |
| 265 | Ga0068860_100012703 | 3300005843 | Bacteria | 8285 |
| 266 | Ga0068860_100059624 | 3300005843 | Bacteria | 3628 |
| 267 | Ga0068860_100388980 | 3300005843 | Bacteria | 1378 |
| 268 | Ga0068860_100697212 | 3300005843 | Bacteria | 1025 |
| 269 | Ga0068862_100005443 | 3300005844 | Bacteria | 10639 |
| 270 | Ga0068862_100009248 | 3300005844 | Bacteria | 8159 |
| 271 | Ga0068862_100009717 | 3300005844 | Bacteria | 7951 |
| 272 | Ga0068862_100063009 | 3300005844 | Bacteria | 3190 |
| 273 | Ga0068862_100128028 | 3300005844 | Bacteria | 2243 |
| 274 | Ga0068862_100721894 | 3300005844 | Bacteria | 967 |
| 275 | Ga0070716_100044247 | 3300006173 | Bacteria | 2493 |
| 276 | Ga0070712_100619233 | 3300006175 | Bacteria | 917 |
| 277 | Ga0097621_100014323 | 3300006237 | Bacteria | 5932 |
| 278 | Ga0097621_100218325 | 3300006237 | Bacteria | 1660 |
| 279 | Ga0068871_100006417 | 3300006358 | Bacteria | 8321 |
| 280 | Ga0068871_100105553 | 3300006358 | Bacteria | 2364 |
| 281 | Ga0068871_100112809 | 3300006358 | Bacteria | 2288 |
| 282 | Ga0068871_100125634 | 3300006358 | Bacteria | 2171 |
| 283 | Ga0075433_10011424 | 3300006852 | Bacteria | 7152 |
| 284 | Ga0075434_100510961 | 3300006871 | Bacteria | 1222 |
| 285 | Ga0075434_100791979 | 3300006871 | Bacteria | 964 |
| 286 | Ga0068865_100033541 | 3300006881 | Bacteria | 3438 |
| 287 | Ga0068865_100157238 | 3300006881 | Bacteria | 1730 |
| 288 | Ga0068865_100251528 | 3300006881 | Bacteria | 1395 |
| 289 | Ga0068865_100329609 | 3300006881 | Bacteria | 1230 |
| 290 | Ga0068865_100731295 | 3300006881 | Bacteria | 848 |
| 291 | Ga0075436_100213878 | 3300006914 | Bacteria | 1367 |
| 292 | Ga0097620_100008163 | 3300006931 | Bacteria | 10621 |
| 293 | Ga0097620_100012475 | 3300006931 | Bacteria | 8547 |
| 294 | Ga0097620_100036370 | 3300006931 | Bacteria | 4943 |
| 295 | Ga0097620_100142837 | 3300006931 | Bacteria | 2467 |
| 296 | Ga0097620_100162921 | 3300006931 | Bacteria | 2309 |
| 297 | Ga0097620_100164561 | 3300006931 | Bacteria | 2298 |
| 298 | Ga0097620_101131388 | 3300006931 | Bacteria | 862 |
| 299 | Ga0097620_101264927 | 3300006931 | Bacteria | 813 |
| 300 | Ga0075435_100261170 | 3300007076 | Bacteria | 1476 |
| 301 | Ga0105240_10109964 | 3300009093 | Bacteria | 3336 |
| 302 | Ga0111539_10072986 | 3300009094 | Bacteria | 4046 |
| 303 | Ga0111539_10736500 | 3300009094 | Bacteria | 1147 |
| 304 | Ga0105245_10000285 | 3300009098 | Bacteria | 48237 |
| 305 | Ga0105245_10021177 | 3300009098 | Bacteria | 5701 |
| 306 | Ga0114129_10357020 | 3300009147 | Bacteria | 1935 |
| 307 | Ga0105241_10042296 | 3300009174 | Bacteria | 3446 |
| 308 | Ga0105241_10144371 | 3300009174 | Bacteria | 1941 |
| 309 | Ga0105248_10020125 | 3300009177 | Bacteria | 7394 |
| 310 | Ga0105248_10046924 | 3300009177 | Bacteria | 4843 |
| 311 | Ga0105248_10051371 | 3300009177 | Bacteria | 4625 |
| 312 | Ga0105248_10088873 | 3300009177 | Bacteria | 3477 |
| 313 | Ga0105248_10197743 | 3300009177 | Bacteria | 2265 |
| 314 | Ga0105248_10608041 | 3300009177 | Bacteria | 1233 |
| 315 | Ga0105248_11964412 | 3300009177 | Bacteria | 664 |
| 316 | Ga0105237_10024240 | 3300009545 | Bacteria | 6208 |
| 317 | Ga0105238_10110443 | 3300009551 | Bacteria | 2730 |
| 318 | Ga0105238_10611228 | 3300009551 | Bacteria | 1098 |
| 319 | Ga0105238_10743978 | 3300009551 | Bacteria | 994 |
| 320 | Ga0105249_10010129 | 3300009553 | Bacteria | 8276 |
| 321 | Ga0105249_10024423 | 3300009553 | Bacteria | 5432 |
| 322 | Ga0105249_10113737 | 3300009553 | Bacteria | 2562 |
| 323 | Ga0105249_10125011 | 3300009553 | Bacteria | 2448 |
| 324 | Ga0105249_10309443 | 3300009553 | Bacteria | 1587 |
| 325 | Ga0105249_10338919 | 3300009553 | Bacteria | 1520 |
| 326 | Ga0105249_10384045 | 3300009553 | Bacteria | 1431 |
| 327 | Ga0105239_10064925 | 3300010375 | Bacteria | 4008 |
| 328 | Ga0105239_11480589 | 3300010375 | Unclassified | 784 |
| 329 | Ga0105246_10012160 | 3300011119 | Bacteria | 5365 |
| 330 | Ga0105246_10156921 | 3300011119 | Bacteria | 1729 |
| 331 | Ga0157373_10011849 | 3300013100 | Bacteria | 6405 |
| 332 | Ga0157373_10012019 | 3300013100 | Bacteria | 6364 |
| 333 | Ga0157373_10016553 | 3300013100 | Bacteria | 5376 |
| 334 | Ga0157373_10030375 | 3300013100 | Bacteria | 3888 |
| 335 | Ga0157373_10116265 | 3300013100 | Bacteria | 1880 |
| 336 | Ga0157373_10185086 | 3300013100 | Bacteria | 1467 |
| 337 | Ga0157371_10002316 | 3300013102 | Bacteria | 18311 |
| 338 | Ga0157371_10263314 | 3300013102 | Bacteria | 1243 |
| 339 | Ga0157371_10366232 | 3300013102 | Bacteria | 1051 |
| 340 | Ga0157370_10134409 | 3300013104 | Bacteria | 2306 |
| 341 | Ga0157370_10619460 | 3300013104 | Bacteria | 990 |
| 342 | Ga0157370_11060271 | 3300013104 | Bacteria | 733 |
| 343 | Ga0157369_10048804 | 3300013105 | Bacteria | 4592 |
| 344 | Ga0157369_10100375 | 3300013105 | Bacteria | 3085 |
| 345 | Ga0157369_11080176 | 3300013105 | Bacteria | 820 |
| 346 | Ga0157374_10054329 | 3300013296 | Bacteria | 3736 |
| 347 | Ga0157374_10867581 | 3300013296 | Bacteria | 920 |
| 348 | Ga0157378_10001258 | 3300013297 | Bacteria | 22842 |
| 349 | Ga0157378_10186971 | 3300013297 | Bacteria | 1951 |
| 350 | Ga0157378_10482727 | 3300013297 | Bacteria | 1235 |
| 351 | Ga0163162_10037174 | 3300013306 | Bacteria | 4857 |
| 352 | Ga0163162_10161998 | 3300013306 | Bacteria | 2359 |
| 353 | Ga0163162_10391485 | 3300013306 | Bacteria | 1522 |
| 354 | Ga0163162_10437872 | 3300013306 | Bacteria | 1439 |
| 355 | Ga0163162_10820375 | 3300013306 | Bacteria | 1047 |
| 356 | Ga0163162_11016229 | 3300013306 | Bacteria | 938 |
| 357 | Ga0157372_10031246 | 3300013307 | Bacteria | 5830 |
| 358 | Ga0157372_10317258 | 3300013307 | Bacteria | 1814 |
| 359 | Ga0157372_10619193 | 3300013307 | Bacteria | 1261 |
| 360 | Ga0157372_10734106 | 3300013307 | Bacteria | 1148 |
| 361 | Ga0157375_10004348 | 3300013308 | Bacteria | 12300 |
| 362 | Ga0157375_10058033 | 3300013308 | Bacteria | 3828 |
| 363 | Ga0157375_10205827 | 3300013308 | Bacteria | 2124 |
| 364 | Ga0157375_10398105 | 3300013308 | Bacteria | 1544 |
| 365 | Ga0157375_10875080 | 3300013308 | Bacteria | 1044 |
| 366 | Ga0157375_12579454 | 3300013308 | Bacteria | 607 |
| 367 | Ga0163163_10091516 | 3300014325 | Bacteria | 3056 |
| 368 | Ga0163163_10189906 | 3300014325 | Bacteria | 2103 |
| 369 | Ga0157380_10005051 | 3300014326 | Bacteria | 9205 |
| 370 | Ga0157380_10108324 | 3300014326 | Bacteria | 2329 |
| 371 | Ga0157380_10226606 | 3300014326 | Bacteria | 1676 |
| 372 | Ga0157379_10125893 | 3300014968 | Bacteria | 2305 |
| 373 | Ga0163161_10000753 | 3300017792 | Bacteria | 25411 |
| 374 | Ga0163161_10210395 | 3300017792 | Bacteria | 1502 |
| 375 | Ga0207666_1004870 | 3300025271 | Bacteria | 1697 |
| 376 | Ga0207673_1003610 | 3300025290 | Bacteria | 1818 |
| 377 | Ga0207697_10000158 | 3300025315 | Bacteria | 33821 |
| 378 | Ga0207697_10002568 | 3300025315 | Bacteria | 9344 |
| 379 | Ga0207697_10035271 | 3300025315 | Bacteria | 2047 |
| 380 | Ga0207697_10068977 | 3300025315 | Bacteria | 1480 |
| 381 | Ga0207656_10015597 | 3300025321 | Bacteria | 2943 |
| 382 | Ga0207682_10001693 | 3300025893 | Bacteria | 10102 |
| 383 | Ga0207682_10093071 | 3300025893 | Bacteria | 1309 |
| 384 | Ga0207642_10391403 | 3300025899 | Bacteria | 830 |
| 385 | Ga0207710_10139445 | 3300025900 | Bacteria | 1170 |
| 386 | Ga0207688_10000317 | 3300025901 | Bacteria | 22230 |
| 387 | Ga0207688_10024903 | 3300025901 | Bacteria | 3283 |
| 388 | Ga0207688_10081281 | 3300025901 | Bacteria | 1851 |
| 389 | Ga0207688_10278317 | 3300025901 | Bacteria | 1019 |
| 390 | Ga0207688_10325488 | 3300025901 | Bacteria | 944 |
| 391 | Ga0207680_10023816 | 3300025903 | Bacteria | 3350 |
| 392 | Ga0207680_10083708 | 3300025903 | Bacteria | 2011 |
| 393 | Ga0207680_10451379 | 3300025903 | Bacteria | 912 |
| 394 | Ga0207680_10688954 | 3300025903 | Bacteria | 732 |
| 395 | Ga0207647_10000253 | 3300025904 | Bacteria | 43758 |
| 396 | Ga0207647_10083225 | 3300025904 | Bacteria | 1916 |
| 397 | Ga0207645_10002074 | 3300025907 | Bacteria | 16043 |
| 398 | Ga0207645_10026481 | 3300025907 | Bacteria | 3746 |
| 399 | Ga0207645_10027619 | 3300025907 | Bacteria | 3663 |
| 400 | Ga0207645_10035096 | 3300025907 | Bacteria | 3220 |
| 401 | Ga0207645_10128078 | 3300025907 | Bacteria | 1651 |
| 402 | Ga0207645_10138155 | 3300025907 | Bacteria | 1587 |
| 403 | Ga0207645_10159546 | 3300025907 | Bacteria | 1475 |
| 404 | Ga0207645_10214075 | 3300025907 | Bacteria | 1269 |
| 405 | Ga0207643_10052521 | 3300025908 | Bacteria | 2315 |
| 406 | Ga0207643_10418670 | 3300025908 | Bacteria | 849 |
| 407 | Ga0207705_10016274 | 3300025909 | Bacteria | 5334 |
| 408 | Ga0207705_10039435 | 3300025909 | Bacteria | 3385 |
| 409 | Ga0207705_10043066 | 3300025909 | Bacteria | 3242 |
| 410 | Ga0207705_10046964 | 3300025909 | Bacteria | 3104 |
| 411 | Ga0207705_10097504 | 3300025909 | Bacteria | 2159 |
| 412 | Ga0207705_10108167 | 3300025909 | Bacteria | 2052 |
| 413 | Ga0207705_10145067 | 3300025909 | Bacteria | 1775 |
| 414 | Ga0207705_10170976 | 3300025909 | Bacteria | 1636 |
| 415 | Ga0207705_10362739 | 3300025909 | Bacteria | 1117 |
| 416 | Ga0207705_10724521 | 3300025909 | Bacteria | 773 |
| 417 | Ga0207654_10152514 | 3300025911 | Bacteria | 1484 |
| 418 | Ga0207707_10169859 | 3300025912 | Bacteria | 1906 |
| 419 | Ga0207707_10992692 | 3300025912 | Bacteria | 689 |
| 420 | Ga0207671_10195065 | 3300025914 | Bacteria | 1580 |
| 421 | Ga0207693_10058526 | 3300025915 | Bacteria | 3018 |
| 422 | Ga0207660_10243517 | 3300025917 | Bacteria | 1417 |
| 423 | Ga0207662_10213130 | 3300025918 | Bacteria | 1254 |
| 424 | Ga0207662_10286789 | 3300025918 | Bacteria | 1091 |
| 425 | Ga0207657_10002291 | 3300025919 | Bacteria | 20732 |
| 426 | Ga0207657_10011406 | 3300025919 | Bacteria | 8823 |
| 427 | Ga0207657_10019294 | 3300025919 | Bacteria | 6479 |
| 428 | Ga0207657_10030898 | 3300025919 | Bacteria | 4855 |
| 429 | Ga0207657_10042043 | 3300025919 | Bacteria | 4036 |
| 430 | Ga0207657_10045766 | 3300025919 | Bacteria | 3837 |
| 431 | Ga0207657_10047166 | 3300025919 | Bacteria | 3769 |
| 432 | Ga0207657_10059739 | 3300025919 | Bacteria | 3274 |
| 433 | Ga0207657_10065000 | 3300025919 | Bacteria | 3111 |
| 434 | Ga0207657_10068358 | 3300025919 | Bacteria | 3018 |
| 435 | Ga0207649_10018682 | 3300025920 | Bacteria | 3948 |
| 436 | Ga0207649_10043290 | 3300025920 | Bacteria | 2752 |
| 437 | Ga0207649_10103742 | 3300025920 | Bacteria | 1887 |
| 438 | Ga0207649_10146307 | 3300025920 | Bacteria | 1622 |
| 439 | Ga0207649_10210951 | 3300025920 | Bacteria | 1378 |
| 440 | Ga0207649_10290304 | 3300025920 | Bacteria | 1192 |
| 441 | Ga0207649_10325052 | 3300025920 | Bacteria | 1131 |
| 442 | Ga0207649_10341208 | 3300025920 | Bacteria | 1106 |
| 443 | Ga0207649_10342527 | 3300025920 | Bacteria | 1104 |
| 444 | Ga0207649_10970190 | 3300025920 | Bacteria | 668 |
| 445 | Ga0207652_10220732 | 3300025921 | Bacteria | 1708 |
| 446 | Ga0207652_10375825 | 3300025921 | Bacteria | 1283 |
| 447 | Ga0207652_10537128 | 3300025921 | Bacteria | 1051 |
| 448 | Ga0207681_10027069 | 3300025923 | Bacteria | 3705 |
| 449 | Ga0207681_10030507 | 3300025923 | Bacteria | 3515 |
| 450 | Ga0207681_10061807 | 3300025923 | Bacteria | 2576 |
| 451 | Ga0207681_10213239 | 3300025923 | Bacteria | 1489 |
| 452 | Ga0207694_10392709 | 3300025924 | Bacteria | 1153 |
| 453 | Ga0207650_10003054 | 3300025925 | Bacteria | 11531 |
| 454 | Ga0207650_10018631 | 3300025925 | Bacteria | 4873 |
| 455 | Ga0207650_10101953 | 3300025925 | Bacteria | 2210 |
| 456 | Ga0207650_10279773 | 3300025925 | Bacteria | 1358 |
| 457 | Ga0207650_10520785 | 3300025925 | Bacteria | 995 |
| 458 | Ga0207659_10018172 | 3300025926 | Bacteria | 4605 |
| 459 | Ga0207659_10127013 | 3300025926 | Bacteria | 1963 |
| 460 | Ga0207659_10300153 | 3300025926 | Bacteria | 1319 |
| 461 | Ga0207687_10031400 | 3300025927 | Bacteria | 3589 |
| 462 | Ga0207664_10021302 | 3300025929 | Bacteria | 4817 |
| 463 | Ga0207664_10041131 | 3300025929 | Bacteria | 3600 |
