F482801
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 834 | 280 | 1668 | 268 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0053402|Ga0466969_0053402_129_1049 |
| Length | 306 |
| Sequence | LNANALTLSRKPAVYKIVETGFYARGIDRETEFVIGGLKVAVVLPAYNASLTLERTYAEIPMGIVDEVILVDDASTDETAELAERLGIHTIIHARNSGYGANQKTCYSIALAKGADIVVMLHPDYQYTPRLITAMAGMIASGHYDAVFASRILGGGALAGGMPRYKYVANRLLTAFQNLLMGAKLSEYHTGYRAWSREVLEQLPLAACSDDFLFDNQMIALTIAAGCRYGEISCPTKYFAEASSINFQRSCIYGVGVIRTAITYRLWRWRIAKSRLFSADAPRLPRVLAPMPSMSVAEPIKRVRAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 112 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 174 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 175 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 199 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 209 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 210 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 227 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 228 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 262 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 263 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 264 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 265 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.04 |
| Metatranscriptomes | 0.96 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 3.72 |
| Rhizosphere | 95.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466969_0053402 | 3300044656 | Bacteria | 1982 |
| 2 | MBSR1b_contig_11028726 | 2162886012 | Bacteria | 980 |
| 3 | MBSR1b_contig_6310719 | 2162886012 | Bacteria | 980 |
| 4 | LJNas_1000003 | 3300000546 | Bacteria | 33926 |
| 5 | JGI24736J21556_1001478 | 3300001904 | Unclassified | 4310 |
| 6 | JGI24740J21852_10024048 | 3300001979 | Bacteria | 2071 |
| 7 | JGI24737J22298_10002529 | 3300001990 | Bacteria | 6493 |
| 8 | rootH1_10040856 | 3300003323 | Bacteria | 3073 |
| 9 | Ga0058863_10141147 | 3300004799 | Bacteria | 1371 |
| 10 | Ga0065712_10169954 | 3300005290 | Bacteria | 1249 |
| 11 | Ga0065712_10214995 | 3300005290 | Bacteria | 1060 |
| 12 | Ga0065715_10003513 | 3300005293 | Bacteria | 5160 |
| 13 | Ga0065715_10218654 | 3300005293 | Bacteria | 1259 |
| 14 | Ga0070658_10010319 | 3300005327 | Bacteria | 7496 |
| 15 | Ga0070658_10036934 | 3300005327 | Bacteria | 3937 |
| 16 | Ga0070658_10057738 | 3300005327 | Unclassified | 3157 |
| 17 | Ga0070658_10085673 | 3300005327 | Bacteria | 2591 |
| 18 | Ga0070676_10239571 | 3300005328 | Bacteria | 1206 |
| 19 | Ga0070683_100035957 | 3300005329 | Bacteria | 4531 |
| 20 | Ga0070683_100038958 | 3300005329 | Bacteria | 4360 |
| 21 | Ga0070690_100011511 | 3300005330 | Bacteria | 5176 |
| 22 | Ga0070670_100025213 | 3300005331 | Bacteria | 5117 |
| 23 | Ga0070670_100386742 | 3300005331 | Unclassified | 1233 |
| 24 | Ga0068869_100003182 | 3300005334 | Bacteria | 10027 |
| 25 | Ga0068869_100165445 | 3300005334 | Bacteria | 1725 |
| 26 | Ga0070666_10004558 | 3300005335 | Bacteria | 8450 |
| 27 | Ga0070666_10129025 | 3300005335 | Bacteria | 1756 |
| 28 | Ga0070680_100290970 | 3300005336 | Bacteria | 1384 |
| 29 | Ga0070682_100082814 | 3300005337 | Bacteria | 2081 |
| 30 | Ga0070682_100157481 | 3300005337 | Bacteria | 1565 |
| 31 | Ga0068868_100004977 | 3300005338 | Bacteria | 9331 |
| 32 | Ga0068868_100029819 | 3300005338 | Bacteria | 4179 |
| 33 | Ga0068868_100057463 | 3300005338 | Bacteria | 3074 |
| 34 | Ga0068868_100136349 | 3300005338 | Bacteria | 2012 |
| 35 | Ga0070660_100000156 | 3300005339 | Bacteria | 44192 |
| 36 | Ga0070660_100144403 | 3300005339 | Bacteria | 1911 |
| 37 | Ga0070660_100375985 | 3300005339 | Bacteria | 1172 |
| 38 | Ga0070661_100017772 | 3300005344 | Bacteria | 5047 |
| 39 | Ga0070661_100024803 | 3300005344 | Bacteria | 4303 |
| 40 | Ga0070661_100056754 | 3300005344 | Bacteria | 2869 |
| 41 | Ga0070661_100174029 | 3300005344 | Bacteria | 1636 |
| 42 | Ga0070692_10232105 | 3300005345 | Bacteria | 1096 |
| 43 | Ga0070668_100040827 | 3300005347 | Bacteria | 3552 |
| 44 | Ga0070669_100036383 | 3300005353 | Bacteria | 3567 |
| 45 | Ga0070671_100000051 | 3300005355 | Bacteria | 79207 |
| 46 | Ga0070671_100044507 | 3300005355 | Bacteria | 3689 |
| 47 | Ga0070671_100086827 | 3300005355 | Bacteria | 2618 |
| 48 | Ga0070674_100074020 | 3300005356 | Unclassified | 2416 |
| 49 | Ga0070673_100021217 | 3300005364 | Bacteria | 4703 |
| 50 | Ga0070673_100354207 | 3300005364 | Bacteria | 1303 |
| 51 | Ga0070659_100007568 | 3300005366 | Bacteria | 7894 |
| 52 | Ga0070659_100397881 | 3300005366 | Bacteria | 1162 |
| 53 | Ga0070667_100017241 | 3300005367 | Bacteria | 5982 |
| 54 | Ga0070667_100373046 | 3300005367 | Bacteria | 1295 |
| 55 | Ga0070709_10041959 | 3300005434 | Bacteria | 2822 |
| 56 | Ga0070709_10267247 | 3300005434 | Bacteria | 1238 |
| 57 | Ga0070714_100045019 | 3300005435 | Bacteria | 3738 |
| 58 | Ga0070714_100077195 | 3300005435 | Bacteria | 2893 |
| 59 | Ga0070714_100100166 | 3300005435 | Bacteria | 2551 |
| 60 | Ga0070714_100149087 | 3300005435 | Bacteria | 2106 |
| 61 | Ga0070714_100160428 | 3300005435 | Unclassified | 2034 |
| 62 | Ga0070714_100338505 | 3300005435 | Bacteria | 1411 |
| 63 | Ga0070713_100000438 | 3300005436 | Bacteria | 26645 |
| 64 | Ga0070713_100001915 | 3300005436 | Bacteria | 13419 |
| 65 | Ga0070713_100003381 | 3300005436 | Bacteria | 10540 |
| 66 | Ga0070713_100005207 | 3300005436 | Bacteria | 8858 |
| 67 | Ga0070713_100033340 | 3300005436 | Bacteria | 4123 |
| 68 | Ga0070713_100141469 | 3300005436 | Bacteria | 2132 |
| 69 | Ga0070713_100191931 | 3300005436 | Bacteria | 1841 |
| 70 | Ga0070713_100197188 | 3300005436 | Bacteria | 1817 |
| 71 | Ga0070710_10007915 | 3300005437 | Bacteria | 5164 |
| 72 | Ga0070710_10008713 | 3300005437 | Unclassified | 4946 |
| 73 | Ga0070710_10023148 | 3300005437 | Bacteria | 3261 |
| 74 | Ga0070711_100009670 | 3300005439 | Bacteria | 5941 |
| 75 | Ga0070711_100018718 | 3300005439 | Bacteria | 4427 |
| 76 | Ga0070711_100123271 | 3300005439 | Bacteria | 1920 |
| 77 | Ga0070711_100366090 | 3300005439 | Unclassified | 1162 |
| 78 | Ga0070708_100002318 | 3300005445 | Bacteria | 14730 |
| 79 | Ga0070708_100007153 | 3300005445 | Bacteria | 8907 |
| 80 | Ga0070708_100017296 | 3300005445 | Bacteria | 6010 |
| 81 | Ga0070708_100049293 | 3300005445 | Bacteria | 3725 |
| 82 | Ga0070708_100065072 | 3300005445 | Bacteria | 3268 |
| 83 | Ga0070708_100149239 | 3300005445 | Bacteria | 2173 |
| 84 | Ga0070708_100245598 | 3300005445 | Bacteria | 1681 |
| 85 | Ga0070708_100393676 | 3300005445 | Bacteria | 1306 |
| 86 | Ga0070708_100453416 | 3300005445 | Bacteria | 1210 |
| 87 | Ga0070663_100001977 | 3300005455 | Bacteria | 11438 |
| 88 | Ga0070663_100017943 | 3300005455 | Bacteria | 4628 |
| 89 | Ga0070663_100019093 | 3300005455 | Bacteria | 4510 |
| 90 | Ga0070678_100001121 | 3300005456 | Bacteria | 14070 |
| 91 | Ga0070662_100003695 | 3300005457 | Bacteria | 9570 |
| 92 | Ga0070662_100014257 | 3300005457 | Bacteria | 5306 |
| 93 | Ga0070662_100064711 | 3300005457 | Bacteria | 2678 |
| 94 | Ga0070681_10000642 | 3300005458 | Bacteria | 28781 |
| 95 | Ga0070681_10203092 | 3300005458 | Bacteria | 1900 |
| 96 | Ga0070681_10291956 | 3300005458 | Bacteria | 1540 |
| 97 | Ga0068867_100013158 | 3300005459 | Bacteria | 5858 |
| 98 | Ga0070685_10159780 | 3300005466 | Bacteria | 1435 |
| 99 | Ga0070706_100002917 | 3300005467 | Bacteria | 17028 |
| 100 | Ga0070706_100003337 | 3300005467 | Bacteria | 15839 |
| 101 | Ga0070706_100118289 | 3300005467 | Bacteria | 2468 |
| 102 | Ga0070707_100008344 | 3300005468 | Bacteria | 9618 |
| 103 | Ga0070707_100031608 | 3300005468 | Bacteria | 5044 |
| 104 | Ga0070707_100042974 | 3300005468 | Bacteria | 4327 |
| 105 | Ga0070698_100000846 | 3300005471 | Bacteria | 33541 |
| 106 | Ga0070698_100006156 | 3300005471 | Bacteria | 13066 |
| 107 | Ga0070699_100001679 | 3300005518 | Bacteria | 20176 |
| 108 | Ga0070699_100030648 | 3300005518 | Bacteria | 4644 |
| 109 | Ga0070699_100034627 | 3300005518 | Bacteria | 4365 |
| 110 | Ga0070699_100285582 | 3300005518 | Bacteria | 1478 |
| 111 | Ga0070679_100021761 | 3300005530 | Bacteria | 6263 |
| 112 | Ga0070679_100051046 | 3300005530 | Bacteria | 4119 |
| 113 | Ga0070679_100091708 | 3300005530 | Unclassified | 3026 |
| 114 | Ga0070679_100415146 | 3300005530 | Bacteria | 1291 |
| 115 | Ga0070684_100010075 | 3300005535 | Bacteria | 7472 |
| 116 | Ga0070684_100137088 | 3300005535 | Bacteria | 2211 |
| 117 | Ga0070684_100245867 | 3300005535 | Bacteria | 1635 |
| 118 | Ga0070684_100688410 | 3300005535 | Bacteria | 953 |
| 119 | Ga0070684_100690676 | 3300005535 | Unclassified | 951 |
| 120 | Ga0070697_100001267 | 3300005536 | Bacteria | 19065 |
| 121 | Ga0070697_100001538 | 3300005536 | Bacteria | 17569 |
| 122 | Ga0070697_100182138 | 3300005536 | Bacteria | 1781 |
| 123 | Ga0068853_100000214 | 3300005539 | Bacteria | 41184 |
| 124 | Ga0068853_100062512 | 3300005539 | Bacteria | 3222 |
| 125 | Ga0068853_100107498 | 3300005539 | Unclassified | 2474 |
| 126 | Ga0068853_100140132 | 3300005539 | Bacteria | 2171 |
| 127 | Ga0070672_100039518 | 3300005543 | Bacteria | 3614 |
| 128 | Ga0070672_100287244 | 3300005543 | Bacteria | 1392 |
| 129 | Ga0070686_100003290 | 3300005544 | Bacteria | 8843 |
| 130 | Ga0070695_100048709 | 3300005545 | Unclassified | 2710 |
| 131 | Ga0070696_100158473 | 3300005546 | Bacteria | 1666 |
| 132 | Ga0070693_100014773 | 3300005547 | Bacteria | 4009 |
| 133 | Ga0070665_100006906 | 3300005548 | Bacteria | 11537 |
| 134 | Ga0070665_100293915 | 3300005548 | Bacteria | 1627 |
| 135 | Ga0070665_100782307 | 3300005548 | Bacteria | 967 |
| 136 | Ga0068855_100002185 | 3300005563 | Bacteria | 24187 |
| 137 | Ga0068855_100002738 | 3300005563 | Bacteria | 21707 |
| 138 | Ga0068855_100003286 | 3300005563 | Bacteria | 19801 |
| 139 | Ga0068855_100004246 | 3300005563 | Bacteria | 17500 |
| 140 | Ga0068855_100004580 | 3300005563 | Bacteria | 16889 |
| 141 | Ga0068855_100006613 | 3300005563 | Bacteria | 14081 |
| 142 | Ga0068855_100089171 | 3300005563 | Unclassified | 3561 |
| 143 | Ga0068855_100226422 | 3300005563 | Bacteria | 2095 |
| 144 | Ga0068855_100413986 | 3300005563 | Bacteria | 1475 |
| 145 | Ga0068855_100630188 | 3300005563 | Bacteria | 1154 |