| 464 | Ga0207664_10993026 | 3300025929 | Bacteria | 752 |
| 465 | Ga0207664_11547157 | 3300025929 | Bacteria | 585 |
| 466 | Ga0207644_10005273 | 3300025931 | Bacteria | 8437 |
| 467 | Ga0207644_10007766 | 3300025931 | Bacteria | 7003 |
| 468 | Ga0207644_10010963 | 3300025931 | Bacteria | 5987 |
| 469 | Ga0207644_10020310 | 3300025931 | Bacteria | 4516 |
| 470 | Ga0207644_10030225 | 3300025931 | Bacteria | 3765 |
| 471 | Ga0207644_10108980 | 3300025931 | Bacteria | 2091 |
| 472 | Ga0207644_10566374 | 3300025931 | Bacteria | 941 |
| 473 | Ga0207690_10011180 | 3300025932 | Bacteria | 5358 |
| 474 | Ga0207690_10057356 | 3300025932 | Bacteria | 2631 |
| 475 | Ga0207690_10096713 | 3300025932 | Bacteria | 2100 |
| 476 | Ga0207690_10201824 | 3300025932 | Bacteria | 1511 |
| 477 | Ga0207690_10300446 | 3300025932 | Bacteria | 1256 |
| 478 | Ga0207690_10459685 | 3300025932 | Bacteria | 1024 |
| 479 | Ga0207690_10486476 | 3300025932 | Bacteria | 997 |
| 480 | Ga0207706_10000434 | 3300025933 | Bacteria | 44818 |
| 481 | Ga0207706_10000643 | 3300025933 | Bacteria | 37034 |
| 482 | Ga0207706_10035989 | 3300025933 | Bacteria | 4399 |
| 483 | Ga0207706_10044379 | 3300025933 | Bacteria | 3940 |
| 484 | Ga0207706_10046085 | 3300025933 | Bacteria | 3861 |
| 485 | Ga0207706_10139178 | 3300025933 | Bacteria | 2135 |
| 486 | Ga0207706_10219339 | 3300025933 | Bacteria | 1665 |
| 487 | Ga0207709_10253862 | 3300025935 | Bacteria | 1286 |
| 488 | Ga0207669_10013845 | 3300025937 | Bacteria | 4024 |
| 489 | Ga0207669_10091532 | 3300025937 | Bacteria | 1981 |
| 490 | Ga0207704_10126284 | 3300025938 | Bacteria | 1762 |
| 491 | Ga0207704_10580661 | 3300025938 | Bacteria | 915 |
| 492 | Ga0207665_10043994 | 3300025939 | Bacteria | 2987 |
| 493 | Ga0207691_10000848 | 3300025940 | Bacteria | 30357 |
| 494 | Ga0207691_10000852 | 3300025940 | Bacteria | 30260 |
| 495 | Ga0207691_10019525 | 3300025940 | Bacteria | 6412 |
| 496 | Ga0207691_10107428 | 3300025940 | Bacteria | 2484 |
| 497 | Ga0207691_10156533 | 3300025940 | Bacteria | 2001 |
| 498 | Ga0207691_10538504 | 3300025940 | Bacteria | 990 |
| 499 | Ga0207691_10816601 | 3300025940 | Bacteria | 783 |
| 500 | Ga0207711_10003912 | 3300025941 | Bacteria | 12815 |
| 501 | Ga0207711_10018660 | 3300025941 | Bacteria | 5767 |
| 502 | Ga0207711_10071281 | 3300025941 | Bacteria | 3015 |
| 503 | Ga0207689_10000017 | 3300025942 | Bacteria | 117159 |
| 504 | Ga0207689_10030990 | 3300025942 | Bacteria | 4455 |
| 505 | Ga0207689_10035239 | 3300025942 | Bacteria | 4158 |
| 506 | Ga0207689_10044482 | 3300025942 | Bacteria | 3671 |
| 507 | Ga0207661_10297569 | 3300025944 | Bacteria | 1446 |
| 508 | Ga0207661_10750479 | 3300025944 | Bacteria | 898 |
| 509 | Ga0207679_10046450 | 3300025945 | Bacteria | 3148 |
| 510 | Ga0207679_10057851 | 3300025945 | Bacteria | 2870 |
| 511 | Ga0207679_10129703 | 3300025945 | Bacteria | 2021 |
| 512 | Ga0207679_10239311 | 3300025945 | Bacteria | 1537 |
| 513 | Ga0207679_10291908 | 3300025945 | Bacteria | 1402 |
| 514 | Ga0207679_10347057 | 3300025945 | Bacteria | 1292 |
| 515 | Ga0207679_10433273 | 3300025945 | Bacteria | 1163 |
| 516 | Ga0207679_10596421 | 3300025945 | Bacteria | 995 |
| 517 | Ga0207679_10622649 | 3300025945 | Bacteria | 974 |
| 518 | Ga0207679_10670877 | 3300025945 | Bacteria | 939 |
| 519 | Ga0207667_10040202 | 3300025949 | Bacteria | 4980 |
| 520 | Ga0207667_10144280 | 3300025949 | Bacteria | 2451 |
| 521 | Ga0207667_10258564 | 3300025949 | Bacteria | 1780 |
| 522 | Ga0207651_10006199 | 3300025960 | Bacteria | 6227 |
| 523 | Ga0207651_10105685 | 3300025960 | Bacteria | 2101 |
| 524 | Ga0207651_10126106 | 3300025960 | Bacteria | 1951 |
| 525 | Ga0207651_10144365 | 3300025960 | Bacteria | 1843 |
| 526 | Ga0207651_10178665 | 3300025960 | Bacteria | 1681 |
| 527 | Ga0207651_10186524 | 3300025960 | Bacteria | 1651 |
| 528 | Ga0207651_11025459 | 3300025960 | Bacteria | 738 |
| 529 | Ga0207712_10008327 | 3300025961 | Bacteria | 6555 |
| 530 | Ga0207712_10116830 | 3300025961 | Bacteria | 2011 |
| 531 | Ga0207712_10520344 | 3300025961 | Bacteria | 1019 |
| 532 | Ga0207668_10000223 | 3300025972 | Bacteria | 38523 |
| 533 | Ga0207668_10002049 | 3300025972 | Bacteria | 11759 |
| 534 | Ga0207668_10013108 | 3300025972 | Bacteria | 5096 |
| 535 | Ga0207668_10157443 | 3300025972 | Bacteria | 1766 |
| 536 | Ga0207668_10173511 | 3300025972 | Bacteria | 1693 |
| 537 | Ga0207668_10179524 | 3300025972 | Bacteria | 1668 |
| 538 | Ga0207668_10259117 | 3300025972 | Bacteria | 1416 |
| 539 | Ga0207640_10003828 | 3300025981 | Bacteria | 8117 |
| 540 | Ga0207640_10065521 | 3300025981 | Bacteria | 2424 |
| 541 | Ga0207640_10286453 | 3300025981 | Bacteria | 1297 |
| 542 | Ga0207640_10353592 | 3300025981 | Bacteria | 1181 |
| 543 | Ga0207658_10008048 | 3300025986 | Bacteria | 7182 |
| 544 | Ga0207658_10034535 | 3300025986 | Bacteria | 3615 |
| 545 | Ga0207658_10035614 | 3300025986 | Bacteria | 3566 |
| 546 | Ga0207658_10068482 | 3300025986 | Bacteria | 2678 |
| 547 | Ga0207658_10104199 | 3300025986 | Bacteria | 2228 |
| 548 | Ga0207658_10173408 | 3300025986 | Bacteria | 1779 |
| 549 | Ga0207658_10238712 | 3300025986 | Bacteria | 1538 |
| 550 | Ga0207658_10558136 | 3300025986 | Bacteria | 1025 |
| 551 | Ga0207658_10643497 | 3300025986 | Bacteria | 955 |
| 552 | Ga0207677_10042390 | 3300026023 | Bacteria | 3017 |
| 553 | Ga0207703_10002927 | 3300026035 | Bacteria | 14530 |
| 554 | Ga0207703_10057641 | 3300026035 | Bacteria | 3168 |
| 555 | Ga0207639_10040564 | 3300026041 | Bacteria | 3475 |
| 556 | Ga0207639_10055955 | 3300026041 | Bacteria | 3021 |
| 557 | Ga0207639_10186625 | 3300026041 | Bacteria | 1768 |
| 558 | Ga0207639_10234929 | 3300026041 | Bacteria | 1591 |
| 559 | Ga0207639_10304656 | 3300026041 | Bacteria | 1409 |
| 560 | Ga0207639_10386680 | 3300026041 | Bacteria | 1258 |
| 561 | Ga0207678_10009957 | 3300026067 | Bacteria | 8340 |
| 562 | Ga0207678_10014935 | 3300026067 | Bacteria | 6832 |
| 563 | Ga0207678_10028426 | 3300026067 | Bacteria | 4882 |
| 564 | Ga0207678_10029181 | 3300026067 | Bacteria | 4815 |
| 565 | Ga0207678_10083355 | 3300026067 | Bacteria | 2735 |
| 566 | Ga0207678_10108507 | 3300026067 | Bacteria | 2368 |
| 567 | Ga0207678_10200088 | 3300026067 | Bacteria | 1708 |
| 568 | Ga0207678_10459229 | 3300026067 | Bacteria | 1108 |
| 569 | Ga0207702_10012040 | 3300026078 | Bacteria | 7192 |
| 570 | Ga0207702_10196688 | 3300026078 | Bacteria | 1866 |
| 571 | Ga0207702_10227452 | 3300026078 | Bacteria | 1741 |
| 572 | Ga0207702_10881061 | 3300026078 | Bacteria | 887 |
| 573 | Ga0207702_11485388 | 3300026078 | Bacteria | 671 |
| 574 | Ga0207641_10016993 | 3300026088 | Bacteria | 5956 |
| 575 | Ga0207641_10019912 | 3300026088 | Bacteria | 5508 |
| 576 | Ga0207641_10113956 | 3300026088 | Bacteria | 2401 |
| 577 | Ga0207641_10649009 | 3300026088 | Bacteria | 1036 |
| 578 | Ga0207641_10653234 | 3300026088 | Bacteria | 1033 |
| 579 | Ga0207648_10001216 | 3300026089 | Bacteria | 28854 |
| 580 | Ga0207648_10006444 | 3300026089 | Bacteria | 11662 |
| 581 | Ga0207648_10097123 | 3300026089 | Bacteria | 2578 |
| 582 | Ga0207648_10106101 | 3300026089 | Bacteria | 2465 |
| 583 | Ga0207648_10532373 | 3300026089 | Bacteria | 1077 |
| 584 | Ga0207676_10003642 | 3300026095 | Bacteria | 10901 |
| 585 | Ga0207676_10005620 | 3300026095 | Bacteria | 8874 |
| 586 | Ga0207676_10012995 | 3300026095 | Bacteria | 5978 |
| 587 | Ga0207676_10606861 | 3300026095 | Bacteria | 1052 |
| 588 | Ga0207676_10866113 | 3300026095 | Bacteria | 884 |
| 589 | Ga0207674_10004077 | 3300026116 | Bacteria | 17703 |
| 590 | Ga0207674_10007596 | 3300026116 | Bacteria | 12631 |
| 591 | Ga0207674_10044074 | 3300026116 | Bacteria | 4597 |
| 592 | Ga0207674_10052412 | 3300026116 | Bacteria | 4162 |
| 593 | Ga0207674_10196538 | 3300026116 | Bacteria | 1966 |
| 594 | Ga0207675_100025642 | 3300026118 | Bacteria | 5486 |
| 595 | Ga0207675_100387047 | 3300026118 | Bacteria | 1376 |
| 596 | Ga0207675_100493467 | 3300026118 | Bacteria | 1218 |
| 597 | Ga0207675_100520192 | 3300026118 | Bacteria | 1186 |
| 598 | Ga0207675_100538729 | 3300026118 | Bacteria | 1165 |
| 599 | Ga0207683_10006197 | 3300026121 | Bacteria | 10251 |
| 600 | Ga0207683_10092191 | 3300026121 | Bacteria | 2700 |
| 601 | Ga0207698_10018409 | 3300026142 | Bacteria | 4758 |
| 602 | Ga0207698_10020485 | 3300026142 | Bacteria | 4554 |
| 603 | Ga0207698_10184857 | 3300026142 | Bacteria | 1850 |
| 604 | Ga0207698_10411484 | 3300026142 | Bacteria | 1295 |
| 605 | Ga0209974_10121778 | 3300027876 | Bacteria | 925 |
| 606 | Ga0207428_10462014 | 3300027907 | Bacteria | 925 |
| 607 | Ga0268266_10005814 | 3300028379 | Bacteria | 11417 |
| 608 | Ga0268266_10009325 | 3300028379 | Bacteria | 8653 |
| 609 | Ga0268266_10156875 | 3300028379 | Bacteria | 2056 |
| 610 | Ga0268266_10264521 | 3300028379 | Bacteria | 1595 |
| 611 | Ga0268265_10001836 | 3300028380 | Bacteria | 16950 |
| 612 | Ga0268265_10004795 | 3300028380 | Bacteria | 9321 |
| 613 | Ga0268265_10023329 | 3300028380 | Bacteria | 4360 |
| 614 | Ga0268265_10024003 | 3300028380 | Bacteria | 4307 |
| 615 | Ga0268265_10119081 | 3300028380 | Bacteria | 2172 |
| 616 | Ga0268265_10323675 | 3300028380 | Bacteria | 1397 |
| 617 | Ga0268265_10432723 | 3300028380 | Bacteria | 1224 |
| 618 | Ga0268265_10727765 | 3300028380 | Bacteria | 961 |
| 619 | Ga0268265_11977389 | 3300028380 | Bacteria | 590 |
| 620 | Ga0268264_10008809 | 3300028381 | Bacteria | 8368 |
| 621 | Ga0268264_10112581 | 3300028381 | Bacteria | 2386 |
| 622 | Ga0268264_10126648 | 3300028381 | Bacteria | 2258 |
| 623 | Ga0268264_10419922 | 3300028381 | Bacteria | 1289 |
| 624 | Ga0268264_10795517 | 3300028381 | Bacteria | 944 |
| 625 | Ga0307408_100017171 | 3300031548 | Bacteria | 4842 |
| 626 | Ga0307408_100162669 | 3300031548 | Bacteria | 1774 |
| 627 | Ga0307405_10027843 | 3300031731 | Bacteria | 3283 |
| 628 | Ga0307405_10035968 | 3300031731 | Bacteria | 2963 |
| 629 | Ga0307405_10068674 | 3300031731 | Bacteria | 2269 |
| 630 | Ga0307413_10001438 | 3300031824 | Bacteria | 9021 |
| 631 | Ga0307413_10018300 | 3300031824 | Bacteria | 3672 |
| 632 | Ga0307413_10036235 | 3300031824 | Bacteria | 2838 |
| 633 | Ga0307413_10061660 | 3300031824 | Bacteria | 2315 |
| 634 | Ga0307413_10099897 | 3300031824 | Bacteria | 1914 |
| 635 | Ga0307413_10272732 | 3300031824 | Bacteria | 1267 |
| 636 | Ga0307413_10584816 | 3300031824 | Bacteria | 911 |
| 637 | Ga0307413_10664031 | 3300031824 | Unclassified | 861 |
| 638 | Ga0307413_11634054 | 3300031824 | Bacteria | 573 |
| 639 | Ga0307410_10003596 | 3300031852 | Bacteria | 7809 |
| 640 | Ga0307410_10102415 | 3300031852 | Bacteria | 2054 |
| 641 | Ga0307410_10107957 | 3300031852 | Bacteria | 2009 |
| 642 | Ga0307410_10120784 | 3300031852 | Bacteria | 1910 |
| 643 | Ga0307410_10292254 | 3300031852 | Bacteria | 1283 |
| 644 | Ga0307410_10323010 | 3300031852 | Bacteria | 1225 |
| 645 | Ga0307410_10903272 | 3300031852 | Bacteria | 757 |
| 646 | Ga0307406_10023830 | 3300031901 | Bacteria | 3647 |
| 647 | Ga0307406_10028520 | 3300031901 | Bacteria | 3373 |
| 648 | Ga0307406_10049479 | 3300031901 | Bacteria | 2660 |
| 649 | Ga0307406_10879292 | 3300031901 | Bacteria | 761 |
| 650 | Ga0307407_10031384 | 3300031903 | Bacteria | 2877 |
| 651 | Ga0307407_10079831 | 3300031903 | Bacteria | 1975 |
| 652 | Ga0307407_10154385 | 3300031903 | Bacteria | 1495 |
| 653 | Ga0307407_10437810 | 3300031903 | Bacteria | 946 |
| 654 | Ga0307407_10468582 | 3300031903 | Bacteria | 918 |
| 655 | Ga0307407_10626557 | 3300031903 | Bacteria | 803 |
| 656 | Ga0307412_10003166 | 3300031911 | Bacteria | 9145 |
| 657 | Ga0307412_10021619 | 3300031911 | Bacteria | 3933 |
| 658 | Ga0307412_10040504 | 3300031911 | Bacteria | 3014 |
| 659 | Ga0307412_10040782 | 3300031911 | Bacteria | 3005 |
| 660 | Ga0307412_10123510 | 3300031911 | Bacteria | 1868 |
| 661 | Ga0307412_10126569 | 3300031911 | Bacteria | 1849 |
| 662 | Ga0307412_10139254 | 3300031911 | Bacteria | 1775 |
| 663 | Ga0307412_10145585 | 3300031911 | Bacteria | 1741 |