| 146 | Ga0068855_100775068 | 3300005563 | Unclassified | 1021 |
| 147 | Ga0070664_100010879 | 3300005564 | Bacteria | 7379 |
| 148 | Ga0070664_100013802 | 3300005564 | Bacteria | 6586 |
| 149 | Ga0070664_100078335 | 3300005564 | Bacteria | 2843 |
| 150 | Ga0070664_100264969 | 3300005564 | Unclassified | 1547 |
| 151 | Ga0070664_100288242 | 3300005564 | Bacteria | 1482 |
| 152 | Ga0070664_100600913 | 3300005564 | Bacteria | 1020 |
| 153 | Ga0068857_100007967 | 3300005577 | Bacteria | 9146 |
| 154 | Ga0068857_100023696 | 3300005577 | Bacteria | 5404 |
| 155 | Ga0068857_100037341 | 3300005577 | Bacteria | 4302 |
| 156 | Ga0068857_100110146 | 3300005577 | Bacteria | 2474 |
| 157 | Ga0068854_100010340 | 3300005578 | Bacteria | 6047 |
| 158 | Ga0068854_100012942 | 3300005578 | Bacteria | 5465 |
| 159 | Ga0068854_100017644 | 3300005578 | Bacteria | 4779 |
| 160 | Ga0068854_100019294 | 3300005578 | Bacteria | 4593 |
| 161 | Ga0068856_100000269 | 3300005614 | Bacteria | 56597 |
| 162 | Ga0068856_100006429 | 3300005614 | Bacteria | 11533 |
| 163 | Ga0068856_100020381 | 3300005614 | Bacteria | 6439 |
| 164 | Ga0068856_100039823 | 3300005614 | Bacteria | 4614 |
| 165 | Ga0068856_100056622 | 3300005614 | Bacteria | 3869 |
| 166 | Ga0068856_100058291 | 3300005614 | Bacteria | 3813 |
| 167 | Ga0068856_100062601 | 3300005614 | Unclassified | 3675 |
| 168 | Ga0068856_100154825 | 3300005614 | Bacteria | 2302 |
| 169 | Ga0068856_100192309 | 3300005614 | Bacteria | 2054 |
| 170 | Ga0068856_100296253 | 3300005614 | Bacteria | 1635 |
| 171 | Ga0068856_100363856 | 3300005614 | Bacteria | 1465 |
| 172 | Ga0068856_100644905 | 3300005614 | Bacteria | 1080 |
| 173 | Ga0068856_100851378 | 3300005614 | Bacteria | 931 |
| 174 | Ga0068852_100000025 | 3300005616 | Bacteria | 115410 |
| 175 | Ga0068852_100000053 | 3300005616 | Bacteria | 79046 |
| 176 | Ga0068852_100023014 | 3300005616 | Bacteria | 5007 |
| 177 | Ga0068852_100291836 | 3300005616 | Bacteria | 1576 |
| 178 | Ga0068852_100389176 | 3300005616 | Unclassified | 1369 |
| 179 | Ga0068852_100900191 | 3300005616 | Bacteria | 902 |
| 180 | Ga0068859_100026135 | 3300005617 | Bacteria | 5856 |
| 181 | Ga0068859_100030073 | 3300005617 | Bacteria | 5449 |
| 182 | Ga0068866_10028614 | 3300005718 | Bacteria | 2657 |
| 183 | Ga0068861_100115421 | 3300005719 | Bacteria | 2157 |
| 184 | Ga0068851_10001003 | 3300005834 | Bacteria | 12257 |
| 185 | Ga0068851_10102345 | 3300005834 | Bacteria | 1521 |
| 186 | Ga0068863_100003429 | 3300005841 | Bacteria | 15619 |
| 187 | Ga0068863_100032007 | 3300005841 | Bacteria | 5016 |
| 188 | Ga0068863_100089517 | 3300005841 | Bacteria | 2918 |
| 189 | Ga0068863_100269145 | 3300005841 | Bacteria | 1649 |
| 190 | Ga0068863_100545457 | 3300005841 | Bacteria | 1144 |
| 191 | Ga0068858_100005999 | 3300005842 | Bacteria | 11865 |
| 192 | Ga0068858_100359711 | 3300005842 | Bacteria | 1395 |
| 193 | Ga0068860_100011963 | 3300005843 | Bacteria | 8552 |
| 194 | Ga0068862_100075967 | 3300005844 | Bacteria | 2907 |
| 195 | Ga0068862_100204316 | 3300005844 | Bacteria | 1782 |
| 196 | Ga0068862_100303259 | 3300005844 | Bacteria | 1470 |
| 197 | Ga0070717_10000968 | 3300006028 | Bacteria | 19176 |
| 198 | Ga0070717_10002643 | 3300006028 | Bacteria | 12617 |
| 199 | Ga0070717_10003289 | 3300006028 | Bacteria | 11564 |
| 200 | Ga0070717_10010243 | 3300006028 | Bacteria | 7064 |
| 201 | Ga0070717_10022983 | 3300006028 | Bacteria | 4933 |
| 202 | Ga0070717_10033413 | 3300006028 | Bacteria | 4150 |
| 203 | Ga0070717_10033453 | 3300006028 | Bacteria | 4148 |
| 204 | Ga0070717_10158855 | 3300006028 | Bacteria | 1960 |
| 205 | Ga0070717_10186875 | 3300006028 | Bacteria | 1809 |
| 206 | Ga0070717_10217911 | 3300006028 | Bacteria | 1677 |
| 207 | Ga0070716_100024518 | 3300006173 | Bacteria | 3211 |
| 208 | Ga0070716_100051894 | 3300006173 | Bacteria | 2333 |
| 209 | Ga0070716_100227142 | 3300006173 | Bacteria | 1258 |
| 210 | Ga0070716_100236985 | 3300006173 | Bacteria | 1235 |
| 211 | Ga0070712_100000076 | 3300006175 | Bacteria | 50960 |
| 212 | Ga0070712_100001666 | 3300006175 | Bacteria | 13590 |
| 213 | Ga0070712_100026618 | 3300006175 | Bacteria | 3855 |
| 214 | Ga0070712_100057563 | 3300006175 | Bacteria | 2731 |
| 215 | Ga0075366_10014843 | 3300006195 | Bacteria | 4453 |
| 216 | Ga0097621_100005067 | 3300006237 | Bacteria | 9260 |
| 217 | Ga0097621_100005779 | 3300006237 | Bacteria | 8734 |
| 218 | Ga0097621_100031803 | 3300006237 | Unclassified | 4189 |
| 219 | Ga0097621_100034951 | 3300006237 | Bacteria | 4012 |
| 220 | Ga0097621_100128835 | 3300006237 | Bacteria | 2152 |
| 221 | Ga0097621_100225512 | 3300006237 | Bacteria | 1634 |
| 222 | Ga0097621_100276997 | 3300006237 | Bacteria | 1476 |
| 223 | Ga0068871_100001349 | 3300006358 | Bacteria | 16430 |
| 224 | Ga0068871_100005807 | 3300006358 | Bacteria | 8671 |
| 225 | Ga0068871_100041503 | 3300006358 | Bacteria | 3690 |
| 226 | Ga0068871_100136418 | 3300006358 | Bacteria | 2084 |
| 227 | Ga0068871_100179152 | 3300006358 | Unclassified | 1820 |
| 228 | Ga0075434_100000139 | 3300006871 | Bacteria | 44156 |
| 229 | Ga0075434_100006917 | 3300006871 | Bacteria | 10453 |
| 230 | Ga0068865_100012452 | 3300006881 | Bacteria | 5354 |
| 231 | Ga0068865_100019086 | 3300006881 | Bacteria | 4435 |
| 232 | Ga0068865_100035469 | 3300006881 | Bacteria | 3355 |
| 233 | Ga0068865_100532851 | 3300006881 | Bacteria | 984 |
| 234 | Ga0075436_100004473 | 3300006914 | Bacteria | 9589 |
| 235 | Ga0075436_100078038 | 3300006914 | Bacteria | 2294 |
| 236 | Ga0097620_100026135 | 3300006931 | Bacteria | 5856 |
| 237 | Ga0097620_100030076 | 3300006931 | Bacteria | 5449 |
| 238 | Ga0075435_100000345 | 3300007076 | Bacteria | 28688 |
| 239 | Ga0075435_100170616 | 3300007076 | Unclassified | 1835 |
| 240 | Ga0099795_10000530 | 3300007788 | Bacteria | 7183 |
| 241 | Ga0105250_10099352 | 3300009092 | Bacteria | 1187 |
| 242 | Ga0105240_10000280 | 3300009093 | Bacteria | 100888 |
| 243 | Ga0105240_10000426 | 3300009093 | Bacteria | 78171 |
| 244 | Ga0105240_10011959 | 3300009093 | Bacteria | 12029 |
| 245 | Ga0105240_10013870 | 3300009093 | Bacteria | 11037 |
| 246 | Ga0105240_10017978 | 3300009093 | Bacteria | 9510 |
| 247 | Ga0105240_10077828 | 3300009093 | Bacteria | 4085 |
| 248 | Ga0105240_10095986 | 3300009093 | Bacteria | 3614 |
| 249 | Ga0105240_10117188 | 3300009093 | Unclassified | 3212 |
| 250 | Ga0105240_10170247 | 3300009093 | Bacteria | 2580 |
| 251 | Ga0105240_10186099 | 3300009093 | Bacteria | 2446 |
| 252 | Ga0105240_10279231 | 3300009093 | Bacteria | 1919 |
| 253 | Ga0105240_10436987 | 3300009093 | Bacteria | 1467 |
| 254 | Ga0105240_10733801 | 3300009093 | Bacteria | 1075 |
| 255 | Ga0105245_10236977 | 3300009098 | Bacteria | 1767 |
| 256 | Ga0105247_10005296 | 3300009101 | Bacteria | 8137 |
| 257 | Ga0105247_10068447 | 3300009101 | Bacteria | 2214 |
| 258 | Ga0105247_10071116 | 3300009101 | Bacteria | 2175 |
| 259 | Ga0114129_10089827 | 3300009147 | Bacteria | 4259 |
| 260 | Ga0114129_10314506 | 3300009147 | Bacteria | 2084 |
| 261 | Ga0105243_10076124 | 3300009148 | Bacteria | 2726 |
| 262 | Ga0105241_10000455 | 3300009174 | Bacteria | 30779 |
| 263 | Ga0105241_10024107 | 3300009174 | Bacteria | 4518 |
| 264 | Ga0105241_10049786 | 3300009174 | Unclassified | 3192 |
| 265 | Ga0105241_10052946 | 3300009174 | Unclassified | 3102 |
| 266 | Ga0105241_10125293 | 3300009174 | Unclassified | 2074 |
| 267 | Ga0105241_10376389 | 3300009174 | Bacteria | 1239 |
| 268 | Ga0105242_10016004 | 3300009176 | Bacteria | 5827 |
| 269 | Ga0105248_10009308 | 3300009177 | Bacteria | 10816 |
| 270 | Ga0105248_10018163 | 3300009177 | Bacteria | 7766 |
| 271 | Ga0105248_10042161 | 3300009177 | Bacteria | 5118 |
| 272 | Ga0105248_10243071 | 3300009177 | Bacteria | 2026 |
| 273 | Ga0105248_10639552 | 3300009177 | Bacteria | 1200 |
| 274 | Ga0105237_10004312 | 3300009545 | Bacteria | 16491 |
| 275 | Ga0105237_10017196 | 3300009545 | Bacteria | 7502 |
| 276 | Ga0105237_10029965 | 3300009545 | Bacteria | 5528 |
| 277 | Ga0105237_10114497 | 3300009545 | Bacteria | 2689 |
| 278 | Ga0105237_10194385 | 3300009545 | Unclassified | 2028 |
| 279 | Ga0105237_10366664 | 3300009545 | Bacteria | 1445 |
| 280 | Ga0105237_10465866 | 3300009545 | Bacteria | 1270 |
| 281 | Ga0105238_10000743 | 3300009551 | Bacteria | 34004 |
| 282 | Ga0105238_10001544 | 3300009551 | Bacteria | 23076 |
| 283 | Ga0105238_10053362 | 3300009551 | Bacteria | 4062 |
| 284 | Ga0105238_10115481 | 3300009551 | Unclassified | 2664 |
| 285 | Ga0105238_10152720 | 3300009551 | Bacteria | 2284 |
| 286 | Ga0105238_10186437 | 3300009551 | Bacteria | 2051 |
| 287 | Ga0105238_10482056 | 3300009551 | Bacteria | 1240 |
| 288 | Ga0105249_10010391 | 3300009553 | Bacteria | 8181 |
| 289 | Ga0105249_10049700 | 3300009553 | Bacteria | 3824 |
| 290 | Ga0105249_10465181 | 3300009553 | Unclassified | 1305 |
| 291 | Ga0105239_10003363 | 3300010375 | Bacteria | 19652 |
| 292 | Ga0105239_10047535 | 3300010375 | Bacteria | 4703 |
| 293 | Ga0105239_10123565 | 3300010375 | Bacteria | 2876 |
| 294 | Ga0105239_10142661 | 3300010375 | Unclassified | 2670 |
| 295 | Ga0105246_10009151 | 3300011119 | Bacteria | 6099 |
| 296 | Ga0105246_10152779 | 3300011119 | Bacteria | 1749 |
| 297 | Ga0105246_10177621 | 3300011119 | Bacteria | 1636 |
| 298 | Ga0157373_10027296 | 3300013100 | Bacteria | 4119 |
| 299 | Ga0157373_10029018 | 3300013100 | Unclassified | 3988 |
| 300 | Ga0157373_10092749 | 3300013100 | Bacteria | 2127 |
| 301 | Ga0157371_10005744 | 3300013102 | Bacteria | 10392 |
| 302 | Ga0157371_10032437 | 3300013102 | Unclassified | 3759 |
| 303 | Ga0157370_10000012 | 3300013104 | Bacteria | 201181 |
| 304 | Ga0157370_10006522 | 3300013104 | Bacteria | 12851 |
| 305 | Ga0157370_10023853 | 3300013104 | Bacteria | 6068 |
| 306 | Ga0157370_10025341 | 3300013104 | Bacteria | 5871 |
| 307 | Ga0157370_10078999 | 3300013104 | Unclassified | 3099 |
| 308 | Ga0157370_10130965 | 3300013104 | Bacteria | 2339 |
| 309 | Ga0157370_10227410 | 3300013104 | Bacteria | 1727 |
| 310 | Ga0157370_10261967 | 3300013104 | Bacteria | 1598 |
| 311 | Ga0157370_10287735 | 3300013104 | Bacteria | 1518 |
| 312 | Ga0157370_10351006 | 3300013104 | Bacteria | 1360 |
| 313 | Ga0157370_10411604 | 3300013104 | Bacteria | 1244 |
| 314 | Ga0157369_10000096 | 3300013105 | Bacteria | 121542 |
| 315 | Ga0157369_10000319 | 3300013105 | Bacteria | 64594 |
| 316 | Ga0157369_10002552 | 3300013105 | Bacteria | 21794 |
| 317 | Ga0157369_10002908 | 3300013105 | Bacteria | 20471 |
| 318 | Ga0157369_10014845 | 3300013105 | Bacteria | 8790 |
| 319 | Ga0157369_10027605 | 3300013105 | Bacteria | 6289 |
| 320 | Ga0157369_10033662 | 3300013105 | Bacteria | 5630 |
| 321 | Ga0157369_10047347 | 3300013105 | Bacteria | 4669 |
| 322 | Ga0157369_10054899 | 3300013105 | Unclassified | 4301 |
| 323 | Ga0157369_10065998 | 3300013105 | Bacteria | 3894 |
| 324 | Ga0157369_10097690 | 3300013105 | Bacteria | 3133 |
| 325 | Ga0157369_10111030 | 3300013105 | Bacteria | 2914 |
| 326 | Ga0157369_10243750 | 3300013105 | Bacteria | 1877 |
| 327 | Ga0157369_10335549 | 3300013105 | Bacteria | 1571 |
| 328 | Ga0157369_10373139 | 3300013105 | Bacteria | 1481 |
| 329 | Ga0157374_10000299 | 3300013296 | Bacteria | 45851 |
| 330 | Ga0157374_10000673 | 3300013296 | Bacteria | 30064 |
| 331 | Ga0157374_10002089 | 3300013296 | Bacteria | 16803 |
| 332 | Ga0157374_10004674 | 3300013296 | Bacteria | 11492 |
| 333 | Ga0157374_10006900 | 3300013296 | Bacteria | 9658 |
| 334 | Ga0157374_10024583 | 3300013296 | Bacteria | 5402 |
| 335 | Ga0157374_10042197 | 3300013296 | Unclassified | 4207 |
| 336 | Ga0157374_10051437 | 3300013296 | Bacteria | 3834 |
| 337 | Ga0157374_10270904 | 3300013296 | Bacteria | 1674 |
| 338 | Ga0157374_10558967 | 3300013296 | Unclassified | 1152 |
| 339 | Ga0157378_10000222 | 3300013297 | Bacteria | 55407 |
| 340 | Ga0157378_10014888 | 3300013297 | Bacteria | 6806 |
| 341 | Ga0157378_10018387 | 3300013297 | Bacteria | 6137 |
| 342 | Ga0157378_10067844 | 3300013297 | Bacteria | 3197 |
| 343 | Ga0157378_10112300 | 3300013297 | Bacteria | 2499 |
| 344 | Ga0157378_10211624 | 3300013297 | Bacteria | 1839 |
| 345 | Ga0157378_10351018 | 3300013297 | Bacteria | 1441 |
| 346 | Ga0157378_10401296 | 3300013297 | Bacteria | 1351 |
| 347 | Ga0163162_10002572 | 3300013306 | Bacteria | 17167 |
| 348 | Ga0163162_10014711 | 3300013306 | Bacteria | 7647 |
| 349 | Ga0163162_10026375 | 3300013306 | Bacteria | 5742 |
| 350 | Ga0163162_10027362 | 3300013306 | Bacteria | 5639 |
| 351 | Ga0163162_10045306 | 3300013306 | Bacteria | 4407 |
| 352 | Ga0163162_10321937 | 3300013306 | Bacteria | 1679 |
| 353 | Ga0163162_10461684 | 3300013306 | Bacteria | 1401 |
| 354 | Ga0157372_10000066 | 3300013307 | Bacteria | 113120 |
| 355 | Ga0157372_10002499 | 3300013307 | Bacteria | 19946 |
| 356 | Ga0157372_10003262 | 3300013307 | Bacteria | 17534 |
| 357 | Ga0157372_10007214 | 3300013307 | Bacteria | 11834 |
| 358 | Ga0157372_10042263 | 3300013307 | Bacteria | 5040 |
| 359 | Ga0157372_10047721 | 3300013307 | Bacteria | 4760 |
| 360 | Ga0157372_10055584 | 3300013307 | Bacteria | 4421 |
| 361 | Ga0157372_10056483 | 3300013307 | Unclassified | 4386 |
| 362 | Ga0157372_10095319 | 3300013307 | Bacteria | 3390 |
| 363 | Ga0157372_10125291 | 3300013307 | Bacteria | 2953 |
| 364 | Ga0157372_10248091 | 3300013307 | Bacteria | 2066 |
| 365 | Ga0157372_10408562 | 3300013307 | Bacteria | 1582 |
| 366 | Ga0157372_10841647 | 3300013307 | Unclassified | 1065 |
| 367 | Ga0157375_10015149 | 3300013308 | Bacteria | 6897 |
| 368 | Ga0157375_10064677 | 3300013308 | Bacteria | 3643 |
| 369 | Ga0157375_10518802 | 3300013308 | Bacteria | 1355 |
| 370 | Ga0163163_10008107 | 3300014325 | Bacteria | 9308 |
| 371 | Ga0163163_10091041 | 3300014325 | Bacteria | 3064 |
| 372 | Ga0163163_10163387 | 3300014325 | Bacteria | 2273 |
| 373 | Ga0163163_10318623 | 3300014325 | Bacteria | 1608 |
| 374 | Ga0182008_10023567 | 3300014497 | Bacteria | 3142 |
| 375 | Ga0157379_10006245 | 3300014968 | Bacteria | 10258 |
| 376 | Ga0157379_10027234 | 3300014968 | Bacteria | 5088 |
| 377 | Ga0157379_10027802 | 3300014968 | Bacteria | 5034 |
| 378 | Ga0157379_10064905 | 3300014968 | Bacteria | 3263 |
| 379 | Ga0157379_10133704 | 3300014968 | Bacteria | 2234 |
| 380 | Ga0157379_10182066 | 3300014968 | Bacteria | 1898 |
| 381 | Ga0157376_10008636 | 3300014969 | Bacteria | 7363 |
| 382 | Ga0157376_10010434 | 3300014969 | Bacteria | 6794 |
| 383 | Ga0157376_10015385 | 3300014969 | Bacteria | 5779 |
| 384 | Ga0157376_10026102 | 3300014969 | Bacteria | 4611 |
| 385 | Ga0157376_10034688 | 3300014969 | Bacteria | 4076 |
| 386 | Ga0157376_10047637 | 3300014969 | Bacteria | 3540 |
| 387 | Ga0157376_10062832 | 3300014969 | Bacteria | 3126 |
| 388 | Ga0157376_10108218 | 3300014969 | Bacteria | 2442 |
| 389 | Ga0157376_10127256 | 3300014969 | Unclassified | 2268 |
| 390 | Ga0157376_10181135 | 3300014969 | Bacteria | 1926 |
| 391 | Ga0157376_10347604 | 3300014969 | Bacteria | 1418 |
| 392 | Ga0157376_10917442 | 3300014969 | Unclassified | 895 |
| 393 | Ga0163161_10472939 | 3300017792 | Bacteria | 1016 |
| 394 | Ga0163161_10483404 | 3300017792 | Bacteria | 1006 |
| 395 | Ga0224572_1000036 | 3300024225 | Bacteria | 7740 |
| 396 | Ga0224572_1004457 | 3300024225 | Unclassified | 2436 |
| 397 | Ga0228598_1000276 | 3300024227 | Bacteria | 9916 |
| 398 | Ga0228598_1000964 | 3300024227 | Bacteria | 6267 |
| 399 | Ga0228598_1001460 | 3300024227 | Bacteria | 5206 |
| 400 | Ga0228598_1002102 | 3300024227 | Bacteria | 4352 |
| 401 | Ga0228598_1004640 | 3300024227 | Bacteria | 2906 |
| 402 | Ga0207656_10002627 | 3300025321 | Bacteria | 6078 |
| 403 | Ga0207692_10005214 | 3300025898 | Bacteria | 5190 |
| 404 | Ga0207692_10025718 | 3300025898 | Bacteria | 2754 |
| 405 | Ga0207692_10051499 | 3300025898 | Bacteria | 2088 |
| 406 | Ga0207692_10053537 | 3300025898 | Bacteria | 2056 |
| 407 | Ga0207642_10034565 | 3300025899 | Bacteria | 2151 |
| 408 | Ga0207710_10072841 | 3300025900 | Bacteria | 1578 |
| 409 | Ga0207688_10055736 | 3300025901 | Bacteria | 2219 |
| 410 | Ga0207680_10016577 | 3300025903 | Bacteria | 3872 |
| 411 | Ga0207680_10080557 | 3300025903 | Bacteria | 2045 |
| 412 | Ga0207680_10377498 | 3300025903 | Bacteria | 999 |
| 413 | Ga0207647_10005357 | 3300025904 | Bacteria | 9427 |
| 414 | Ga0207647_10007108 | 3300025904 | Bacteria | 8117 |
| 415 | Ga0207647_10012592 | 3300025904 | Bacteria | 5882 |
| 416 | Ga0207647_10026994 | 3300025904 | Bacteria | 3748 |
| 417 | Ga0207699_10000762 | 3300025906 | Bacteria | 15429 |
| 418 | Ga0207699_10032194 | 3300025906 | Bacteria | 2953 |
| 419 | Ga0207699_10032806 | 3300025906 | Bacteria | 2929 |
| 420 | Ga0207699_10122215 | 3300025906 | Bacteria | 1686 |
| 421 | Ga0207699_10258912 | 3300025906 | Bacteria | 1202 |
| 422 | Ga0207699_10347645 | 3300025906 | Bacteria | 1046 |
| 423 | Ga0207645_10007759 | 3300025907 | Bacteria | 7552 |
| 424 | Ga0207705_10000067 | 3300025909 | Bacteria | 136004 |
| 425 | Ga0207705_10004569 | 3300025909 | Bacteria | 10452 |
| 426 | Ga0207705_10021221 | 3300025909 | Bacteria | 4632 |
| 427 | Ga0207705_10033475 | 3300025909 | Bacteria | 3672 |
| 428 | Ga0207705_10041229 | 3300025909 | Unclassified | 3312 |
| 429 | Ga0207684_10001626 | 3300025910 | Bacteria | 23847 |
| 430 | Ga0207684_10098148 | 3300025910 | Bacteria | 2501 |
| 431 | Ga0207684_10122198 | 3300025910 | Bacteria | 2232 |
| 432 | Ga0207654_10000451 | 3300025911 | Bacteria | 23494 |
| 433 | Ga0207654_10002118 | 3300025911 | Bacteria | 10164 |
| 434 | Ga0207654_10008689 | 3300025911 | Bacteria | 5149 |
| 435 | Ga0207707_10002539 | 3300025912 | Bacteria | 16383 |
| 436 | Ga0207707_10061973 | 3300025912 | Bacteria | 3254 |
| 437 | Ga0207707_10175193 | 3300025912 | Bacteria | 1874 |
| 438 | Ga0207707_10496342 | 3300025912 | Bacteria | 1041 |
| 439 | Ga0207695_10000028 | 3300025913 | Bacteria | 551835 |
| 440 | Ga0207695_10000899 | 3300025913 | Bacteria | 53483 |
| 441 | Ga0207695_10012432 | 3300025913 | Bacteria | 10220 |
| 442 | Ga0207695_10015257 | 3300025913 | Bacteria | 9057 |
| 443 | Ga0207695_10015556 | 3300025913 | Bacteria | 8950 |
| 444 | Ga0207695_10063286 | 3300025913 | Bacteria | 3815 |
| 445 | Ga0207695_10077219 | 3300025913 | Bacteria | 3384 |
| 446 | Ga0207695_10081608 | 3300025913 | Unclassified | 3272 |
| 447 | Ga0207695_10084168 | 3300025913 | Unclassified | 3211 |
| 448 | Ga0207695_10104802 | 3300025913 | Bacteria | 2816 |
| 449 | Ga0207695_10201010 | 3300025913 | Bacteria | 1907 |
| 450 | Ga0207671_10000173 | 3300025914 | Bacteria | 99428 |
| 451 | Ga0207671_10000187 | 3300025914 | Bacteria | 95484 |
| 452 | Ga0207671_10003219 | 3300025914 | Bacteria | 16428 |
| 453 | Ga0207671_10144112 | 3300025914 | Bacteria | 1837 |
| 454 | Ga0207671_10194007 | 3300025914 | Bacteria | 1584 |
| 455 | Ga0207671_10200048 | 3300025914 | Unclassified | 1560 |
| 456 | Ga0207671_10365357 | 3300025914 | Bacteria | 1146 |
| 457 | Ga0207693_10000015 | 3300025915 | Bacteria | 147464 |
| 458 | Ga0207693_10000232 | 3300025915 | Bacteria | 51104 |
| 459 | Ga0207693_10027895 | 3300025915 | Bacteria | 4463 |
| 460 | Ga0207693_10034822 | 3300025915 | Bacteria | 3971 |
| 461 | Ga0207663_10002517 | 3300025916 | Bacteria | 8833 |
| 462 | Ga0207663_10043095 | 3300025916 | Bacteria | 2761 |
| 463 | Ga0207663_10143269 | 3300025916 | Bacteria | 1667 |
| 464 | Ga0207663_10322241 | 3300025916 | Unclassified | 1162 |
| 465 | Ga0207660_10013089 | 3300025917 | Bacteria | 5432 |
| 466 | Ga0207660_10194028 | 3300025917 | Unclassified | 1583 |
| 467 | Ga0207657_10001170 | 3300025919 | Bacteria | 27822 |
| 468 | Ga0207657_10009293 | 3300025919 | Bacteria | 9900 |
| 469 | Ga0207657_10037093 | 3300025919 | Bacteria | 4358 |
| 470 | Ga0207657_10057393 | 3300025919 | Unclassified | 3355 |
| 471 | Ga0207657_10087800 | 3300025919 | Bacteria | 2601 |
| 472 | Ga0207649_10042591 | 3300025920 | Bacteria | 2770 |
| 473 | Ga0207649_10060652 | 3300025920 | Unclassified | 2378 |
| 474 | Ga0207649_10154204 | 3300025920 | Unclassified | 1585 |
| 475 | Ga0207649_10312566 | 3300025920 | Bacteria | 1152 |
| 476 | Ga0207652_10010692 | 3300025921 | Bacteria | 7390 |
| 477 | Ga0207652_10061568 | 3300025921 | Bacteria | 3241 |
| 478 | Ga0207652_10113775 | 3300025921 | Bacteria | 2402 |
| 479 | Ga0207652_10187185 | 3300025921 | Bacteria | 1861 |
| 480 | Ga0207646_10001190 | 3300025922 | Bacteria | 32778 |
| 481 | Ga0207646_10081960 | 3300025922 | Bacteria | 2885 |
| 482 | Ga0207646_10113694 | 3300025922 | Bacteria | 2430 |