| 664 | Ga0307409_100012427 | 3300031995 | Bacteria | 5425 |
| 665 | Ga0307409_100071970 | 3300031995 | Bacteria | 2751 |
| 666 | Ga0307409_100092353 | 3300031995 | Bacteria | 2483 |
| 667 | Ga0307409_100110065 | 3300031995 | Bacteria | 2308 |
| 668 | Ga0307409_100206867 | 3300031995 | Bacteria | 1760 |
| 669 | Ga0307409_100248552 | 3300031995 | Bacteria | 1624 |
| 670 | Ga0307409_100261875 | 3300031995 | Bacteria | 1587 |
| 671 | Ga0307409_100512531 | 3300031995 | Bacteria | 1170 |
| 672 | Ga0307409_100940745 | 3300031995 | Bacteria | 880 |
| 673 | Ga0307416_100019713 | 3300032002 | Bacteria | 4790 |
| 674 | Ga0307416_100069269 | 3300032002 | Bacteria | 2919 |
| 675 | Ga0307416_100095314 | 3300032002 | Bacteria | 2569 |
| 676 | Ga0307416_100110262 | 3300032002 | Bacteria | 2423 |
| 677 | Ga0307416_100251120 | 3300032002 | Bacteria | 1721 |
| 678 | Ga0307416_100269105 | 3300032002 | Bacteria | 1671 |
| 679 | Ga0307416_100323330 | 3300032002 | Bacteria | 1546 |
| 680 | Ga0307416_100342345 | 3300032002 | Bacteria | 1509 |
| 681 | Ga0307416_100393236 | 3300032002 | Bacteria | 1421 |
| 682 | Ga0307416_100754779 | 3300032002 | Bacteria | 1066 |
| 683 | Ga0307416_101098934 | 3300032002 | Bacteria | 900 |
| 684 | Ga0307414_10011458 | 3300032004 | Bacteria | 5201 |
| 685 | Ga0307414_10062534 | 3300032004 | Bacteria | 2642 |
| 686 | Ga0307414_10076654 | 3300032004 | Bacteria | 2430 |
| 687 | Ga0307414_10112593 | 3300032004 | Bacteria | 2075 |
| 688 | Ga0307414_10184606 | 3300032004 | Bacteria | 1681 |
| 689 | Ga0307414_10215482 | 3300032004 | Bacteria | 1573 |
| 690 | Ga0307414_10316850 | 3300032004 | Bacteria | 1326 |
| 691 | Ga0307414_10416692 | 3300032004 | Bacteria | 1170 |
| 692 | Ga0307414_10442417 | 3300032004 | Bacteria | 1138 |
| 693 | Ga0307414_10500915 | 3300032004 | Bacteria | 1075 |
| 694 | Ga0307414_11823705 | 3300032004 | Bacteria | 567 |
| 695 | Ga0307411_10010399 | 3300032005 | Bacteria | 4957 |
| 696 | Ga0307411_10010853 | 3300032005 | Bacteria | 4881 |
| 697 | Ga0307411_10034033 | 3300032005 | Bacteria | 3166 |
| 698 | Ga0307411_10060334 | 3300032005 | Bacteria | 2518 |
| 699 | Ga0307411_10067388 | 3300032005 | Bacteria | 2408 |
| 700 | Ga0307411_10186000 | 3300032005 | Bacteria | 1581 |
| 701 | Ga0307411_10605556 | 3300032005 | Bacteria | 942 |
| 702 | Ga0307411_11497776 | 3300032005 | Unclassified | 620 |
| 703 | Ga0307415_100015345 | 3300032126 | Bacteria | 4533 |
| 704 | Ga0307415_100042531 | 3300032126 | Bacteria | 3024 |
| 705 | Ga0307415_100087449 | 3300032126 | Bacteria | 2245 |
| 706 | Ga0307415_100097844 | 3300032126 | Bacteria | 2143 |
| 707 | Ga0307415_100157722 | 3300032126 | Bacteria | 1755 |
| 708 | Ga0307415_100176127 | 3300032126 | Bacteria | 1673 |
| 709 | Ga0307415_100275699 | 3300032126 | Bacteria | 1380 |
| 710 | Ga0307415_101111476 | 3300032126 | Bacteria | 740 |
| 711 | Ga0373928_0120256 | 3300035084 | Bacteria | 703 |
| 712 | Ga0373940_0039047 | 3300035088 | Bacteria | 1298 |
| 713 | Ga0373943_0379166 | 3300035170 | Bacteria | 814 |
| 714 | Ga0373961_0134814 | 3300035241 | Bacteria | 830 |
| 715 | Ga0373931_0106924 | 3300035691 | Bacteria | 1582 |
| 716 | Ga0373935_0104235 | 3300035692 | Bacteria | 1874 |
| 717 | Ga0395899_0018993 | 3300037312 | Bacteria | 5223 |
| 718 | Ga0395899_0426216 | 3300037312 | Bacteria | 873 |
| 719 | Ga0395900_0000995 | 3300037418 | Bacteria | 36856 |
| 720 | Ga0395900_0959091 | 3300037418 | Bacteria | 776 |
| 721 | Ga0395898_0139400 | 3300037466 | Bacteria | 2322 |
| 722 | Ga0395905_0000538 | 3300037471 | Bacteria | 51665 |
| 723 | Ga0395905_0001688 | 3300037471 | Bacteria | 26037 |
| 724 | Ga0395905_0070915 | 3300037471 | Bacteria | 3266 |
| 725 | Ga0395905_0072272 | 3300037471 | Bacteria | 3234 |
| 726 | Ga0395905_0206676 | 3300037471 | Bacteria | 1840 |
| 727 | Ga0395905_0238254 | 3300037471 | Bacteria | 1700 |
| 728 | Ga0395905_0272120 | 3300037471 | Bacteria | 1580 |
| 729 | Ga0395905_0273431 | 3300037471 | Bacteria | 1575 |
| 730 | Ga0395905_0416594 | 3300037471 | Bacteria | 1239 |
| 731 | Ga0436364_0996148 | 3300037853 | Bacteria | 15568 |
| 732 | Ga0395901_0002926 | 3300038443 | Bacteria | 17249 |
| 733 | Ga0395901_0075005 | 3300038443 | Bacteria | 3528 |
| 734 | Ga0395901_0129440 | 3300038443 | Bacteria | 2652 |
| 735 | Ga0395901_0345500 | 3300038443 | Bacteria | 1536 |
| 736 | Ga0395901_0362197 | 3300038443 | Bacteria | 1495 |
| 737 | Ga0436363_0512431 | 3300039450 | Bacteria | 739 |
| 738 | Ga0439455_0206100 | 3300042012 | Bacteria | 570 |
| 739 | Ga0439464_0011183 | 3300042439 | Bacteria | 2374 |
| 740 | Ga0466972_0060740 | 3300044658 | Bacteria | 1813 |
| 741 | Ga0466966_0006596 | 3300044684 | Bacteria | 7685 |
| 742 | Ga0466966_0109592 | 3300044684 | Bacteria | 1703 |
| 743 | Ga0466961_0086810 | 3300044693 | Bacteria | 1977 |
| 744 | Ga0466963_0013165 | 3300044694 | Bacteria | 5075 |
| 745 | Ga0466963_0255861 | 3300044694 | Bacteria | 1229 |
| 746 | Ga0466963_0644470 | 3300044694 | Bacteria | 748 |
| 747 | Ga0466964_0177765 | 3300044706 | Bacteria | 1007 |
| 748 | Ga0466970_0036271 | 3300044765 | Bacteria | 2612 |
| 749 | Ga0466970_0082363 | 3300044765 | Bacteria | 1740 |
| 750 | Ga0466957_0057200 | 3300044842 | Bacteria | 2386 |
| 751 | Ga0466957_0101764 | 3300044842 | Bacteria | 1812 |
| 752 | Ga0466957_0103953 | 3300044842 | Bacteria | 1794 |
| 753 | Ga0466957_0256232 | 3300044842 | Bacteria | 1165 |
| 754 | Ga0466957_0304485 | 3300044842 | Bacteria | 1072 |
| 755 | Ga0466959_0052885 | 3300045049 | Bacteria | 2972 |
| 756 | Ga0466958_0087472 | 3300045836 | Bacteria | 1924 |
| 757 | Ga0466958_0142901 | 3300045836 | Bacteria | 1507 |
| 758 | Ga0466967_0057824 | 3300045976 | Bacteria | 3425 |
| 759 | Ga0466967_0058464 | 3300045976 | Bacteria | 3408 |
| 760 | Ga0466967_0193286 | 3300045976 | Bacteria | 1924 |
| 761 | Ga0466967_0195336 | 3300045976 | Bacteria | 1914 |
| 762 | Ga0466967_0245626 | 3300045976 | Bacteria | 1708 |
| 763 | Ga0466967_0598131 | 3300045976 | Bacteria | 1088 |
| 764 | Ga0495596_0051414 | 3300046500 | Bacteria | 1614 |
| 765 | Ga0495643_0173046 | 3300046522 | Bacteria | 1055 |
| 766 | Ga0495663_0003697 | 3300046525 | Bacteria | 4375 |
| 767 | Ga0495663_0045954 | 3300046525 | Bacteria | 1340 |
| 768 | Ga0495663_0123884 | 3300046525 | Bacteria | 867 |
| 769 | Ga0495598_0019117 | 3300046537 | Bacteria | 1791 |
| 770 | Ga0495621_0000350 | 3300046539 | Bacteria | 11260 |
| 771 | Ga0495621_0005701 | 3300046539 | Bacteria | 3597 |
| 772 | Ga0495633_0031633 | 3300046558 | Bacteria | 2563 |
| 773 | Ga0495668_0077947 | 3300046616 | Bacteria | 1819 |
| 774 | Ga0495659_0024873 | 3300046664 | Bacteria | 2045 |
| 775 | Ga0495669_0032311 | 3300046684 | Bacteria | 2300 |
| 776 | Ga0495669_0156759 | 3300046684 | Bacteria | 1079 |
| 777 | Ga0495669_0204177 | 3300046684 | Bacteria | 945 |
| 778 | Ga0495669_0283457 | 3300046684 | Bacteria | 797 |
| 779 | Ga0495669_0438175 | 3300046684 | Bacteria | 634 |
| 780 | Ga0495670_0010361 | 3300046691 | Bacteria | 4580 |
| 781 | Ga0495670_0012515 | 3300046691 | Bacteria | 4175 |
| 782 | Ga0495672_0287285 | 3300047320 | Bacteria | 784 |
| 783 | Ga0495677_0024518 | 3300047445 | Bacteria | 2188 |
| 784 | Ga0495677_0165252 | 3300047445 | Bacteria | 855 |
| 785 | Ga0495685_090595 | 3300047447 | Bacteria | 1014 |
| 786 | Ga0495615_0021854 | 3300048090 | Bacteria | 1448 |
| 787 | Ga0496100_0978721 | 3300048903 | Bacteria | 665 |
| 788 | Ga0496101_0065195 | 3300048904 | Bacteria | 2655 |
| 789 | Ga0496102_0286092 | 3300048905 | Unclassified | 1554 |
| 790 | Ga0496102_0708678 | 3300048905 | Bacteria | 929 |
| 791 | Ga0496102_0744269 | 3300048905 | Bacteria | 903 |
| 792 | Ga0496104_0288642 | 3300048907 | Bacteria | 1553 |
| 793 | Ga0496104_0483621 | 3300048907 | Bacteria | 1149 |
| 794 | Ga0496106_0021199 | 3300048909 | Bacteria | 4824 |
| 795 | Ga0496106_0641263 | 3300048909 | Bacteria | 849 |
| 796 | Ga0496106_1045706 | 3300048909 | Bacteria | 641 |
| 797 | Ga0496107_0006978 | 3300048910 | Bacteria | 7784 |
| 798 | Ga0496107_0145011 | 3300048910 | Unclassified | 1755 |
| 799 | Ga0496107_0188797 | 3300048910 | Unclassified | 1531 |
| 800 | Ga0496107_0358123 | 3300048910 | Bacteria | 1086 |
| 801 | Ga0496107_0435222 | 3300048910 | Bacteria | 975 |
| 802 | Ga0496107_0487973 | 3300048910 | Bacteria | 914 |
| 803 | Ga0496108_0011900 | 3300048911 | Bacteria | 7078 |
| 804 | Ga0496108_0044078 | 3300048911 | Bacteria | 3725 |
| 805 | Ga0496109_0020941 | 3300048912 | Bacteria | 5780 |
| 806 | Ga0496109_0024307 | 3300048912 | Bacteria | 5385 |
| 807 | Ga0496109_0556202 | 3300048912 | Bacteria | 1082 |
| 808 | Ga0496109_0896009 | 3300048912 | Bacteria | 825 |
| 809 | Ga0496109_1091865 | 3300048912 | Bacteria | 735 |
| 810 | Ga0496109_1187975 | 3300048912 | Bacteria | 700 |
| 811 | Ga0496110_0010516 | 3300048913 | Bacteria | 7533 |
| 812 | Ga0496110_0055960 | 3300048913 | Bacteria | 3471 |
| 813 | Ga0496111_0018962 | 3300048914 | Bacteria | 4769 |
| 814 | Ga0496111_0053188 | 3300048914 | Bacteria | 2925 |
| 815 | Ga0496111_0085906 | 3300048914 | Bacteria | 2301 |
| 816 | Ga0496111_0816828 | 3300048914 | Bacteria | 674 |
| 817 | Ga0496112_0136255 | 3300048915 | Bacteria | 2425 |
| 818 | Ga0496112_0146453 | 3300048915 | Bacteria | 2330 |
| 819 | Ga0496112_0239961 | 3300048915 | Bacteria | 1765 |
| 820 | Ga0496113_0086813 | 3300048916 | Bacteria | 2404 |
| 821 | Ga0496113_0222581 | 3300048916 | Bacteria | 1504 |
| 822 | Ga0496114_0005747 | 3300048917 | Bacteria | 9734 |
| 823 | Ga0496114_0271573 | 3300048917 | Bacteria | 1494 |
| 824 | Ga0496115_0001982 | 3300048918 | Bacteria | 14619 |
| 825 | Ga0501225_0062255 | 3300049705 | Bacteria | 1051 |
| 826 | Ga0501225_0086878 | 3300049705 | Bacteria | 903 |
| 827 | Ga0501268_002439 | 3300049765 | Bacteria | 2450 |
| 828 | Ga0501273_010716 | 3300049770 | Bacteria | 1131 |
| 829 | Ga0501204_014099 | 3300049850 | Bacteria | 978 |
| 830 | nmdc:mga05p37_388427_c1 | 3300050507 | Bacteria | 1633 |
| 831 | nmdc:mga08y16_987285_c1 | 3300050511 | Bacteria | 823 |
| 832 | nmdc:mga0n895_435921_c1 | 3300050512 | Bacteria | 1324 |
| 833 | nmdc:mga0rr50_229314_c1 | 3300050513 | Bacteria | 1536 |
| 834 | nmdc:mga0a205_5296_c1 | 3300050515 | Bacteria | 11612 |
| 835 | Ga0500658_0000073 | 3300053134 | Bacteria | 46171 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100162669 | Ga0307408_1001626691 | 155 |
| 2 | 3300031731 | Ga0307405_10027843 | Ga0307405_100278433 | 155 |
| 3 | 3300031824 | Ga0307413_10018300 | Ga0307413_100183003 | 155 |
| 4 | 3300031852 | Ga0307410_10120784 | Ga0307410_101207842 | 155 |
| 5 | 3300031901 | Ga0307406_10028520 | Ga0307406_100285203 | 155 |
| 6 | 3300031911 | Ga0307412_10040782 | Ga0307412_100407822 | 155 |
| 7 | 3300031995 | Ga0307409_100092353 | Ga0307409_1000923532 | 155 |
| 8 | 3300032002 | Ga0307416_100251120 | Ga0307416_1002511202 | 155 |
| 9 | 3300032004 | Ga0307414_10076654 | Ga0307414_100766542 | 155 |
| 10 | 3300013308 | Ga0157375_10058033 | Ga0157375_100580333 | 157 |
| 11 | 3300005327 | Ga0070658_10042549 | Ga0070658_100425493 | 158 |
| 12 | 3300005355 | Ga0070671_100187950 | Ga0070671_1001879502 | 158 |
| 13 | 3300005614 | Ga0068856_100034293 | Ga0068856_1000342935 | 158 |
| 14 | 3300005841 | Ga0068863_100411949 | Ga0068863_1004119492 | 158 |
| 15 | 3300009177 | Ga0105248_10046924 | Ga0105248_100469241 | 158 |
| 16 | 3300013102 | Ga0157371_10263314 | Ga0157371_102633142 | 158 |
| 17 | 3300037471 | Ga0395905_0001688 | Ga0395905_0001688_17458_18006 | 158 |
| 18 | 3300005455 | Ga0070663_100396648 | Ga0070663_1003966482 | 159 |
| 19 | 3300005543 | Ga0070672_100619425 | Ga0070672_1006194252 | 159 |
| 20 | 3300005718 | Ga0068866_10137169 | Ga0068866_101371692 | 159 |
| 21 | 3300025909 | Ga0207705_10016274 | Ga0207705_100162745 | 159 |
| 22 | 3300025931 | Ga0207644_10010963 | Ga0207644_100109632 | 159 |
| 23 | 3300026078 | Ga0207702_10196688 | Ga0207702_101966882 | 159 |
| 24 | 3300026142 | Ga0207698_10018409 | Ga0207698_100184093 | 159 |
| 25 | 3300037471 | Ga0395905_0273431 | Ga0395905_0273431_474_1016 | 159 |