| 483 | Ga0207646_10260429 | 3300025922 | Bacteria | 1567 |
| 484 | Ga0207646_10331680 | 3300025922 | Bacteria | 1374 |
| 485 | Ga0207646_10591657 | 3300025922 | Bacteria | 996 |
| 486 | Ga0207681_10168952 | 3300025923 | Bacteria | 1656 |
| 487 | Ga0207694_10000293 | 3300025924 | Bacteria | 47019 |
| 488 | Ga0207694_10000619 | 3300025924 | Bacteria | 32276 |
| 489 | Ga0207694_10094338 | 3300025924 | Viruses | 2365 |
| 490 | Ga0207694_10134300 | 3300025924 | Bacteria | 1985 |
| 491 | Ga0207694_10243533 | 3300025924 | Bacteria | 1470 |
| 492 | Ga0207650_10036436 | 3300025925 | Bacteria | 3580 |
| 493 | Ga0207650_10080101 | 3300025925 | Bacteria | 2475 |
| 494 | Ga0207687_10014766 | 3300025927 | Bacteria | 5115 |
| 495 | Ga0207687_10022573 | 3300025927 | Bacteria | 4189 |
| 496 | Ga0207700_10001032 | 3300025928 | Bacteria | 16050 |
| 497 | Ga0207700_10002165 | 3300025928 | Bacteria | 11255 |
| 498 | Ga0207700_10007804 | 3300025928 | Bacteria | 6575 |
| 499 | Ga0207700_10048308 | 3300025928 | Bacteria | 3159 |
| 500 | Ga0207700_10057268 | 3300025928 | Bacteria | 2938 |
| 501 | Ga0207700_10156354 | 3300025928 | Bacteria | 1889 |
| 502 | Ga0207700_10167472 | 3300025928 | Bacteria | 1830 |
| 503 | Ga0207700_10230820 | 3300025928 | Bacteria | 1573 |
| 504 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 505 | Ga0207664_10003566 | 3300025929 | Bacteria | 10395 |
| 506 | Ga0207664_10026922 | 3300025929 | Bacteria | 4352 |
| 507 | Ga0207664_10070400 | 3300025929 | Bacteria | 2815 |
| 508 | Ga0207664_10094699 | 3300025929 | Bacteria | 2455 |
| 509 | Ga0207664_10180496 | 3300025929 | Unclassified | 1812 |
| 510 | Ga0207664_10217865 | 3300025929 | Bacteria | 1654 |
| 511 | Ga0207664_10515626 | 3300025929 | Bacteria | 1071 |
| 512 | Ga0207644_10000943 | 3300025931 | Bacteria | 18532 |
| 513 | Ga0207690_10004118 | 3300025932 | Bacteria | 8587 |
| 514 | Ga0207690_10005318 | 3300025932 | Bacteria | 7588 |
| 515 | Ga0207690_10036488 | 3300025932 | Unclassified | 3184 |
| 516 | Ga0207706_10001048 | 3300025933 | Bacteria | 28070 |
| 517 | Ga0207706_10018561 | 3300025933 | Bacteria | 6258 |
| 518 | Ga0207706_10033180 | 3300025933 | Bacteria | 4595 |
| 519 | Ga0207670_10093157 | 3300025936 | Bacteria | 2134 |
| 520 | Ga0207669_10186497 | 3300025937 | Bacteria | 1492 |
| 521 | Ga0207704_10258083 | 3300025938 | Bacteria | 1312 |
| 522 | Ga0207665_10004168 | 3300025939 | Bacteria | 9622 |
| 523 | Ga0207665_10007991 | 3300025939 | Bacteria | 6981 |
| 524 | Ga0207665_10014309 | 3300025939 | Bacteria | 5224 |
| 525 | Ga0207665_10031181 | 3300025939 | Bacteria | 3527 |
| 526 | Ga0207665_10055876 | 3300025939 | Bacteria | 2664 |
| 527 | Ga0207665_10056572 | 3300025939 | Bacteria | 2648 |
| 528 | Ga0207665_10123793 | 3300025939 | Bacteria | 1829 |
| 529 | Ga0207711_10003722 | 3300025941 | Bacteria | 13145 |
| 530 | Ga0207711_10032600 | 3300025941 | Bacteria | 4405 |
| 531 | Ga0207711_10619967 | 3300025941 | Bacteria | 1009 |
| 532 | Ga0207711_10636638 | 3300025941 | Bacteria | 995 |
| 533 | Ga0207689_10000243 | 3300025942 | Bacteria | 48629 |
| 534 | Ga0207689_10022237 | 3300025942 | Bacteria | 5332 |
| 535 | Ga0207661_10051136 | 3300025944 | Bacteria | 3296 |
| 536 | Ga0207661_10090597 | 3300025944 | Bacteria | 2546 |
| 537 | Ga0207661_10096643 | 3300025944 | Bacteria | 2472 |
| 538 | Ga0207661_10140099 | 3300025944 | Bacteria | 2081 |
| 539 | Ga0207679_10025685 | 3300025945 | Bacteria | 4054 |
| 540 | Ga0207679_10128412 | 3300025945 | Bacteria | 2030 |
| 541 | Ga0207679_10365973 | 3300025945 | Bacteria | 1260 |
| 542 | Ga0207679_10500008 | 3300025945 | Bacteria | 1085 |
| 543 | Ga0207679_10519179 | 3300025945 | Bacteria | 1065 |
| 544 | Ga0207667_10001480 | 3300025949 | Bacteria | 29472 |
| 545 | Ga0207667_10004114 | 3300025949 | Bacteria | 17873 |
| 546 | Ga0207667_10005233 | 3300025949 | Bacteria | 15825 |
| 547 | Ga0207667_10008217 | 3300025949 | Bacteria | 12419 |
| 548 | Ga0207667_10010107 | 3300025949 | Bacteria | 11056 |
| 549 | Ga0207667_10014135 | 3300025949 | Bacteria | 9111 |
| 550 | Ga0207667_10048429 | 3300025949 | Unclassified | 4494 |
| 551 | Ga0207667_10073882 | 3300025949 | Bacteria | 3543 |
| 552 | Ga0207667_10075774 | 3300025949 | Bacteria | 3492 |
| 553 | Ga0207667_10244851 | 3300025949 | Bacteria | 1834 |
| 554 | Ga0207667_10481399 | 3300025949 | Bacteria | 1260 |
| 555 | Ga0207667_10653084 | 3300025949 | Bacteria | 1057 |
| 556 | Ga0207651_10108484 | 3300025960 | Unclassified | 2078 |
| 557 | Ga0207712_10032530 | 3300025961 | Bacteria | 3521 |
| 558 | Ga0207668_10050734 | 3300025972 | Bacteria | 2861 |
| 559 | Ga0207640_10003317 | 3300025981 | Bacteria | 8673 |
| 560 | Ga0207640_10003895 | 3300025981 | Bacteria | 8055 |
| 561 | Ga0207640_10033201 | 3300025981 | Unclassified | 3209 |
| 562 | Ga0207640_10046969 | 3300025981 | Bacteria | 2782 |
| 563 | Ga0207640_10100116 | 3300025981 | Bacteria | 2030 |
| 564 | Ga0207658_10013363 | 3300025986 | Bacteria | 5607 |
| 565 | Ga0207658_10069109 | 3300025986 | Bacteria | 2667 |
| 566 | Ga0207677_10056140 | 3300026023 | Bacteria | 2696 |
| 567 | Ga0207677_10058004 | 3300026023 | Unclassified | 2663 |
| 568 | Ga0207677_10168808 | 3300026023 | Bacteria | 1708 |
| 569 | Ga0207677_10266462 | 3300026023 | Bacteria | 1399 |
| 570 | Ga0207703_10001248 | 3300026035 | Bacteria | 23840 |
| 571 | Ga0207703_10024876 | 3300026035 | Bacteria | 4712 |
| 572 | Ga0207639_10000062 | 3300026041 | Bacteria | 107537 |
| 573 | Ga0207639_10122040 | 3300026041 | Bacteria | 2142 |
| 574 | Ga0207639_10203418 | 3300026041 | Bacteria | 1700 |
| 575 | Ga0207639_10233355 | 3300026041 | Bacteria | 1596 |
| 576 | Ga0207639_10306173 | 3300026041 | Bacteria | 1406 |
| 577 | Ga0207678_10000117 | 3300026067 | Bacteria | 65678 |
| 578 | Ga0207678_10002336 | 3300026067 | Bacteria | 17192 |
| 579 | Ga0207678_10007354 | 3300026067 | Bacteria | 9751 |
| 580 | Ga0207708_10106715 | 3300026075 | Bacteria | 2172 |
| 581 | Ga0207702_10000304 | 3300026078 | Bacteria | 56789 |
| 582 | Ga0207702_10004014 | 3300026078 | Bacteria | 13222 |
| 583 | Ga0207702_10005038 | 3300026078 | Bacteria | 11606 |
| 584 | Ga0207702_10017516 | 3300026078 | Bacteria | 5926 |
| 585 | Ga0207702_10046400 | 3300026078 | Bacteria | 3657 |
| 586 | Ga0207702_10063930 | 3300026078 | Bacteria | 3148 |
| 587 | Ga0207702_10067992 | 3300026078 | Bacteria | 3060 |
| 588 | Ga0207702_10092231 | 3300026078 | Bacteria | 2654 |
| 589 | Ga0207702_10230119 | 3300026078 | Bacteria | 1732 |
| 590 | Ga0207702_10490282 | 3300026078 | Unclassified | 1197 |
| 591 | Ga0207641_10012957 | 3300026088 | Bacteria | 6841 |
| 592 | Ga0207641_10024083 | 3300026088 | Bacteria | 5017 |
| 593 | Ga0207641_10052269 | 3300026088 | Bacteria | 3460 |
| 594 | Ga0207641_10195449 | 3300026088 | Bacteria | 1862 |
| 595 | Ga0207648_10008290 | 3300026089 | Bacteria | 10092 |
| 596 | Ga0207648_10350308 | 3300026089 | Bacteria | 1331 |
| 597 | Ga0207676_10056512 | 3300026095 | Bacteria | 3086 |
| 598 | Ga0207674_10000086 | 3300026116 | Bacteria | 100722 |
| 599 | Ga0207674_10010026 | 3300026116 | Bacteria | 10781 |
| 600 | Ga0207674_10013159 | 3300026116 | Bacteria | 9207 |
| 601 | Ga0207674_10332803 | 3300026116 | Bacteria | 1468 |
| 602 | Ga0207674_10363188 | 3300026116 | Bacteria | 1399 |
| 603 | Ga0207675_100030664 | 3300026118 | Bacteria | 5008 |
| 604 | Ga0207683_10003887 | 3300026121 | Bacteria | 12956 |
| 605 | Ga0207698_10000021 | 3300026142 | Bacteria | 133280 |
| 606 | Ga0207698_10000799 | 3300026142 | Bacteria | 18282 |
| 607 | Ga0207698_10039351 | 3300026142 | Unclassified | 3502 |
| 608 | Ga0207698_10065160 | 3300026142 | Unclassified | 2860 |
| 609 | Ga0207698_10697203 | 3300026142 | Bacteria | 1010 |
| 610 | Ga0209179_1019456 | 3300027512 | Bacteria | 1308 |
| 611 | Ga0209588_1019317 | 3300027671 | Bacteria | 2126 |
| 612 | Ga0265354_1004051 | 3300028016 | Bacteria | 1574 |
| 613 | Ga0265356_1005491 | 3300028017 | Bacteria | 1510 |
| 614 | Ga0265357_1004502 | 3300028023 | Bacteria | 1261 |
| 615 | Ga0268266_10161473 | 3300028379 | Bacteria | 2028 |
| 616 | Ga0268266_10250829 | 3300028379 | Bacteria | 1637 |
| 617 | Ga0268265_10113021 | 3300028380 | Bacteria | 2221 |
| 618 | Ga0268265_10196777 | 3300028380 | Bacteria | 1745 |
| 619 | Ga0268265_10340034 | 3300028380 | Bacteria | 1366 |
| 620 | Ga0268264_10044261 | 3300028381 | Bacteria | 3692 |
| 621 | Ga0268264_10079764 | 3300028381 | Bacteria | 2793 |
| 622 | Ga0268264_10087880 | 3300028381 | Bacteria | 2674 |
| 623 | Ga0265338_10008940 | 3300028800 | Unclassified | 12047 |
| 624 | Ga0265338_10010095 | 3300028800 | Bacteria | 11157 |
| 625 | Ga0265338_10024089 | 3300028800 | Bacteria | 6230 |
| 626 | Ga0265338_10121530 | 3300028800 | Bacteria | 2081 |
| 627 | Ga0265338_10221161 | 3300028800 | Bacteria | 1414 |
| 628 | Ga0265762_1000135 | 3300030760 | Bacteria | 11092 |
| 629 | Ga0265762_1000493 | 3300030760 | Bacteria | 6868 |
| 630 | Ga0265772_101336 | 3300030886 | Bacteria | 883 |
| 631 | Ga0265760_10001232 | 3300031090 | Bacteria | 7484 |
| 632 | Ga0265760_10003170 | 3300031090 | Bacteria | 4810 |
| 633 | Ga0265760_10005210 | 3300031090 | Bacteria | 3724 |
| 634 | Ga0265760_10014480 | 3300031090 | Bacteria | 2260 |
| 635 | Ga0265330_10000200 | 3300031235 | Bacteria | 46237 |
| 636 | Ga0265330_10012866 | 3300031235 | Bacteria | 3906 |
| 637 | Ga0265320_10046395 | 3300031240 | Bacteria | 2130 |
| 638 | Ga0265325_10001396 | 3300031241 | Bacteria | 17040 |
| 639 | Ga0265325_10050789 | 3300031241 | Bacteria | 2134 |
| 640 | Ga0265325_10081220 | 3300031241 | Bacteria | 1611 |
| 641 | Ga0265340_10041307 | 3300031247 | Bacteria | 2268 |
| 642 | Ga0265340_10084905 | 3300031247 | Bacteria | 1486 |
| 643 | Ga0265339_10003570 | 3300031249 | Bacteria | 10873 |
| 644 | Ga0265339_10024296 | 3300031249 | Bacteria | 3494 |
| 645 | Ga0265339_10164832 | 3300031249 | Bacteria | 1113 |
| 646 | Ga0265339_10199751 | 3300031249 | Bacteria | 987 |
| 647 | Ga0265316_10003072 | 3300031344 | Bacteria | 17028 |
| 648 | Ga0265316_10006425 | 3300031344 | Bacteria | 11232 |
| 649 | Ga0265316_10011160 | 3300031344 | Bacteria | 8128 |
| 650 | Ga0265316_10014543 | 3300031344 | Bacteria | 6918 |
| 651 | Ga0265316_10033235 | 3300031344 | Bacteria | 4203 |