| 26 | 3300044842 | Ga0466957_0256232 | Ga0466957_0256232_367_903 | 159 |
| 27 | 3300045976 | Ga0466967_0598131 | Ga0466967_0598131_95_631 | 159 |
| 28 | 3300048905 | Ga0496102_0286092 | Ga0496102_0286092_878_1420 | 159 |
| 29 | 3300048907 | Ga0496104_0483621 | Ga0496104_0483621_249_791 | 159 |
| 30 | 3300048910 | Ga0496107_0145011 | Ga0496107_0145011_176_718 | 159 |
| 31 | 3300048911 | Ga0496108_0011900 | Ga0496108_0011900_3163_3705 | 159 |
| 32 | 3300048912 | Ga0496109_0024307 | Ga0496109_0024307_3454_3996 | 159 |
| 33 | 3300048913 | Ga0496110_0055960 | Ga0496110_0055960_470_1012 | 159 |
| 34 | 3300048914 | Ga0496111_0018962 | Ga0496111_0018962_2427_2969 | 159 |
| 35 | 3300048915 | Ga0496112_0239961 | Ga0496112_0239961_671_1213 | 159 |
| 36 | 3300048916 | Ga0496113_0086813 | Ga0496113_0086813_470_1012 | 159 |
| 37 | 3300050513 | nmdc:mga0rr50_229314_c1 | nmdc:mga0rr50_229314_c1_144_692 | 159 |
| 38 | 3300005340 | Ga0070689_100237840 | Ga0070689_1002378401 | 160 |
| 39 | 3300005364 | Ga0070673_100479821 | Ga0070673_1004798212 | 160 |
| 40 | 3300005457 | Ga0070662_100070347 | Ga0070662_1000703473 | 160 |
| 41 | 3300005546 | Ga0070696_100271458 | Ga0070696_1002714582 | 160 |
| 42 | 3300005548 | Ga0070665_100628837 | Ga0070665_1006288372 | 160 |
| 43 | 3300005719 | Ga0068861_100440753 | Ga0068861_1004407532 | 160 |
| 44 | 3300005842 | Ga0068858_100005690 | Ga0068858_10000569011 | 160 |
| 45 | 3300005844 | Ga0068862_100063009 | Ga0068862_1000630093 | 160 |
| 46 | 3300025901 | Ga0207688_10278317 | Ga0207688_102783172 | 160 |
| 47 | 3300026118 | Ga0207675_100538729 | Ga0207675_1005387291 | 160 |
| 48 | 3300028380 | Ga0268265_10323675 | Ga0268265_103236752 | 160 |
| 49 | 3300031901 | Ga0307406_10049479 | Ga0307406_100494792 | 160 |
| 50 | 3300031911 | Ga0307412_10040504 | Ga0307412_100405043 | 160 |
| 51 | 3300031995 | Ga0307409_100248552 | Ga0307409_1002485522 | 160 |
| 52 | 3300032002 | Ga0307416_100095314 | Ga0307416_1000953142 | 160 |
| 53 | 3300032004 | Ga0307414_10442417 | Ga0307414_104424172 | 160 |
| 54 | 3300032126 | Ga0307415_100042531 | Ga0307415_1000425312 | 160 |
| 55 | 3300044684 | Ga0466966_0006596 | Ga0466966_0006596_6379_6909 | 160 |
| 56 | 3300044693 | Ga0466961_0086810 | Ga0466961_0086810_398_928 | 160 |
| 57 | 3300044765 | Ga0466970_0082363 | Ga0466970_0082363_467_997 | 160 |
| 58 | 3300044842 | Ga0466957_0101764 | Ga0466957_0101764_155_685 | 160 |
| 59 | 3300045049 | Ga0466959_0052885 | Ga0466959_0052885_348_878 | 160 |
| 60 | 3300045836 | Ga0466958_0087472 | Ga0466958_0087472_1322_1852 | 160 |
| 61 | 3300046522 | Ga0495643_0173046 | Ga0495643_0173046_56_583 | 160 |
| 62 | 3300048907 | Ga0496104_0288642 | Ga0496104_0288642_773_1306 | 160 |
| 63 | 3300049705 | Ga0501225_0062255 | Ga0501225_0062255_323_871 | 160 |
| 64 | 3300049705 | Ga0501225_0086878 | Ga0501225_0086878_252_794 | 160 |
| 65 | 3300049765 | Ga0501268_002439 | Ga0501268_002439_1448_1990 | 160 |
| 66 | 3300049850 | Ga0501204_014099 | Ga0501204_014099_222_764 | 160 |
| 67 | 3300005328 | Ga0070676_10265174 | Ga0070676_102651742 | 161 |
| 68 | 3300005331 | Ga0070670_100645807 | Ga0070670_1006458072 | 161 |
| 69 | 3300005337 | Ga0070682_100286970 | Ga0070682_1002869702 | 161 |
| 70 | 3300005343 | Ga0070687_100294506 | Ga0070687_1002945061 | 161 |
| 71 | 3300005347 | Ga0070668_100430959 | Ga0070668_1004309592 | 161 |
| 72 | 3300005364 | Ga0070673_100144859 | Ga0070673_1001448592 | 161 |
| 73 | 3300005366 | Ga0070659_100329388 | Ga0070659_1003293882 | 161 |
| 74 | 3300005455 | Ga0070663_100028142 | Ga0070663_1000281422 | 161 |
| 75 | 3300005539 | Ga0068853_100185963 | Ga0068853_1001859632 | 161 |
| 76 | 3300005547 | Ga0070693_100060368 | Ga0070693_1000603683 | 161 |
| 77 | 3300005564 | Ga0070664_100047598 | Ga0070664_1000475982 | 161 |
| 78 | 3300005577 | Ga0068857_100051053 | Ga0068857_1000510533 | 161 |
| 79 | 3300005578 | Ga0068854_100037092 | Ga0068854_1000370922 | 161 |
| 80 | 3300005617 | Ga0068859_100012474 | Ga0068859_1000124747 | 161 |
| 81 | 3300005834 | Ga0068851_10024620 | Ga0068851_100246202 | 161 |
| 82 | 3300005841 | Ga0068863_100082035 | Ga0068863_1000820352 | 161 |
| 83 | 3300005842 | Ga0068858_100015129 | Ga0068858_1000151291 | 161 |
| 84 | 3300006852 | Ga0075433_10011424 | Ga0075433_100114247 | 161 |
| 85 | 3300006931 | Ga0097620_100012475 | Ga0097620_1000124753 | 161 |
| 86 | 3300009098 | Ga0105245_10021177 | Ga0105245_100211771 | 161 |
| 87 | 3300009553 | Ga0105249_10024423 | Ga0105249_100244233 | 161 |
| 88 | 3300009553 | Ga0105249_10384045 | Ga0105249_103840452 | 161 |
| 89 | 3300011119 | Ga0105246_10156921 | Ga0105246_101569212 | 161 |
| 90 | 3300013100 | Ga0157373_10030375 | Ga0157373_100303752 | 161 |
| 91 | 3300013306 | Ga0163162_10161998 | Ga0163162_101619982 | 161 |
| 92 | 3300013308 | Ga0157375_10398105 | Ga0157375_103981052 | 161 |
| 93 | 3300025907 | Ga0207645_10026481 | Ga0207645_100264812 | 161 |
| 94 | 3300025907 | Ga0207645_10159546 | Ga0207645_101595462 | 161 |
| 95 | 3300025918 | Ga0207662_10213130 | Ga0207662_102131301 | 161 |
| 96 | 3300025925 | Ga0207650_10520785 | Ga0207650_105207852 | 161 |
| 97 | 3300025932 | Ga0207690_10486476 | Ga0207690_104864762 | 161 |
| 98 | 3300025933 | Ga0207706_10035989 | Ga0207706_100359894 | 161 |
| 99 | 3300025933 | Ga0207706_10046085 | Ga0207706_100460854 | 161 |
| 100 | 3300025933 | Ga0207706_10219339 | Ga0207706_102193392 | 161 |
| 101 | 3300025940 | Ga0207691_10156533 | Ga0207691_101565333 | 161 |
| 102 | 3300025940 | Ga0207691_10538504 | Ga0207691_105385042 | 161 |
| 103 | 3300025945 | Ga0207679_10622649 | Ga0207679_106226492 | 161 |
| 104 | 3300025960 | Ga0207651_10126106 | Ga0207651_101261061 | 161 |
| 105 | 3300025961 | Ga0207712_10116830 | Ga0207712_101168303 | 161 |
| 106 | 3300026035 | Ga0207703_10057641 | Ga0207703_100576413 | 161 |
| 107 | 3300026041 | Ga0207639_10304656 | Ga0207639_103046562 | 161 |
| 108 | 3300026088 | Ga0207641_10113956 | Ga0207641_101139562 | 161 |
| 109 | 3300026095 | Ga0207676_10005620 | Ga0207676_100056209 | 161 |
| 110 | 3300026116 | Ga0207674_10052412 | Ga0207674_100524123 | 161 |
| 111 | 3300028380 | Ga0268265_10024003 | Ga0268265_100240034 | 161 |
| 112 | 3300031903 | Ga0307407_10468582 | Ga0307407_104685821 | 161 |
| 113 | 3300035088 | Ga0373940_0039047 | Ga0373940_0039047_141_677 | 161 |
| 114 | 3300035241 | Ga0373961_0134814 | Ga0373961_0134814_156_728 | 161 |
| 115 | 3300037312 | Ga0395899_0426216 | Ga0395899_0426216_253_789 | 161 |
| 116 | 3300037471 | Ga0395905_0272120 | Ga0395905_0272120_460_996 | 161 |
| 117 | 3300038443 | Ga0395901_0362197 | Ga0395901_0362197_632_1168 | 161 |
| 118 | 3300048909 | Ga0496106_0641263 | Ga0496106_0641263_45_560 | 161 |
| 119 | 3300001989 | JGI24739J22299_10003420 | JGI24739J22299_100034202 | 162 |
| 120 | 3300002075 | JGI24738J21930_10000035 | JGI24738J21930_1000003510 | 162 |
| 121 | 3300005328 | Ga0070676_10314617 | Ga0070676_103146172 | 162 |
| 122 | 3300005330 | Ga0070690_100233144 | Ga0070690_1002331442 | 162 |
| 123 | 3300005331 | Ga0070670_100023463 | Ga0070670_1000234634 | 162 |
| 124 | 3300005333 | Ga0070677_10208222 | Ga0070677_102082221 | 162 |
| 125 | 3300005334 | Ga0068869_100045744 | Ga0068869_1000457443 | 162 |
| 126 | 3300005338 | Ga0068868_100000881 | Ga0068868_1000008818 | 162 |
| 127 | 3300005339 | Ga0070660_100004031 | Ga0070660_1000040317 | 162 |
| 128 | 3300005343 | Ga0070687_100378139 | Ga0070687_1003781391 | 162 |
| 129 | 3300005344 | Ga0070661_100092146 | Ga0070661_1000921462 | 162 |
| 130 | 3300005347 | Ga0070668_100032292 | Ga0070668_1000322923 | 162 |
| 131 | 3300005353 | Ga0070669_100002615 | Ga0070669_1000026158 | 162 |
| 132 | 3300005354 | Ga0070675_100163451 | Ga0070675_1001634512 | 162 |
| 133 | 3300005355 | Ga0070671_100040586 | Ga0070671_1000405862 | 162 |
| 134 | 3300005356 | Ga0070674_100060210 | Ga0070674_1000602102 | 162 |
| 135 | 3300005364 | Ga0070673_100003488 | Ga0070673_1000034883 | 162 |
| 136 | 3300005365 | Ga0070688_100171660 | Ga0070688_1001716602 | 162 |
| 137 | 3300005366 | Ga0070659_100001672 | Ga0070659_1000016725 | 162 |
| 138 | 3300005367 | Ga0070667_100003302 | Ga0070667_1000033023 | 162 |
| 139 | 3300005455 | Ga0070663_100307328 | Ga0070663_1003073281 | 162 |
| 140 | 3300005457 | Ga0070662_100002895 | Ga0070662_1000028955 | 162 |
| 141 | 3300005459 | Ga0068867_100006073 | Ga0068867_1000060735 | 162 |
| 142 | 3300005466 | Ga0070685_10131747 | Ga0070685_101317472 | 162 |
| 143 | 3300005539 | Ga0068853_100007792 | Ga0068853_1000077923 | 162 |
| 144 | 3300005543 | Ga0070672_100008903 | Ga0070672_1000089034 | 162 |
| 145 | 3300005544 | Ga0070686_100519189 | Ga0070686_1005191892 | 162 |
| 146 | 3300005547 | Ga0070693_100782394 | Ga0070693_1007823941 | 162 |
| 147 | 3300005563 | Ga0068855_100031999 | Ga0068855_1000319995 | 162 |
| 148 | 3300005564 | Ga0070664_100029545 | Ga0070664_1000295452 | 162 |
| 149 | 3300005577 | Ga0068857_100003503 | Ga0068857_1000035032 | 162 |
| 150 | 3300005578 | Ga0068854_100004302 | Ga0068854_1000043022 | 162 |
| 151 | 3300005614 | Ga0068856_100394677 | Ga0068856_1003946772 | 162 |
| 152 | 3300005616 | Ga0068852_100001990 | Ga0068852_1000019907 | 162 |
| 153 | 3300005617 | Ga0068859_100008163 | Ga0068859_1000081635 | 162 |
| 154 | 3300005618 | Ga0068864_100003128 | Ga0068864_10000312812 | 162 |
| 155 | 3300005718 | Ga0068866_10348395 | Ga0068866_103483951 | 162 |
| 156 | 3300005719 | Ga0068861_100326971 | Ga0068861_1003269712 | 162 |
| 157 | 3300005841 | Ga0068863_100037056 | Ga0068863_1000370564 | 162 |
| 158 | 3300005842 | Ga0068858_100005468 | Ga0068858_1000054682 | 162 |
| 159 | 3300005843 | Ga0068860_100059624 | Ga0068860_1000596242 | 162 |
| 160 | 3300006358 | Ga0068871_100125634 | Ga0068871_1001256343 | 162 |
| 161 | 3300006881 | Ga0068865_100033541 | Ga0068865_1000335412 | 162 |
| 162 | 3300006914 | Ga0075436_100213878 | Ga0075436_1002138781 | 162 |
| 163 | 3300006931 | Ga0097620_100008163 | Ga0097620_1000081635 | 162 |
| 164 | 3300007076 | Ga0075435_100261170 | Ga0075435_1002611702 | 162 |
| 165 | 3300009093 | Ga0105240_10109964 | Ga0105240_101099643 | 162 |
| 166 | 3300009098 | Ga0105245_10000285 | Ga0105245_1000028530 | 162 |
| 167 | 3300009174 | Ga0105241_10042296 | Ga0105241_100422962 | 162 |
| 168 | 3300009177 | Ga0105248_10020125 | Ga0105248_100201255 | 162 |
| 169 | 3300009551 | Ga0105238_10110443 | Ga0105238_101104433 | 162 |
| 170 | 3300009553 | Ga0105249_10309443 | Ga0105249_103094432 | 162 |
| 171 | 3300010375 | Ga0105239_10064925 | Ga0105239_100649253 | 162 |
| 172 | 3300011119 | Ga0105246_10012160 | Ga0105246_100121605 | 162 |
| 173 | 3300013100 | Ga0157373_10016553 | Ga0157373_100165532 | 162 |
| 174 | 3300013102 | Ga0157371_10002316 | Ga0157371_1000231615 | 162 |
| 175 | 3300013297 | Ga0157378_10001258 | Ga0157378_1000125822 | 162 |
| 176 | 3300013306 | Ga0163162_10037174 | Ga0163162_100371744 | 162 |
| 177 | 3300013307 | Ga0157372_10031246 | Ga0157372_100312462 | 162 |
| 178 | 3300025290 | Ga0207673_1003610 | Ga0207673_10036102 | 162 |
| 179 | 3300025315 | Ga0207697_10000158 | Ga0207697_100001583 | 162 |
| 180 | 3300025899 | Ga0207642_10391403 | Ga0207642_103914031 | 162 |
| 181 | 3300025904 | Ga0207647_10000253 | Ga0207647_1000025324 | 162 |
| 182 | 3300025907 | Ga0207645_10027619 | Ga0207645_100276194 | 162 |
| 183 | 3300025911 | Ga0207654_10152514 | Ga0207654_101525142 | 162 |
| 184 | 3300025918 | Ga0207662_10286789 | Ga0207662_102867892 | 162 |
| 185 | 3300025919 | Ga0207657_10011406 | Ga0207657_100114065 | 162 |
| 186 | 3300025920 | Ga0207649_10103742 | Ga0207649_101037422 | 162 |
| 187 | 3300025923 | Ga0207681_10061807 | Ga0207681_100618072 | 162 |
| 188 | 3300025925 | Ga0207650_10018631 | Ga0207650_100186314 | 162 |
| 189 | 3300025926 | Ga0207659_10127013 | Ga0207659_101270132 | 162 |
| 190 | 3300025927 | Ga0207687_10031400 | Ga0207687_100314002 | 162 |
| 191 | 3300025931 | Ga0207644_10005273 | Ga0207644_100052732 | 162 |
| 192 | 3300025933 | Ga0207706_10000643 | Ga0207706_1000064326 | 162 |
| 193 | 3300025937 | Ga0207669_10091532 | Ga0207669_100915322 | 162 |
| 194 | 3300025940 | Ga0207691_10000848 | Ga0207691_100008489 | 162 |
| 195 | 3300025941 | Ga0207711_10018660 | Ga0207711_100186602 | 162 |
| 196 | 3300025942 | Ga0207689_10000017 | Ga0207689_1000001732 | 162 |
| 197 | 3300025945 | Ga0207679_10596421 | Ga0207679_105964212 | 162 |
| 198 | 3300025949 | Ga0207667_10144280 | Ga0207667_101442802 | 162 |
| 199 | 3300025960 | Ga0207651_10006199 | Ga0207651_100061992 | 162 |
| 200 | 3300025972 | Ga0207668_10013108 | Ga0207668_100131082 | 162 |
| 201 | 3300025981 | Ga0207640_10003828 | Ga0207640_100038281 | 162 |
| 202 | 3300025986 | Ga0207658_10238712 | Ga0207658_102387122 | 162 |
| 203 | 3300026023 | Ga0207677_10042390 | Ga0207677_100423902 | 162 |
| 204 | 3300026041 | Ga0207639_10234929 | Ga0207639_102349292 | 162 |
| 205 | 3300026067 | Ga0207678_10459229 | Ga0207678_104592292 | 162 |
| 206 | 3300026078 | Ga0207702_10881061 | Ga0207702_108810611 | 162 |
| 207 | 3300026089 | Ga0207648_10001216 | Ga0207648_100012165 | 162 |
| 208 | 3300026095 | Ga0207676_10003642 | Ga0207676_100036423 | 162 |
| 209 | 3300026116 | Ga0207674_10007596 | Ga0207674_1000759610 | 162 |
| 210 | 3300026118 | Ga0207675_100520192 | Ga0207675_1005201922 | 162 |
| 211 | 3300028381 | Ga0268264_10112581 | Ga0268264_101125813 | 162 |
| 212 | 3300028381 | Ga0268264_10126648 | Ga0268264_101266481 | 162 |
| 213 | 3300044842 | Ga0466957_0057200 | Ga0466957_0057200_629_1144 | 162 |
| 214 | 3300045836 | Ga0466958_0142901 | Ga0466958_0142901_584_1102 | 162 |
| 215 | 3300048909 | Ga0496106_1045706 | Ga0496106_1045706_21_554 | 162 |
| 216 | 3300050512 | nmdc:mga0n895_435921_c1 | nmdc:mga0n895_435921_c1_521_1093 | 162 |
| 217 | 3300001979 | JGI24740J21852_10096864 | JGI24740J21852_100968641 | 163 |
| 218 | 3300005334 | Ga0068869_100091921 | Ga0068869_1000919212 | 163 |
| 219 | 3300005340 | Ga0070689_100874312 | Ga0070689_1008743121 | 163 |
| 220 | 3300005353 | Ga0070669_100074454 | Ga0070669_1000744542 | 163 |
| 221 | 3300005364 | Ga0070673_100102861 | Ga0070673_1001028611 | 163 |
| 222 | 3300005444 | Ga0070694_100348458 | Ga0070694_1003484582 | 163 |
| 223 | 3300005455 | Ga0070663_100348667 | Ga0070663_1003486671 | 163 |
| 224 | 3300005459 | Ga0068867_100005296 | Ga0068867_1000052962 | 163 |
| 225 | 3300005543 | Ga0070672_100081691 | Ga0070672_1000816912 | 163 |
| 226 | 3300005545 | Ga0070695_100329580 | Ga0070695_1003295801 | 163 |
| 227 | 3300005548 | Ga0070665_100969566 | Ga0070665_1009695662 | 163 |
| 228 | 3300005616 | Ga0068852_100068158 | Ga0068852_1000681583 | 163 |
| 229 | 3300005617 | Ga0068859_100162923 | Ga0068859_1001629232 | 163 |
| 230 | 3300005842 | Ga0068858_100017238 | Ga0068858_1000172385 | 163 |
| 231 | 3300005844 | Ga0068862_100128028 | Ga0068862_1001280282 | 163 |
| 232 | 3300006931 | Ga0097620_100162921 | Ga0097620_1001629212 | 163 |
| 233 | 3300010375 | Ga0105239_11480589 | Ga0105239_114805891 | 163 |
| 234 | 3300013297 | Ga0157378_10482727 | Ga0157378_104827272 | 163 |
| 235 | 3300013306 | Ga0163162_10437872 | Ga0163162_104378722 | 163 |
| 236 | 3300013308 | Ga0157375_10205827 | Ga0157375_102058272 | 163 |
| 237 | 3300025935 | Ga0207709_10253862 | Ga0207709_102538622 | 163 |
| 238 | 3300025940 | Ga0207691_10019525 | Ga0207691_100195254 | 163 |
| 239 | 3300025942 | Ga0207689_10035239 | Ga0207689_100352395 | 163 |
| 240 | 3300025960 | Ga0207651_10144365 | Ga0207651_101443652 | 163 |
| 241 | 3300025960 | Ga0207651_10186524 | Ga0207651_101865242 | 163 |
| 242 | 3300026035 | Ga0207703_10002927 | Ga0207703_100029275 | 163 |
| 243 | 3300026041 | Ga0207639_10055955 | Ga0207639_100559553 | 163 |
| 244 | 3300026088 | Ga0207641_10019912 | Ga0207641_100199125 | 163 |
| 245 | 3300026089 | Ga0207648_10006444 | Ga0207648_100064444 | 163 |
| 246 | 3300026142 | Ga0207698_10020485 | Ga0207698_100204853 | 163 |
| 247 | 3300028380 | Ga0268265_10023329 | Ga0268265_100233295 | 163 |
| 248 | 3300037471 | Ga0395905_0416594 | Ga0395905_0416594_367_912 | 163 |
| 249 | 3300045976 | Ga0466967_0245626 | Ga0466967_0245626_236_754 | 163 |
| 250 | 3300048911 | Ga0496108_0044078 | Ga0496108_0044078_431_967 | 163 |
| 251 | 3300048912 | Ga0496109_0556202 | Ga0496109_0556202_307_852 | 163 |
| 252 | 3300050515 | nmdc:mga0a205_5296_c1 | nmdc:mga0a205_5296_c1_2024_2596 | 163 |
| 253 | 3300005262 | Ga0065165_1007899 | Ga0065165_10078995 | 164 |
| 254 | 3300005327 | Ga0070658_10090495 | Ga0070658_100904953 | 164 |
| 255 | 3300005327 | Ga0070658_10189446 | Ga0070658_101894463 | 164 |
| 256 | 3300005339 | Ga0070660_100022082 | Ga0070660_1000220822 | 164 |
| 257 | 3300005339 | Ga0070660_100121153 | Ga0070660_1001211533 | 164 |
| 258 | 3300005344 | Ga0070661_100118586 | Ga0070661_1001185862 | 164 |
| 259 | 3300005345 | Ga0070692_10462774 | Ga0070692_104627741 | 164 |
| 260 | 3300005366 | Ga0070659_100001497 | Ga0070659_1000014973 | 164 |
| 261 | 3300005530 | Ga0070679_100418171 | Ga0070679_1004181711 | 164 |
| 262 | 3300005547 | Ga0070693_100075771 | Ga0070693_1000757712 | 164 |
| 263 | 3300005563 | Ga0068855_100554548 | Ga0068855_1005545482 | 164 |
| 264 | 3300005564 | Ga0070664_100035533 | Ga0070664_1000355333 | 164 |
| 265 | 3300005564 | Ga0070664_100039633 | Ga0070664_1000396333 | 164 |
| 266 | 3300005577 | Ga0068857_101142212 | Ga0068857_1011422122 | 164 |
| 267 | 3300005578 | Ga0068854_100545485 | Ga0068854_1005454852 | 164 |
| 268 | 3300005614 | Ga0068856_100033259 | Ga0068856_1000332595 | 164 |
| 269 | 3300005614 | Ga0068856_100080624 | Ga0068856_1000806243 | 164 |
| 270 | 3300005616 | Ga0068852_100050120 | Ga0068852_1000501202 | 164 |
| 271 | 3300005616 | Ga0068852_100256482 | Ga0068852_1002564822 | 164 |
| 272 | 3300013100 | Ga0157373_10011849 | Ga0157373_100118492 | 164 |
| 273 | 3300013104 | Ga0157370_10134409 | Ga0157370_101344091 | 164 |
| 274 | 3300013105 | Ga0157369_10100375 | Ga0157369_101003753 | 164 |
| 275 | 3300013307 | Ga0157372_10619193 | Ga0157372_106191932 | 164 |
| 276 | 3300025901 | Ga0207688_10000317 | Ga0207688_100003174 | 164 |
| 277 | 3300025909 | Ga0207705_10108167 | Ga0207705_101081673 | 164 |
| 278 | 3300025912 | Ga0207707_10992692 | Ga0207707_109926921 | 164 |
| 279 | 3300025919 | Ga0207657_10042043 | Ga0207657_100420432 | 164 |
| 280 | 3300025919 | Ga0207657_10047166 | Ga0207657_100471663 | 164 |
| 281 | 3300025920 | Ga0207649_10043290 | Ga0207649_100432903 | 164 |
| 282 | 3300025920 | Ga0207649_10146307 | Ga0207649_101463072 | 164 |
| 283 | 3300025920 | Ga0207649_10210951 | Ga0207649_102109512 | 164 |
| 284 | 3300025920 | Ga0207649_10325052 | Ga0207649_103250522 | 164 |
| 285 | 3300025921 | Ga0207652_10375825 | Ga0207652_103758251 | 164 |
| 286 | 3300025925 | Ga0207650_10279773 | Ga0207650_102797732 | 164 |
| 287 | 3300025929 | Ga0207664_11547157 | Ga0207664_115471571 | 164 |
| 288 | 3300025945 | Ga0207679_10046450 | Ga0207679_100464503 | 164 |
| 289 | 3300025945 | Ga0207679_10057851 | Ga0207679_100578513 | 164 |
| 290 | 3300025945 | Ga0207679_10433273 | Ga0207679_104332731 | 164 |
| 291 | 3300025949 | Ga0207667_10040202 | Ga0207667_100402025 | 164 |
| 292 | 3300025981 | Ga0207640_10065521 | Ga0207640_100655212 | 164 |
| 293 | 3300026067 | Ga0207678_10108507 | Ga0207678_101085072 | 164 |
| 294 | 3300026078 | Ga0207702_10012040 | Ga0207702_100120402 | 164 |
| 295 | 3300026078 | Ga0207702_11485388 | Ga0207702_114853881 | 164 |
| 296 | 3300026142 | Ga0207698_10411484 | Ga0207698_104114841 | 164 |
| 297 | 3300028379 | Ga0268266_10005814 | Ga0268266_100058147 | 164 |
| 298 | 3300044658 | Ga0466972_0060740 | Ga0466972_0060740_287_808 | 164 |
| 299 | 3300044684 | Ga0466966_0109592 | Ga0466966_0109592_545_1066 | 164 |
| 300 | 3300044694 | Ga0466963_0255861 | Ga0466963_0255861_448_969 | 164 |
| 301 | 3300044694 | Ga0466963_0644470 | Ga0466963_0644470_44_562 | 164 |
| 302 | 3300044706 | Ga0466964_0177765 | Ga0466964_0177765_112_633 | 164 |
| 303 | 3300044765 | Ga0466970_0036271 | Ga0466970_0036271_53_583 | 164 |
| 304 | 3300045976 | Ga0466967_0058464 | Ga0466967_0058464_1415_1939 | 164 |
| 305 | 3300045976 | Ga0466967_0195336 | Ga0466967_0195336_673_1191 | 164 |
| 306 | 3300046684 | Ga0495669_0032311 | Ga0495669_0032311_247_768 | 164 |
| 307 | 3300048905 | Ga0496102_0708678 | Ga0496102_0708678_77_601 | 164 |
| 308 | 3300048910 | Ga0496107_0188797 | Ga0496107_0188797_794_1318 | 164 |
| 309 | 3300048914 | Ga0496111_0085906 | Ga0496111_0085906_217_741 | 164 |
| 310 | 3300048915 | Ga0496112_0136255 | Ga0496112_0136255_1882_2406 | 164 |
| 311 | 3300002459 | JGI24751J29686_10030402 | JGI24751J29686_100304022 | 165 |
| 312 | 3300005344 | Ga0070661_100940087 | Ga0070661_1009400871 | 165 |
| 313 | 3300005347 | Ga0070668_100304141 | Ga0070668_1003041412 | 165 |
| 314 | 3300005353 | Ga0070669_101381627 | Ga0070669_1013816271 | 165 |
| 315 | 3300005355 | Ga0070671_100004406 | Ga0070671_1000044066 | 165 |
| 316 | 3300005355 | Ga0070671_100013680 | Ga0070671_1000136803 | 165 |
| 317 | 3300005355 | Ga0070671_100035593 | Ga0070671_1000355932 | 165 |
| 318 | 3300005367 | Ga0070667_100040579 | Ga0070667_1000405793 | 165 |
| 319 | 3300005367 | Ga0070667_100331256 | Ga0070667_1003312562 | 165 |
| 320 | 3300005434 | Ga0070709_10004923 | Ga0070709_100049236 | 165 |
| 321 | 3300005435 | Ga0070714_100045950 | Ga0070714_1000459502 | 165 |
| 322 | 3300005435 | Ga0070714_100048939 | Ga0070714_1000489392 | 165 |
| 323 | 3300005436 | Ga0070713_100041173 | Ga0070713_1000411732 | 165 |
| 324 | 3300005455 | Ga0070663_100794110 | Ga0070663_1007941101 | 165 |
| 325 | 3300005457 | Ga0070662_100251782 | Ga0070662_1002517822 | 165 |
| 326 | 3300005459 | Ga0068867_100155741 | Ga0068867_1001557412 | 165 |
| 327 | 3300005539 | Ga0068853_100033639 | Ga0068853_1000336394 | 165 |
| 328 | 3300005543 | Ga0070672_100457398 | Ga0070672_1004573981 | 165 |
| 329 | 3300005614 | Ga0068856_100753644 | Ga0068856_1007536441 | 165 |
| 330 | 3300005617 | Ga0068859_100142831 | Ga0068859_1001428312 | 165 |
| 331 | 3300005618 | Ga0068864_100290357 | Ga0068864_1002903573 | 165 |
| 332 | 3300005719 | Ga0068861_100414096 | Ga0068861_1004140962 | 165 |
| 333 | 3300005841 | Ga0068863_100546393 | Ga0068863_1005463932 | 165 |
| 334 | 3300005843 | Ga0068860_100388980 | Ga0068860_1003889802 | 165 |
| 335 | 3300006173 | Ga0070716_100044247 | Ga0070716_1000442472 | 165 |
| 336 | 3300006175 | Ga0070712_100619233 | Ga0070712_1006192332 | 165 |
| 337 | 3300006237 | Ga0097621_100014323 | Ga0097621_1000143235 | 165 |
| 338 | 3300006358 | Ga0068871_100105553 | Ga0068871_1001055533 | 165 |
| 339 | 3300006931 | Ga0097620_100142837 | Ga0097620_1001428372 | 165 |
| 340 | 3300009177 | Ga0105248_10051371 | Ga0105248_100513712 | 165 |
| 341 | 3300009177 | Ga0105248_10608041 | Ga0105248_106080412 | 165 |
| 342 | 3300013104 | Ga0157370_11060271 | Ga0157370_110602711 | 165 |
| 343 | 3300013105 | Ga0157369_10048804 | Ga0157369_100488043 | 165 |
| 344 | 3300013308 | Ga0157375_10004348 | Ga0157375_100043483 | 165 |
| 345 | 3300013308 | Ga0157375_10875080 | Ga0157375_108750802 | 165 |
| 346 | 3300014325 | Ga0163163_10189906 | Ga0163163_101899063 | 165 |
| 347 | 3300017792 | Ga0163161_10000753 | Ga0163161_1000075319 | 165 |
| 348 | 3300025271 | Ga0207666_1004870 | Ga0207666_10048702 | 165 |
| 349 | 3300025315 | Ga0207697_10068977 | Ga0207697_100689772 | 165 |
| 350 | 3300025909 | Ga0207705_10724521 | Ga0207705_107245212 | 165 |
| 351 | 3300025915 | Ga0207693_10058526 | Ga0207693_100585263 | 165 |
| 352 | 3300025929 | Ga0207664_10021302 | Ga0207664_100213022 | 165 |
| 353 | 3300025929 | Ga0207664_10041131 | Ga0207664_100411312 | 165 |
| 354 | 3300025931 | Ga0207644_10007766 | Ga0207644_100077663 | 165 |
| 355 | 3300025931 | Ga0207644_10030225 | Ga0207644_100302255 | 165 |
| 356 | 3300025931 | Ga0207644_10108980 | Ga0207644_101089802 | 165 |
| 357 | 3300025933 | Ga0207706_10139178 | Ga0207706_101391782 | 165 |
| 358 | 3300025939 | Ga0207665_10043994 | Ga0207665_100439943 | 165 |
| 359 | 3300025940 | Ga0207691_10816601 | Ga0207691_108166012 | 165 |