| 652 | Ga0265316_10075255 | 3300031344 | Bacteria | 2597 |
| 653 | Ga0265316_10263437 | 3300031344 | Bacteria | 1263 |
| 654 | Ga0265316_10301007 | 3300031344 | Bacteria | 1168 |
| 655 | Ga0307408_100039575 | 3300031548 | Bacteria | 3333 |
| 656 | Ga0265313_10004821 | 3300031595 | Bacteria | 10143 |
| 657 | Ga0265313_10010804 | 3300031595 | Bacteria | 5734 |
| 658 | Ga0265313_10095187 | 3300031595 | Unclassified | 1330 |
| 659 | Ga0265313_10105684 | 3300031595 | Bacteria | 1244 |
| 660 | Ga0265314_10004409 | 3300031711 | Bacteria | 13066 |
| 661 | Ga0265342_10004197 | 3300031712 | Bacteria | 11455 |
| 662 | Ga0265342_10011907 | 3300031712 | Bacteria | 5918 |
| 663 | Ga0265342_10083118 | 3300031712 | Unclassified | 1846 |
| 664 | Ga0316576_10147291 | 3300031727 | Bacteria | 1774 |
| 665 | Ga0316576_10199343 | 3300031727 | Bacteria | 1508 |
| 666 | Ga0307413_10007857 | 3300031824 | Bacteria | 4990 |
| 667 | Ga0307412_10122539 | 3300031911 | Bacteria | 1874 |
| 668 | Ga0307412_10155302 | 3300031911 | Bacteria | 1693 |
| 669 | Ga0307409_100125174 | 3300031995 | Bacteria | 2185 |
| 670 | Ga0307409_100193369 | 3300031995 | Bacteria | 1813 |
| 671 | Ga0307415_100343945 | 3300032126 | Bacteria | 1253 |
| 672 | Ga0373930_0031960 | 3300034816 | Bacteria | 1087 |
| 673 | Ga0373926_0007073 | 3300035083 | Bacteria | 3735 |
| 674 | Ga0373934_0009124 | 3300035086 | Bacteria | 3711 |
| 675 | Ga0373940_0025718 | 3300035088 | Bacteria | 1535 |
| 676 | Ga0373951_0050065 | 3300035091 | Bacteria | 1026 |
| 677 | Ga0373923_0048549 | 3300035111 | Bacteria | 1773 |
| 678 | Ga0373923_0050019 | 3300035111 | Bacteria | 1749 |
| 679 | Ga0373923_0149494 | 3300035111 | Bacteria | 1060 |
| 680 | Ga0373936_0009985 | 3300035113 | Bacteria | 3583 |
| 681 | Ga0373945_0007386 | 3300035116 | Bacteria | 3562 |
| 682 | Ga0373945_0015700 | 3300035116 | Bacteria | 2551 |
| 683 | Ga0373953_0037907 | 3300035117 | Bacteria | 1904 |
| 684 | Ga0373956_0117980 | 3300035119 | Bacteria | 1238 |
| 685 | Ga0373956_0214067 | 3300035119 | Bacteria | 914 |
| 686 | Ga0373957_0014975 | 3300035120 | Bacteria | 2660 |
| 687 | Ga0373943_0000004 | 3300035170 | Bacteria | 99386 |
| 688 | Ga0373943_0115830 | 3300035170 | Bacteria | 1419 |
| 689 | Ga0373946_0013086 | 3300035171 | Bacteria | 3113 |
| 690 | Ga0373955_0312728 | 3300035172 | Bacteria | 948 |
| 691 | Ga0373931_0052696 | 3300035691 | Bacteria | 2170 |
| 692 | Ga0373931_0168334 | 3300035691 | Bacteria | 1289 |
| 693 | Ga0373931_0380385 | 3300035691 | Bacteria | 890 |
| 694 | Ga0373935_0006337 | 3300035692 | Bacteria | 7055 |
| 695 | Ga0373935_0367165 | 3300035692 | Bacteria | 1029 |
| 696 | Ga0373935_0414977 | 3300035692 | Bacteria | 968 |
| 697 | Ga0373927_0010374 | 3300035695 | Bacteria | 6217 |
| 698 | Ga0373933_0113173 | 3300035724 | Bacteria | 1694 |
| 699 | Ga0373947_0001184 | 3300035725 | Bacteria | 16054 |
| 700 | Ga0373947_0235697 | 3300035725 | Bacteria | 1206 |
| 701 | Ga0373947_0361820 | 3300035725 | Bacteria | 974 |
| 702 | Ga0373937_0016470 | 3300036401 | Bacteria | 6566 |
| 703 | Ga0373937_0087124 | 3300036401 | Bacteria | 2890 |
| 704 | Ga0373937_0268263 | 3300036401 | Bacteria | 1611 |
| 705 | Ga0373937_0688243 | 3300036401 | Unclassified | 969 |
| 706 | Ga0373925_0001518 | 3300037068 | Bacteria | 19835 |
| 707 | Ga0395899_0036439 | 3300037312 | Bacteria | 3690 |
| 708 | Ga0395899_0040972 | 3300037312 | Bacteria | 3462 |
| 709 | Ga0395900_0000764 | 3300037418 | Bacteria | 42836 |
| 710 | Ga0395900_0013397 | 3300037418 | Bacteria | 8378 |
| 711 | Ga0395900_0018930 | 3300037418 | Bacteria | 7022 |
| 712 | Ga0395900_0030978 | 3300037418 | Bacteria | 5494 |
| 713 | Ga0395900_0124278 | 3300037418 | Bacteria | 2646 |
| 714 | Ga0395900_0167309 | 3300037418 | Bacteria | 2240 |
| 715 | Ga0395900_0211620 | 3300037418 | Bacteria | 1957 |
| 716 | Ga0395900_0291530 | 3300037418 | Unclassified | 1620 |
| 717 | Ga0395900_0316182 | 3300037418 | Bacteria | 1543 |
| 718 | Ga0395898_0025349 | 3300037466 | Bacteria | 5976 |
| 719 | Ga0395898_0131765 | 3300037466 | Bacteria | 2394 |
| 720 | Ga0395898_0253144 | 3300037466 | Bacteria | 1679 |
| 721 | Ga0395898_0276736 | 3300037466 | Unclassified | 1601 |
| 722 | Ga0395905_0004670 | 3300037471 | Bacteria | 14159 |
| 723 | Ga0395905_0007858 | 3300037471 | Bacteria | 10565 |
| 724 | Ga0395905_0027401 | 3300037471 | Bacteria | 5374 |
| 725 | Ga0395905_0134826 | 3300037471 | Bacteria | 2322 |
| 726 | Ga0395905_0178517 | 3300037471 | Bacteria | 1993 |
| 727 | Ga0395905_0189223 | 3300037471 | Bacteria | 1931 |
| 728 | Ga0395905_0242098 | 3300037471 | Bacteria | 1685 |
| 729 | Ga0436364_1006193 | 3300037853 | Bacteria | 4668 |
| 730 | Ga0395901_0028944 | 3300038443 | Bacteria | 5700 |
| 731 | Ga0395901_0043639 | 3300038443 | Bacteria | 4650 |
| 732 | Ga0395901_0068007 | 3300038443 | Bacteria | 3711 |
| 733 | Ga0395901_0100565 | 3300038443 | Bacteria | 3033 |
| 734 | Ga0395901_0149508 | 3300038443 | Bacteria | 2454 |
| 735 | Ga0395901_0358070 | 3300038443 | Bacteria | 1505 |
| 736 | Ga0395901_0425571 | 3300038443 | Bacteria | 1361 |
| 737 | Ga0436365_1239626 | 3300039437 | Bacteria | 10589 |
| 738 | Ga0436360_0113684 | 3300039438 | Bacteria | 2066 |
| 739 | Ga0436363_0408258 | 3300039450 | Bacteria | 3019 |
| 740 | Ga0436363_1660949 | 3300039450 | Unclassified | 1542 |
| 741 | Ga0451577_0000102 | 3300042876 | Bacteria | 188094 |
| 742 | Ga0451577_0000758 | 3300042876 | Bacteria | 49236 |
| 743 | Ga0466969_0048327 | 3300044656 | Unclassified | 2104 |
| 744 | Ga0466966_0000039 | 3300044684 | Bacteria | 97202 |
| 745 | Ga0466966_0238059 | 3300044684 | Bacteria | 1098 |
| 746 | Ga0466961_0039462 | 3300044693 | Bacteria | 3027 |
| 747 | Ga0466963_0003335 | 3300044694 | Bacteria | 9158 |
| 748 | Ga0466963_0014927 | 3300044694 | Bacteria | 4800 |
| 749 | Ga0453684_0000249 | 3300044712 | Bacteria | 232232 |
| 750 | Ga0453684_0001768 | 3300044712 | Bacteria | 57666 |
| 751 | Ga0453684_0015369 | 3300044712 | Bacteria | 12118 |
| 752 | Ga0466959_0146276 | 3300045049 | Bacteria | 1667 |
| 753 | Ga0451576_0000071 | 3300045051 | Bacteria | 258795 |
| 754 | Ga0451576_0000451 | 3300045051 | Bacteria | 93335 |
| 755 | Ga0466958_0436706 | 3300045836 | Bacteria | 847 |
| 756 | Ga0466967_0103815 | 3300045976 | Bacteria | 2601 |
| 757 | Ga0466967_0182182 | 3300045976 | Bacteria | 1982 |
| 758 | Ga0466967_0303648 | 3300045976 | Bacteria | 1536 |
| 759 | Ga0495603_0058355 | 3300046455 | Unclassified | 2282 |
| 760 | Ga0495629_0130326 | 3300046459 | Bacteria | 1752 |
| 761 | Ga0495629_0319898 | 3300046459 | Bacteria | 1061 |
| 762 | Ga0495651_0143372 | 3300046462 | Bacteria | 1730 |
| 763 | Ga0495653_0198724 | 3300046463 | Bacteria | 1362 |
| 764 | Ga0495580_0000352 | 3300046472 | Bacteria | 37485 |
| 765 | Ga0495580_0011121 | 3300046472 | Bacteria | 6975 |
| 766 | Ga0495580_0030883 | 3300046472 | Bacteria | 3875 |
| 767 | Ga0495580_0063992 | 3300046472 | Bacteria | 2579 |
| 768 | Ga0495580_0106809 | 3300046472 | Bacteria | 1944 |
| 769 | Ga0495580_0259736 | 3300046472 | Bacteria | 1188 |
| 770 | Ga0495582_0092814 | 3300046473 | Bacteria | 1684 |
| 771 | Ga0495662_0144820 | 3300046476 | Bacteria | 1170 |
| 772 | Ga0495594_0048721 | 3300046499 | Bacteria | 2328 |
| 773 | Ga0495628_0143255 | 3300046516 | Bacteria | 1823 |
| 774 | Ga0495667_0348934 | 3300046559 | Bacteria | 935 |
| 775 | Ga0495635_0264294 | 3300046663 | Bacteria | 1158 |
| 776 | Ga0495659_0085098 | 3300046664 | Bacteria | 1206 |
| 777 | Ga0495588_0123053 | 3300046674 | Bacteria | 1368 |
| 778 | Ga0495588_0140012 | 3300046674 | Bacteria | 1278 |
| 779 | Ga0495646_0129182 | 3300046680 | Bacteria | 1424 |
| 780 | Ga0495613_0262829 | 3300046689 | Bacteria | 1202 |
| 781 | Ga0495624_0029496 | 3300046690 | Bacteria | 3579 |
| 782 | Ga0495600_0087327 | 3300046809 | Bacteria | 2035 |
| 783 | Ga0495581_0072705 | 3300047315 | Bacteria | 1990 |
| 784 | Ga0495604_0028109 | 3300047317 | Unclassified | 4474 |
| 785 | Ga0495674_0004509 | 3300047319 | Bacteria | 13393 |
| 786 | Ga0495674_0396468 | 3300047319 | Bacteria | 1115 |
| 787 | Ga0495675_0030402 | 3300047444 | Unclassified | 3446 |
| 788 | Ga0495677_0028301 | 3300047445 | Bacteria | 2035 |
| 789 | Ga0495602_0212523 | 3300048088 | Bacteria | 1467 |
| 790 | Ga0495602_0301657 | 3300048088 | Unclassified | 1172 |
| 791 | Ga0495602_0363687 | 3300048088 | Bacteria | 1041 |
| 792 | Ga0496100_0048284 | 3300048903 | Bacteria | 2747 |
| 793 | Ga0496100_0117059 | 3300048903 | Bacteria | 1860 |
| 794 | Ga0496100_0154033 | 3300048903 | Bacteria | 1642 |
| 795 | Ga0496100_0484298 | 3300048903 | Bacteria | 952 |
| 796 | Ga0496102_0003924 | 3300048905 | Bacteria | 12594 |
| 797 | Ga0496102_0035557 | 3300048905 | Bacteria | 4485 |
| 798 | Ga0496102_0405424 | 3300048905 | Bacteria | 1281 |
| 799 | Ga0496103_0001542 | 3300048906 | Bacteria | 15338 |
| 800 | Ga0496103_0132710 | 3300048906 | Bacteria | 1591 |
| 801 | Ga0496104_0005846 | 3300048907 | Bacteria | 10775 |
| 802 | Ga0496104_0382380 | 3300048907 | Bacteria | 1320 |
| 803 | Ga0496104_0448972 | 3300048907 | Bacteria | 1201 |
| 804 | Ga0496104_0687196 | 3300048907 | Bacteria | 931 |
| 805 | Ga0496105_0062047 | 3300048908 | Bacteria | 3085 |
| 806 | Ga0496106_0055917 | 3300048909 | Bacteria | 2983 |
| 807 | Ga0496106_0175937 | 3300048909 | Unclassified | 1698 |
| 808 | Ga0496107_0034480 | 3300048910 | Bacteria | 3626 |
| 809 | Ga0496107_0145890 | 3300048910 | Bacteria | 1750 |
| 810 | Ga0496107_0409060 | 3300048910 | Bacteria | 1009 |
| 811 | Ga0496109_0034833 | 3300048912 | Bacteria | 4538 |
| 812 | Ga0496110_0147904 | 3300048913 | Bacteria | 2126 |
| 813 | Ga0496112_0008629 | 3300048915 | Bacteria | 9137 |
| 814 | Ga0496112_0045517 | 3300048915 | Unclassified | 4301 |
| 815 | Ga0496112_0077138 | 3300048915 | Bacteria | 3295 |
| 816 | Ga0496113_0098519 | 3300048916 | Bacteria | 2263 |
| 817 | Ga0496114_0173249 | 3300048917 | Bacteria | 1881 |
| 818 | Ga0496114_0190962 | 3300048917 | Bacteria | 1792 |
| 819 | Ga0496115_0038573 | 3300048918 | Bacteria | 3791 |
| 820 | Ga0496115_0042940 | 3300048918 | Bacteria | 3604 |
| 821 | Ga0496115_0083186 | 3300048918 | Bacteria | 2609 |
| 822 | Ga0496115_0198270 | 3300048918 | Bacteria | 1658 |
| 823 | Ga0501070_0569789 | 3300049586 | Bacteria | 905 |