| 360 | 3300025941 | Ga0207711_10071281 | Ga0207711_100712812 | 165 |
| 361 | 3300025960 | Ga0207651_11025459 | Ga0207651_110254591 | 165 |
| 362 | 3300025972 | Ga0207668_10259117 | Ga0207668_102591171 | 165 |
| 363 | 3300025986 | Ga0207658_10008048 | Ga0207658_100080482 | 165 |
| 364 | 3300025986 | Ga0207658_10035614 | Ga0207658_100356143 | 165 |
| 365 | 3300026041 | Ga0207639_10040564 | Ga0207639_100405643 | 165 |
| 366 | 3300026088 | Ga0207641_10016993 | Ga0207641_100169931 | 165 |
| 367 | 3300027876 | Ga0209974_10121778 | Ga0209974_101217782 | 165 |
| 368 | 3300028381 | Ga0268264_10419922 | Ga0268264_104199222 | 165 |
| 369 | 3300031824 | Ga0307413_10061660 | Ga0307413_100616602 | 165 |
| 370 | 3300031852 | Ga0307410_10003596 | Ga0307410_100035963 | 165 |
| 371 | 3300031903 | Ga0307407_10031384 | Ga0307407_100313843 | 165 |
| 372 | 3300031995 | Ga0307409_100206867 | Ga0307409_1002068672 | 165 |
| 373 | 3300032002 | Ga0307416_100069269 | Ga0307416_1000692691 | 165 |
| 374 | 3300032005 | Ga0307411_10605556 | Ga0307411_106055562 | 165 |
| 375 | 3300032126 | Ga0307415_100097844 | Ga0307415_1000978442 | 165 |
| 376 | 3300035170 | Ga0373943_0379166 | Ga0373943_0379166_100_612 | 165 |
| 377 | 3300035691 | Ga0373931_0106924 | Ga0373931_0106924_398_919 | 165 |
| 378 | 3300035692 | Ga0373935_0104235 | Ga0373935_0104235_675_1187 | 165 |
| 379 | 3300037471 | Ga0395905_0072272 | Ga0395905_0072272_2140_2658 | 165 |
| 380 | 3300037471 | Ga0395905_0206676 | Ga0395905_0206676_455_1003 | 165 |
| 381 | 3300038443 | Ga0395901_0345500 | Ga0395901_0345500_790_1308 | 165 |
| 382 | 3300048903 | Ga0496100_0978721 | Ga0496100_0978721_62_586 | 165 |
| 383 | 3300048904 | Ga0496101_0065195 | Ga0496101_0065195_393_917 | 165 |
| 384 | 3300048910 | Ga0496107_0006978 | Ga0496107_0006978_3001_3540 | 165 |
| 385 | 3300048910 | Ga0496107_0358123 | Ga0496107_0358123_263_787 | 165 |
| 386 | 3300048912 | Ga0496109_0020941 | Ga0496109_0020941_3140_3679 | 165 |
| 387 | 3300048912 | Ga0496109_0896009 | Ga0496109_0896009_45_566 | 165 |
| 388 | 3300048912 | Ga0496109_1091865 | Ga0496109_1091865_145_654 | 165 |
| 389 | 3300048913 | Ga0496110_0010516 | Ga0496110_0010516_3935_4474 | 165 |
| 390 | 3300048914 | Ga0496111_0053188 | Ga0496111_0053188_1486_2025 | 165 |
| 391 | 3300048914 | Ga0496111_0816828 | Ga0496111_0816828_16_537 | 165 |
| 392 | 3300048915 | Ga0496112_0146453 | Ga0496112_0146453_1657_2178 | 165 |
| 393 | 3300048916 | Ga0496113_0222581 | Ga0496113_0222581_44_565 | 165 |
| 394 | 3300048917 | Ga0496114_0005747 | Ga0496114_0005747_1631_2170 | 165 |
| 395 | 3300048917 | Ga0496114_0271573 | Ga0496114_0271573_420_944 | 165 |
| 396 | 3300048918 | Ga0496115_0001982 | Ga0496115_0001982_5999_6523 | 165 |
| 397 | 3300002067 | JGI24735J21928_10013884 | JGI24735J21928_100138842 | 166 |
| 398 | 3300005327 | Ga0070658_10080678 | Ga0070658_100806783 | 166 |
| 399 | 3300005328 | Ga0070676_10193920 | Ga0070676_101939201 | 166 |
| 400 | 3300005328 | Ga0070676_10203435 | Ga0070676_102034351 | 166 |
| 401 | 3300005329 | Ga0070683_100514256 | Ga0070683_1005142562 | 166 |
| 402 | 3300005331 | Ga0070670_100151406 | Ga0070670_1001514063 | 166 |
| 403 | 3300005339 | Ga0070660_100080308 | Ga0070660_1000803082 | 166 |
| 404 | 3300005344 | Ga0070661_100221448 | Ga0070661_1002214482 | 166 |
| 405 | 3300005354 | Ga0070675_101107614 | Ga0070675_1011076141 | 166 |
| 406 | 3300005366 | Ga0070659_100335773 | Ga0070659_1003357731 | 166 |
| 407 | 3300005435 | Ga0070714_101222361 | Ga0070714_1012223611 | 166 |
| 408 | 3300005457 | Ga0070662_100327368 | Ga0070662_1003273682 | 166 |
| 409 | 3300005458 | Ga0070681_10149323 | Ga0070681_101493233 | 166 |
| 410 | 3300005530 | Ga0070679_100303524 | Ga0070679_1003035241 | 166 |
| 411 | 3300005543 | Ga0070672_100482430 | Ga0070672_1004824302 | 166 |
| 412 | 3300005548 | Ga0070665_100274026 | Ga0070665_1002740262 | 166 |
| 413 | 3300005564 | Ga0070664_100135938 | Ga0070664_1001359383 | 166 |
| 414 | 3300005577 | Ga0068857_100045474 | Ga0068857_1000454742 | 166 |
| 415 | 3300005614 | Ga0068856_100119211 | Ga0068856_1001192113 | 166 |
| 416 | 3300005616 | Ga0068852_100722874 | Ga0068852_1007228742 | 166 |
| 417 | 3300005842 | Ga0068858_100022221 | Ga0068858_1000222212 | 166 |
| 418 | 3300005844 | Ga0068862_100009248 | Ga0068862_1000092482 | 166 |
| 419 | 3300006358 | Ga0068871_100006417 | Ga0068871_1000064173 | 166 |
| 420 | 3300009147 | Ga0114129_10357020 | Ga0114129_103570202 | 166 |
| 421 | 3300009545 | Ga0105237_10024240 | Ga0105237_100242406 | 166 |
| 422 | 3300013105 | Ga0157369_11080176 | Ga0157369_110801761 | 166 |
| 423 | 3300013296 | Ga0157374_10867581 | Ga0157374_108675812 | 166 |
| 424 | 3300013307 | Ga0157372_10734106 | Ga0157372_107341062 | 166 |
| 425 | 3300014325 | Ga0163163_10091516 | Ga0163163_100915162 | 166 |
| 426 | 3300025900 | Ga0207710_10139445 | Ga0207710_101394452 | 166 |
| 427 | 3300025904 | Ga0207647_10083225 | Ga0207647_100832252 | 166 |
| 428 | 3300025907 | Ga0207645_10138155 | Ga0207645_101381552 | 166 |
| 429 | 3300025909 | Ga0207705_10046964 | Ga0207705_100469641 | 166 |
| 430 | 3300025912 | Ga0207707_10169859 | Ga0207707_101698591 | 166 |
| 431 | 3300025914 | Ga0207671_10195065 | Ga0207671_101950652 | 166 |
| 432 | 3300025919 | Ga0207657_10065000 | Ga0207657_100650002 | 166 |
| 433 | 3300025919 | Ga0207657_10068358 | Ga0207657_100683582 | 166 |
| 434 | 3300025920 | Ga0207649_10018682 | Ga0207649_100186822 | 166 |
| 435 | 3300025920 | Ga0207649_10341208 | Ga0207649_103412082 | 166 |
| 436 | 3300025929 | Ga0207664_10993026 | Ga0207664_109930261 | 166 |
| 437 | 3300025932 | Ga0207690_10201824 | Ga0207690_102018242 | 166 |
| 438 | 3300025942 | Ga0207689_10030990 | Ga0207689_100309902 | 166 |
| 439 | 3300025944 | Ga0207661_10750479 | Ga0207661_107504792 | 166 |
| 440 | 3300025945 | Ga0207679_10129703 | Ga0207679_101297032 | 166 |
| 441 | 3300025945 | Ga0207679_10670877 | Ga0207679_106708771 | 166 |
| 442 | 3300026067 | Ga0207678_10029181 | Ga0207678_100291813 | 166 |
| 443 | 3300026078 | Ga0207702_10227452 | Ga0207702_102274522 | 166 |
| 444 | 3300026095 | Ga0207676_10606861 | Ga0207676_106068612 | 166 |
| 445 | 3300026095 | Ga0207676_10866113 | Ga0207676_108661131 | 166 |
| 446 | 3300026116 | Ga0207674_10004077 | Ga0207674_1000407716 | 166 |
| 447 | 3300026118 | Ga0207675_100387047 | Ga0207675_1003870472 | 166 |
| 448 | 3300028380 | Ga0268265_10432723 | Ga0268265_104327231 | 166 |
| 449 | 3300037312 | Ga0395899_0018993 | Ga0395899_0018993_234_749 | 166 |
| 450 | 3300037418 | Ga0395900_0959091 | Ga0395900_0959091_156_689 | 166 |
| 451 | 3300037471 | Ga0395905_0070915 | Ga0395905_0070915_1777_2307 | 166 |
| 452 | 3300037471 | Ga0395905_0238254 | Ga0395905_0238254_1053_1568 | 166 |
| 453 | 3300038443 | Ga0395901_0129440 | Ga0395901_0129440_839_1354 | 166 |
| 454 | 3300044694 | Ga0466963_0013165 | Ga0466963_0013165_3124_3639 | 166 |
| 455 | 3300045976 | Ga0466967_0057824 | Ga0466967_0057824_1929_2444 | 166 |
| 456 | 3300045976 | Ga0466967_0193286 | Ga0466967_0193286_1070_1594 | 166 |
| 457 | 3300046684 | Ga0495669_0156759 | Ga0495669_0156759_167_703 | 166 |
| 458 | 3300046684 | Ga0495669_0438175 | Ga0495669_0438175_35_562 | 166 |
| 459 | 3300048905 | Ga0496102_0744269 | Ga0496102_0744269_278_811 | 166 |
| 460 | 3300048909 | Ga0496106_0021199 | Ga0496106_0021199_312_842 | 166 |
| 461 | 3300050507 | nmdc:mga05p37_388427_c1 | nmdc:mga05p37_388427_c1_448_1023 | 166 |
| 462 | iso_pu_bacteria | 2896429255 | 2896430587 | 166 |
| 463 | 3300005290 | Ga0065712_10152941 | Ga0065712_101529412 | 167 |
| 464 | 3300005327 | Ga0070658_10267703 | Ga0070658_102677032 | 167 |
| 465 | 3300005328 | Ga0070676_10134996 | Ga0070676_101349962 | 167 |
| 466 | 3300005330 | Ga0070690_100529427 | Ga0070690_1005294271 | 167 |
| 467 | 3300005331 | Ga0070670_100401835 | Ga0070670_1004018352 | 167 |
| 468 | 3300005334 | Ga0068869_100455567 | Ga0068869_1004555671 | 167 |
| 469 | 3300005335 | Ga0070666_10043591 | Ga0070666_100435912 | 167 |
| 470 | 3300005336 | Ga0070680_100168601 | Ga0070680_1001686012 | 167 |
| 471 | 3300005338 | Ga0068868_100165723 | Ga0068868_1001657232 | 167 |
| 472 | 3300005339 | Ga0070660_100306187 | Ga0070660_1003061872 | 167 |
| 473 | 3300005344 | Ga0070661_100453561 | Ga0070661_1004535612 | 167 |
| 474 | 3300005353 | Ga0070669_100821550 | Ga0070669_1008215501 | 167 |
| 475 | 3300005355 | Ga0070671_100125193 | Ga0070671_1001251932 | 167 |
| 476 | 3300005355 | Ga0070671_100643322 | Ga0070671_1006433221 | 167 |
| 477 | 3300005364 | Ga0070673_100165338 | Ga0070673_1001653382 | 167 |
| 478 | 3300005364 | Ga0070673_101297026 | Ga0070673_1012970261 | 167 |
| 479 | 3300005366 | Ga0070659_100355688 | Ga0070659_1003556882 | 167 |
| 480 | 3300005367 | Ga0070667_100073795 | Ga0070667_1000737952 | 167 |
| 481 | 3300005455 | Ga0070663_100100509 | Ga0070663_1001005092 | 167 |
| 482 | 3300005457 | Ga0070662_100050029 | Ga0070662_1000500292 | 167 |
| 483 | 3300005458 | Ga0070681_10427998 | Ga0070681_104279982 | 167 |
| 484 | 3300005459 | Ga0068867_100099499 | Ga0068867_1000994992 | 167 |
| 485 | 3300005530 | Ga0070679_100129150 | Ga0070679_1001291502 | 167 |
| 486 | 3300005544 | Ga0070686_100611490 | Ga0070686_1006114902 | 167 |
| 487 | 3300005547 | Ga0070693_100183163 | Ga0070693_1001831632 | 167 |
| 488 | 3300005548 | Ga0070665_100012854 | Ga0070665_1000128548 | 167 |
| 489 | 3300005548 | Ga0070665_101347760 | Ga0070665_1013477601 | 167 |
| 490 | 3300005564 | Ga0070664_100175131 | Ga0070664_1001751312 | 167 |
| 491 | 3300005578 | Ga0068854_100071112 | Ga0068854_1000711122 | 167 |
| 492 | 3300005614 | Ga0068856_100327431 | Ga0068856_1003274312 | 167 |
| 493 | 3300005615 | Ga0070702_100622095 | Ga0070702_1006220951 | 167 |
| 494 | 3300005617 | Ga0068859_100164555 | Ga0068859_1001645553 | 167 |
| 495 | 3300005834 | Ga0068851_10069144 | Ga0068851_100691442 | 167 |
| 496 | 3300006931 | Ga0097620_100164561 | Ga0097620_1001645612 | 167 |
| 497 | 3300009174 | Ga0105241_10144371 | Ga0105241_101443712 | 167 |
| 498 | 3300013100 | Ga0157373_10116265 | Ga0157373_101162652 | 167 |
| 499 | 3300013307 | Ga0157372_10317258 | Ga0157372_103172582 | 167 |
| 500 | 3300025901 | Ga0207688_10024903 | Ga0207688_100249033 | 167 |
| 501 | 3300025901 | Ga0207688_10325488 | Ga0207688_103254881 | 167 |
| 502 | 3300025903 | Ga0207680_10688954 | Ga0207680_106889542 | 167 |
| 503 | 3300025907 | Ga0207645_10035096 | Ga0207645_100350962 | 167 |
| 504 | 3300025909 | Ga0207705_10145067 | Ga0207705_101450672 | 167 |
| 505 | 3300025909 | Ga0207705_10362739 | Ga0207705_103627391 | 167 |
| 506 | 3300025917 | Ga0207660_10243517 | Ga0207660_102435172 | 167 |
| 507 | 3300025919 | Ga0207657_10059739 | Ga0207657_100597392 | 167 |
| 508 | 3300025920 | Ga0207649_10290304 | Ga0207649_102903042 | 167 |
| 509 | 3300025921 | Ga0207652_10537128 | Ga0207652_105371282 | 167 |
| 510 | 3300025925 | Ga0207650_10101953 | Ga0207650_101019532 | 167 |
| 511 | 3300025931 | Ga0207644_10566374 | Ga0207644_105663742 | 167 |
| 512 | 3300025932 | Ga0207690_10459685 | Ga0207690_104596852 | 167 |
| 513 | 3300025933 | Ga0207706_10044379 | Ga0207706_100443793 | 167 |
| 514 | 3300025942 | Ga0207689_10044482 | Ga0207689_100444825 | 167 |
| 515 | 3300025945 | Ga0207679_10291908 | Ga0207679_102919082 | 167 |
| 516 | 3300025960 | Ga0207651_10105685 | Ga0207651_101056852 | 167 |
| 517 | 3300025981 | Ga0207640_10353592 | Ga0207640_103535922 | 167 |
| 518 | 3300025986 | Ga0207658_10173408 | Ga0207658_101734082 | 167 |
| 519 | 3300026041 | Ga0207639_10186625 | Ga0207639_101866252 | 167 |
| 520 | 3300026067 | Ga0207678_10014935 | Ga0207678_100149353 | 167 |
| 521 | 3300026089 | Ga0207648_10097123 | Ga0207648_100971233 | 167 |
| 522 | 3300026116 | Ga0207674_10044074 | Ga0207674_100440742 | 167 |
| 523 | 3300028379 | Ga0268266_10009325 | Ga0268266_100093254 | 167 |
| 524 | 3300031852 | Ga0307410_10292254 | Ga0307410_102922541 | 167 |
| 525 | 3300031911 | Ga0307412_10126569 | Ga0307412_101265692 | 167 |
| 526 | 3300031911 | Ga0307412_10139254 | Ga0307412_101392542 | 167 |
| 527 | 3300032002 | Ga0307416_100323330 | Ga0307416_1003233302 | 167 |
| 528 | 3300032004 | Ga0307414_10112593 | Ga0307414_101125932 | 167 |
| 529 | 3300032004 | Ga0307414_10215482 | Ga0307414_102154822 | 167 |
| 530 | 3300032005 | Ga0307411_10060334 | Ga0307411_100603342 | 167 |
| 531 | 3300032126 | Ga0307415_100015345 | Ga0307415_1000153454 | 167 |
| 532 | 3300032126 | Ga0307415_100176127 | Ga0307415_1001761272 | 167 |
| 533 | 3300032126 | Ga0307415_101111476 | Ga0307415_1011114762 | 167 |
| 534 | 3300038443 | Ga0395901_0075005 | Ga0395901_0075005_765_1304 | 167 |
| 535 | 3300039450 | Ga0436363_0512431 | Ga0436363_0512431_67_585 | 167 |
| 536 | 3300044842 | Ga0466957_0103953 | Ga0466957_0103953_919_1443 | 167 |
| 537 | 3300046616 | Ga0495668_0077947 | Ga0495668_0077947_297_833 | 167 |
| 538 | 3300048910 | Ga0496107_0435222 | Ga0496107_0435222_264_800 | 167 |
| 539 | 3300053134 | Ga0500658_0000073 | Ga0500658_0000073_36174_36710 | 167 |
| 540 | 3300005335 | Ga0070666_10120410 | Ga0070666_101204102 | 168 |
| 541 | 3300005338 | Ga0068868_100316980 | Ga0068868_1003169802 | 168 |
| 542 | 3300005339 | Ga0070660_100010556 | Ga0070660_1000105563 | 168 |
| 543 | 3300005344 | Ga0070661_100079500 | Ga0070661_1000795003 | 168 |
| 544 | 3300005344 | Ga0070661_100775135 | Ga0070661_1007751351 | 168 |
| 545 | 3300005345 | Ga0070692_10064690 | Ga0070692_100646902 | 168 |
| 546 | 3300005347 | Ga0070668_100010358 | Ga0070668_1000103588 | 168 |
| 547 | 3300005353 | Ga0070669_100081765 | Ga0070669_1000817653 | 168 |
| 548 | 3300005355 | Ga0070671_100308212 | Ga0070671_1003082122 | 168 |
| 549 | 3300005356 | Ga0070674_100046481 | Ga0070674_1000464813 | 168 |
| 550 | 3300005366 | Ga0070659_100197158 | Ga0070659_1001971582 | 168 |
| 551 | 3300005367 | Ga0070667_100056316 | Ga0070667_1000563162 | 168 |
| 552 | 3300005367 | Ga0070667_100063842 | Ga0070667_1000638422 | 168 |
| 553 | 3300005367 | Ga0070667_100068000 | Ga0070667_1000680004 | 168 |
| 554 | 3300005367 | Ga0070667_100588176 | Ga0070667_1005881762 | 168 |
| 555 | 3300005455 | Ga0070663_100266408 | Ga0070663_1002664082 | 168 |
| 556 | 3300005456 | Ga0070678_100132696 | Ga0070678_1001326961 | 168 |
| 557 | 3300005459 | Ga0068867_100120324 | Ga0068867_1001203242 | 168 |
| 558 | 3300005459 | Ga0068867_100728036 | Ga0068867_1007280361 | 168 |
| 559 | 3300005539 | Ga0068853_100118282 | Ga0068853_1001182822 | 168 |
| 560 | 3300005543 | Ga0070672_100109649 | Ga0070672_1001096493 | 168 |
| 561 | 3300005564 | Ga0070664_100066220 | Ga0070664_1000662202 | 168 |
| 562 | 3300005564 | Ga0070664_100182252 | Ga0070664_1001822522 | 168 |
| 563 | 3300005578 | Ga0068854_100100937 | Ga0068854_1001009372 | 168 |
| 564 | 3300005616 | Ga0068852_100024314 | Ga0068852_1000243145 | 168 |
| 565 | 3300005617 | Ga0068859_101131378 | Ga0068859_1011313782 | 168 |
| 566 | 3300005617 | Ga0068859_101265103 | Ga0068859_1012651031 | 168 |
| 567 | 3300005719 | Ga0068861_100320117 | Ga0068861_1003201172 | 168 |
| 568 | 3300005719 | Ga0068861_100602286 | Ga0068861_1006022862 | 168 |
| 569 | 3300005834 | Ga0068851_10107123 | Ga0068851_101071232 | 168 |
| 570 | 3300005840 | Ga0068870_10129155 | Ga0068870_101291552 | 168 |
| 571 | 3300005841 | Ga0068863_100528036 | Ga0068863_1005280361 | 168 |
| 572 | 3300005843 | Ga0068860_100012703 | Ga0068860_1000127034 | 168 |
| 573 | 3300005844 | Ga0068862_100009717 | Ga0068862_1000097178 | 168 |
| 574 | 3300006237 | Ga0097621_100218325 | Ga0097621_1002183251 | 168 |
| 575 | 3300006358 | Ga0068871_100112809 | Ga0068871_1001128092 | 168 |
| 576 | 3300006871 | Ga0075434_100791979 | Ga0075434_1007919792 | 168 |
| 577 | 3300006881 | Ga0068865_100251528 | Ga0068865_1002515282 | 168 |
| 578 | 3300006881 | Ga0068865_100329609 | Ga0068865_1003296092 | 168 |
| 579 | 3300006931 | Ga0097620_101131388 | Ga0097620_1011313882 | 168 |
| 580 | 3300006931 | Ga0097620_101264927 | Ga0097620_1012649271 | 168 |
| 581 | 3300009177 | Ga0105248_10088873 | Ga0105248_100888733 | 168 |
| 582 | 3300009177 | Ga0105248_10197743 | Ga0105248_101977432 | 168 |
| 583 | 3300009551 | Ga0105238_10611228 | Ga0105238_106112282 | 168 |
| 584 | 3300009551 | Ga0105238_10743978 | Ga0105238_107439782 | 168 |
| 585 | 3300009553 | Ga0105249_10125011 | Ga0105249_101250112 | 168 |
| 586 | 3300013104 | Ga0157370_10619460 | Ga0157370_106194601 | 168 |
| 587 | 3300013296 | Ga0157374_10054329 | Ga0157374_100543292 | 168 |
| 588 | 3300013297 | Ga0157378_10186971 | Ga0157378_101869713 | 168 |
| 589 | 3300013306 | Ga0163162_10820375 | Ga0163162_108203752 | 168 |
| 590 | 3300013306 | Ga0163162_11016229 | Ga0163162_110162291 | 168 |
| 591 | 3300014968 | Ga0157379_10125893 | Ga0157379_101258932 | 168 |
| 592 | 3300025315 | Ga0207697_10035271 | Ga0207697_100352713 | 168 |
| 593 | 3300025321 | Ga0207656_10015597 | Ga0207656_100155973 | 168 |
| 594 | 3300025893 | Ga0207682_10093071 | Ga0207682_100930712 | 168 |
| 595 | 3300025903 | Ga0207680_10023816 | Ga0207680_100238165 | 168 |
| 596 | 3300025903 | Ga0207680_10083708 | Ga0207680_100837082 | 168 |
| 597 | 3300025903 | Ga0207680_10451379 | Ga0207680_104513791 | 168 |
| 598 | 3300025907 | Ga0207645_10002074 | Ga0207645_100020742 | 168 |
| 599 | 3300025907 | Ga0207645_10214075 | Ga0207645_102140752 | 168 |
| 600 | 3300025908 | Ga0207643_10052521 | Ga0207643_100525213 | 168 |
| 601 | 3300025909 | Ga0207705_10039435 | Ga0207705_100394352 | 168 |
| 602 | 3300025909 | Ga0207705_10043066 | Ga0207705_100430662 | 168 |
| 603 | 3300025919 | Ga0207657_10019294 | Ga0207657_100192942 | 168 |
| 604 | 3300025919 | Ga0207657_10045766 | Ga0207657_100457663 | 168 |
| 605 | 3300025920 | Ga0207649_10342527 | Ga0207649_103425271 | 168 |
| 606 | 3300025921 | Ga0207652_10220732 | Ga0207652_102207322 | 168 |
| 607 | 3300025923 | Ga0207681_10030507 | Ga0207681_100305073 | 168 |
| 608 | 3300025924 | Ga0207694_10392709 | Ga0207694_103927092 | 168 |
| 609 | 3300025926 | Ga0207659_10300153 | Ga0207659_103001532 | 168 |
| 610 | 3300025932 | Ga0207690_10057356 | Ga0207690_100573564 | 168 |
| 611 | 3300025932 | Ga0207690_10096713 | Ga0207690_100967132 | 168 |
| 612 | 3300025932 | Ga0207690_10300446 | Ga0207690_103004461 | 168 |
| 613 | 3300025937 | Ga0207669_10013845 | Ga0207669_100138454 | 168 |
| 614 | 3300025940 | Ga0207691_10107428 | Ga0207691_101074282 | 168 |
| 615 | 3300025941 | Ga0207711_10003912 | Ga0207711_100039129 | 168 |
| 616 | 3300025944 | Ga0207661_10297569 | Ga0207661_102975692 | 168 |
| 617 | 3300025945 | Ga0207679_10239311 | Ga0207679_102393112 | 168 |
| 618 | 3300025972 | Ga0207668_10000223 | Ga0207668_1000022335 | 168 |
| 619 | 3300025972 | Ga0207668_10173511 | Ga0207668_101735112 | 168 |
| 620 | 3300025986 | Ga0207658_10034535 | Ga0207658_100345354 | 168 |
| 621 | 3300025986 | Ga0207658_10104199 | Ga0207658_101041992 | 168 |
| 622 | 3300025986 | Ga0207658_10558136 | Ga0207658_105581362 | 168 |
| 623 | 3300025986 | Ga0207658_10643497 | Ga0207658_106434972 | 168 |
| 624 | 3300026067 | Ga0207678_10009957 | Ga0207678_100099577 | 168 |
| 625 | 3300026067 | Ga0207678_10083355 | Ga0207678_100833553 | 168 |
| 626 | 3300026088 | Ga0207641_10649009 | Ga0207641_106490092 | 168 |
| 627 | 3300026089 | Ga0207648_10532373 | Ga0207648_105323732 | 168 |
| 628 | 3300026118 | Ga0207675_100493467 | Ga0207675_1004934671 | 168 |
| 629 | 3300026121 | Ga0207683_10092191 | Ga0207683_100921913 | 168 |
| 630 | 3300026142 | Ga0207698_10184857 | Ga0207698_101848572 | 168 |
| 631 | 3300028379 | Ga0268266_10156875 | Ga0268266_101568753 | 168 |
| 632 | 3300028380 | Ga0268265_10001836 | Ga0268265_100018363 | 168 |
| 633 | 3300028380 | Ga0268265_10119081 | Ga0268265_101190812 | 168 |
| 634 | 3300028381 | Ga0268264_10008809 | Ga0268264_100088094 | 168 |
| 635 | 3300031903 | Ga0307407_10079831 | Ga0307407_100798313 | 168 |
| 636 | 3300031995 | Ga0307409_100012427 | Ga0307409_1000124273 | 168 |
| 637 | 3300032002 | Ga0307416_100269105 | Ga0307416_1002691052 | 168 |
| 638 | 3300032004 | Ga0307414_10316850 | Ga0307414_103168502 | 168 |
| 639 | 3300037853 | Ga0436364_0996148 | Ga0436364_0996148_2673_3185 | 168 |
| 640 | 3300042439 | Ga0439464_0011183 | Ga0439464_0011183_1529_2068 | 168 |
| 641 | 3300044842 | Ga0466957_0304485 | Ga0466957_0304485_165_677 | 168 |
| 642 | 3300046525 | Ga0495663_0123884 | Ga0495663_0123884_263_799 | 168 |
| 643 | 3300046684 | Ga0495669_0204177 | Ga0495669_0204177_59_595 | 168 |
| 644 | 3300048910 | Ga0496107_0487973 | Ga0496107_0487973_185_721 | 168 |
| 645 | 3300048912 | Ga0496109_1187975 | Ga0496109_1187975_12_521 | 168 |
| 646 | 3300049770 | Ga0501273_010716 | Ga0501273_010716_540_1088 | 168 |
| 647 | 3300005327 | Ga0070658_10039227 | Ga0070658_100392274 | 169 |
| 648 | 3300005339 | Ga0070660_100006513 | Ga0070660_1000065136 | 169 |
| 649 | 3300005344 | Ga0070661_100077892 | Ga0070661_1000778922 | 169 |
| 650 | 3300005366 | Ga0070659_100001058 | Ga0070659_10000105814 | 169 |
| 651 | 3300005440 | Ga0070705_100395338 | Ga0070705_1003953381 | 169 |
| 652 | 3300005457 | Ga0070662_100053901 | Ga0070662_1000539012 | 169 |
| 653 | 3300005564 | Ga0070664_100025432 | Ga0070664_1000254326 | 169 |
| 654 | 3300005834 | Ga0068851_10099492 | Ga0068851_100994922 | 169 |
| 655 | 3300013100 | Ga0157373_10012019 | Ga0157373_100120196 | 169 |
| 656 | 3300025909 | Ga0207705_10170976 | Ga0207705_101709762 | 169 |
| 657 | 3300025919 | Ga0207657_10002291 | Ga0207657_1000229114 | 169 |
| 658 | 3300025932 | Ga0207690_10011180 | Ga0207690_100111802 | 169 |
| 659 | 3300005457 | Ga0070662_100177610 | Ga0070662_1001776101 | 170 |
| 660 | 3300031995 | Ga0307409_100110065 | Ga0307409_1001100652 | 170 |
| 661 | 3300032004 | Ga0307414_10416692 | Ga0307414_104166922 | 170 |
| 662 | 3300005295 | Ga0065707_10246837 | Ga0065707_102468372 | 171 |
| 663 | 3300005345 | Ga0070692_10024658 | Ga0070692_100246582 | 171 |
| 664 | 3300005347 | Ga0070668_100452668 | Ga0070668_1004526681 | 171 |
| 665 | 3300005455 | Ga0070663_100258189 | Ga0070663_1002581892 | 171 |
| 666 | 3300013102 | Ga0157371_10366232 | Ga0157371_103662322 | 171 |
| 667 | 3300025909 | Ga0207705_10097504 | Ga0207705_100975042 | 171 |
| 668 | 3300025919 | Ga0207657_10030898 | Ga0207657_100308985 | 171 |
| 669 | 3300025949 | Ga0207667_10258564 | Ga0207667_102585642 | 171 |
| 670 | 3300025972 | Ga0207668_10179524 | Ga0207668_101795242 | 171 |
| 671 | 3300026067 | Ga0207678_10028426 | Ga0207678_100284265 | 171 |
| 672 | 3300028379 | Ga0268266_10264521 | Ga0268266_102645212 | 171 |
| 673 | 3300047320 | Ga0495672_0287285 | Ga0495672_0287285_134_649 | 171 |
| 674 | 3300031731 | Ga0307405_10068674 | Ga0307405_100686742 | 172 |
| 675 | 3300032002 | Ga0307416_100110262 | Ga0307416_1001102622 | 172 |
| 676 | 3300035084 | Ga0373928_0120256 | Ga0373928_0120256_60_617 | 172 |
| 677 | 3300031995 | Ga0307409_100940745 | Ga0307409_1009407451 | 173 |
| 678 | 3300031824 | Ga0307413_10099897 | Ga0307413_100998972 | 174 |
| 679 | 3300031824 | Ga0307413_10584816 | Ga0307413_105848162 | 174 |
| 680 | 3300031824 | Ga0307413_10664031 | Ga0307413_106640312 | 174 |
| 681 | 3300031852 | Ga0307410_10903272 | Ga0307410_109032722 | 174 |
| 682 | 3300031901 | Ga0307406_10879292 | Ga0307406_108792921 | 174 |
| 683 | 3300031903 | Ga0307407_10626557 | Ga0307407_106265572 | 174 |
| 684 | 3300031911 | Ga0307412_10123510 | Ga0307412_101235101 | 174 |
| 685 | 3300031911 | Ga0307412_10145585 | Ga0307412_101455852 | 174 |
| 686 | 3300031995 | Ga0307409_100261875 | Ga0307409_1002618752 | 174 |
| 687 | 3300032002 | Ga0307416_100754779 | Ga0307416_1007547792 | 174 |
| 688 | 3300032004 | Ga0307414_10184606 | Ga0307414_101846062 | 174 |
| 689 | 3300032005 | Ga0307411_11497776 | Ga0307411_114977761 | 174 |
| 690 | 3300032126 | Ga0307415_100157722 | Ga0307415_1001577222 | 174 |
| 691 | 2162886012 | MBSR1b_contig_4799473 | MBSR1b_0004.00006500 | 175 |
| 692 | 3300001977 | JGI24746J21847_1002084 | JGI24746J21847_10020842 | 175 |
| 693 | 3300002076 | JGI24749J21850_1003195 | JGI24749J21850_10031952 | 175 |
| 694 | 3300002155 | JGI24033J26618_1020308 | JGI24033J26618_10203082 | 175 |