| 824 | Ga0501083_0017521 | 3300049744 | Unclassified | 4994 |
| 825 | nmdc:mga05p37_302442_c1 | 3300050507 | Bacteria | 1900 |
| 826 | nmdc:mga05p37_392690_c1 | 3300050507 | Bacteria | 1622 |
| 827 | nmdc:mga05p37_727240_c1 | 3300050507 | Bacteria | 1098 |
| 828 | nmdc:mga0n895_28133_c1 | 3300050512 | Bacteria | 5347 |
| 829 | nmdc:mga0n895_3709_c1 | 3300050512 | Bacteria | 12351 |
| 830 | nmdc:mga0rr50_512_c1 | 3300050513 | Bacteria | 20696 |
| 831 | nmdc:mga0rr50_75769_c1 | 3300050513 | Unclassified | 2580 |
| 832 | nmdc:mga08x19_8839_c1 | 3300050514 | Bacteria | 6009 |
| 833 | nmdc:mga0a205_1566_c1 | 3300050515 | Bacteria | 19595 |
| 834 | Ga0500590_000958 | 3300053148 | Bacteria | 11123 |
| 835 | Ga0466969_0053402 | |||
| 836 | MBSR1b_contig_11028726 | |||
| 837 | MBSR1b_contig_6310719 | |||
| 838 | LJNas_1000003 | |||
| 839 | JGI24736J21556_1001478 | |||
| 840 | JGI24740J21852_10024048 | |||
| 841 | JGI24737J22298_10002529 | |||
| 842 | rootH1_10040856 | |||
| 843 | Ga0058863_10141147 | |||
| 844 | Ga0065712_10169954 | |||
| 845 | Ga0065712_10214995 | |||
| 846 | Ga0065715_10003513 | |||
| 847 | Ga0065715_10218654 | |||
| 848 | Ga0070658_10010319 | |||
| 849 | Ga0070658_10036934 | |||
| 850 | Ga0070658_10057738 | |||
| 851 | Ga0070658_10085673 | |||
| 852 | Ga0070676_10239571 | |||
| 853 | Ga0070683_100035957 | |||
| 854 | Ga0070683_100038958 | |||
| 855 | Ga0070690_100011511 | |||
| 856 | Ga0070670_100025213 | |||
| 857 | Ga0070670_100386742 | |||
| 858 | Ga0068869_100003182 | |||
| 859 | Ga0068869_100165445 | |||
| 860 | Ga0070666_10004558 | |||
| 861 | Ga0070666_10129025 | |||
| 862 | Ga0070680_100290970 | |||
| 863 | Ga0070682_100082814 | |||
| 864 | Ga0070682_100157481 | |||
| 865 | Ga0068868_100004977 | |||
| 866 | Ga0068868_100029819 | |||
| 867 | Ga0068868_100057463 | |||
| 868 | Ga0068868_100136349 | |||
| 869 | Ga0070660_100000156 | |||
| 870 | Ga0070660_100144403 | |||
| 871 | Ga0070660_100375985 | |||
| 872 | Ga0070661_100017772 | |||
| 873 | Ga0070661_100024803 | |||
| 874 | Ga0070661_100056754 | |||
| 875 | Ga0070661_100174029 | |||
| 876 | Ga0070692_10232105 | |||
| 877 | Ga0070668_100040827 | |||
| 878 | Ga0070669_100036383 | |||
| 879 | Ga0070671_100000051 | |||
| 880 | Ga0070671_100044507 | |||
| 881 | Ga0070671_100086827 | |||
| 882 | Ga0070674_100074020 | |||
| 883 | Ga0070673_100021217 | |||
| 884 | Ga0070673_100354207 | |||
| 885 | Ga0070659_100007568 | |||
| 886 | Ga0070659_100397881 | |||
| 887 | Ga0070667_100017241 | |||
| 888 | Ga0070667_100373046 | |||
| 889 | Ga0070709_10041959 | |||
| 890 | Ga0070709_10267247 | |||
| 891 | Ga0070714_100045019 | |||
| 892 | Ga0070714_100077195 | |||
| 893 | Ga0070714_100100166 | |||
| 894 | Ga0070714_100149087 | |||
| 895 | Ga0070714_100160428 | |||
| 896 | Ga0070714_100338505 | |||
| 897 | Ga0070713_100000438 | |||
| 898 | Ga0070713_100001915 | |||
| 899 | Ga0070713_100003381 | |||
| 900 | Ga0070713_100005207 | |||
| 901 | Ga0070713_100033340 | |||
| 902 | Ga0070713_100141469 | |||
| 903 | Ga0070713_100191931 | |||
| 904 | Ga0070713_100197188 | |||
| 905 | Ga0070710_10007915 | |||
| 906 | Ga0070710_10008713 | |||
| 907 | Ga0070710_10023148 | |||
| 908 | Ga0070711_100009670 | |||
| 909 | Ga0070711_100018718 | |||
| 910 | Ga0070711_100123271 | |||
| 911 | Ga0070711_100366090 | |||
| 912 | Ga0070708_100002318 | |||
| 913 | Ga0070708_100007153 | |||
| 914 | Ga0070708_100017296 | |||
| 915 | Ga0070708_100049293 | |||
| 916 | Ga0070708_100065072 | |||
| 917 | Ga0070708_100149239 | |||
| 918 | Ga0070708_100245598 | |||
| 919 | Ga0070708_100393676 | |||
| 920 | Ga0070708_100453416 | |||
| 921 | Ga0070663_100001977 | |||
| 922 | Ga0070663_100017943 | |||
| 923 | Ga0070663_100019093 | |||
| 924 | Ga0070678_100001121 | |||
| 925 | Ga0070662_100003695 | |||
| 926 | Ga0070662_100014257 | |||
| 927 | Ga0070662_100064711 | |||
| 928 | Ga0070681_10000642 | |||
| 929 | Ga0070681_10203092 | |||
| 930 | Ga0070681_10291956 | |||
| 931 | Ga0068867_100013158 | |||
| 932 | Ga0070685_10159780 | |||
| 933 | Ga0070706_100002917 | |||
| 934 | Ga0070706_100003337 | |||
| 935 | Ga0070706_100118289 | |||
| 936 | Ga0070707_100008344 | |||
| 937 | Ga0070707_100031608 | |||
| 938 | Ga0070707_100042974 | |||
| 939 | Ga0070698_100000846 | |||
| 940 | Ga0070698_100006156 | |||
| 941 | Ga0070699_100001679 | |||
| 942 | Ga0070699_100030648 | |||
| 943 | Ga0070699_100034627 | |||
| 944 | Ga0070699_100285582 | |||
| 945 | Ga0070679_100021761 | |||
| 946 | Ga0070679_100051046 | |||
| 947 | Ga0070679_100091708 | |||
| 948 | Ga0070679_100415146 | |||
| 949 | Ga0070684_100010075 | |||
| 950 | Ga0070684_100137088 | |||
| 951 | Ga0070684_100245867 | |||
| 952 | Ga0070684_100688410 | |||
| 953 | Ga0070684_100690676 | |||
| 954 | Ga0070697_100001267 | |||
| 955 | Ga0070697_100001538 | |||
| 956 | Ga0070697_100182138 | |||
| 957 | Ga0068853_100000214 | |||
| 958 | Ga0068853_100062512 | |||
| 959 | Ga0068853_100107498 | |||
| 960 | Ga0068853_100140132 | |||
| 961 | Ga0070672_100039518 | |||
| 962 | Ga0070672_100287244 | |||
| 963 | Ga0070686_100003290 | |||
| 964 | Ga0070695_100048709 | |||
| 965 | Ga0070696_100158473 | |||
| 966 | Ga0070693_100014773 | |||
| 967 | Ga0070665_100006906 | |||
| 968 | Ga0070665_100293915 | |||
| 969 | Ga0070665_100782307 | |||
| 970 | Ga0068855_100002185 | |||
| 971 | Ga0068855_100002738 | |||
| 972 | Ga0068855_100003286 | |||
| 973 | Ga0068855_100004246 | |||
| 974 | Ga0068855_100004580 | |||
| 975 | Ga0068855_100006613 | |||
| 976 | Ga0068855_100089171 | |||
| 977 | Ga0068855_100226422 | |||
| 978 | Ga0068855_100413986 | |||
| 979 | Ga0068855_100630188 | |||
| 980 | Ga0068855_100775068 | |||
| 981 | Ga0070664_100010879 | |||
| 982 | Ga0070664_100013802 | |||
| 983 | Ga0070664_100078335 | |||
| 984 | Ga0070664_100264969 | |||
| 985 | Ga0070664_100288242 | |||
| 986 | Ga0070664_100600913 | |||
| 987 | Ga0068857_100007967 | |||
| 988 | Ga0068857_100023696 | |||
| 989 | Ga0068857_100037341 | |||
| 990 | Ga0068857_100110146 | |||
| 991 | Ga0068854_100010340 | |||
| 992 | Ga0068854_100012942 | |||
| 993 | Ga0068854_100017644 | |||
| 994 | Ga0068854_100019294 | |||
| 995 | Ga0068856_100000269 | |||
| 996 | Ga0068856_100006429 | |||
| 997 | Ga0068856_100020381 | |||
| 998 | Ga0068856_100039823 | |||
| 999 | Ga0068856_100056622 | |||
| 1000 | Ga0068856_100058291 | |||
| 1001 | Ga0068856_100062601 | |||
| 1002 | Ga0068856_100154825 | |||
| 1003 | Ga0068856_100192309 | |||
| 1004 | Ga0068856_100296253 | |||
| 1005 | Ga0068856_100363856 | |||
| 1006 | Ga0068856_100644905 | |||
| 1007 | Ga0068856_100851378 | |||
| 1008 | Ga0068852_100000025 | |||
| 1009 | Ga0068852_100000053 | |||
| 1010 | Ga0068852_100023014 | |||
| 1011 | Ga0068852_100291836 | |||
| 1012 | Ga0068852_100389176 | |||
| 1013 | Ga0068852_100900191 | |||
| 1014 | Ga0068859_100026135 | |||
| 1015 | Ga0068859_100030073 | |||
| 1016 | Ga0068866_10028614 | |||
| 1017 | Ga0068861_100115421 | |||
| 1018 | Ga0068851_10001003 | |||
| 1019 | Ga0068851_10102345 | |||
| 1020 | Ga0068863_100003429 | |||
| 1021 | Ga0068863_100032007 | |||
| 1022 | Ga0068863_100089517 | |||
| 1023 | Ga0068863_100269145 | |||
| 1024 | Ga0068863_100545457 | |||
| 1025 | Ga0068858_100005999 | |||
| 1026 | Ga0068858_100359711 | |||
| 1027 | Ga0068860_100011963 | |||
| 1028 | Ga0068862_100075967 | |||
| 1029 | Ga0068862_100204316 | |||
| 1030 | Ga0068862_100303259 | |||
| 1031 | Ga0070717_10000968 | |||
| 1032 | Ga0070717_10002643 | |||
| 1033 | Ga0070717_10003289 | |||
| 1034 | Ga0070717_10010243 | |||
| 1035 | Ga0070717_10022983 | |||
| 1036 | Ga0070717_10033413 | |||
| 1037 | Ga0070717_10033453 | |||
| 1038 | Ga0070717_10158855 | |||
| 1039 | Ga0070717_10186875 | |||
| 1040 | Ga0070717_10217911 | |||
| 1041 | Ga0070716_100024518 | |||
| 1042 | Ga0070716_100051894 | |||
| 1043 | Ga0070716_100227142 | |||
| 1044 | Ga0070716_100236985 | |||
| 1045 | Ga0070712_100000076 | |||
| 1046 | Ga0070712_100001666 | |||
| 1047 | Ga0070712_100026618 | |||
| 1048 | Ga0070712_100057563 | |||
| 1049 | Ga0075366_10014843 | |||
| 1050 | Ga0097621_100005067 | |||
| 1051 | Ga0097621_100005779 | |||
| 1052 | Ga0097621_100031803 | |||
| 1053 | Ga0097621_100034951 | |||
| 1054 | Ga0097621_100128835 | |||
| 1055 | Ga0097621_100225512 | |||
| 1056 | Ga0097621_100276997 | |||
| 1057 | Ga0068871_100001349 | |||
| 1058 | Ga0068871_100005807 | |||
| 1059 | Ga0068871_100041503 | |||
| 1060 | Ga0068871_100136418 | |||
| 1061 | Ga0068871_100179152 | |||
| 1062 | Ga0075434_100000139 | |||
| 1063 | Ga0075434_100006917 | |||
| 1064 | Ga0068865_100012452 | |||
| 1065 | Ga0068865_100019086 | |||
| 1066 | Ga0068865_100035469 | |||
| 1067 | Ga0068865_100532851 | |||
| 1068 | Ga0075436_100004473 | |||
| 1069 | Ga0075436_100078038 | |||
| 1070 | Ga0097620_100026135 | |||
| 1071 | Ga0097620_100030076 | |||
| 1072 | Ga0075435_100000345 | |||
| 1073 | Ga0075435_100170616 | |||
| 1074 | Ga0099795_10000530 | |||
| 1075 | Ga0105250_10099352 | |||
| 1076 | Ga0105240_10000280 | |||
| 1077 | Ga0105240_10000426 | |||
| 1078 | Ga0105240_10011959 | |||
| 1079 | Ga0105240_10013870 | |||
| 1080 | Ga0105240_10017978 | |||
| 1081 | Ga0105240_10077828 | |||
| 1082 | Ga0105240_10095986 | |||
| 1083 | Ga0105240_10117188 | |||
| 1084 | Ga0105240_10170247 | |||
| 1085 | Ga0105240_10186099 | |||
| 1086 | Ga0105240_10279231 | |||
| 1087 | Ga0105240_10436987 | |||
| 1088 | Ga0105240_10733801 | |||
| 1089 | Ga0105245_10236977 | |||
| 1090 | Ga0105247_10005296 | |||
| 1091 | Ga0105247_10068447 | |||
| 1092 | Ga0105247_10071116 | |||
| 1093 | Ga0114129_10089827 | |||
| 1094 | Ga0114129_10314506 | |||
| 1095 | Ga0105243_10076124 | |||
| 1096 | Ga0105241_10000455 | |||
| 1097 | Ga0105241_10024107 | |||
| 1098 | Ga0105241_10049786 | |||
| 1099 | Ga0105241_10052946 | |||
| 1100 | Ga0105241_10125293 | |||
| 1101 | Ga0105241_10376389 | |||
| 1102 | Ga0105242_10016004 | |||
| 1103 | Ga0105248_10009308 | |||
| 1104 | Ga0105248_10018163 | |||
| 1105 | Ga0105248_10042161 | |||
| 1106 | Ga0105248_10243071 | |||
| 1107 | Ga0105248_10639552 | |||
| 1108 | Ga0105237_10004312 | |||
| 1109 | Ga0105237_10017196 | |||
| 1110 | Ga0105237_10029965 | |||
| 1111 | Ga0105237_10114497 | |||
| 1112 | Ga0105237_10194385 | |||
| 1113 | Ga0105237_10366664 | |||
| 1114 | Ga0105237_10465866 | |||
| 1115 | Ga0105238_10000743 | |||
| 1116 | Ga0105238_10001544 | |||
| 1117 | Ga0105238_10053362 | |||
| 1118 | Ga0105238_10115481 | |||
| 1119 | Ga0105238_10152720 | |||
| 1120 | Ga0105238_10186437 | |||
| 1121 | Ga0105238_10482056 | |||
| 1122 | Ga0105249_10010391 | |||
| 1123 | Ga0105249_10049700 | |||
| 1124 | Ga0105249_10465181 | |||
| 1125 | Ga0105239_10003363 | |||
| 1126 | Ga0105239_10047535 | |||
| 1127 | Ga0105239_10123565 | |||
| 1128 | Ga0105239_10142661 | |||
| 1129 | Ga0105246_10009151 | |||
| 1130 | Ga0105246_10152779 | |||
| 1131 | Ga0105246_10177621 | |||
| 1132 | Ga0157373_10027296 | |||
| 1133 | Ga0157373_10029018 | |||
| 1134 | Ga0157373_10092749 | |||
| 1135 | Ga0157371_10005744 | |||
| 1136 | Ga0157371_10032437 | |||
| 1137 | Ga0157370_10000012 | |||
| 1138 | Ga0157370_10006522 | |||
| 1139 | Ga0157370_10023853 | |||
| 1140 | Ga0157370_10025341 | |||
| 1141 | Ga0157370_10078999 | |||
| 1142 | Ga0157370_10130965 | |||
| 1143 | Ga0157370_10227410 | |||
| 1144 | Ga0157370_10261967 | |||
| 1145 | Ga0157370_10287735 | |||
| 1146 | Ga0157370_10351006 | |||
| 1147 | Ga0157370_10411604 | |||
| 1148 | Ga0157369_10000096 | |||
| 1149 | Ga0157369_10000319 | |||
| 1150 | Ga0157369_10002552 | |||
| 1151 | Ga0157369_10002908 | |||
| 1152 | Ga0157369_10014845 | |||
| 1153 | Ga0157369_10027605 | |||
| 1154 | Ga0157369_10033662 | |||
| 1155 | Ga0157369_10047347 | |||
| 1156 | Ga0157369_10054899 | |||
| 1157 | Ga0157369_10065998 | |||
| 1158 | Ga0157369_10097690 | |||
| 1159 | Ga0157369_10111030 | |||
| 1160 | Ga0157369_10243750 | |||
| 1161 | Ga0157369_10335549 | |||
| 1162 | Ga0157369_10373139 | |||
| 1163 | Ga0157374_10000299 | |||
| 1164 | Ga0157374_10000673 | |||
| 1165 | Ga0157374_10002089 | |||
| 1166 | Ga0157374_10004674 | |||
| 1167 | Ga0157374_10006900 | |||
| 1168 | Ga0157374_10024583 | |||
| 1169 | Ga0157374_10042197 | |||
| 1170 | Ga0157374_10051437 | |||
| 1171 | Ga0157374_10270904 | |||
| 1172 | Ga0157374_10558967 | |||
| 1173 | Ga0157378_10000222 | |||
| 1174 | Ga0157378_10014888 | |||
| 1175 | Ga0157378_10018387 | |||
| 1176 | Ga0157378_10067844 | |||
| 1177 | Ga0157378_10112300 | |||
| 1178 | Ga0157378_10211624 | |||
| 1179 | Ga0157378_10351018 | |||
| 1180 | Ga0157378_10401296 | |||
| 1181 | Ga0163162_10002572 | |||
| 1182 | Ga0163162_10014711 | |||
| 1183 | Ga0163162_10026375 | |||
| 1184 | Ga0163162_10027362 | |||
| 1185 | Ga0163162_10045306 | |||
| 1186 | Ga0163162_10321937 | |||
| 1187 | Ga0163162_10461684 | |||
| 1188 | Ga0157372_10000066 | |||
| 1189 | Ga0157372_10002499 | |||
| 1190 | Ga0157372_10003262 | |||
| 1191 | Ga0157372_10007214 | |||
| 1192 | Ga0157372_10042263 | |||
| 1193 | Ga0157372_10047721 | |||
| 1194 | Ga0157372_10055584 | |||
| 1195 | Ga0157372_10056483 | |||
| 1196 | Ga0157372_10095319 | |||
| 1197 | Ga0157372_10125291 | |||
| 1198 | Ga0157372_10248091 | |||
| 1199 | Ga0157372_10408562 | |||
| 1200 | Ga0157372_10841647 | |||
| 1201 | Ga0157375_10015149 | |||
| 1202 | Ga0157375_10064677 | |||
| 1203 | Ga0157375_10518802 | |||
| 1204 | Ga0163163_10008107 | |||
| 1205 | Ga0163163_10091041 | |||
| 1206 | Ga0163163_10163387 | |||
| 1207 | Ga0163163_10318623 | |||
| 1208 | Ga0182008_10023567 | |||
| 1209 | Ga0157379_10006245 | |||
| 1210 | Ga0157379_10027234 | |||
| 1211 | Ga0157379_10027802 | |||
| 1212 | Ga0157379_10064905 | |||
| 1213 | Ga0157379_10133704 | |||
| 1214 | Ga0157379_10182066 | |||
| 1215 | Ga0157376_10008636 | |||
| 1216 | Ga0157376_10010434 | |||
| 1217 | Ga0157376_10015385 | |||
| 1218 | Ga0157376_10026102 | |||
| 1219 | Ga0157376_10034688 | |||
| 1220 | Ga0157376_10047637 | |||
| 1221 | Ga0157376_10062832 | |||
| 1222 | Ga0157376_10108218 | |||
| 1223 | Ga0157376_10127256 | |||
| 1224 | Ga0157376_10181135 | |||
| 1225 | Ga0157376_10347604 | |||
| 1226 | Ga0157376_10917442 | |||
| 1227 | Ga0163161_10472939 | |||
| 1228 | Ga0163161_10483404 | |||
| 1229 | Ga0224572_1000036 | |||
| 1230 | Ga0224572_1004457 | |||
| 1231 | Ga0228598_1000276 | |||
| 1232 | Ga0228598_1000964 | |||
| 1233 | Ga0228598_1001460 | |||
| 1234 | Ga0228598_1002102 | |||
| 1235 | Ga0228598_1004640 | |||
| 1236 | Ga0207656_10002627 | |||
| 1237 | Ga0207692_10005214 | |||
| 1238 | Ga0207692_10025718 | |||
| 1239 | Ga0207692_10051499 | |||
| 1240 | Ga0207692_10053537 | |||
| 1241 | Ga0207642_10034565 | |||
| 1242 | Ga0207710_10072841 | |||
| 1243 | Ga0207688_10055736 | |||
| 1244 | Ga0207680_10016577 | |||
| 1245 | Ga0207680_10080557 | |||
| 1246 | Ga0207680_10377498 | |||
| 1247 | Ga0207647_10005357 | |||
| 1248 | Ga0207647_10007108 | |||
| 1249 | Ga0207647_10012592 | |||
| 1250 | Ga0207647_10026994 | |||
| 1251 | Ga0207699_10000762 | |||
| 1252 | Ga0207699_10032194 | |||
| 1253 | Ga0207699_10032806 | |||
| 1254 | Ga0207699_10122215 | |||
| 1255 | Ga0207699_10258912 | |||
| 1256 | Ga0207699_10347645 | |||
| 1257 | Ga0207645_10007759 | |||
| 1258 | Ga0207705_10000067 | |||
| 1259 | Ga0207705_10004569 | |||
| 1260 | Ga0207705_10021221 | |||
| 1261 | Ga0207705_10033475 | |||
| 1262 | Ga0207705_10041229 | |||
| 1263 | Ga0207684_10001626 | |||
| 1264 | Ga0207684_10098148 | |||
| 1265 | Ga0207684_10122198 | |||
| 1266 | Ga0207654_10000451 | |||
| 1267 | Ga0207654_10002118 | |||
| 1268 | Ga0207654_10008689 | |||
| 1269 | Ga0207707_10002539 | |||
| 1270 | Ga0207707_10061973 | |||
| 1271 | Ga0207707_10175193 | |||
| 1272 | Ga0207707_10496342 | |||
| 1273 | Ga0207695_10000028 | |||
| 1274 | Ga0207695_10000899 | |||
| 1275 | Ga0207695_10012432 | |||
| 1276 | Ga0207695_10015257 | |||
| 1277 | Ga0207695_10015556 | |||
| 1278 | Ga0207695_10063286 | |||
| 1279 | Ga0207695_10077219 | |||
| 1280 | Ga0207695_10081608 | |||
| 1281 | Ga0207695_10084168 | |||
| 1282 | Ga0207695_10104802 | |||
| 1283 | Ga0207695_10201010 | |||
| 1284 | Ga0207671_10000173 | |||
| 1285 | Ga0207671_10000187 | |||
| 1286 | Ga0207671_10003219 | |||
| 1287 | Ga0207671_10144112 | |||
| 1288 | Ga0207671_10194007 | |||
| 1289 | Ga0207671_10200048 | |||
| 1290 | Ga0207671_10365357 | |||
| 1291 | Ga0207693_10000015 | |||
| 1292 | Ga0207693_10000232 | |||
| 1293 | Ga0207693_10027895 | |||
| 1294 | Ga0207693_10034822 | |||
| 1295 | Ga0207663_10002517 | |||
| 1296 | Ga0207663_10043095 | |||
| 1297 | Ga0207663_10143269 | |||
| 1298 | Ga0207663_10322241 | |||
| 1299 | Ga0207660_10013089 | |||
| 1300 | Ga0207660_10194028 | |||
| 1301 | Ga0207657_10001170 | |||
| 1302 | Ga0207657_10009293 | |||
| 1303 | Ga0207657_10037093 | |||
| 1304 | Ga0207657_10057393 | |||
| 1305 | Ga0207657_10087800 | |||
| 1306 | Ga0207649_10042591 | |||
| 1307 | Ga0207649_10060652 | |||
| 1308 | Ga0207649_10154204 | |||
| 1309 | Ga0207649_10312566 | |||
| 1310 | Ga0207652_10010692 | |||
| 1311 | Ga0207652_10061568 | |||
| 1312 | Ga0207652_10113775 | |||
| 1313 | Ga0207652_10187185 | |||
| 1314 | Ga0207646_10001190 | |||
| 1315 | Ga0207646_10081960 | |||
| 1316 | Ga0207646_10113694 | |||
| 1317 | Ga0207646_10260429 | |||
| 1318 | Ga0207646_10331680 | |||
| 1319 | Ga0207646_10591657 | |||
| 1320 | Ga0207681_10168952 | |||
| 1321 | Ga0207694_10000293 | |||
| 1322 | Ga0207694_10000619 | |||
| 1323 | Ga0207694_10094338 | |||
| 1324 | Ga0207694_10134300 | |||
| 1325 | Ga0207694_10243533 | |||
| 1326 | Ga0207650_10036436 | |||
| 1327 | Ga0207650_10080101 | |||
| 1328 | Ga0207687_10014766 | |||
| 1329 | Ga0207687_10022573 | |||
| 1330 | Ga0207700_10001032 | |||
| 1331 | Ga0207700_10002165 | |||
| 1332 | Ga0207700_10007804 | |||
| 1333 | Ga0207700_10048308 | |||
| 1334 | Ga0207700_10057268 | |||
| 1335 | Ga0207700_10156354 | |||
| 1336 | Ga0207700_10167472 | |||
| 1337 | Ga0207700_10230820 | |||
| 1338 | Ga0207664_10000087 | |||
| 1339 | Ga0207664_10003566 | |||
| 1340 | Ga0207664_10026922 | |||
| 1341 | Ga0207664_10070400 | |||
| 1342 | Ga0207664_10094699 | |||
| 1343 | Ga0207664_10180496 | |||
| 1344 | Ga0207664_10217865 | |||
| 1345 | Ga0207664_10515626 | |||
| 1346 | Ga0207644_10000943 | |||
| 1347 | Ga0207690_10004118 | |||
| 1348 | Ga0207690_10005318 | |||
| 1349 | Ga0207690_10036488 | |||
| 1350 | Ga0207706_10001048 | |||
| 1351 | Ga0207706_10018561 | |||
| 1352 | Ga0207706_10033180 | |||
| 1353 | Ga0207670_10093157 | |||
| 1354 | Ga0207669_10186497 | |||
| 1355 | Ga0207704_10258083 | |||
| 1356 | Ga0207665_10004168 | |||
| 1357 | Ga0207665_10007991 | |||
| 1358 | Ga0207665_10014309 | |||
| 1359 | Ga0207665_10031181 | |||
| 1360 | Ga0207665_10055876 | |||
| 1361 | Ga0207665_10056572 | |||
| 1362 | Ga0207665_10123793 | |||
| 1363 | Ga0207711_10003722 | |||
| 1364 | Ga0207711_10032600 | |||
| 1365 | Ga0207711_10619967 | |||
| 1366 | Ga0207711_10636638 | |||
| 1367 | Ga0207689_10000243 | |||
| 1368 | Ga0207689_10022237 | |||
| 1369 | Ga0207661_10051136 | |||
| 1370 | Ga0207661_10090597 | |||
| 1371 | Ga0207661_10096643 | |||
| 1372 | Ga0207661_10140099 | |||
| 1373 | Ga0207679_10025685 | |||
| 1374 | Ga0207679_10128412 | |||
| 1375 | Ga0207679_10365973 | |||
| 1376 | Ga0207679_10500008 | |||
| 1377 | Ga0207679_10519179 | |||
| 1378 | Ga0207667_10001480 | |||
| 1379 | Ga0207667_10004114 | |||
| 1380 | Ga0207667_10005233 | |||
| 1381 | Ga0207667_10008217 | |||
| 1382 | Ga0207667_10010107 | |||
| 1383 | Ga0207667_10014135 | |||
| 1384 | Ga0207667_10048429 | |||
| 1385 | Ga0207667_10073882 | |||
| 1386 | Ga0207667_10075774 | |||
| 1387 | Ga0207667_10244851 | |||
| 1388 | Ga0207667_10481399 | |||
| 1389 | Ga0207667_10653084 | |||
| 1390 | Ga0207651_10108484 | |||
| 1391 | Ga0207712_10032530 | |||
| 1392 | Ga0207668_10050734 | |||
| 1393 | Ga0207640_10003317 | |||
| 1394 | Ga0207640_10003895 | |||
| 1395 | Ga0207640_10033201 | |||
| 1396 | Ga0207640_10046969 | |||
| 1397 | Ga0207640_10100116 | |||
| 1398 | Ga0207658_10013363 | |||
| 1399 | Ga0207658_10069109 | |||
| 1400 | Ga0207677_10056140 | |||
| 1401 | Ga0207677_10058004 | |||
| 1402 | Ga0207677_10168808 | |||
| 1403 | Ga0207677_10266462 | |||
| 1404 | Ga0207703_10001248 | |||
| 1405 | Ga0207703_10024876 | |||
| 1406 | Ga0207639_10000062 | |||
| 1407 | Ga0207639_10122040 | |||
| 1408 | Ga0207639_10203418 | |||
| 1409 | Ga0207639_10233355 | |||
| 1410 | Ga0207639_10306173 | |||
| 1411 | Ga0207678_10000117 | |||
| 1412 | Ga0207678_10002336 | |||
| 1413 | Ga0207678_10007354 | |||
| 1414 | Ga0207708_10106715 | |||
| 1415 | Ga0207702_10000304 | |||
| 1416 | Ga0207702_10004014 | |||
| 1417 | Ga0207702_10005038 | |||
| 1418 | Ga0207702_10017516 | |||
| 1419 | Ga0207702_10046400 | |||
| 1420 | Ga0207702_10063930 | |||
| 1421 | Ga0207702_10067992 | |||
| 1422 | Ga0207702_10092231 | |||
| 1423 | Ga0207702_10230119 | |||
| 1424 | Ga0207702_10490282 | |||
| 1425 | Ga0207641_10012957 | |||
| 1426 | Ga0207641_10024083 | |||
| 1427 | Ga0207641_10052269 | |||
| 1428 | Ga0207641_10195449 | |||
| 1429 | Ga0207648_10008290 | |||
| 1430 | Ga0207648_10350308 | |||
| 1431 | Ga0207676_10056512 | |||
| 1432 | Ga0207674_10000086 | |||
| 1433 | Ga0207674_10010026 | |||
| 1434 | Ga0207674_10013159 | |||
| 1435 | Ga0207674_10332803 | |||
| 1436 | Ga0207674_10363188 | |||
| 1437 | Ga0207675_100030664 | |||
| 1438 | Ga0207683_10003887 | |||
| 1439 | Ga0207698_10000021 | |||
| 1440 | Ga0207698_10000799 | |||
| 1441 | Ga0207698_10039351 | |||
| 1442 | Ga0207698_10065160 | |||
| 1443 | Ga0207698_10697203 | |||
| 1444 | Ga0209179_1019456 | |||
| 1445 | Ga0209588_1019317 | |||
| 1446 | Ga0265354_1004051 | |||
| 1447 | Ga0265356_1005491 | |||
| 1448 | Ga0265357_1004502 | |||
| 1449 | Ga0268266_10161473 | |||
| 1450 | Ga0268266_10250829 | |||
| 1451 | Ga0268265_10113021 | |||
| 1452 | Ga0268265_10196777 | |||
| 1453 | Ga0268265_10340034 | |||
| 1454 | Ga0268264_10044261 | |||
| 1455 | Ga0268264_10079764 | |||
| 1456 | Ga0268264_10087880 | |||
| 1457 | Ga0265338_10008940 | |||
| 1458 | Ga0265338_10010095 | |||
| 1459 | Ga0265338_10024089 | |||
| 1460 | Ga0265338_10121530 | |||
| 1461 | Ga0265338_10221161 | |||
| 1462 | Ga0265762_1000135 | |||
| 1463 | Ga0265762_1000493 | |||
| 1464 | Ga0265772_101336 | |||
| 1465 | Ga0265760_10001232 | |||
| 1466 | Ga0265760_10003170 | |||
| 1467 | Ga0265760_10005210 | |||
| 1468 | Ga0265760_10014480 | |||
| 1469 | Ga0265330_10000200 | |||
| 1470 | Ga0265330_10012866 | |||
| 1471 | Ga0265320_10046395 | |||
| 1472 | Ga0265325_10001396 | |||
| 1473 | Ga0265325_10050789 | |||
| 1474 | Ga0265325_10081220 | |||
| 1475 | Ga0265340_10041307 | |||
| 1476 | Ga0265340_10084905 | |||
| 1477 | Ga0265339_10003570 | |||
| 1478 | Ga0265339_10024296 | |||
| 1479 | Ga0265339_10164832 | |||
| 1480 | Ga0265339_10199751 | |||
| 1481 | Ga0265316_10003072 | |||
| 1482 | Ga0265316_10006425 | |||
| 1483 | Ga0265316_10011160 | |||
| 1484 | Ga0265316_10014543 | |||
| 1485 | Ga0265316_10033235 | |||
| 1486 | Ga0265316_10075255 | |||
| 1487 | Ga0265316_10263437 | |||
| 1488 | Ga0265316_10301007 | |||
| 1489 | Ga0307408_100039575 | |||
| 1490 | Ga0265313_10004821 | |||
| 1491 | Ga0265313_10010804 | |||
| 1492 | Ga0265313_10095187 | |||
| 1493 | Ga0265313_10105684 | |||
| 1494 | Ga0265314_10004409 | |||
| 1495 | Ga0265342_10004197 | |||
| 1496 | Ga0265342_10011907 | |||
| 1497 | Ga0265342_10083118 | |||
| 1498 | Ga0316576_10147291 | |||
| 1499 | Ga0316576_10199343 | |||
| 1500 | Ga0307413_10007857 | |||
| 1501 | Ga0307412_10122539 | |||
| 1502 | Ga0307412_10155302 | |||
| 1503 | Ga0307409_100125174 | |||
| 1504 | Ga0307409_100193369 | |||
| 1505 | Ga0307415_100343945 | |||
| 1506 | Ga0373930_0031960 | |||
| 1507 | Ga0373926_0007073 | |||
| 1508 | Ga0373934_0009124 | |||
| 1509 | Ga0373940_0025718 | |||
| 1510 | Ga0373951_0050065 | |||
| 1511 | Ga0373923_0048549 | |||
| 1512 | Ga0373923_0050019 | |||
| 1513 | Ga0373923_0149494 | |||
| 1514 | Ga0373936_0009985 | |||
| 1515 | Ga0373945_0007386 | |||
| 1516 | Ga0373945_0015700 | |||
| 1517 | Ga0373953_0037907 | |||
| 1518 | Ga0373956_0117980 | |||
| 1519 | Ga0373956_0214067 | |||
| 1520 | Ga0373957_0014975 | |||
| 1521 | Ga0373943_0000004 | |||
| 1522 | Ga0373943_0115830 | |||
| 1523 | Ga0373946_0013086 | |||
| 1524 | Ga0373955_0312728 | |||
| 1525 | Ga0373931_0052696 | |||
| 1526 | Ga0373931_0168334 | |||
| 1527 | Ga0373931_0380385 | |||
| 1528 | Ga0373935_0006337 | |||
| 1529 | Ga0373935_0367165 | |||
| 1530 | Ga0373935_0414977 | |||
| 1531 | Ga0373927_0010374 | |||
| 1532 | Ga0373933_0113173 | |||
| 1533 | Ga0373947_0001184 | |||
| 1534 | Ga0373947_0235697 | |||
| 1535 | Ga0373947_0361820 | |||
| 1536 | Ga0373937_0016470 | |||
| 1537 | Ga0373937_0087124 | |||
| 1538 | Ga0373937_0268263 | |||
| 1539 | Ga0373937_0688243 | |||
| 1540 | Ga0373925_0001518 | |||
| 1541 | Ga0395899_0036439 | |||
| 1542 | Ga0395899_0040972 | |||
| 1543 | Ga0395900_0000764 | |||
| 1544 | Ga0395900_0013397 | |||
| 1545 | Ga0395900_0018930 | |||
| 1546 | Ga0395900_0030978 | |||
| 1547 | Ga0395900_0124278 | |||
| 1548 | Ga0395900_0167309 | |||
| 1549 | Ga0395900_0211620 | |||
| 1550 | Ga0395900_0291530 | |||
| 1551 | Ga0395900_0316182 | |||
| 1552 | Ga0395898_0025349 | |||
| 1553 | Ga0395898_0131765 | |||
| 1554 | Ga0395898_0253144 | |||
| 1555 | Ga0395898_0276736 | |||
| 1556 | Ga0395905_0004670 | |||
| 1557 | Ga0395905_0007858 | |||
| 1558 | Ga0395905_0027401 | |||
| 1559 | Ga0395905_0134826 | |||
| 1560 | Ga0395905_0178517 | |||
| 1561 | Ga0395905_0189223 | |||
| 1562 | Ga0395905_0242098 | |||
| 1563 | Ga0436364_1006193 | |||
| 1564 | Ga0395901_0028944 | |||
| 1565 | Ga0395901_0043639 | |||
| 1566 | Ga0395901_0068007 | |||
| 1567 | Ga0395901_0100565 | |||
| 1568 | Ga0395901_0149508 | |||
| 1569 | Ga0395901_0358070 | |||
| 1570 | Ga0395901_0425571 | |||
| 1571 | Ga0436365_1239626 | |||
| 1572 | Ga0436360_0113684 | |||
| 1573 | Ga0436363_0408258 | |||
| 1574 | Ga0436363_1660949 | |||
| 1575 | Ga0451577_0000102 | |||
| 1576 | Ga0451577_0000758 | |||
| 1577 | Ga0466969_0048327 | |||
| 1578 | Ga0466966_0000039 | |||
| 1579 | Ga0466966_0238059 | |||
| 1580 | Ga0466961_0039462 | |||
| 1581 | Ga0466963_0003335 | |||
| 1582 | Ga0466963_0014927 | |||
| 1583 | Ga0453684_0000249 | |||
| 1584 | Ga0453684_0001768 | |||
| 1585 | Ga0453684_0015369 | |||
| 1586 | Ga0466959_0146276 | |||
| 1587 | Ga0451576_0000071 | |||
| 1588 | Ga0451576_0000451 | |||
| 1589 | Ga0466958_0436706 | |||
| 1590 | Ga0466967_0103815 | |||
| 1591 | Ga0466967_0182182 | |||
| 1592 | Ga0466967_0303648 | |||
| 1593 | Ga0495603_0058355 | |||
| 1594 | Ga0495629_0130326 | |||
| 1595 | Ga0495629_0319898 | |||
| 1596 | Ga0495651_0143372 | |||
| 1597 | Ga0495653_0198724 | |||
| 1598 | Ga0495580_0000352 | |||
| 1599 | Ga0495580_0011121 | |||
| 1600 | Ga0495580_0030883 | |||
| 1601 | Ga0495580_0063992 | |||
| 1602 | Ga0495580_0106809 | |||
| 1603 | Ga0495580_0259736 | |||
| 1604 | Ga0495582_0092814 | |||
| 1605 | Ga0495662_0144820 | |||
| 1606 | Ga0495594_0048721 | |||
| 1607 | Ga0495628_0143255 | |||
| 1608 | Ga0495667_0348934 | |||
| 1609 | Ga0495635_0264294 | |||
| 1610 | Ga0495659_0085098 | |||
| 1611 | Ga0495588_0123053 | |||
| 1612 | Ga0495588_0140012 | |||
| 1613 | Ga0495646_0129182 | |||
| 1614 | Ga0495613_0262829 | |||
| 1615 | Ga0495624_0029496 | |||
| 1616 | Ga0495600_0087327 | |||
| 1617 | Ga0495581_0072705 | |||
| 1618 | Ga0495604_0028109 | |||
| 1619 | Ga0495674_0004509 | |||
| 1620 | Ga0495674_0396468 | |||
| 1621 | Ga0495675_0030402 | |||
| 1622 | Ga0495677_0028301 | |||
| 1623 | Ga0495602_0212523 | |||
| 1624 | Ga0495602_0301657 | |||
| 1625 | Ga0495602_0363687 | |||
| 1626 | Ga0496100_0048284 | |||
| 1627 | Ga0496100_0117059 | |||
| 1628 | Ga0496100_0154033 | |||
| 1629 | Ga0496100_0484298 | |||
| 1630 | Ga0496102_0003924 | |||
| 1631 | Ga0496102_0035557 | |||
| 1632 | Ga0496102_0405424 | |||
| 1633 | Ga0496103_0001542 | |||
| 1634 | Ga0496103_0132710 | |||
| 1635 | Ga0496104_0005846 | |||
| 1636 | Ga0496104_0382380 | |||
| 1637 | Ga0496104_0448972 | |||
| 1638 | Ga0496104_0687196 | |||
| 1639 | Ga0496105_0062047 | |||
| 1640 | Ga0496106_0055917 | |||
| 1641 | Ga0496106_0175937 | |||
| 1642 | Ga0496107_0034480 | |||
| 1643 | Ga0496107_0145890 | |||
| 1644 | Ga0496107_0409060 | |||
| 1645 | Ga0496109_0034833 | |||
| 1646 | Ga0496110_0147904 | |||
| 1647 | Ga0496112_0008629 | |||
| 1648 | Ga0496112_0045517 | |||
| 1649 | Ga0496112_0077138 | |||
| 1650 | Ga0496113_0098519 | |||
| 1651 | Ga0496114_0173249 | |||
| 1652 | Ga0496114_0190962 | |||
| 1653 | Ga0496115_0038573 | |||
| 1654 | Ga0496115_0042940 | |||
| 1655 | Ga0496115_0083186 | |||
| 1656 | Ga0496115_0198270 | |||
| 1657 | Ga0501070_0569789 | |||
| 1658 | Ga0501083_0017521 | |||
| 1659 | nmdc:mga05p37_302442_c1 | |||
| 1660 | nmdc:mga05p37_392690_c1 | |||
| 1661 | nmdc:mga05p37_727240_c1 | |||
| 1662 | nmdc:mga0n895_28133_c1 | |||
| 1663 | nmdc:mga0n895_3709_c1 | |||
| 1664 | nmdc:mga0rr50_512_c1 | |||
| 1665 | nmdc:mga0rr50_75769_c1 | |||
| 1666 | nmdc:mga08x19_8839_c1 | |||
| 1667 | nmdc:mga0a205_1566_c1 | |||
| 1668 | Ga0500590_000958 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e25-assembly1.cif.gz_A-2 | crystal structure of m. tuberculosis glucosyl-3-phosphoglycerate synthase | 0.797 | 4 | 231 |
| 5jud-assembly1.cif.gz_A-2 | crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with uridine-diphosphate (udp) - gpgs*udp | 0.7898 | 4 | 239 |
| 3kia-assembly1.cif.gz_A | crystal structure of mannosyl-3-phosphoglycerate synthase from rubrobacter xylanophilus | 0.7716 | 4 | 240 |
| 7msn-assembly1.cif.gz_A | suns glycosin s-glycosyltransferase | 0.7649 | 5 | 113 |
| 7msk-assembly1.cif.gz_B | thus glycosin s-glycosyltransferase | 0.764 | 5 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58619_2_238_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8898 | 7 | 223 | 3.90.550.10 |
| af_O53493_586_855_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8822 | 1 | 236 | 3.90.550.10 |
| af_Q57964_2_229_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8481 | 8 | 229 | 3.90.550.10 |
| af_O05154_2_177_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8362 | 6 | 117 | 3.90.550.10 |
| af_P9WMY1_2_214_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8334 | 7 | 230 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1F6Q9-F1-model_v4 | Glycosyl transferase family 2 | 0.9909 | 1 | 110 |
GO:0016757
|
| AF-A0A537CHA2-F1-model_v4 | Glycosyltransferase family 2 protein | 0.9895 | 1 | 246 |
GO:0016020
GO:0016740 |
| AF-A0A1H4C0R3-F1-model_v4 | Glycosyl transferase family 2 | 0.9842 | 1 | 244 |
GO:0016740
|
| AF-A0A1V5YLC6-F1-model_v4 | Undecaprenyl-phosphate mannosyltransferase (EC 2.4.1.54) | 0.9826 | 5 | 244 |
GO:0047267
|
| AF-A0A2V5PW17-F1-model_v4 | Glycosyl transferase family 2 | 0.9823 | 62 | 239 |
GO:0016740
|