| 695 | 3300002239 | JGI24034J26672_10026050 | JGI24034J26672_100260502 | 175 |
| 696 | 3300002244 | JGI24742J22300_10063245 | JGI24742J22300_100632451 | 175 |
| 697 | 3300005293 | Ga0065715_10000359 | Ga0065715_1000035919 | 175 |
| 698 | 3300005328 | Ga0070676_10020596 | Ga0070676_100205962 | 175 |
| 699 | 3300005330 | Ga0070690_100387312 | Ga0070690_1003873122 | 175 |
| 700 | 3300005331 | Ga0070670_100021668 | Ga0070670_1000216686 | 175 |
| 701 | 3300005333 | Ga0070677_10000999 | Ga0070677_100009998 | 175 |
| 702 | 3300005334 | Ga0068869_100916811 | Ga0068869_1009168111 | 175 |
| 703 | 3300005336 | Ga0070680_101512107 | Ga0070680_1015121071 | 175 |
| 704 | 3300005344 | Ga0070661_100414310 | Ga0070661_1004143101 | 175 |
| 705 | 3300005347 | Ga0070668_100027610 | Ga0070668_1000276104 | 175 |
| 706 | 3300005347 | Ga0070668_100161674 | Ga0070668_1001616742 | 175 |
| 707 | 3300005353 | Ga0070669_100030619 | Ga0070669_1000306193 | 175 |
| 708 | 3300005354 | Ga0070675_100004653 | Ga0070675_10000465310 | 175 |
| 709 | 3300005355 | Ga0070671_100014729 | Ga0070671_1000147297 | 175 |
| 710 | 3300005356 | Ga0070674_100002641 | Ga0070674_1000026414 | 175 |
| 711 | 3300005364 | Ga0070673_100065813 | Ga0070673_1000658134 | 175 |
| 712 | 3300005367 | Ga0070667_100003455 | Ga0070667_10000345513 | 175 |
| 713 | 3300005441 | Ga0070700_100034056 | Ga0070700_1000340562 | 175 |
| 714 | 3300005444 | Ga0070694_100287168 | Ga0070694_1002871682 | 175 |
| 715 | 3300005455 | Ga0070663_100006460 | Ga0070663_1000064602 | 175 |
| 716 | 3300005457 | Ga0070662_100008482 | Ga0070662_1000084826 | 175 |
| 717 | 3300005459 | Ga0068867_100156551 | Ga0068867_1001565512 | 175 |
| 718 | 3300005543 | Ga0070672_100003490 | Ga0070672_1000034909 | 175 |
| 719 | 3300005564 | Ga0070664_100115285 | Ga0070664_1001152854 | 175 |
| 720 | 3300005577 | Ga0068857_100219570 | Ga0068857_1002195702 | 175 |
| 721 | 3300005578 | Ga0068854_100388055 | Ga0068854_1003880552 | 175 |
| 722 | 3300005615 | Ga0070702_100289376 | Ga0070702_1002893762 | 175 |
| 723 | 3300005617 | Ga0068859_100036370 | Ga0068859_1000363704 | 175 |
| 724 | 3300005618 | Ga0068864_100221533 | Ga0068864_1002215332 | 175 |
| 725 | 3300005718 | Ga0068866_10412079 | Ga0068866_104120791 | 175 |
| 726 | 3300005719 | Ga0068861_100004768 | Ga0068861_1000047688 | 175 |
| 727 | 3300005840 | Ga0068870_10073710 | Ga0068870_100737102 | 175 |
| 728 | 3300005841 | Ga0068863_100502325 | Ga0068863_1005023252 | 175 |
| 729 | 3300005843 | Ga0068860_100697212 | Ga0068860_1006972122 | 175 |
| 730 | 3300005844 | Ga0068862_100005443 | Ga0068862_1000054433 | 175 |
| 731 | 3300005844 | Ga0068862_100721894 | Ga0068862_1007218941 | 175 |
| 732 | 3300006871 | Ga0075434_100510961 | Ga0075434_1005109612 | 175 |
| 733 | 3300006881 | Ga0068865_100157238 | Ga0068865_1001572382 | 175 |
| 734 | 3300006881 | Ga0068865_100731295 | Ga0068865_1007312951 | 175 |
| 735 | 3300006931 | Ga0097620_100036370 | Ga0097620_1000363704 | 175 |
| 736 | 3300009094 | Ga0111539_10072986 | Ga0111539_100729862 | 175 |
| 737 | 3300009094 | Ga0111539_10736500 | Ga0111539_107365001 | 175 |
| 738 | 3300009177 | Ga0105248_11964412 | Ga0105248_119644121 | 175 |
| 739 | 3300009553 | Ga0105249_10010129 | Ga0105249_100101293 | 175 |
| 740 | 3300009553 | Ga0105249_10113737 | Ga0105249_101137373 | 175 |
| 741 | 3300009553 | Ga0105249_10338919 | Ga0105249_103389192 | 175 |
| 742 | 3300013100 | Ga0157373_10185086 | Ga0157373_101850862 | 175 |
| 743 | 3300013306 | Ga0163162_10391485 | Ga0163162_103914852 | 175 |
| 744 | 3300013308 | Ga0157375_12579454 | Ga0157375_125794541 | 175 |
| 745 | 3300014326 | Ga0157380_10005051 | Ga0157380_100050519 | 175 |
| 746 | 3300014326 | Ga0157380_10108324 | Ga0157380_101083243 | 175 |
| 747 | 3300014326 | Ga0157380_10226606 | Ga0157380_102266062 | 175 |
| 748 | 3300017792 | Ga0163161_10210395 | Ga0163161_102103952 | 175 |
| 749 | 3300025315 | Ga0207697_10002568 | Ga0207697_100025689 | 175 |
| 750 | 3300025893 | Ga0207682_10001693 | Ga0207682_100016934 | 175 |
| 751 | 3300025901 | Ga0207688_10081281 | Ga0207688_100812812 | 175 |
| 752 | 3300025907 | Ga0207645_10128078 | Ga0207645_101280782 | 175 |
| 753 | 3300025908 | Ga0207643_10418670 | Ga0207643_104186701 | 175 |
| 754 | 3300025920 | Ga0207649_10970190 | Ga0207649_109701901 | 175 |
| 755 | 3300025923 | Ga0207681_10027069 | Ga0207681_100270692 | 175 |
| 756 | 3300025923 | Ga0207681_10213239 | Ga0207681_102132392 | 175 |
| 757 | 3300025925 | Ga0207650_10003054 | Ga0207650_100030542 | 175 |
| 758 | 3300025926 | Ga0207659_10018172 | Ga0207659_100181722 | 175 |
| 759 | 3300025931 | Ga0207644_10020310 | Ga0207644_100203106 | 175 |
| 760 | 3300025933 | Ga0207706_10000434 | Ga0207706_1000043432 | 175 |
| 761 | 3300025938 | Ga0207704_10126284 | Ga0207704_101262842 | 175 |
| 762 | 3300025938 | Ga0207704_10580661 | Ga0207704_105806611 | 175 |
| 763 | 3300025940 | Ga0207691_10000852 | Ga0207691_1000085218 | 175 |
| 764 | 3300025945 | Ga0207679_10347057 | Ga0207679_103470572 | 175 |
| 765 | 3300025960 | Ga0207651_10178665 | Ga0207651_101786652 | 175 |
| 766 | 3300025961 | Ga0207712_10008327 | Ga0207712_100083273 | 175 |
| 767 | 3300025961 | Ga0207712_10520344 | Ga0207712_105203442 | 175 |
| 768 | 3300025972 | Ga0207668_10002049 | Ga0207668_1000204911 | 175 |
| 769 | 3300025972 | Ga0207668_10157443 | Ga0207668_101574431 | 175 |
| 770 | 3300025981 | Ga0207640_10286453 | Ga0207640_102864532 | 175 |
| 771 | 3300025986 | Ga0207658_10068482 | Ga0207658_100684823 | 175 |
| 772 | 3300026041 | Ga0207639_10386680 | Ga0207639_103866801 | 175 |
| 773 | 3300026067 | Ga0207678_10200088 | Ga0207678_102000882 | 175 |
| 774 | 3300026088 | Ga0207641_10653234 | Ga0207641_106532341 | 175 |
| 775 | 3300026089 | Ga0207648_10106101 | Ga0207648_101061011 | 175 |
| 776 | 3300026095 | Ga0207676_10012995 | Ga0207676_100129955 | 175 |
| 777 | 3300026116 | Ga0207674_10196538 | Ga0207674_101965381 | 175 |
| 778 | 3300026118 | Ga0207675_100025642 | Ga0207675_1000256421 | 175 |
| 779 | 3300026121 | Ga0207683_10006197 | Ga0207683_100061975 | 175 |
| 780 | 3300027907 | Ga0207428_10462014 | Ga0207428_104620142 | 175 |
| 781 | 3300028380 | Ga0268265_10004795 | Ga0268265_1000479511 | 175 |
| 782 | 3300028380 | Ga0268265_10727765 | Ga0268265_107277651 | 175 |
| 783 | 3300028380 | Ga0268265_11977389 | Ga0268265_119773891 | 175 |
| 784 | 3300028381 | Ga0268264_10795517 | Ga0268264_107955171 | 175 |
| 785 | 3300031548 | Ga0307408_100017171 | Ga0307408_1000171716 | 175 |
| 786 | 3300031731 | Ga0307405_10035968 | Ga0307405_100359681 | 175 |
| 787 | 3300031824 | Ga0307413_10001438 | Ga0307413_100014384 | 175 |
| 788 | 3300031824 | Ga0307413_10036235 | Ga0307413_100362352 | 175 |
| 789 | 3300031824 | Ga0307413_10272732 | Ga0307413_102727322 | 175 |
| 790 | 3300031824 | Ga0307413_11634054 | Ga0307413_116340541 | 175 |
| 791 | 3300031852 | Ga0307410_10102415 | Ga0307410_101024152 | 175 |
| 792 | 3300031852 | Ga0307410_10107957 | Ga0307410_101079571 | 175 |
| 793 | 3300031852 | Ga0307410_10323010 | Ga0307410_103230102 | 175 |
| 794 | 3300031901 | Ga0307406_10023830 | Ga0307406_100238303 | 175 |
| 795 | 3300031903 | Ga0307407_10154385 | Ga0307407_101543852 | 175 |
| 796 | 3300031903 | Ga0307407_10437810 | Ga0307407_104378102 | 175 |
| 797 | 3300031911 | Ga0307412_10003166 | Ga0307412_100031662 | 175 |
| 798 | 3300031911 | Ga0307412_10021619 | Ga0307412_100216195 | 175 |
| 799 | 3300031995 | Ga0307409_100071970 | Ga0307409_1000719703 | 175 |
| 800 | 3300031995 | Ga0307409_100512531 | Ga0307409_1005125312 | 175 |
| 801 | 3300032002 | Ga0307416_100019713 | Ga0307416_1000197132 | 175 |
| 802 | 3300032002 | Ga0307416_100342345 | Ga0307416_1003423452 | 175 |
| 803 | 3300032002 | Ga0307416_100393236 | Ga0307416_1003932362 | 175 |
| 804 | 3300032002 | Ga0307416_101098934 | Ga0307416_1010989342 | 175 |
| 805 | 3300032004 | Ga0307414_10011458 | Ga0307414_100114582 | 175 |
| 806 | 3300032004 | Ga0307414_10062534 | Ga0307414_100625343 | 175 |
| 807 | 3300032004 | Ga0307414_10500915 | Ga0307414_105009151 | 175 |
| 808 | 3300032004 | Ga0307414_11823705 | Ga0307414_118237051 | 175 |
| 809 | 3300032005 | Ga0307411_10010399 | Ga0307411_100103992 | 175 |
| 810 | 3300032005 | Ga0307411_10010853 | Ga0307411_100108533 | 175 |
| 811 | 3300032005 | Ga0307411_10034033 | Ga0307411_100340334 | 175 |
| 812 | 3300032005 | Ga0307411_10067388 | Ga0307411_100673881 | 175 |
| 813 | 3300032005 | Ga0307411_10186000 | Ga0307411_101860002 | 175 |
| 814 | 3300032126 | Ga0307415_100087449 | Ga0307415_1000874492 | 175 |
| 815 | 3300032126 | Ga0307415_100275699 | Ga0307415_1002756992 | 175 |
| 816 | 3300037418 | Ga0395900_0000995 | Ga0395900_0000995_5968_6495 | 175 |
| 817 | 3300037466 | Ga0395898_0139400 | Ga0395898_0139400_547_1074 | 175 |
| 818 | 3300037471 | Ga0395905_0000538 | Ga0395905_0000538_41499_42026 | 175 |
| 819 | 3300038443 | Ga0395901_0002926 | Ga0395901_0002926_15718_16245 | 175 |
| 820 | 3300042012 | Ga0439455_0206100 | Ga0439455_0206100_11_538 | 175 |
| 821 | 3300046500 | Ga0495596_0051414 | Ga0495596_0051414_904_1431 | 175 |
| 822 | 3300046525 | Ga0495663_0003697 | Ga0495663_0003697_1227_1754 | 175 |
| 823 | 3300046525 | Ga0495663_0045954 | Ga0495663_0045954_733_1260 | 175 |
| 824 | 3300046537 | Ga0495598_0019117 | Ga0495598_0019117_583_1110 | 175 |
| 825 | 3300046539 | Ga0495621_0000350 | Ga0495621_0000350_9481_10008 | 175 |
| 826 | 3300046539 | Ga0495621_0005701 | Ga0495621_0005701_2695_3222 | 175 |
| 827 | 3300046558 | Ga0495633_0031633 | Ga0495633_0031633_1178_1705 | 175 |
| 828 | 3300046664 | Ga0495659_0024873 | Ga0495659_0024873_943_1470 | 175 |
| 829 | 3300046684 | Ga0495669_0283457 | Ga0495669_0283457_247_774 | 175 |
| 830 | 3300046691 | Ga0495670_0010361 | Ga0495670_0010361_803_1330 | 175 |
| 831 | 3300046691 | Ga0495670_0012515 | Ga0495670_0012515_980_1507 | 175 |
| 832 | 3300047445 | Ga0495677_0024518 | Ga0495677_0024518_796_1323 | 175 |
| 833 | 3300047445 | Ga0495677_0165252 | Ga0495677_0165252_29_556 | 175 |
| 834 | 3300047447 | Ga0495685_090595 | Ga0495685_090595_437_964 | 175 |
| 835 | 3300048090 | Ga0495615_0021854 | Ga0495615_0021854_449_976 | 175 |
| 836 | 3300050511 | nmdc:mga08y16_987285_c1 | nmdc:mga08y16_987285_c1_32_559 | 175 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qyn-assembly1.cif.gz_C | crystal structure of secb from escherichia coli | 0.9598 | 23 | 152 |
| 1fx3-assembly1.cif.gz_D | crystal structure of h. influenzae secb | 0.9436 | 23 | 154 |
| 1qyn-assembly1.cif.gz_C | crystal structure of secb from escherichia coli | 0.9387 | 23 | 152 |
| 1ozb-assembly2.cif.gz_G | crystal structure of secb complexed with seca c-terminus | 0.9341 | 19 | 154 |
| 1ozb-assembly1.cif.gz_A | crystal structure of secb complexed with seca c-terminus | 0.9306 | 23 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1qynD00 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.9572 | 23 | 155 | 3.10.420.10 |
| 1qynD00 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.9301 | 23 | 155 | 3.10.420.10 |
| af_P95257_21_163_3.10.420.10 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7576 | 24 | 144 | 3.10.420.10 |
| 5jtlB00 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7576 | 18 | 169 | 3.10.420.10 |
| af_Q57803_2_154_3.10.420.10 | Alpha Beta;Roll;Bacterial Protein-export protein SecB;SecB-like | 0.7547 | 24 | 161 | 3.10.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5NPE3-F1-model_v4 | Protein-export chaperone SecB | 0.9739 | 30 | 163 |
GO:0015031
GO:0051082 GO:0051262 |
| AF-A0A2E2YF56-F1-model_v4 | Protein-export protein SecB | 0.9653 | 25 | 155 |
GO:0005737
GO:0006457 GO:0015031 GO:0051082 GO:0051262 |
| AF-A0A5C9CQ51-F1-model_v4 | Preprotein translocase subunit SecB | 0.9653 | 35 | 159 |
GO:0015031
GO:0051082 GO:0051262 |
| AF-A0A7J6ZP74-F1-model_v4 | deleted | 0.9648 | 34 | 159 |
|
| AF-A0A7X3LZW4-F1-model_v4 | Protein-export protein SecB | 0.9646 | 21 | 156 |
GO:0005737
GO:0006457 GO:0015031 GO:0051082 GO:0051262 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar