F482776
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 834 | 345 | 1668 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100415377|Ga0070699_1004153773 |
| Length | 160 |
| Sequence | MWARAARSAYDVYVFMPKQRAKPMDRSIRVGEAAELLGVSVDTLRRWTASGRLRVRRSAGDQRLVALSDIHRLQTELRQKRARPIVAQSARNRFPGVVTRVEKDRVAAVVEVQAGAHRLVSLMTAEAAEELALRPGIEVVCVVKATNVVVEIAQSPRRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 189 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 228 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 232 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 233 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 234 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.48 |
| Nodule | 0 |
| Rhizoplane | 11.27 |
| Rhizosphere | 87.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100415377 | 3300005518 | Bacteria | 1217 |
| 2 | Ga0070683_100000409 | 3300005329 | Bacteria | 29689 |
| 3 | Ga0070683_100183818 | 3300005329 | Bacteria | 1984 |
| 4 | Ga0070683_100311533 | 3300005329 | Bacteria | 1498 |
| 5 | Ga0070683_100368863 | 3300005329 | Bacteria | 1367 |
| 6 | Ga0070683_101082797 | 3300005329 | Bacteria | 770 |
| 7 | Ga0070683_101121834 | 3300005329 | Bacteria | 756 |
| 8 | Ga0070683_101201325 | 3300005329 | Unclassified | 729 |
| 9 | Ga0070690_100131387 | 3300005330 | Bacteria | 1691 |
| 10 | Ga0070690_100149997 | 3300005330 | Bacteria | 1590 |
| 11 | Ga0070670_100281079 | 3300005331 | Unclassified | 1453 |
| 12 | Ga0068869_100058575 | 3300005334 | Bacteria | 2817 |
| 13 | Ga0070680_100035001 | 3300005336 | Bacteria | 4052 |
| 14 | Ga0070680_100186998 | 3300005336 | Bacteria | 1745 |
| 15 | Ga0070680_100251412 | 3300005336 | Bacteria | 1494 |
| 16 | Ga0070680_100515540 | 3300005336 | Unclassified | 1023 |
| 17 | Ga0070682_100055291 | 3300005337 | Bacteria | 2492 |
| 18 | Ga0070682_100109646 | 3300005337 | Archaea | 1837 |
| 19 | Ga0070682_100149819 | 3300005337 | Bacteria | 1600 |
| 20 | Ga0068868_100003392 | 3300005338 | Bacteria | 11085 |
| 21 | Ga0068868_100097563 | 3300005338 | Bacteria | 2375 |
| 22 | Ga0068868_100107077 | 3300005338 | Bacteria | 2268 |
| 23 | Ga0068868_100119954 | 3300005338 | Bacteria | 2144 |
| 24 | Ga0070660_100740936 | 3300005339 | Unclassified | 825 |
| 25 | Ga0070689_100019607 | 3300005340 | Bacteria | 5003 |
| 26 | Ga0070689_100094471 | 3300005340 | Bacteria | 2361 |
| 27 | Ga0070691_10049323 | 3300005341 | Archaea | 2005 |
| 28 | Ga0070691_10150068 | 3300005341 | Bacteria | 1194 |
| 29 | Ga0070691_10356527 | 3300005341 | Unclassified | 814 |
| 30 | Ga0070687_100094466 | 3300005343 | Unclassified | 1661 |
| 31 | Ga0070687_100285845 | 3300005343 | Bacteria | 1040 |
| 32 | Ga0070687_100754111 | 3300005343 | Bacteria | 685 |
| 33 | Ga0070661_100266865 | 3300005344 | Bacteria | 1324 |
| 34 | Ga0070661_100276493 | 3300005344 | Bacteria | 1301 |
| 35 | Ga0070661_100633014 | 3300005344 | Bacteria | 867 |
| 36 | Ga0070661_100917863 | 3300005344 | Unclassified | 723 |
| 37 | Ga0070661_101044007 | 3300005344 | Bacteria | 679 |
| 38 | Ga0070692_10012117 | 3300005345 | Bacteria | 3979 |
| 39 | Ga0070668_100894891 | 3300005347 | Bacteria | 793 |
| 40 | Ga0070668_101024406 | 3300005347 | Bacteria | 743 |
| 41 | Ga0070669_101353301 | 3300005353 | Unclassified | 617 |
| 42 | Ga0070669_101854198 | 3300005353 | Bacteria | 526 |
| 43 | Ga0070675_100254108 | 3300005354 | Unclassified | 1539 |
| 44 | Ga0070675_100515841 | 3300005354 | Bacteria | 1078 |
| 45 | Ga0070675_100909260 | 3300005354 | Bacteria | 807 |
| 46 | Ga0070671_100317398 | 3300005355 | Archaea | 1327 |
| 47 | Ga0070671_101786634 | 3300005355 | Bacteria | 546 |
| 48 | Ga0070674_100784644 | 3300005356 | Bacteria | 821 |
| 49 | Ga0070674_100864662 | 3300005356 | Bacteria | 785 |
| 50 | Ga0070674_100881816 | 3300005356 | Bacteria | 778 |
| 51 | Ga0070673_100097429 | 3300005364 | Bacteria | 2415 |
| 52 | Ga0070688_100121877 | 3300005365 | Bacteria | 1748 |
| 53 | Ga0070659_100158169 | 3300005366 | Bacteria | 1852 |
| 54 | Ga0070659_100253663 | 3300005366 | Unclassified | 1458 |
| 55 | Ga0070659_101168414 | 3300005366 | Bacteria | 680 |
| 56 | Ga0070709_10573870 | 3300005434 | Bacteria | 866 |
| 57 | Ga0070714_100023957 | 3300005435 | Bacteria | 5020 |
| 58 | Ga0070714_100175540 | 3300005435 | Bacteria | 1947 |
| 59 | Ga0070714_100345189 | 3300005435 | Bacteria | 1397 |
| 60 | Ga0070713_100437244 | 3300005436 | Bacteria | 1227 |
| 61 | Ga0070713_100669906 | 3300005436 | Bacteria | 989 |
| 62 | Ga0070713_100843319 | 3300005436 | Bacteria | 880 |
| 63 | Ga0070713_101288108 | 3300005436 | Unclassified | 708 |
| 64 | Ga0070713_101645881 | 3300005436 | Bacteria | 623 |
| 65 | Ga0070710_10075684 | 3300005437 | Bacteria | 1951 |
| 66 | Ga0070710_10376453 | 3300005437 | Unclassified | 946 |
| 67 | Ga0070701_10124968 | 3300005438 | Bacteria | 1455 |
| 68 | Ga0070701_10700493 | 3300005438 | Bacteria | 681 |
| 69 | Ga0070711_100823246 | 3300005439 | Bacteria | 788 |
| 70 | Ga0070705_100107287 | 3300005440 | Bacteria | 1777 |
| 71 | Ga0070705_101418738 | 3300005440 | Unclassified | 579 |
| 72 | Ga0070700_100004549 | 3300005441 | Bacteria | 7256 |
| 73 | Ga0070700_100026823 | 3300005441 | Bacteria | 3407 |
| 74 | Ga0070700_100406520 | 3300005441 | Bacteria | 1025 |
| 75 | Ga0070700_100841180 | 3300005441 | Bacteria | 742 |
| 76 | Ga0070700_101557865 | 3300005441 | Bacteria | 563 |
| 77 | Ga0070694_100291550 | 3300005444 | Bacteria | 1247 |
| 78 | Ga0070708_100015116 | 3300005445 | Bacteria | 6366 |
| 79 | Ga0070708_100032221 | 3300005445 | Bacteria | 4544 |
| 80 | Ga0070708_100043562 | 3300005445 | Bacteria | 3944 |
| 81 | Ga0070708_100515654 | 3300005445 | Unclassified | 1128 |
| 82 | Ga0070708_100561404 | 3300005445 | Unclassified | 1076 |
| 83 | Ga0070708_101063652 | 3300005445 | Bacteria | 758 |
| 84 | Ga0070708_101622281 | 3300005445 | Unclassified | 602 |
| 85 | Ga0070663_100208658 | 3300005455 | Bacteria | 1528 |
| 86 | Ga0070663_100239977 | 3300005455 | Bacteria | 1430 |
| 87 | Ga0070663_101044577 | 3300005455 | Bacteria | 712 |
| 88 | Ga0070678_100399505 | 3300005456 | Archaea | 1194 |
| 89 | Ga0070678_101458436 | 3300005456 | Bacteria | 640 |
| 90 | Ga0070662_100045621 | 3300005457 | Bacteria | 3146 |
| 91 | Ga0070662_100131374 | 3300005457 | Bacteria | 1931 |
| 92 | Ga0070662_101131780 | 3300005457 | Bacteria | 672 |
| 93 | Ga0070681_10054890 | 3300005458 | Bacteria | 3969 |
| 94 | Ga0070681_10200498 | 3300005458 | Archaea | 1914 |
| 95 | Ga0070681_11479485 | 3300005458 | Unclassified | 603 |
| 96 | Ga0070685_10029046 | 3300005466 | Bacteria | 3069 |
| 97 | Ga0070685_10863733 | 3300005466 | Bacteria | 671 |
| 98 | Ga0070706_100039381 | 3300005467 | Bacteria | 4363 |
| 99 | Ga0070706_100569452 | 3300005467 | Unclassified | 1053 |
| 100 | Ga0070707_100022662 | 3300005468 | Bacteria | 5937 |
| 101 | Ga0070707_100044147 | 3300005468 | Bacteria | 4266 |
| 102 | Ga0070707_100764785 | 3300005468 | Unclassified | 929 |
| 103 | Ga0070698_100077635 | 3300005471 | Bacteria | 3320 |
| 104 | Ga0070698_100149654 | 3300005471 | Bacteria | 2282 |
| 105 | Ga0070698_100151084 | 3300005471 | Bacteria | 2270 |
| 106 | Ga0070699_100019776 | 3300005518 | Bacteria | 5804 |
| 107 | Ga0070699_100248770 | 3300005518 | Bacteria | 1588 |
| 108 | Ga0070699_100593947 | 3300005518 | Bacteria | 1009 |
| 109 | Ga0070699_101368517 | 3300005518 | Bacteria | 649 |
| 110 | Ga0070679_100044827 | 3300005530 | Bacteria | 4406 |
| 111 | Ga0070679_100052034 | 3300005530 | Bacteria | 4080 |
| 112 | Ga0070679_100068834 | 3300005530 | Bacteria | 3531 |
| 113 | Ga0070679_100318192 | 3300005530 | Bacteria | 1505 |
| 114 | Ga0070679_100928903 | 3300005530 | Bacteria | 814 |
| 115 | Ga0070684_100003119 | 3300005535 | Bacteria | 12375 |
| 116 | Ga0070684_100042042 | 3300005535 | Bacteria | 3944 |
| 117 | Ga0070684_100252893 | 3300005535 | Unclassified | 1611 |
| 118 | Ga0070684_100524915 | 3300005535 | Bacteria | 1097 |
| 119 | Ga0070684_100844525 | 3300005535 | Bacteria | 857 |
| 120 | Ga0070697_100089102 | 3300005536 | Bacteria | 2549 |
| 121 | Ga0070697_100618883 | 3300005536 | Bacteria | 952 |
| 122 | Ga0070697_100673615 | 3300005536 | Bacteria | 912 |
| 123 | Ga0070697_101223270 | 3300005536 | Unclassified | 669 |
| 124 | Ga0070672_101888820 | 3300005543 | Bacteria | 537 |
| 125 | Ga0070695_100163800 | 3300005545 | Bacteria | 1563 |
| 126 | Ga0070695_100269044 | 3300005545 | Unclassified | 1248 |
| 127 | Ga0070695_100435832 | 3300005545 | Unclassified | 1001 |
| 128 | Ga0070696_100200153 | 3300005546 | Bacteria | 1491 |
| 129 | Ga0070696_100399957 | 3300005546 | Bacteria | 1074 |
| 130 | Ga0070696_100405217 | 3300005546 | Bacteria | 1068 |
| 131 | Ga0070696_100469323 | 3300005546 | Unclassified | 996 |
| 132 | Ga0070696_100509287 | 3300005546 | Bacteria | 959 |
| 133 | Ga0070693_100016592 | 3300005547 | Bacteria | 3815 |
| 134 | Ga0070693_100126729 | 3300005547 | Bacteria | 1591 |
| 135 | Ga0070693_100135511 | 3300005547 | Bacteria | 1544 |
| 136 | Ga0070693_100343435 | 3300005547 | Bacteria | 1019 |
| 137 | Ga0070693_101046110 | 3300005547 | Bacteria | 620 |
| 138 | Ga0070665_100002833 | 3300005548 | Bacteria | 18780 |
| 139 | Ga0070665_100090543 | 3300005548 | Bacteria | 3065 |
| 140 | Ga0070704_101573803 | 3300005549 | Bacteria | 606 |
| 141 | Ga0068855_100012319 | 3300005563 | Bacteria | 10331 |
| 142 | Ga0068855_100041751 | 3300005563 | Bacteria | 5435 |
| 143 | Ga0068855_100372881 | 3300005563 | Unclassified | 1568 |
| 144 | Ga0070664_100138732 | 3300005564 | Bacteria | 2140 |
| 145 | Ga0070664_100559943 | 3300005564 | Bacteria | 1057 |
| 146 | Ga0070664_101393235 | 3300005564 | Unclassified | 663 |
| 147 | Ga0068857_100048327 | 3300005577 | Bacteria | 3777 |
| 148 | Ga0068854_100021504 | 3300005578 | Bacteria | 4379 |
| 149 | Ga0068854_100067494 | 3300005578 | Bacteria | 2606 |
| 150 | Ga0068854_100312805 | 3300005578 | Bacteria | 1274 |
| 151 | Ga0068854_101851498 | 3300005578 | Bacteria | 554 |
| 152 | Ga0068854_101857238 | 3300005578 | Bacteria | 553 |
| 153 | Ga0068856_100097048 | 3300005614 | Bacteria | 2936 |
| 154 | Ga0068856_100195995 | 3300005614 | Archaea | 2034 |
| 155 | Ga0068856_100450983 | 3300005614 | Bacteria | 1307 |
| 156 | Ga0068856_100688831 | 3300005614 | Bacteria | 1042 |
| 157 | Ga0068856_101603886 | 3300005614 | Unclassified | 664 |
| 158 | Ga0070702_100016763 | 3300005615 | Bacteria | 3766 |
| 159 | Ga0070702_100045922 | 3300005615 | Bacteria | 2474 |
| 160 | Ga0070702_100255446 | 3300005615 | Bacteria | 1190 |
| 161 | Ga0070702_100945359 | 3300005615 | Bacteria | 678 |
| 162 | Ga0070702_100954865 | 3300005615 | Bacteria | 675 |
| 163 | Ga0068852_100033281 | 3300005616 | Bacteria | 4277 |
| 164 | Ga0068852_100045150 | 3300005616 | Bacteria | 3746 |
| 165 | Ga0068852_100070890 | 3300005616 | Bacteria | 3058 |
| 166 | Ga0068852_100131191 | 3300005616 | Bacteria | 2308 |
| 167 | Ga0068852_101312007 | 3300005616 | Bacteria | 745 |
| 168 | Ga0068859_100121155 | 3300005617 | Archaea | 2682 |
| 169 | Ga0068859_101390845 | 3300005617 | Unclassified | 774 |
| 170 | Ga0068864_100374360 | 3300005618 | Bacteria | 1348 |
| 171 | Ga0068864_100935291 | 3300005618 | Unclassified | 857 |
| 172 | Ga0068864_101628634 | 3300005618 | Unclassified | 650 |
| 173 | Ga0068866_10038776 | 3300005718 | Bacteria | 2348 |
| 174 | Ga0068866_10168679 | 3300005718 | Unclassified | 1283 |
| 175 | Ga0068861_100034200 | 3300005719 | Bacteria | 3757 |
| 176 | Ga0068861_102165155 | 3300005719 | Bacteria | 557 |
| 177 | Ga0068851_10532543 | 3300005834 | Unclassified | 708 |
| 178 | Ga0068851_10553286 | 3300005834 | Bacteria | 695 |
| 179 | Ga0068870_10184433 | 3300005840 | Bacteria | 1255 |
| 180 | Ga0068870_10731522 | 3300005840 | Bacteria | 685 |
| 181 | Ga0068863_100492468 | 3300005841 | Bacteria | 1206 |
| 182 | Ga0068863_100579273 | 3300005841 | Bacteria | 1110 |
| 183 | Ga0068858_100067362 | 3300005842 | Bacteria | 3316 |
| 184 | Ga0068862_100229116 | 3300005844 | Bacteria | 1685 |
| 185 | Ga0081455_10081058 | 3300005937 | Bacteria | 2659 |
| 186 | Ga0081538_10001737 | 3300005981 | Bacteria | 22139 |
| 187 | Ga0081540_1125186 | 3300005983 | Bacteria | 1059 |
| 188 | Ga0081539_10002515 | 3300005985 | Bacteria | 25631 |
| 189 | Ga0081539_10412008 | 3300005985 | Unclassified | 561 |
| 190 | Ga0081539_10499265 | 3300005985 | Bacteria | 504 |
| 191 | Ga0070717_10021733 | 3300006028 | Bacteria | 5060 |
| 192 | Ga0070717_10367856 | 3300006028 | Bacteria | 1288 |
| 193 | Ga0075365_10305807 | 3300006038 | Bacteria | 1119 |
| 194 | Ga0075365_10622961 | 3300006038 | Bacteria | 763 |
| 195 | Ga0070715_10314148 | 3300006163 | Unclassified | 843 |
| 196 | Ga0070715_10479997 | 3300006163 | Bacteria | 708 |
| 197 | Ga0070716_100169572 | 3300006173 | Bacteria | 1423 |
| 198 | Ga0070716_100298399 | 3300006173 | Bacteria | 1120 |
| 199 | Ga0070712_100614386 | 3300006175 | Bacteria | 921 |
| 200 | Ga0070712_101184026 | 3300006175 | Archaea | 665 |
| 201 | Ga0070712_101865873 | 3300006175 | Unclassified | 526 |
| 202 | Ga0097621_100288737 | 3300006237 | Bacteria | 1446 |
| 203 | Ga0097621_100378339 | 3300006237 | Bacteria | 1264 |
| 204 | Ga0068871_100397193 | 3300006358 | Unclassified | 1227 |
| 205 | Ga0075428_101243371 | 3300006844 | Bacteria | 784 |
| 206 | Ga0075431_102179447 | 3300006847 | Unclassified | 509 |
| 207 | Ga0075433_10132119 | 3300006852 | Archaea | 2218 |
| 208 | Ga0075433_10340602 | 3300006852 | Bacteria | 1325 |
| 209 | Ga0075433_10405932 | 3300006852 | Bacteria | 1202 |
| 210 | Ga0075434_100008954 | 3300006871 | Bacteria | 9321 |
| 211 | Ga0075434_100010480 | 3300006871 | Bacteria | 8690 |
| 212 | Ga0075434_100070271 | 3300006871 | Bacteria | 3492 |
| 213 | Ga0075434_100213043 | 3300006871 | Bacteria | 1952 |
| 214 | Ga0075434_100588174 | 3300006871 | Bacteria | 1132 |
| 215 | Ga0075434_100816015 | 3300006871 | Bacteria | 949 |
| 216 | Ga0075434_101074695 | 3300006871 | Bacteria | 818 |
| 217 | Ga0075434_101883145 | 3300006871 | Bacteria | 604 |
| 218 | Ga0075429_100454834 | 3300006880 | Unclassified | 1122 |
| 219 | Ga0075429_100887107 | 3300006880 | Bacteria | 781 |
| 220 | Ga0068865_100571989 | 3300006881 | Bacteria | 952 |
| 221 | Ga0068865_100672824 | 3300006881 | Bacteria | 882 |
| 222 | Ga0075436_100015200 | 3300006914 | Bacteria | 5273 |
| 223 | Ga0075436_100086955 | 3300006914 | Bacteria | 2171 |
| 224 | Ga0075436_100965219 | 3300006914 | Bacteria | 639 |
| 225 | Ga0097620_100121155 | 3300006931 | Archaea | 2682 |
| 226 | Ga0097620_101390521 | 3300006931 | Unclassified | 774 |
| 227 | Ga0075435_100039171 | 3300007076 | Bacteria | 3782 |
| 228 | Ga0075435_100239591 | 3300007076 | Bacteria | 1543 |
| 229 | Ga0075435_100356513 | 3300007076 | Bacteria | 1254 |
| 230 | Ga0075435_100683505 | 3300007076 | Unclassified | 892 |
| 231 | Ga0099794_10203765 | 3300007265 | Bacteria | 1013 |
| 232 | Ga0105240_10195183 | 3300009093 | Bacteria | 2378 |
| 233 | Ga0105240_10729610 | 3300009093 | Unclassified | 1079 |
| 234 | Ga0111539_10020732 | 3300009094 | Bacteria | 8092 |
| 235 | Ga0111539_10069136 | 3300009094 | Bacteria | 4170 |
| 236 | Ga0111539_10102369 | 3300009094 | Bacteria | 3361 |
| 237 | Ga0111539_10210536 | 3300009094 | Bacteria | 2265 |
| 238 | Ga0111539_10450470 | 3300009094 | Bacteria | 1499 |
| 239 | Ga0111539_11262726 | 3300009094 | Unclassified | 857 |
| 240 | Ga0111539_11521685 | 3300009094 | Bacteria | 776 |
| 241 | Ga0105245_10003127 | 3300009098 | Bacteria | 14810 |
| 242 | Ga0105245_10007097 | 3300009098 | Bacteria | 9831 |
| 243 | Ga0105245_10129917 | 3300009098 | Bacteria | 2362 |
| 244 | Ga0105245_10751783 | 3300009098 | Unclassified | 1011 |
| 245 | Ga0105245_10897997 | 3300009098 | Unclassified | 928 |
| 246 | Ga0105245_11134024 | 3300009098 | Bacteria | 829 |
| 247 | Ga0105245_11214806 | 3300009098 | Unclassified | 802 |
| 248 | Ga0105247_11098742 | 3300009101 | Bacteria | 627 |
| 249 | Ga0114129_10003826 | 3300009147 | Bacteria | 21203 |
| 250 | Ga0114129_11759174 | 3300009147 | Bacteria | 755 |
| 251 | Ga0105243_10377391 | 3300009148 | Bacteria | 1310 |
| 252 | Ga0105243_10653782 | 3300009148 | Unclassified | 1019 |
| 253 | Ga0105243_11294941 | 3300009148 | Bacteria | 746 |
| 254 | Ga0105243_11990012 | 3300009148 | Unclassified | 615 |
| 255 | Ga0105241_10087621 | 3300009174 | Bacteria | 2451 |
| 256 | Ga0105241_10595818 | 3300009174 | Bacteria | 998 |
| 257 | Ga0105241_10866326 | 3300009174 | Unclassified | 836 |
| 258 | Ga0105242_10017630 | 3300009176 | Bacteria | 5569 |
| 259 | Ga0105242_10149759 | 3300009176 | Unclassified | 2034 |
| 260 | Ga0105242_10632528 | 3300009176 | Bacteria | 1038 |
| 261 | Ga0105248_10115826 | 3300009177 | Bacteria | 3023 |
| 262 | Ga0105248_10233821 | 3300009177 | Archaea | 2069 |
| 263 | Ga0105248_11292554 | 3300009177 | Bacteria | 825 |
| 264 | Ga0105248_11479737 | 3300009177 | Bacteria | 769 |
| 265 | Ga0105237_10054714 | 3300009545 | Bacteria | 3998 |
| 266 | Ga0105237_10107191 | 3300009545 | Bacteria | 2786 |
| 267 | Ga0105237_10525161 | 3300009545 | Bacteria | 1190 |
| 268 | Ga0105238_10019519 | 3300009551 | Bacteria | 6903 |
| 269 | Ga0105238_10056329 | 3300009551 | Bacteria | 3944 |
| 270 | Ga0105238_10206064 | 3300009551 | Bacteria | 1942 |
| 271 | Ga0105238_10345092 | 3300009551 | Bacteria | 1477 |
| 272 | Ga0105238_12577811 | 3300009551 | Unclassified | 545 |
| 273 | Ga0105249_10034555 | 3300009553 | Bacteria | 4583 |
| 274 | Ga0105249_10127677 | 3300009553 | Bacteria | 2423 |
| 275 | Ga0105249_10154799 | 3300009553 | Bacteria | 2210 |
| 276 | Ga0105249_10211267 | 3300009553 | Bacteria | 1905 |
| 277 | Ga0105239_10093826 | 3300010375 | Bacteria | 3314 |
| 278 | Ga0105239_10106834 | 3300010375 | Bacteria | 3101 |
| 279 | Ga0105239_10132362 | 3300010375 | Bacteria | 2775 |
| 280 | Ga0105239_10325684 | 3300010375 | Bacteria | 1733 |
| 281 | Ga0105239_10451366 | 3300010375 | Bacteria | 1458 |
| 282 | Ga0105239_10452574 | 3300010375 | Bacteria | 1457 |
| 283 | Ga0105239_13050484 | 3300010375 | Bacteria | 546 |
| 284 | Ga0105246_10007499 | 3300011119 | Bacteria | 6689 |
| 285 | Ga0105246_10206303 | 3300011119 | Archaea | 1531 |
| 286 | Ga0105246_11030376 | 3300011119 | Bacteria | 747 |
| 287 | Ga0157373_10057890 | 3300013100 | Bacteria | 2748 |
| 288 | Ga0157370_10172620 | 3300013104 | Bacteria | 2009 |
| 289 | Ga0157370_10335049 | 3300013104 | Bacteria | 1395 |
| 290 | Ga0157370_10817446 | 3300013104 | Bacteria | 848 |
| 291 | Ga0157369_10490393 | 3300013105 | Bacteria | 1271 |
| 292 | Ga0157369_10559470 | 3300013105 | Bacteria | 1182 |
| 293 | Ga0157369_10725762 | 3300013105 | Bacteria | 1023 |
| 294 | Ga0157374_10062947 | 3300013296 | Bacteria | 3479 |
| 295 | Ga0157374_10107933 | 3300013296 | Bacteria | 2675 |
| 296 | Ga0157374_10130187 | 3300013296 | Bacteria | 2435 |
| 297 | Ga0157374_10357674 | 3300013296 | Bacteria | 1451 |
| 298 | Ga0157374_11148051 | 3300013296 | Bacteria | 798 |
| 299 | Ga0157374_11846146 | 3300013296 | Bacteria | 630 |
| 300 | Ga0157378_10179001 | 3300013297 | Bacteria | 1993 |
| 301 | Ga0157378_11788323 | 3300013297 | Bacteria | 662 |
| 302 | Ga0163162_10089703 | 3300013306 | Bacteria | 3155 |
| 303 | Ga0163162_10255565 | 3300013306 | Archaea | 1884 |
| 304 | Ga0157372_10021233 | 3300013307 | Bacteria | 7014 |
| 305 | Ga0157372_10059797 | 3300013307 | Bacteria | 4263 |
| 306 | Ga0157372_10146035 | 3300013307 | Bacteria | 2727 |
| 307 | Ga0157372_10221775 | 3300013307 | Bacteria | 2191 |
| 308 | Ga0157372_11443327 | 3300013307 | Bacteria | 793 |
| 309 | Ga0157372_12954706 | 3300013307 | Unclassified | 544 |
| 310 | Ga0157375_10372127 | 3300013308 | Bacteria | 1595 |
| 311 | Ga0157375_10565568 | 3300013308 | Bacteria | 1298 |
| 312 | Ga0157375_13032810 | 3300013308 | Unclassified | 561 |
| 313 | Ga0157375_13108012 | 3300013308 | Bacteria | 554 |
| 314 | Ga0163163_10002871 | 3300014325 | Bacteria | 14576 |
| 315 | Ga0163163_10243207 | 3300014325 | Bacteria | 1849 |
| 316 | Ga0163163_10676844 | 3300014325 | Bacteria | 1095 |
| 317 | Ga0163163_10781222 | 3300014325 | Bacteria | 1018 |
| 318 | Ga0163163_11721019 | 3300014325 | Bacteria | 688 |
| 319 | Ga0157380_10089740 | 3300014326 | Bacteria | 2533 |
| 320 | Ga0157380_10615177 | 3300014326 | Bacteria | 1077 |
| 321 | Ga0157380_10673710 | 3300014326 | Bacteria | 1035 |
| 322 | Ga0182008_10121724 | 3300014497 | Bacteria | 1297 |
| 323 | Ga0182008_10460038 | 3300014497 | Unclassified | 693 |
| 324 | Ga0157377_10207508 | 3300014745 | Unclassified | 1247 |
| 325 | Ga0157377_10721102 | 3300014745 | Bacteria | 726 |
| 326 | Ga0157379_10097654 | 3300014968 | Bacteria | 2637 |
| 327 | Ga0157379_11299795 | 3300014968 | Bacteria | 702 |
| 328 | Ga0157376_10049452 | 3300014969 | Bacteria | 3482 |
| 329 | Ga0157376_10166689 | 3300014969 | Bacteria | 2002 |
| 330 | Ga0197907_11034745 | 3300020069 | Bacteria | 706 |
| 331 | Ga0206356_10092015 | 3300020070 | Bacteria | 654 |
| 332 | Ga0206353_10146378 | 3300020082 | Bacteria | 1688 |
| 333 | Ga0206353_10898528 | 3300020082 | Bacteria | 556 |
| 334 | Ga0213876_10215121 | 3300021384 | Bacteria | 1022 |
| 335 | Ga0224712_10144675 | 3300022467 | Unclassified | 1049 |
| 336 | Ga0207692_10051514 | 3300025898 | Bacteria | 2088 |
| 337 | Ga0207642_10098926 | 3300025899 | Bacteria | 1459 |
| 338 | Ga0207688_10011795 | 3300025901 | Bacteria | 4755 |
| 339 | Ga0207688_10063286 | 3300025901 | Unclassified | 2087 |
| 340 | Ga0207688_10269500 | 3300025901 | Unclassified | 1035 |
| 341 | Ga0207688_10929409 | 3300025901 | Unclassified | 550 |
| 342 | Ga0207680_10102351 | 3300025903 | Unclassified | 1843 |
| 343 | Ga0207647_10385905 | 3300025904 | Bacteria | 790 |
| 344 | Ga0207705_10639352 | 3300025909 | Unclassified | 827 |
| 345 | Ga0207684_10052654 | 3300025910 | Bacteria | 3455 |
| 346 | Ga0207684_10083346 | 3300025910 | Bacteria | 2723 |
| 347 | Ga0207684_10488739 | 3300025910 | Archaea | 1055 |
| 348 | Ga0207707_10038754 | 3300025912 | Bacteria | 4165 |
| 349 | Ga0207707_11446167 | 3300025912 | Unclassified | 547 |
| 350 | Ga0207695_10114009 | 3300025913 | Bacteria | 2679 |
| 351 | Ga0207695_10118603 | 3300025913 | Bacteria | 2617 |
| 352 | Ga0207695_10303291 | 3300025913 | Archaea | 1488 |
| 353 | Ga0207671_10120188 | 3300025914 | Bacteria | 2008 |
| 354 | Ga0207671_10189397 | 3300025914 | Archaea | 1604 |
| 355 | Ga0207671_10483735 | 3300025914 | Unclassified | 987 |
| 356 | Ga0207693_10065551 | 3300025915 | Bacteria | 2844 |
| 357 | Ga0207693_10886218 | 3300025915 | Archaea | 685 |
| 358 | Ga0207663_10967092 | 3300025916 | Bacteria | 682 |
| 359 | Ga0207660_10064040 | 3300025917 | Bacteria | 2652 |
| 360 | Ga0207660_10364438 | 3300025917 | Bacteria | 1160 |
| 361 | Ga0207660_10797317 | 3300025917 | Bacteria | 771 |
| 362 | Ga0207662_10060721 | 3300025918 | Bacteria | 2268 |
| 363 | Ga0207657_10001018 | 3300025919 | Bacteria | 29759 |
| 364 | Ga0207657_10097609 | 3300025919 | Bacteria | 2443 |
| 365 | Ga0207657_10972787 | 3300025919 | Unclassified | 652 |
| 366 | Ga0207649_10273807 | 3300025920 | Bacteria | 1225 |
| 367 | Ga0207649_10714208 | 3300025920 | Unclassified | 778 |
| 368 | Ga0207652_10051763 | 3300025921 | Bacteria | 3522 |
| 369 | Ga0207652_10148030 | 3300025921 | Bacteria | 2102 |
| 370 | Ga0207652_10515141 | 3300025921 | Unclassified | 1076 |
| 371 | Ga0207646_10003120 | 3300025922 | Bacteria | 19012 |
| 372 | Ga0207646_10017500 | 3300025922 | Bacteria | 6706 |
| 373 | Ga0207646_10034473 | 3300025922 | Bacteria | 4574 |
| 374 | Ga0207646_10979512 | 3300025922 | Bacteria | 748 |
| 375 | Ga0207694_10035285 | 3300025924 | Bacteria | 3836 |
| 376 | Ga0207694_10105774 | 3300025924 | Bacteria | 2234 |
| 377 | Ga0207694_10183804 | 3300025924 | Bacteria | 1696 |
| 378 | Ga0207650_10345102 | 3300025925 | Bacteria | 1223 |
| 379 | Ga0207659_10618775 | 3300025926 | Bacteria | 924 |
| 380 | Ga0207687_10001051 | 3300025927 | Bacteria | 18717 |
| 381 | Ga0207687_10012543 | 3300025927 | Bacteria | 5537 |
| 382 | Ga0207687_10029105 | 3300025927 | Bacteria | 3714 |
| 383 | Ga0207687_10079444 | 3300025927 | Bacteria | 2365 |
| 384 | Ga0207687_10180754 | 3300025927 | Bacteria | 1634 |
| 385 | Ga0207687_10630961 | 3300025927 | Bacteria | 905 |
| 386 | Ga0207687_11171132 | 3300025927 | Bacteria | 661 |
| 387 | Ga0207700_10446095 | 3300025928 | Unclassified | 1140 |
| 388 | Ga0207700_10575936 | 3300025928 | Bacteria | 1001 |
| 389 | Ga0207700_10644302 | 3300025928 | Bacteria | 944 |
| 390 | Ga0207700_10832802 | 3300025928 | Unclassified | 825 |
| 391 | Ga0207664_10038120 | 3300025929 | Bacteria | 3725 |
| 392 | Ga0207664_10101940 | 3300025929 | Bacteria | 2373 |
| 393 | Ga0207664_10153797 | 3300025929 | Archaea | 1956 |
| 394 | Ga0207664_11664078 | 3300025929 | Unclassified | 560 |
| 395 | Ga0207644_10080219 | 3300025931 | Bacteria | 2410 |
| 396 | Ga0207690_10017626 | 3300025932 | Bacteria | 4366 |
| 397 | Ga0207706_10066880 | 3300025933 | Bacteria | 3163 |
| 398 | Ga0207706_10157411 | 3300025933 | Bacteria | 1997 |
| 399 | Ga0207706_10297867 | 3300025933 | Unclassified | 1406 |
| 400 | Ga0207686_11349846 | 3300025934 | Bacteria | 586 |
| 401 | Ga0207709_10244377 | 3300025935 | Bacteria | 1307 |
| 402 | Ga0207709_11415170 | 3300025935 | Bacteria | 576 |
| 403 | Ga0207670_10104248 | 3300025936 | Bacteria | 2031 |
| 404 | Ga0207669_10717973 | 3300025937 | Bacteria | 823 |
| 405 | Ga0207669_10991561 | 3300025937 | Unclassified | 706 |
| 406 | Ga0207704_10169000 | 3300025938 | Unclassified | 1566 |
| 407 | Ga0207704_10562814 | 3300025938 | Bacteria | 928 |
| 408 | Ga0207665_10128047 | 3300025939 | Bacteria | 1799 |
| 409 | Ga0207665_10239665 | 3300025939 | Bacteria | 1336 |
| 410 | Ga0207665_10646357 | 3300025939 | Bacteria | 829 |
| 411 | Ga0207711_10840270 | 3300025941 | Bacteria | 855 |
| 412 | Ga0207711_10967288 | 3300025941 | Unclassified | 790 |
| 413 | Ga0207689_10041949 | 3300025942 | Bacteria | 3786 |
| 414 | Ga0207689_11228772 | 3300025942 | Bacteria | 630 |
| 415 | Ga0207661_10006305 | 3300025944 | Bacteria | 8392 |
| 416 | Ga0207661_10167107 | 3300025944 | Bacteria | 1913 |
| 417 | Ga0207661_10735340 | 3300025944 | Bacteria | 908 |
| 418 | Ga0207661_12053924 | 3300025944 | Unclassified | 517 |
| 419 | Ga0207679_10051753 | 3300025945 | Bacteria | 3008 |
| 420 | Ga0207679_10268653 | 3300025945 | Unclassified | 1458 |
| 421 | Ga0207679_10576345 | 3300025945 | Unclassified | 1012 |
| 422 | Ga0207667_10005782 | 3300025949 | Bacteria | 15087 |
| 423 | Ga0207667_10149234 | 3300025949 | Bacteria | 2406 |
| 424 | Ga0207667_10482522 | 3300025949 | Bacteria | 1258 |
| 425 | Ga0207651_10385558 | 3300025960 | Archaea | 1189 |
| 426 | Ga0207651_10461158 | 3300025960 | Bacteria | 1092 |
| 427 | Ga0207712_10503429 | 3300025961 | Bacteria | 1036 |
| 428 | Ga0207712_10902827 | 3300025961 | Bacteria | 781 |
| 429 | Ga0207668_10320562 | 3300025972 | Bacteria | 1286 |
| 430 | Ga0207668_10441853 | 3300025972 | Bacteria | 1108 |
| 431 | Ga0207668_11339361 | 3300025972 | Bacteria | 645 |
| 432 | Ga0207640_10065456 | 3300025981 | Bacteria | 2425 |
| 433 | Ga0207640_10178334 | 3300025981 | Bacteria | 1591 |
| 434 | Ga0207640_10378494 | 3300025981 | Bacteria | 1146 |
| 435 | Ga0207640_10439734 | 3300025981 | Bacteria | 1072 |
| 436 | Ga0207640_10601685 | 3300025981 | Bacteria | 931 |
| 437 | Ga0207640_10722211 | 3300025981 | Unclassified | 856 |
| 438 | Ga0207640_11588933 | 3300025981 | Bacteria | 589 |
| 439 | Ga0207658_10684939 | 3300025986 | Bacteria | 926 |
| 440 | Ga0207677_10008302 | 3300026023 | Bacteria | 5790 |
| 441 | Ga0207677_10112583 | 3300026023 | Bacteria | 2030 |
| 442 | Ga0207677_10129194 | 3300026023 | Bacteria | 1915 |
| 443 | Ga0207677_10739278 | 3300026023 | Bacteria | 876 |
| 444 | Ga0207703_10020306 | 3300026035 | Bacteria | 5194 |
| 445 | Ga0207639_10244474 | 3300026041 | Bacteria | 1562 |
| 446 | Ga0207678_10039010 | 3300026067 | Bacteria | 4123 |
| 447 | Ga0207678_10072343 | 3300026067 | Bacteria | 2954 |
| 448 | Ga0207678_10661029 | 3300026067 | Unclassified | 918 |
| 449 | Ga0207708_10018938 | 3300026075 | Bacteria | 5184 |
| 450 | Ga0207708_10041559 | 3300026075 | Bacteria | 3505 |
| 451 | Ga0207708_10055701 | 3300026075 | Bacteria | 3015 |
| 452 | Ga0207708_10176315 | 3300026075 | Unclassified | 1695 |
| 453 | Ga0207708_10312020 | 3300026075 | Bacteria | 1281 |
| 454 | Ga0207708_10659728 | 3300026075 | Bacteria | 891 |
| 455 | Ga0207702_10009665 | 3300026078 | Bacteria | 8098 |
| 456 | Ga0207702_10144358 | 3300026078 | Archaea | 2158 |
| 457 | Ga0207702_10181594 | 3300026078 | Bacteria | 1938 |
| 458 | Ga0207702_11267174 | 3300026078 | Bacteria | 731 |
| 459 | Ga0207702_11267584 | 3300026078 | Bacteria | 731 |
| 460 | Ga0207702_12392555 | 3300026078 | Unclassified | 515 |
| 461 | Ga0207641_10098045 | 3300026088 | Bacteria | 2577 |
| 462 | Ga0207648_10138491 | 3300026089 | Bacteria | 2145 |
| 463 | Ga0207648_10402849 | 3300026089 | Bacteria | 1240 |
| 464 | Ga0207676_11498708 | 3300026095 | Bacteria | 671 |
| 465 | Ga0207674_10059570 | 3300026116 | Bacteria | 3863 |
| 466 | Ga0207674_10541267 | 3300026116 | Bacteria | 1125 |
| 467 | Ga0207675_100035337 | 3300026118 | Bacteria | 4661 |
| 468 | Ga0207675_101970610 | 3300026118 | Bacteria | 602 |
| 469 | Ga0207683_10300567 | 3300026121 | Bacteria | 1468 |
| 470 | Ga0207698_10138761 | 3300026142 | Unclassified | 2090 |
| 471 | Ga0207698_10165542 | 3300026142 | Bacteria | 1940 |
| 472 | Ga0209999_1041414 | 3300027543 | Bacteria | 863 |
| 473 | Ga0209966_1015799 | 3300027695 | Bacteria | 1421 |
| 474 | Ga0207428_10108885 | 3300027907 | Bacteria | 2134 |
| 475 | Ga0207428_10852845 | 3300027907 | Bacteria | 645 |
| 476 | Ga0207428_10901853 | 3300027907 | Bacteria | 624 |
| 477 | Ga0268266_10005645 | 3300028379 | Bacteria | 11605 |
| 478 | Ga0268266_10149800 | 3300028379 | Bacteria | 2102 |
| 479 | Ga0268265_10201549 | 3300028380 | Bacteria | 1727 |
| 480 | Ga0265326_10008590 | 3300028558 | Bacteria | 3075 |
| 481 | Ga0265319_1011852 | 3300028563 | Bacteria | 3548 |
| 482 | Ga0265334_10107478 | 3300028573 | Unclassified | 1005 |
| 483 | Ga0265318_10019491 | 3300028577 | Bacteria | 2750 |
| 484 | Ga0265322_10041864 | 3300028654 | Bacteria | 1304 |
| 485 | Ga0265338_10006047 | 3300028800 | Bacteria | 15544 |
| 486 | Ga0265338_10317865 | 3300028800 | Unclassified | 1128 |
| 487 | Ga0265320_10009345 | 3300031240 | Bacteria | 5921 |
| 488 | Ga0265325_10012878 | 3300031241 | Bacteria | 4772 |
| 489 | Ga0265329_10004307 | 3300031242 | Bacteria | 5953 |
| 490 | Ga0265339_10115406 | 3300031249 | Bacteria | 1385 |
| 491 | Ga0265331_10026006 | 3300031250 | Bacteria | 2949 |
| 492 | Ga0265327_10001417 | 3300031251 | Bacteria | 30531 |
| 493 | Ga0265327_10456348 | 3300031251 | Bacteria | 552 |
| 494 | Ga0265313_10021437 | 3300031595 | Bacteria | 3534 |
| 495 | Ga0265314_10035744 | 3300031711 | Bacteria | 3619 |
| 496 | Ga0265314_10667097 | 3300031711 | Unclassified | 529 |
| 497 | Ga0307413_10562878 | 3300031824 | Unclassified | 927 |
| 498 | Ga0307410_10201664 | 3300031852 | Bacteria | 1519 |
| 499 | Ga0307410_10809036 | 3300031852 | Bacteria | 798 |
| 500 | Ga0307406_10257712 | 3300031901 | Bacteria | 1318 |
| 501 | Ga0307406_10605895 | 3300031901 | Bacteria | 904 |
| 502 | Ga0307407_10454519 | 3300031903 | Bacteria | 930 |
| 503 | Ga0307407_10685047 | 3300031903 | Bacteria | 771 |
| 504 | Ga0307412_10885483 | 3300031911 | Bacteria | 781 |
| 505 | Ga0307409_100217799 | 3300031995 | Bacteria | 1721 |
| 506 | Ga0307409_100434472 | 3300031995 | Bacteria | 1263 |
| 507 | Ga0307409_101047701 | 3300031995 | Bacteria | 835 |
| 508 | Ga0307409_102156078 | 3300031995 | Unclassified | 587 |
| 509 | Ga0307416_100012974 | 3300032002 | Bacteria | 5643 |
| 510 | Ga0307416_100188035 | 3300032002 | Bacteria | 1944 |
| 511 | Ga0307416_100338117 | 3300032002 | Bacteria | 1517 |
| 512 | Ga0307416_103726350 | 3300032002 | Bacteria | 510 |
| 513 | Ga0307414_10725323 | 3300032004 | Bacteria | 902 |
| 514 | Ga0307411_10023699 | 3300032005 | Bacteria | 3642 |
| 515 | Ga0307411_10346079 | 3300032005 | Bacteria | 1210 |
| 516 | Ga0307411_12194601 | 3300032005 | Bacteria | 518 |
| 517 | Ga0307415_100037952 | 3300032126 | Bacteria | 3171 |
| 518 | Ga0307415_100172627 | 3300032126 | Bacteria | 1688 |
| 519 | Ga0307415_100182072 | 3300032126 | Unclassified | 1650 |
| 520 | Ga0373928_0279224 | 3300035084 | Unclassified | 506 |
| 521 | Ga0373929_0094457 | 3300035085 | Bacteria | 746 |
| 522 | Ga0373944_0007872 | 3300035089 | Bacteria | 2868 |
| 523 | Ga0373949_0224020 | 3300035090 | Bacteria | 573 |
| 524 | Ga0373923_0260462 | 3300035111 | Unclassified | 813 |
| 525 | Ga0373932_0162351 | 3300035112 | Bacteria | 774 |
| 526 | Ga0373936_0015357 | 3300035113 | Bacteria | 2935 |
| 527 | Ga0373945_0025360 | 3300035116 | Bacteria | 2059 |
| 528 | Ga0373953_0448925 | 3300035117 | Unclassified | 570 |
| 529 | Ga0373954_0130733 | 3300035118 | Unclassified | 1222 |
| 530 | Ga0373957_0390337 | 3300035120 | Unclassified | 598 |
| 531 | Ga0373943_0010870 | 3300035170 | Bacteria | 4087 |
| 532 | Ga0373943_0079186 | 3300035170 | Bacteria | 1681 |
| 533 | Ga0373946_0006819 | 3300035171 | Bacteria | 4156 |
| 534 | Ga0373931_0118261 | 3300035691 | Unclassified | 1512 |
| 535 | Ga0373935_0530105 | 3300035692 | Bacteria | 857 |
| 536 | Ga0373927_0186204 | 3300035695 | Unclassified | 1362 |
| 537 | Ga0373927_0226215 | 3300035695 | Bacteria | 1229 |
| 538 | Ga0373933_0041817 | 3300035724 | Bacteria | 2707 |
| 539 | Ga0373947_0010630 | 3300035725 | Bacteria | 5280 |
| 540 | Ga0373947_0481418 | 3300035725 | Bacteria | 842 |
| 541 | Ga0373947_1045431 | 3300035725 | Bacteria | 557 |
| 542 | Ga0373937_0115033 | 3300036401 | Bacteria | 2504 |
| 543 | Ga0373925_0007670 | 3300037068 | Bacteria | 7861 |
| 544 | Ga0395899_0340819 | 3300037312 | Unclassified | 1005 |
| 545 | Ga0395899_0884010 | 3300037312 | Unclassified | 546 |
| 546 | Ga0395905_0576929 | 3300037471 | Bacteria | 1026 |
| 547 | Ga0395901_0108378 | 3300038443 | Unclassified | 2916 |
| 548 | Ga0395901_0506327 | 3300038443 | Unclassified | 1229 |
| 549 | Ga0395901_1134368 | 3300038443 | Bacteria | 751 |
| 550 | Ga0436365_0401447 | 3300039437 | Bacteria | 1431 |
| 551 | Ga0436365_0446258 | 3300039437 | Bacteria | 1033 |
| 552 | Ga0439466_0124823 | 3300041411 | Unclassified | 794 |
| 553 | Ga0451798_0066473 | 3300041458 | Bacteria | 1264 |
| 554 | Ga0451835_1130578 | 3300041492 | Bacteria | 730 |
| 555 | Ga0466961_0927488 | 3300044693 | Unclassified | 518 |
| 556 | Ga0466963_0694395 | 3300044694 | Unclassified | 718 |
| 557 | Ga0466964_0097874 | 3300044706 | Bacteria | 1288 |
| 558 | Ga0466957_1349774 | 3300044842 | Bacteria | 518 |
| 559 | Ga0466960_0085131 | 3300044901 | Bacteria | 1601 |
| 560 | Ga0466960_0356284 | 3300044901 | Unclassified | 835 |
| 561 | Ga0466967_0264963 | 3300045976 | Bacteria | 1645 |
| 562 | Ga0466967_0771636 | 3300045976 | Unclassified | 954 |
| 563 | Ga0466967_1027553 | 3300045976 | Bacteria | 821 |
| 564 | Ga0495603_0106419 | 3300046455 | Bacteria | 1637 |
| 565 | Ga0495603_0110674 | 3300046455 | Bacteria | 1602 |
| 566 | Ga0495629_0735519 | 3300046459 | Unclassified | 654 |
| 567 | Ga0495641_0013468 | 3300046461 | Bacteria | 4491 |
| 568 | Ga0495641_0096582 | 3300046461 | Bacteria | 1319 |
| 569 | Ga0495641_0099701 | 3300046461 | Bacteria | 1296 |
| 570 | Ga0495651_0079924 | 3300046462 | Bacteria | 2470 |
| 571 | Ga0495651_0141171 | 3300046462 | Bacteria | 1747 |
| 572 | Ga0495653_0510160 | 3300046463 | Unclassified | 748 |
| 573 | Ga0495580_0012998 | 3300046472 | Bacteria | 6374 |
| 574 | Ga0495582_0003843 | 3300046473 | Bacteria | 8453 |
| 575 | Ga0495582_0117218 | 3300046473 | Unclassified | 1498 |
| 576 | Ga0495582_0166129 | 3300046473 | Unclassified | 1256 |
| 577 | Ga0495582_0478159 | 3300046473 | Bacteria | 720 |
| 578 | Ga0495639_0001097 | 3300046475 | Bacteria | 12206 |
| 579 | Ga0495662_0007574 | 3300046476 | Bacteria | 5358 |
| 580 | Ga0495662_0038728 | 3300046476 | Bacteria | 2304 |
| 581 | Ga0495662_0289653 | 3300046476 | Bacteria | 806 |
| 582 | Ga0495664_0081717 | 3300046477 | Bacteria | 1937 |
| 583 | Ga0495594_0063078 | 3300046499 | Bacteria | 2053 |
| 584 | Ga0495608_0015849 | 3300046511 | Bacteria | 5215 |
| 585 | Ga0495618_0296959 | 3300046514 | Unclassified | 1004 |
| 586 | Ga0495628_0051470 | 3300046516 | Bacteria | 3256 |
| 587 | Ga0495628_0206562 | 3300046516 | Unclassified | 1478 |
| 588 | Ga0495628_1144475 | 3300046516 | Bacteria | 530 |
| 589 | Ga0495630_0035913 | 3300046517 | Bacteria | 3704 |
| 590 | Ga0495630_0270433 | 3300046517 | Bacteria | 1298 |
| 591 | Ga0495666_0009932 | 3300046526 | Bacteria | 4754 |
| 592 | Ga0495652_0097892 | 3300046529 | Bacteria | 2385 |
| 593 | Ga0495665_0010415 | 3300046531 | Bacteria | 5030 |
| 594 | Ga0495640_0191325 | 3300046533 | Bacteria | 1300 |
| 595 | Ga0495640_0681250 | 3300046533 | Unclassified | 617 |
| 596 | Ga0495586_0027249 | 3300046535 | Bacteria | 3058 |
| 597 | Ga0495586_0107578 | 3300046535 | Bacteria | 1551 |
| 598 | Ga0495645_0315045 | 3300046543 | Unclassified | 1018 |
| 599 | Ga0495645_0443493 | 3300046543 | Bacteria | 820 |
| 600 | Ga0495622_0291350 | 3300046557 | Bacteria | 712 |
| 601 | Ga0495667_0000710 | 3300046559 | Bacteria | 21319 |
| 602 | Ga0495667_0699038 | 3300046559 | Unclassified | 628 |
| 603 | Ga0495656_0167470 | 3300046615 | Bacteria | 1072 |
| 604 | Ga0495634_0041133 | 3300046642 | Bacteria | 3139 |
| 605 | Ga0495635_0027662 | 3300046663 | Bacteria | 3943 |
| 606 | Ga0495588_0050404 | 3300046674 | Bacteria | 2142 |
| 607 | Ga0495588_0276745 | 3300046674 | Unclassified | 884 |
| 608 | Ga0495657_0014819 | 3300046675 | Bacteria | 5720 |
| 609 | Ga0495657_0129792 | 3300046675 | Bacteria | 1580 |
| 610 | Ga0495623_0524952 | 3300046679 | Unclassified | 622 |
| 611 | Ga0495646_0055215 | 3300046680 | Bacteria | 2386 |
| 612 | Ga0495647_0070696 | 3300046681 | Unclassified | 1396 |
| 613 | Ga0495647_0135196 | 3300046681 | Unclassified | 1048 |
| 614 | Ga0495658_0150827 | 3300046683 | Unclassified | 1427 |
| 615 | Ga0495658_0180806 | 3300046683 | Bacteria | 1308 |
| 616 | Ga0495658_0194658 | 3300046683 | Bacteria | 1262 |
| 617 | Ga0495658_0927551 | 3300046683 | Bacteria | 556 |
| 618 | Ga0495613_0002744 | 3300046689 | Bacteria | 13227 |
| 619 | Ga0495613_0031525 | 3300046689 | Bacteria | 3938 |
| 620 | Ga0495613_0176990 | 3300046689 | Bacteria | 1512 |
| 621 | Ga0495624_0058538 | 3300046690 | Bacteria | 2419 |
| 622 | Ga0495600_0001198 | 3300046809 | Bacteria | 14193 |
| 623 | Ga0495581_0013950 | 3300047315 | Bacteria | 4660 |
| 624 | Ga0495581_0113220 | 3300047315 | Archaea | 1577 |
| 625 | Ga0495604_0602150 | 3300047317 | Unclassified | 704 |
| 626 | Ga0495604_0696646 | 3300047317 | Unclassified | 645 |
| 627 | Ga0495674_0018517 | 3300047319 | Bacteria | 6482 |
| 628 | Ga0495674_0044450 | 3300047319 | Bacteria | 3949 |
| 629 | Ga0495674_0201171 | 3300047319 | Bacteria | 1652 |
| 630 | Ga0495674_0907549 | 3300047319 | Unclassified | 680 |
| 631 | Ga0495676_0003675 | 3300047321 | Bacteria | 13924 |
| 632 | Ga0495676_0146297 | 3300047321 | Archaea | 1687 |
| 633 | Ga0495676_0812418 | 3300047321 | Bacteria | 602 |
| 634 | Ga0495680_0278639 | 3300047322 | Unclassified | 1179 |
| 635 | Ga0495680_0323199 | 3300047322 | Unclassified | 1079 |
| 636 | Ga0495675_0117233 | 3300047444 | Bacteria | 1660 |
| 637 | Ga0495684_0206667 | 3300047471 | Archaea | 1445 |
| 638 | Ga0495684_0242719 | 3300047471 | Bacteria | 1313 |
| 639 | Ga0495593_0014511 | 3300047673 | Bacteria | 4477 |
| 640 | Ga0495602_0175189 | 3300048088 | Archaea | 1660 |
| 641 | Ga0495614_0003581 | 3300048089 | Bacteria | 6960 |
| 642 | Ga0496100_0049574 | 3300048903 | Archaea | 2716 |
| 643 | Ga0496100_0060617 | 3300048903 | Bacteria | 2490 |
| 644 | Ga0496100_0067397 | 3300048903 | Unclassified | 2377 |
| 645 | Ga0496100_0116117 | 3300048903 | Bacteria | 1867 |
| 646 | Ga0496100_0192098 | 3300048903 | Bacteria | 1483 |
| 647 | Ga0496100_0487486 | 3300048903 | Unclassified | 948 |
| 648 | Ga0496100_1384466 | 3300048903 | Bacteria | 555 |
| 649 | Ga0496101_0012809 | 3300048904 | Bacteria | 5608 |
| 650 | Ga0496101_0014379 | 3300048904 | Bacteria | 5317 |
| 651 | Ga0496101_0095332 | 3300048904 | Bacteria | 2219 |
| 652 | Ga0496101_0281753 | 3300048904 | Bacteria | 1299 |
| 653 | Ga0496101_0333362 | 3300048904 | Unclassified | 1191 |
| 654 | Ga0496102_0007406 | 3300048905 | Bacteria | 9376 |
| 655 | Ga0496102_0081837 | 3300048905 | Bacteria | 2978 |
| 656 | Ga0496102_0204067 | 3300048905 | Bacteria | 1863 |
| 657 | Ga0496102_0225590 | 3300048905 | Unclassified | 1766 |
| 658 | Ga0496102_0368102 | 3300048905 | Bacteria | 1353 |
| 659 | Ga0496102_0611852 | 3300048905 | Bacteria | 1013 |
| 660 | Ga0496102_0682790 | 3300048905 | Bacteria | 950 |
| 661 | Ga0496103_0003232 | 3300048906 | Bacteria | 10001 |
| 662 | Ga0496103_0278943 | 3300048906 | Unclassified | 1075 |
| 663 | Ga0496103_0623215 | 3300048906 | Unclassified | 686 |
| 664 | Ga0496103_0784758 | 3300048906 | Unclassified | 601 |
| 665 | Ga0496104_0081495 | 3300048907 | Bacteria | 3086 |
| 666 | Ga0496104_0112043 | 3300048907 | Bacteria | 2616 |
| 667 | Ga0496104_0119132 | 3300048907 | Bacteria | 2535 |
| 668 | Ga0496104_0156727 | 3300048907 | Bacteria | 2185 |
| 669 | Ga0496104_0475701 | 3300048907 | Bacteria | 1161 |
| 670 | Ga0496104_0789002 | 3300048907 | Bacteria | 856 |
| 671 | Ga0496104_0917562 | 3300048907 | Bacteria | 781 |
| 672 | Ga0496105_0007763 | 3300048908 | Bacteria | 8325 |
| 673 | Ga0496105_0350588 | 3300048908 | Archaea | 1179 |
| 674 | Ga0496105_0385406 | 3300048908 | Bacteria | 1115 |
| 675 | Ga0496105_0701800 | 3300048908 | Bacteria | 777 |
| 676 | Ga0496106_0025917 | 3300048909 | Bacteria | 4362 |
| 677 | Ga0496106_0053480 | 3300048909 | Bacteria | 3049 |
| 678 | Ga0496106_0056212 | 3300048909 | Bacteria | 2975 |
| 679 | Ga0496106_0073335 | 3300048909 | Bacteria | 2619 |
| 680 | Ga0496106_1022478 | 3300048909 | Bacteria | 649 |
| 681 | Ga0496107_0073461 | 3300048910 | Bacteria | 2487 |
| 682 | Ga0496107_0088835 | 3300048910 | Bacteria | 2256 |
| 683 | Ga0496107_0222436 | 3300048910 | Bacteria | 1404 |
| 684 | Ga0496107_0247418 | 3300048910 | Bacteria | 1327 |
| 685 | Ga0496107_0402774 | 3300048910 | Bacteria | 1017 |
| 686 | Ga0496108_0008774 | 3300048911 | Bacteria | 8195 |
| 687 | Ga0496108_0012674 | 3300048911 | Bacteria | 6869 |
| 688 | Ga0496108_0013319 | 3300048911 | Bacteria | 6705 |
| 689 | Ga0496108_0023541 | 3300048911 | Bacteria | 5069 |
| 690 | Ga0496108_0236317 | 3300048911 | Bacteria | 1589 |
| 691 | Ga0496108_0381350 | 3300048911 | Bacteria | 1231 |
| 692 | Ga0496108_0397236 | 3300048911 | Unclassified | 1204 |
| 693 | Ga0496108_0618854 | 3300048911 | Bacteria | 943 |
| 694 | Ga0496108_1026893 | 3300048911 | Bacteria | 703 |
| 695 | Ga0496109_0004944 | 3300048912 | Bacteria | 11127 |
| 696 | Ga0496109_0012839 | 3300048912 | Bacteria | 7239 |
| 697 | Ga0496109_0015520 | 3300048912 | Bacteria | 6641 |
| 698 | Ga0496109_0024292 | 3300048912 | Bacteria | 5386 |
| 699 | Ga0496109_0056579 | 3300048912 | Bacteria | 3579 |
| 700 | Ga0496109_0074235 | 3300048912 | Bacteria | 3126 |
| 701 | Ga0496109_0590666 | 3300048912 | Bacteria | 1046 |
| 702 | Ga0496109_0833684 | 3300048912 | Bacteria | 860 |
| 703 | Ga0496110_0001680 | 3300048913 | Bacteria | 16243 |
| 704 | Ga0496110_0048255 | 3300048913 | Bacteria | 3732 |
| 705 | Ga0496110_0351388 | 3300048913 | Bacteria | 1343 |
| 706 | Ga0496110_0511086 | 3300048913 | Unclassified | 1093 |
| 707 | Ga0496110_0917959 | 3300048913 | Bacteria | 782 |
| 708 | Ga0496111_0000680 | 3300048914 | Bacteria | 17874 |
| 709 | Ga0496111_0047288 | 3300048914 | Bacteria | 3098 |
| 710 | Ga0496111_0049846 | 3300048914 | Bacteria | 3019 |
| 711 | Ga0496111_0057617 | 3300048914 | Bacteria | 2813 |
| 712 | Ga0496111_0405908 | 3300048914 | Bacteria | 1007 |
| 713 | Ga0496112_0003319 | 3300048915 | Bacteria | 13282 |
| 714 | Ga0496112_0006106 | 3300048915 | Bacteria | 10531 |
| 715 | Ga0496112_0027826 | 3300048915 | Bacteria | 5453 |
| 716 | Ga0496112_0038496 | 3300048915 | Bacteria | 4670 |
| 717 | Ga0496112_0132586 | 3300048915 | Bacteria | 2462 |
| 718 | Ga0496112_0403900 | 3300048915 | Bacteria | 1306 |
| 719 | Ga0496112_0417923 | 3300048915 | Bacteria | 1280 |
| 720 | Ga0496113_0018993 | 3300048916 | Bacteria | 4800 |
| 721 | Ga0496113_0034272 | 3300048916 | Bacteria | 3703 |
| 722 | Ga0496113_0679947 | 3300048916 | Bacteria | 822 |
| 723 | Ga0496113_0823470 | 3300048916 | Bacteria | 737 |
| 724 | Ga0496113_0940567 | 3300048916 | Bacteria | 682 |
| 725 | Ga0496114_0013817 | 3300048917 | Bacteria | 6472 |
| 726 | Ga0496114_0032535 | 3300048917 | Bacteria | 4294 |
| 727 | Ga0496114_0037856 | 3300048917 | Bacteria | 3991 |
| 728 | Ga0496114_0097108 | 3300048917 | Bacteria | 2509 |
| 729 | Ga0496114_0316222 | 3300048917 | Unclassified | 1379 |
| 730 | Ga0496114_0793642 | 3300048917 | Bacteria | 825 |
| 731 | Ga0496115_0013903 | 3300048918 | Bacteria | 6091 |
| 732 | Ga0496115_0061273 | 3300048918 | Bacteria | 3033 |
| 733 | Ga0496115_0389391 | 3300048918 | Bacteria | 1132 |
| 734 | Ga0496115_0508301 | 3300048918 | Bacteria | 967 |
| 735 | Ga0496116_0000014 | 3300048919 | Bacteria | 569049 |
| 736 | Ga0496117_0050073 | 3300048920 | Bacteria | 2965 |
| 737 | Ga0496118_0033183 | 3300048921 | Bacteria | 4241 |
| 738 | Ga0496119_0000639 | 3300048922 | Bacteria | 47198 |
| 739 | Ga0501031_0069733 | 3300049568 | Bacteria | 2290 |
| 740 | Ga0501031_0192059 | 3300049568 | Bacteria | 1333 |
| 741 | Ga0501032_0062822 | 3300049569 | Bacteria | 2488 |
| 742 | Ga0501032_0177791 | 3300049569 | Bacteria | 1394 |
| 743 | Ga0501036_0169686 | 3300049572 | Bacteria | 1838 |
| 744 | Ga0501036_0673924 | 3300049572 | Bacteria | 855 |
| 745 | Ga0501037_0190470 | 3300049573 | Bacteria | 1452 |
| 746 | Ga0501038_0037802 | 3300049574 | Bacteria | 4231 |
| 747 | Ga0501039_0050276 | 3300049575 | Bacteria | 3224 |
| 748 | Ga0501039_0191892 | 3300049575 | Bacteria | 1606 |
| 749 | Ga0501040_0062746 | 3300049576 | Bacteria | 2556 |
| 750 | Ga0501040_0111947 | 3300049576 | Bacteria | 1909 |
| 751 | Ga0501040_1245992 | 3300049576 | Bacteria | 540 |
| 752 | Ga0501041_0070252 | 3300049577 | Bacteria | 2149 |
| 753 | Ga0501041_0994736 | 3300049577 | Bacteria | 539 |
| 754 | Ga0501042_0110195 | 3300049578 | Bacteria | 1982 |
| 755 | Ga0501042_1194997 | 3300049578 | Bacteria | 554 |
| 756 | Ga0501043_0140836 | 3300049579 | Bacteria | 1889 |
| 757 | Ga0501046_0092984 | 3300049580 | Bacteria | 2318 |
| 758 | Ga0501046_0458901 | 3300049580 | Bacteria | 916 |
| 759 | Ga0501048_0079467 | 3300049582 | Bacteria | 2314 |
| 760 | Ga0501067_0000043 | 3300049583 | Bacteria | 75533 |
| 761 | Ga0501067_0222689 | 3300049583 | Bacteria | 1051 |
| 762 | Ga0501067_0357469 | 3300049583 | Bacteria | 814 |
| 763 | Ga0501068_0001284 | 3300049584 | Bacteria | 13333 |
| 764 | Ga0501068_0039711 | 3300049584 | Bacteria | 2823 |
| 765 | Ga0501068_0111296 | 3300049584 | Bacteria | 1703 |
| 766 | Ga0501069_0083837 | 3300049585 | Bacteria | 1797 |
| 767 | Ga0501069_0146366 | 3300049585 | Bacteria | 1356 |
| 768 | Ga0501070_0087944 | 3300049586 | Bacteria | 2572 |
| 769 | Ga0501070_0181016 | 3300049586 | Bacteria | 1734 |
| 770 | Ga0501070_0465293 | 3300049586 | Bacteria | 1018 |
| 771 | Ga0501071_0024066 | 3300049587 | Bacteria | 4257 |
| 772 | Ga0501071_0056430 | 3300049587 | Bacteria | 2837 |
| 773 | Ga0501071_0117586 | 3300049587 | Bacteria | 1969 |
| 774 | Ga0501071_0156159 | 3300049587 | Bacteria | 1703 |
| 775 | Ga0501072_0039011 | 3300049588 | Bacteria | 3729 |
| 776 | Ga0501074_0015410 | 3300049590 | Bacteria | 5557 |
| 777 | Ga0501074_0150496 | 3300049590 | Unclassified | 1664 |
| 778 | Ga0501074_0355475 | 3300049590 | Bacteria | 1040 |
| 779 | Ga0501074_0728538 | 3300049590 | Bacteria | 699 |
| 780 | Ga0501075_0650688 | 3300049591 | Bacteria | 803 |
| 781 | Ga0501075_0931206 | 3300049591 | Bacteria | 660 |
| 782 | Ga0501076_0058684 | 3300049592 | Bacteria | 3059 |
| 783 | Ga0501077_0031255 | 3300049593 | Bacteria | 3387 |
| 784 | Ga0501077_0150926 | 3300049593 | Bacteria | 1474 |
| 785 | Ga0501079_0004193 | 3300049741 | Bacteria | 10687 |
| 786 | Ga0501079_0083042 | 3300049741 | Bacteria | 2478 |
| 787 | Ga0501079_0209330 | 3300049741 | Bacteria | 1523 |
| 788 | Ga0501080_0032368 | 3300049742 | Bacteria | 4876 |
| 789 | Ga0501080_0421194 | 3300049742 | Bacteria | 1199 |
| 790 | Ga0501080_1001711 | 3300049742 | Bacteria | 725 |
| 791 | Ga0501081_0022740 | 3300049743 | Bacteria | 4196 |
| 792 | Ga0501081_0084297 | 3300049743 | Bacteria | 2229 |
| 793 | Ga0501081_0112489 | 3300049743 | Unclassified | 1933 |
| 794 | Ga0501083_0421347 | 3300049744 | Bacteria | 869 |
| 795 | Ga0501083_0432497 | 3300049744 | Bacteria | 856 |
| 796 | Ga0501035_0393325 | 3300049822 | Bacteria | 1154 |
| 797 | Ga0501044_0602425 | 3300049823 | Bacteria | 992 |
| 798 | Ga0501045_0361928 | 3300049824 | Bacteria | 1079 |
| 799 | Ga0501045_0576657 | 3300049824 | Bacteria | 834 |
| 800 | nmdc:mga0yw44_72825_c1 | 3300050492 | Bacteria | 2136 |
| 801 | nmdc:mga05p37_1054757_c1 | 3300050507 | Bacteria | 857 |
| 802 | nmdc:mga05p37_41885_c1 | 3300050507 | Bacteria | 5624 |
| 803 | nmdc:mga05p37_943518_c1 | 3300050507 | Bacteria | 924 |
| 804 | nmdc:mga08y16_213134_c1 | 3300050511 | Bacteria | 2000 |
| 805 | nmdc:mga08y16_242897_c1 | 3300050511 | Bacteria | 1861 |
| 806 | nmdc:mga08y16_99361_c1 | 3300050511 | Bacteria | 3030 |
| 807 | nmdc:mga0n895_1136349_c1 | 3300050512 | Bacteria | 757 |
| 808 | nmdc:mga0n895_1436_c1 | 3300050512 | Bacteria | 17804 |
| 809 | nmdc:mga0n895_553678_c1 | 3300050512 | Bacteria | 1156 |
| 810 | nmdc:mga0n895_80274_c1 | 3300050512 | Bacteria | 3250 |
| 811 | nmdc:mga0n895_849478_c1 | 3300050512 | Unclassified | 901 |
| 812 | nmdc:mga0n895_869809_c1 | 3300050512 | Bacteria | 888 |
| 813 | nmdc:mga0rr50_342979_c1 | 3300050513 | Bacteria | 1255 |
| 814 | nmdc:mga0rr50_371124_c1 | 3300050513 | Bacteria | 1205 |
| 815 | nmdc:mga0rr50_40302_c1 | 3300050513 | Bacteria | 3395 |
| 816 | nmdc:mga08x19_100000_c1 | 3300050514 | Bacteria | 1923 |
| 817 | nmdc:mga08x19_220738_c1 | 3300050514 | Archaea | 1302 |
| 818 | nmdc:mga08x19_9167_c1 | 3300050514 | Bacteria | 5907 |
| 819 | nmdc:mga0a205_21069_c1 | 3300050515 | Bacteria | 6163 |
| 820 | nmdc:mga0a205_585832_c1 | 3300050515 | Bacteria | 969 |
| 821 | Ga0495601_0168268 | 3300053077 | Unclassified | 1432 |
| 822 | Ga0495612_0007220 | 3300053078 | Bacteria | 4545 |
| 823 | Ga0495612_0078357 | 3300053078 | Bacteria | 1386 |
| 824 | Ga0495612_0131412 | 3300053078 | Bacteria | 1082 |
| 825 | Ga0495612_0154034 | 3300053078 | Unclassified | 1001 |
| 826 | Ga0495612_0227276 | 3300053078 | Bacteria | 827 |
| 827 | Ga0495595_0727679 | 3300053084 | Unclassified | 509 |
| 828 | Ga0495619_0267562 | 3300053085 | Unclassified | 1184 |
| 829 | Ga0500566_0257370 | 3300053094 | Bacteria | 845 |
| 830 | Ga0501082_0170276 | 3300060353 | Bacteria | 1893 |
| 831 | Ga0501082_0360981 | 3300060353 | Bacteria | 1267 |
| 832 | Ga0530510_0052716 | 3300061734 | Bacteria | 2939 |
| 833 | Ga0530510_0055755 | 3300061734 | Bacteria | 2855 |
| 834 | Ga0530510_0593107 | 3300061734 | Bacteria | 842 |
| 835 | Ga0070699_100415377 | |||
| 836 | Ga0070683_100000409 | |||
| 837 | Ga0070683_100183818 | |||
| 838 | Ga0070683_100311533 | |||
| 839 | Ga0070683_100368863 | |||
| 840 | Ga0070683_101082797 | |||
| 841 | Ga0070683_101121834 | |||
| 842 | Ga0070683_101201325 | |||
| 843 | Ga0070690_100131387 | |||
| 844 | Ga0070690_100149997 | |||
| 845 | Ga0070670_100281079 | |||
| 846 | Ga0068869_100058575 | |||
| 847 | Ga0070680_100035001 | |||
| 848 | Ga0070680_100186998 | |||
| 849 | Ga0070680_100251412 | |||
| 850 | Ga0070680_100515540 | |||
| 851 | Ga0070682_100055291 | |||
| 852 | Ga0070682_100109646 | |||
| 853 | Ga0070682_100149819 | |||
| 854 | Ga0068868_100003392 | |||
| 855 | Ga0068868_100097563 | |||
| 856 | Ga0068868_100107077 | |||
| 857 | Ga0068868_100119954 | |||
| 858 | Ga0070660_100740936 | |||
| 859 | Ga0070689_100019607 | |||
| 860 | Ga0070689_100094471 | |||
| 861 | Ga0070691_10049323 | |||
| 862 | Ga0070691_10150068 | |||
| 863 | Ga0070691_10356527 | |||
| 864 | Ga0070687_100094466 | |||
| 865 | Ga0070687_100285845 | |||
| 866 | Ga0070687_100754111 | |||
| 867 | Ga0070661_100266865 | |||
| 868 | Ga0070661_100276493 | |||
| 869 | Ga0070661_100633014 | |||
| 870 | Ga0070661_100917863 | |||
| 871 | Ga0070661_101044007 | |||
| 872 | Ga0070692_10012117 | |||
| 873 | Ga0070668_100894891 | |||
| 874 | Ga0070668_101024406 | |||
| 875 | Ga0070669_101353301 | |||
| 876 | Ga0070669_101854198 | |||
| 877 | Ga0070675_100254108 | |||
| 878 | Ga0070675_100515841 | |||
| 879 | Ga0070675_100909260 | |||
| 880 | Ga0070671_100317398 | |||
| 881 | Ga0070671_101786634 | |||
| 882 | Ga0070674_100784644 | |||
| 883 | Ga0070674_100864662 | |||
| 884 | Ga0070674_100881816 | |||
| 885 | Ga0070673_100097429 | |||
| 886 | Ga0070688_100121877 | |||
| 887 | Ga0070659_100158169 | |||
| 888 | Ga0070659_100253663 | |||
| 889 | Ga0070659_101168414 | |||
| 890 | Ga0070709_10573870 | |||
| 891 | Ga0070714_100023957 | |||
| 892 | Ga0070714_100175540 | |||
| 893 | Ga0070714_100345189 | |||
| 894 | Ga0070713_100437244 | |||
| 895 | Ga0070713_100669906 | |||
| 896 | Ga0070713_100843319 | |||
| 897 | Ga0070713_101288108 | |||
| 898 | Ga0070713_101645881 | |||
| 899 | Ga0070710_10075684 | |||
| 900 | Ga0070710_10376453 | |||
| 901 | Ga0070701_10124968 | |||
| 902 | Ga0070701_10700493 | |||
| 903 | Ga0070711_100823246 | |||
| 904 | Ga0070705_100107287 | |||
| 905 | Ga0070705_101418738 | |||
| 906 | Ga0070700_100004549 | |||
| 907 | Ga0070700_100026823 | |||
| 908 | Ga0070700_100406520 | |||
| 909 | Ga0070700_100841180 | |||
| 910 | Ga0070700_101557865 | |||
| 911 | Ga0070694_100291550 | |||
| 912 | Ga0070708_100015116 | |||
| 913 | Ga0070708_100032221 | |||
| 914 | Ga0070708_100043562 | |||
| 915 | Ga0070708_100515654 | |||
| 916 | Ga0070708_100561404 | |||
| 917 | Ga0070708_101063652 | |||
| 918 | Ga0070708_101622281 | |||
| 919 | Ga0070663_100208658 | |||
| 920 | Ga0070663_100239977 | |||
| 921 | Ga0070663_101044577 | |||
| 922 | Ga0070678_100399505 | |||
| 923 | Ga0070678_101458436 | |||
| 924 | Ga0070662_100045621 | |||
| 925 | Ga0070662_100131374 | |||
| 926 | Ga0070662_101131780 | |||
| 927 | Ga0070681_10054890 | |||
| 928 | Ga0070681_10200498 | |||
| 929 | Ga0070681_11479485 | |||
| 930 | Ga0070685_10029046 | |||
| 931 | Ga0070685_10863733 | |||
| 932 | Ga0070706_100039381 | |||
| 933 | Ga0070706_100569452 | |||
| 934 | Ga0070707_100022662 | |||
| 935 | Ga0070707_100044147 | |||
| 936 | Ga0070707_100764785 | |||
| 937 | Ga0070698_100077635 | |||
| 938 | Ga0070698_100149654 | |||
| 939 | Ga0070698_100151084 | |||
| 940 | Ga0070699_100019776 | |||
| 941 | Ga0070699_100248770 | |||
| 942 | Ga0070699_100593947 | |||
| 943 | Ga0070699_101368517 | |||
| 944 | Ga0070679_100044827 | |||
| 945 | Ga0070679_100052034 | |||
| 946 | Ga0070679_100068834 | |||
| 947 | Ga0070679_100318192 | |||
| 948 | Ga0070679_100928903 | |||
| 949 | Ga0070684_100003119 | |||
| 950 | Ga0070684_100042042 | |||
| 951 | Ga0070684_100252893 | |||
| 952 | Ga0070684_100524915 | |||
| 953 | Ga0070684_100844525 | |||
| 954 | Ga0070697_100089102 | |||
| 955 | Ga0070697_100618883 | |||
| 956 | Ga0070697_100673615 | |||
| 957 | Ga0070697_101223270 | |||
| 958 | Ga0070672_101888820 | |||
| 959 | Ga0070695_100163800 | |||
| 960 | Ga0070695_100269044 | |||
| 961 | Ga0070695_100435832 | |||
| 962 | Ga0070696_100200153 | |||
| 963 | Ga0070696_100399957 | |||
| 964 | Ga0070696_100405217 | |||
| 965 | Ga0070696_100469323 | |||
| 966 | Ga0070696_100509287 | |||
| 967 | Ga0070693_100016592 | |||
| 968 | Ga0070693_100126729 | |||
| 969 | Ga0070693_100135511 | |||
| 970 | Ga0070693_100343435 | |||
| 971 | Ga0070693_101046110 | |||
| 972 | Ga0070665_100002833 | |||
| 973 | Ga0070665_100090543 | |||
| 974 | Ga0070704_101573803 | |||
| 975 | Ga0068855_100012319 | |||
| 976 | Ga0068855_100041751 | |||
| 977 | Ga0068855_100372881 | |||
| 978 | Ga0070664_100138732 | |||
| 979 | Ga0070664_100559943 | |||
| 980 | Ga0070664_101393235 | |||
| 981 | Ga0068857_100048327 | |||
| 982 | Ga0068854_100021504 | |||
| 983 | Ga0068854_100067494 | |||
| 984 | Ga0068854_100312805 | |||
| 985 | Ga0068854_101851498 | |||
| 986 | Ga0068854_101857238 | |||
| 987 | Ga0068856_100097048 | |||
| 988 | Ga0068856_100195995 | |||
| 989 | Ga0068856_100450983 | |||
| 990 | Ga0068856_100688831 | |||
| 991 | Ga0068856_101603886 | |||
| 992 | Ga0070702_100016763 | |||
| 993 | Ga0070702_100045922 | |||
| 994 | Ga0070702_100255446 | |||
| 995 | Ga0070702_100945359 | |||
| 996 | Ga0070702_100954865 | |||
| 997 | Ga0068852_100033281 | |||
| 998 | Ga0068852_100045150 | |||
| 999 | Ga0068852_100070890 | |||
| 1000 | Ga0068852_100131191 | |||
| 1001 | Ga0068852_101312007 | |||
| 1002 | Ga0068859_100121155 | |||
| 1003 | Ga0068859_101390845 | |||
| 1004 | Ga0068864_100374360 | |||
| 1005 | Ga0068864_100935291 | |||
| 1006 | Ga0068864_101628634 | |||
| 1007 | Ga0068866_10038776 | |||
| 1008 | Ga0068866_10168679 | |||
| 1009 | Ga0068861_100034200 | |||
| 1010 | Ga0068861_102165155 | |||
| 1011 | Ga0068851_10532543 | |||
| 1012 | Ga0068851_10553286 | |||
| 1013 | Ga0068870_10184433 | |||
| 1014 | Ga0068870_10731522 | |||
| 1015 | Ga0068863_100492468 | |||
| 1016 | Ga0068863_100579273 | |||
| 1017 | Ga0068858_100067362 | |||
| 1018 | Ga0068862_100229116 | |||
| 1019 | Ga0081455_10081058 | |||
| 1020 | Ga0081538_10001737 | |||
| 1021 | Ga0081540_1125186 | |||
| 1022 | Ga0081539_10002515 | |||
| 1023 | Ga0081539_10412008 | |||
| 1024 | Ga0081539_10499265 | |||
| 1025 | Ga0070717_10021733 | |||
| 1026 | Ga0070717_10367856 | |||
| 1027 | Ga0075365_10305807 | |||
| 1028 | Ga0075365_10622961 | |||
| 1029 | Ga0070715_10314148 | |||
| 1030 | Ga0070715_10479997 | |||
| 1031 | Ga0070716_100169572 | |||
| 1032 | Ga0070716_100298399 | |||
| 1033 | Ga0070712_100614386 | |||
| 1034 | Ga0070712_101184026 | |||
| 1035 | Ga0070712_101865873 | |||
| 1036 | Ga0097621_100288737 | |||
| 1037 | Ga0097621_100378339 | |||
| 1038 | Ga0068871_100397193 | |||
| 1039 | Ga0075428_101243371 | |||
| 1040 | Ga0075431_102179447 | |||
| 1041 | Ga0075433_10132119 | |||
| 1042 | Ga0075433_10340602 | |||
| 1043 | Ga0075433_10405932 | |||
| 1044 | Ga0075434_100008954 | |||
| 1045 | Ga0075434_100010480 | |||
| 1046 | Ga0075434_100070271 | |||
| 1047 | Ga0075434_100213043 | |||
| 1048 | Ga0075434_100588174 | |||
| 1049 | Ga0075434_100816015 | |||
| 1050 | Ga0075434_101074695 | |||
| 1051 | Ga0075434_101883145 | |||
| 1052 | Ga0075429_100454834 | |||
| 1053 | Ga0075429_100887107 | |||
| 1054 | Ga0068865_100571989 | |||
| 1055 | Ga0068865_100672824 | |||
| 1056 | Ga0075436_100015200 | |||
| 1057 | Ga0075436_100086955 | |||
| 1058 | Ga0075436_100965219 | |||
| 1059 | Ga0097620_100121155 | |||
| 1060 | Ga0097620_101390521 | |||
| 1061 | Ga0075435_100039171 | |||
| 1062 | Ga0075435_100239591 | |||
| 1063 | Ga0075435_100356513 | |||
| 1064 | Ga0075435_100683505 | |||
| 1065 | Ga0099794_10203765 | |||
| 1066 | Ga0105240_10195183 | |||
| 1067 | Ga0105240_10729610 | |||
| 1068 | Ga0111539_10020732 | |||
| 1069 | Ga0111539_10069136 | |||
| 1070 | Ga0111539_10102369 | |||
| 1071 | Ga0111539_10210536 | |||
| 1072 | Ga0111539_10450470 | |||
| 1073 | Ga0111539_11262726 | |||
| 1074 | Ga0111539_11521685 | |||
| 1075 | Ga0105245_10003127 | |||
| 1076 | Ga0105245_10007097 | |||
| 1077 | Ga0105245_10129917 | |||
| 1078 | Ga0105245_10751783 | |||
| 1079 | Ga0105245_10897997 | |||
| 1080 | Ga0105245_11134024 | |||
| 1081 | Ga0105245_11214806 | |||
| 1082 | Ga0105247_11098742 | |||
| 1083 | Ga0114129_10003826 | |||
| 1084 | Ga0114129_11759174 | |||
| 1085 | Ga0105243_10377391 | |||
| 1086 | Ga0105243_10653782 | |||
| 1087 | Ga0105243_11294941 | |||
| 1088 | Ga0105243_11990012 | |||
| 1089 | Ga0105241_10087621 | |||
| 1090 | Ga0105241_10595818 | |||
| 1091 | Ga0105241_10866326 | |||
| 1092 | Ga0105242_10017630 | |||
| 1093 | Ga0105242_10149759 | |||
| 1094 | Ga0105242_10632528 | |||
| 1095 | Ga0105248_10115826 | |||
| 1096 | Ga0105248_10233821 | |||
| 1097 | Ga0105248_11292554 | |||
| 1098 | Ga0105248_11479737 | |||
| 1099 | Ga0105237_10054714 | |||
| 1100 | Ga0105237_10107191 | |||
| 1101 | Ga0105237_10525161 | |||
| 1102 | Ga0105238_10019519 | |||
| 1103 | Ga0105238_10056329 | |||
| 1104 | Ga0105238_10206064 | |||
| 1105 | Ga0105238_10345092 | |||
| 1106 | Ga0105238_12577811 | |||
| 1107 | Ga0105249_10034555 | |||
| 1108 | Ga0105249_10127677 | |||
| 1109 | Ga0105249_10154799 | |||
| 1110 | Ga0105249_10211267 | |||
| 1111 | Ga0105239_10093826 | |||
| 1112 | Ga0105239_10106834 | |||
| 1113 | Ga0105239_10132362 | |||
| 1114 | Ga0105239_10325684 | |||
| 1115 | Ga0105239_10451366 | |||
| 1116 | Ga0105239_10452574 | |||
| 1117 | Ga0105239_13050484 | |||
| 1118 | Ga0105246_10007499 | |||
| 1119 | Ga0105246_10206303 | |||
| 1120 | Ga0105246_11030376 | |||
| 1121 | Ga0157373_10057890 | |||
| 1122 | Ga0157370_10172620 | |||
| 1123 | Ga0157370_10335049 | |||
| 1124 | Ga0157370_10817446 | |||
| 1125 | Ga0157369_10490393 | |||
| 1126 | Ga0157369_10559470 | |||
| 1127 | Ga0157369_10725762 | |||
| 1128 | Ga0157374_10062947 | |||
| 1129 | Ga0157374_10107933 | |||
| 1130 | Ga0157374_10130187 | |||
| 1131 | Ga0157374_10357674 | |||
| 1132 | Ga0157374_11148051 | |||
| 1133 | Ga0157374_11846146 | |||
| 1134 | Ga0157378_10179001 | |||
| 1135 | Ga0157378_11788323 | |||
| 1136 | Ga0163162_10089703 | |||
| 1137 | Ga0163162_10255565 | |||
| 1138 | Ga0157372_10021233 | |||
| 1139 | Ga0157372_10059797 | |||
| 1140 | Ga0157372_10146035 | |||
| 1141 | Ga0157372_10221775 | |||
| 1142 | Ga0157372_11443327 | |||
| 1143 | Ga0157372_12954706 | |||
| 1144 | Ga0157375_10372127 | |||
| 1145 | Ga0157375_10565568 | |||
| 1146 | Ga0157375_13032810 | |||
| 1147 | Ga0157375_13108012 | |||
| 1148 | Ga0163163_10002871 | |||
| 1149 | Ga0163163_10243207 | |||
| 1150 | Ga0163163_10676844 | |||
| 1151 | Ga0163163_10781222 | |||
| 1152 | Ga0163163_11721019 | |||
| 1153 | Ga0157380_10089740 | |||
| 1154 | Ga0157380_10615177 | |||
| 1155 | Ga0157380_10673710 | |||
| 1156 | Ga0182008_10121724 | |||
| 1157 | Ga0182008_10460038 | |||
| 1158 | Ga0157377_10207508 | |||
| 1159 | Ga0157377_10721102 | |||
| 1160 | Ga0157379_10097654 | |||
| 1161 | Ga0157379_11299795 | |||
| 1162 | Ga0157376_10049452 | |||
| 1163 | Ga0157376_10166689 | |||
| 1164 | Ga0197907_11034745 | |||
| 1165 | Ga0206356_10092015 | |||
| 1166 | Ga0206353_10146378 | |||
| 1167 | Ga0206353_10898528 | |||
| 1168 | Ga0213876_10215121 | |||
| 1169 | Ga0224712_10144675 | |||
| 1170 | Ga0207692_10051514 | |||
| 1171 | Ga0207642_10098926 | |||
| 1172 | Ga0207688_10011795 | |||
| 1173 | Ga0207688_10063286 | |||
| 1174 | Ga0207688_10269500 | |||
| 1175 | Ga0207688_10929409 | |||
| 1176 | Ga0207680_10102351 | |||
| 1177 | Ga0207647_10385905 | |||
| 1178 | Ga0207705_10639352 | |||
| 1179 | Ga0207684_10052654 | |||
| 1180 | Ga0207684_10083346 | |||
| 1181 | Ga0207684_10488739 | |||
| 1182 | Ga0207707_10038754 | |||
| 1183 | Ga0207707_11446167 | |||
| 1184 | Ga0207695_10114009 | |||
| 1185 | Ga0207695_10118603 | |||
| 1186 | Ga0207695_10303291 | |||
| 1187 | Ga0207671_10120188 | |||
| 1188 | Ga0207671_10189397 | |||
| 1189 | Ga0207671_10483735 | |||
| 1190 | Ga0207693_10065551 | |||
| 1191 | Ga0207693_10886218 | |||
| 1192 | Ga0207663_10967092 | |||
| 1193 | Ga0207660_10064040 | |||
| 1194 | Ga0207660_10364438 | |||
| 1195 | Ga0207660_10797317 | |||
| 1196 | Ga0207662_10060721 | |||
| 1197 | Ga0207657_10001018 | |||
| 1198 | Ga0207657_10097609 | |||
| 1199 | Ga0207657_10972787 | |||
| 1200 | Ga0207649_10273807 | |||
| 1201 | Ga0207649_10714208 | |||
| 1202 | Ga0207652_10051763 | |||
| 1203 | Ga0207652_10148030 | |||
| 1204 | Ga0207652_10515141 | |||
| 1205 | Ga0207646_10003120 | |||
| 1206 | Ga0207646_10017500 | |||
| 1207 | Ga0207646_10034473 | |||
| 1208 | Ga0207646_10979512 | |||
| 1209 | Ga0207694_10035285 | |||
| 1210 | Ga0207694_10105774 | |||
| 1211 | Ga0207694_10183804 | |||
| 1212 | Ga0207650_10345102 | |||
| 1213 | Ga0207659_10618775 | |||
| 1214 | Ga0207687_10001051 | |||
| 1215 | Ga0207687_10012543 | |||
| 1216 | Ga0207687_10029105 | |||
| 1217 | Ga0207687_10079444 | |||
| 1218 | Ga0207687_10180754 | |||
| 1219 | Ga0207687_10630961 | |||
| 1220 | Ga0207687_11171132 | |||
| 1221 | Ga0207700_10446095 | |||
| 1222 | Ga0207700_10575936 | |||
| 1223 | Ga0207700_10644302 | |||
| 1224 | Ga0207700_10832802 | |||
| 1225 | Ga0207664_10038120 | |||
| 1226 | Ga0207664_10101940 | |||
| 1227 | Ga0207664_10153797 | |||
| 1228 | Ga0207664_11664078 | |||
| 1229 | Ga0207644_10080219 | |||
| 1230 | Ga0207690_10017626 | |||
| 1231 | Ga0207706_10066880 | |||
| 1232 | Ga0207706_10157411 | |||
| 1233 | Ga0207706_10297867 | |||
| 1234 | Ga0207686_11349846 | |||
| 1235 | Ga0207709_10244377 | |||
| 1236 | Ga0207709_11415170 | |||
| 1237 | Ga0207670_10104248 | |||
| 1238 | Ga0207669_10717973 | |||
| 1239 | Ga0207669_10991561 | |||
| 1240 | Ga0207704_10169000 | |||
| 1241 | Ga0207704_10562814 | |||
| 1242 | Ga0207665_10128047 | |||
| 1243 | Ga0207665_10239665 | |||
| 1244 | Ga0207665_10646357 | |||
| 1245 | Ga0207711_10840270 | |||
| 1246 | Ga0207711_10967288 | |||
| 1247 | Ga0207689_10041949 | |||
| 1248 | Ga0207689_11228772 | |||
| 1249 | Ga0207661_10006305 | |||
| 1250 | Ga0207661_10167107 | |||
| 1251 | Ga0207661_10735340 | |||
| 1252 | Ga0207661_12053924 | |||
| 1253 | Ga0207679_10051753 | |||
| 1254 | Ga0207679_10268653 | |||
| 1255 | Ga0207679_10576345 | |||
| 1256 | Ga0207667_10005782 | |||
| 1257 | Ga0207667_10149234 | |||
| 1258 | Ga0207667_10482522 | |||
| 1259 | Ga0207651_10385558 | |||
| 1260 | Ga0207651_10461158 | |||
| 1261 | Ga0207712_10503429 | |||
| 1262 | Ga0207712_10902827 | |||
| 1263 | Ga0207668_10320562 | |||
| 1264 | Ga0207668_10441853 | |||
| 1265 | Ga0207668_11339361 | |||
| 1266 | Ga0207640_10065456 | |||
| 1267 | Ga0207640_10178334 | |||
| 1268 | Ga0207640_10378494 | |||
| 1269 | Ga0207640_10439734 | |||
| 1270 | Ga0207640_10601685 | |||
| 1271 | Ga0207640_10722211 | |||
| 1272 | Ga0207640_11588933 | |||
| 1273 | Ga0207658_10684939 | |||
| 1274 | Ga0207677_10008302 | |||
| 1275 | Ga0207677_10112583 | |||
| 1276 | Ga0207677_10129194 | |||
| 1277 | Ga0207677_10739278 | |||
| 1278 | Ga0207703_10020306 | |||
| 1279 | Ga0207639_10244474 | |||
| 1280 | Ga0207678_10039010 | |||
| 1281 | Ga0207678_10072343 | |||
| 1282 | Ga0207678_10661029 | |||
| 1283 | Ga0207708_10018938 | |||
| 1284 | Ga0207708_10041559 | |||
| 1285 | Ga0207708_10055701 | |||
| 1286 | Ga0207708_10176315 | |||
| 1287 | Ga0207708_10312020 | |||
| 1288 | Ga0207708_10659728 | |||
| 1289 | Ga0207702_10009665 | |||
| 1290 | Ga0207702_10144358 | |||
| 1291 | Ga0207702_10181594 | |||
| 1292 | Ga0207702_11267174 | |||
| 1293 | Ga0207702_11267584 | |||
| 1294 | Ga0207702_12392555 | |||
| 1295 | Ga0207641_10098045 | |||
| 1296 | Ga0207648_10138491 | |||
| 1297 | Ga0207648_10402849 | |||
| 1298 | Ga0207676_11498708 | |||
| 1299 | Ga0207674_10059570 | |||
| 1300 | Ga0207674_10541267 | |||
| 1301 | Ga0207675_100035337 | |||
| 1302 | Ga0207675_101970610 | |||
| 1303 | Ga0207683_10300567 | |||
| 1304 | Ga0207698_10138761 | |||
| 1305 | Ga0207698_10165542 | |||
| 1306 | Ga0209999_1041414 | |||
| 1307 | Ga0209966_1015799 | |||
| 1308 | Ga0207428_10108885 | |||
| 1309 | Ga0207428_10852845 | |||
| 1310 | Ga0207428_10901853 | |||
| 1311 | Ga0268266_10005645 | |||
| 1312 | Ga0268266_10149800 | |||
| 1313 | Ga0268265_10201549 | |||
| 1314 | Ga0265326_10008590 | |||
| 1315 | Ga0265319_1011852 | |||
| 1316 | Ga0265334_10107478 | |||
| 1317 | Ga0265318_10019491 | |||
| 1318 | Ga0265322_10041864 | |||
| 1319 | Ga0265338_10006047 | |||
| 1320 | Ga0265338_10317865 | |||
| 1321 | Ga0265320_10009345 | |||
| 1322 | Ga0265325_10012878 | |||
| 1323 | Ga0265329_10004307 | |||
| 1324 | Ga0265339_10115406 | |||
| 1325 | Ga0265331_10026006 | |||
| 1326 | Ga0265327_10001417 | |||
| 1327 | Ga0265327_10456348 | |||
| 1328 | Ga0265313_10021437 | |||
| 1329 | Ga0265314_10035744 | |||
| 1330 | Ga0265314_10667097 | |||
| 1331 | Ga0307413_10562878 | |||
| 1332 | Ga0307410_10201664 | |||
| 1333 | Ga0307410_10809036 | |||
| 1334 | Ga0307406_10257712 | |||
| 1335 | Ga0307406_10605895 | |||
| 1336 | Ga0307407_10454519 | |||
| 1337 | Ga0307407_10685047 | |||
| 1338 | Ga0307412_10885483 | |||
| 1339 | Ga0307409_100217799 | |||
| 1340 | Ga0307409_100434472 | |||
| 1341 | Ga0307409_101047701 | |||
| 1342 | Ga0307409_102156078 | |||
| 1343 | Ga0307416_100012974 | |||
| 1344 | Ga0307416_100188035 | |||
| 1345 | Ga0307416_100338117 | |||
| 1346 | Ga0307416_103726350 | |||
| 1347 | Ga0307414_10725323 | |||
| 1348 | Ga0307411_10023699 | |||
| 1349 | Ga0307411_10346079 | |||
| 1350 | Ga0307411_12194601 | |||
| 1351 | Ga0307415_100037952 | |||
| 1352 | Ga0307415_100172627 | |||
| 1353 | Ga0307415_100182072 | |||
| 1354 | Ga0373928_0279224 | |||
| 1355 | Ga0373929_0094457 | |||
| 1356 | Ga0373944_0007872 | |||
| 1357 | Ga0373949_0224020 | |||
| 1358 | Ga0373923_0260462 | |||
| 1359 | Ga0373932_0162351 | |||
| 1360 | Ga0373936_0015357 | |||
| 1361 | Ga0373945_0025360 | |||
| 1362 | Ga0373953_0448925 | |||
| 1363 | Ga0373954_0130733 | |||
| 1364 | Ga0373957_0390337 | |||
| 1365 | Ga0373943_0010870 | |||
| 1366 | Ga0373943_0079186 | |||
| 1367 | Ga0373946_0006819 | |||
| 1368 | Ga0373931_0118261 | |||
| 1369 | Ga0373935_0530105 | |||
| 1370 | Ga0373927_0186204 | |||
| 1371 | Ga0373927_0226215 | |||
| 1372 | Ga0373933_0041817 | |||
| 1373 | Ga0373947_0010630 | |||
| 1374 | Ga0373947_0481418 | |||
| 1375 | Ga0373947_1045431 | |||
| 1376 | Ga0373937_0115033 | |||
| 1377 | Ga0373925_0007670 | |||
| 1378 | Ga0395899_0340819 | |||
| 1379 | Ga0395899_0884010 | |||
| 1380 | Ga0395905_0576929 | |||
| 1381 | Ga0395901_0108378 | |||
| 1382 | Ga0395901_0506327 | |||
| 1383 | Ga0395901_1134368 | |||
| 1384 | Ga0436365_0401447 | |||
| 1385 | Ga0436365_0446258 | |||
| 1386 | Ga0439466_0124823 | |||
| 1387 | Ga0451798_0066473 | |||
| 1388 | Ga0451835_1130578 | |||
| 1389 | Ga0466961_0927488 | |||
| 1390 | Ga0466963_0694395 | |||
| 1391 | Ga0466964_0097874 | |||
| 1392 | Ga0466957_1349774 | |||
| 1393 | Ga0466960_0085131 | |||
| 1394 | Ga0466960_0356284 | |||
| 1395 | Ga0466967_0264963 | |||
| 1396 | Ga0466967_0771636 | |||
| 1397 | Ga0466967_1027553 | |||
| 1398 | Ga0495603_0106419 | |||
| 1399 | Ga0495603_0110674 | |||
| 1400 | Ga0495629_0735519 | |||
| 1401 | Ga0495641_0013468 | |||
| 1402 | Ga0495641_0096582 | |||
| 1403 | Ga0495641_0099701 | |||
| 1404 | Ga0495651_0079924 | |||
| 1405 | Ga0495651_0141171 | |||
| 1406 | Ga0495653_0510160 | |||
| 1407 | Ga0495580_0012998 | |||
| 1408 | Ga0495582_0003843 | |||
| 1409 | Ga0495582_0117218 | |||
| 1410 | Ga0495582_0166129 | |||
| 1411 | Ga0495582_0478159 | |||
| 1412 | Ga0495639_0001097 | |||
| 1413 | Ga0495662_0007574 | |||
| 1414 | Ga0495662_0038728 | |||
| 1415 | Ga0495662_0289653 | |||
| 1416 | Ga0495664_0081717 | |||
| 1417 | Ga0495594_0063078 | |||
| 1418 | Ga0495608_0015849 | |||
| 1419 | Ga0495618_0296959 | |||
| 1420 | Ga0495628_0051470 | |||
| 1421 | Ga0495628_0206562 | |||
| 1422 | Ga0495628_1144475 | |||
| 1423 | Ga0495630_0035913 | |||
| 1424 | Ga0495630_0270433 | |||
| 1425 | Ga0495666_0009932 | |||
| 1426 | Ga0495652_0097892 | |||
| 1427 | Ga0495665_0010415 | |||
| 1428 | Ga0495640_0191325 | |||
| 1429 | Ga0495640_0681250 | |||
| 1430 | Ga0495586_0027249 | |||
| 1431 | Ga0495586_0107578 | |||
| 1432 | Ga0495645_0315045 | |||
| 1433 | Ga0495645_0443493 | |||
| 1434 | Ga0495622_0291350 | |||
| 1435 | Ga0495667_0000710 | |||
| 1436 | Ga0495667_0699038 | |||
| 1437 | Ga0495656_0167470 | |||
| 1438 | Ga0495634_0041133 | |||
| 1439 | Ga0495635_0027662 | |||
| 1440 | Ga0495588_0050404 | |||
| 1441 | Ga0495588_0276745 | |||
| 1442 | Ga0495657_0014819 | |||
| 1443 | Ga0495657_0129792 | |||
| 1444 | Ga0495623_0524952 | |||
| 1445 | Ga0495646_0055215 | |||
| 1446 | Ga0495647_0070696 | |||
| 1447 | Ga0495647_0135196 | |||
| 1448 | Ga0495658_0150827 | |||
| 1449 | Ga0495658_0180806 | |||
| 1450 | Ga0495658_0194658 | |||
| 1451 | Ga0495658_0927551 | |||
| 1452 | Ga0495613_0002744 | |||
| 1453 | Ga0495613_0031525 | |||
| 1454 | Ga0495613_0176990 | |||
| 1455 | Ga0495624_0058538 | |||
| 1456 | Ga0495600_0001198 | |||
| 1457 | Ga0495581_0013950 | |||
| 1458 | Ga0495581_0113220 | |||
| 1459 | Ga0495604_0602150 | |||
| 1460 | Ga0495604_0696646 | |||
| 1461 | Ga0495674_0018517 | |||
| 1462 | Ga0495674_0044450 | |||
| 1463 | Ga0495674_0201171 | |||
| 1464 | Ga0495674_0907549 | |||
| 1465 | Ga0495676_0003675 | |||
| 1466 | Ga0495676_0146297 | |||
| 1467 | Ga0495676_0812418 | |||
| 1468 | Ga0495680_0278639 | |||
| 1469 | Ga0495680_0323199 | |||
| 1470 | Ga0495675_0117233 | |||
| 1471 | Ga0495684_0206667 | |||
| 1472 | Ga0495684_0242719 | |||
| 1473 | Ga0495593_0014511 | |||
| 1474 | Ga0495602_0175189 | |||
| 1475 | Ga0495614_0003581 | |||
| 1476 | Ga0496100_0049574 | |||
| 1477 | Ga0496100_0060617 | |||
| 1478 | Ga0496100_0067397 | |||
| 1479 | Ga0496100_0116117 | |||
| 1480 | Ga0496100_0192098 | |||
| 1481 | Ga0496100_0487486 | |||
| 1482 | Ga0496100_1384466 | |||
| 1483 | Ga0496101_0012809 | |||
| 1484 | Ga0496101_0014379 | |||
| 1485 | Ga0496101_0095332 | |||
| 1486 | Ga0496101_0281753 | |||
| 1487 | Ga0496101_0333362 | |||
| 1488 | Ga0496102_0007406 | |||
| 1489 | Ga0496102_0081837 | |||
| 1490 | Ga0496102_0204067 | |||
| 1491 | Ga0496102_0225590 | |||
| 1492 | Ga0496102_0368102 | |||
| 1493 | Ga0496102_0611852 | |||
| 1494 | Ga0496102_0682790 | |||
| 1495 | Ga0496103_0003232 | |||
| 1496 | Ga0496103_0278943 | |||
| 1497 | Ga0496103_0623215 | |||
| 1498 | Ga0496103_0784758 | |||
| 1499 | Ga0496104_0081495 | |||
| 1500 | Ga0496104_0112043 | |||
| 1501 | Ga0496104_0119132 | |||
| 1502 | Ga0496104_0156727 | |||
| 1503 | Ga0496104_0475701 | |||
| 1504 | Ga0496104_0789002 | |||
| 1505 | Ga0496104_0917562 | |||
| 1506 | Ga0496105_0007763 | |||
| 1507 | Ga0496105_0350588 | |||
| 1508 | Ga0496105_0385406 | |||
| 1509 | Ga0496105_0701800 | |||
| 1510 | Ga0496106_0025917 | |||
| 1511 | Ga0496106_0053480 | |||
| 1512 | Ga0496106_0056212 | |||
| 1513 | Ga0496106_0073335 | |||
| 1514 | Ga0496106_1022478 | |||
| 1515 | Ga0496107_0073461 | |||
| 1516 | Ga0496107_0088835 | |||
| 1517 | Ga0496107_0222436 | |||
| 1518 | Ga0496107_0247418 | |||
| 1519 | Ga0496107_0402774 | |||
| 1520 | Ga0496108_0008774 | |||
| 1521 | Ga0496108_0012674 | |||
| 1522 | Ga0496108_0013319 | |||
| 1523 | Ga0496108_0023541 | |||
| 1524 | Ga0496108_0236317 | |||
| 1525 | Ga0496108_0381350 | |||
| 1526 | Ga0496108_0397236 | |||
| 1527 | Ga0496108_0618854 | |||
| 1528 | Ga0496108_1026893 | |||
| 1529 | Ga0496109_0004944 | |||
| 1530 | Ga0496109_0012839 | |||
| 1531 | Ga0496109_0015520 | |||
| 1532 | Ga0496109_0024292 | |||
| 1533 | Ga0496109_0056579 | |||
| 1534 | Ga0496109_0074235 | |||
| 1535 | Ga0496109_0590666 | |||
| 1536 | Ga0496109_0833684 | |||
| 1537 | Ga0496110_0001680 | |||
| 1538 | Ga0496110_0048255 | |||
| 1539 | Ga0496110_0351388 | |||
| 1540 | Ga0496110_0511086 | |||
| 1541 | Ga0496110_0917959 | |||
| 1542 | Ga0496111_0000680 | |||
| 1543 | Ga0496111_0047288 | |||
| 1544 | Ga0496111_0049846 | |||
| 1545 | Ga0496111_0057617 | |||
| 1546 | Ga0496111_0405908 | |||
| 1547 | Ga0496112_0003319 | |||
| 1548 | Ga0496112_0006106 | |||
| 1549 | Ga0496112_0027826 | |||
| 1550 | Ga0496112_0038496 | |||
| 1551 | Ga0496112_0132586 | |||
| 1552 | Ga0496112_0403900 | |||
| 1553 | Ga0496112_0417923 | |||
| 1554 | Ga0496113_0018993 | |||
| 1555 | Ga0496113_0034272 | |||
| 1556 | Ga0496113_0679947 | |||
| 1557 | Ga0496113_0823470 | |||
| 1558 | Ga0496113_0940567 | |||
| 1559 | Ga0496114_0013817 | |||
| 1560 | Ga0496114_0032535 | |||
| 1561 | Ga0496114_0037856 | |||
| 1562 | Ga0496114_0097108 | |||
| 1563 | Ga0496114_0316222 | |||
| 1564 | Ga0496114_0793642 | |||
| 1565 | Ga0496115_0013903 | |||
| 1566 | Ga0496115_0061273 | |||
| 1567 | Ga0496115_0389391 | |||
| 1568 | Ga0496115_0508301 | |||
| 1569 | Ga0496116_0000014 | |||
| 1570 | Ga0496117_0050073 | |||
| 1571 | Ga0496118_0033183 | |||
| 1572 | Ga0496119_0000639 | |||
| 1573 | Ga0501031_0069733 | |||
| 1574 | Ga0501031_0192059 | |||
| 1575 | Ga0501032_0062822 | |||
| 1576 | Ga0501032_0177791 | |||
| 1577 | Ga0501036_0169686 | |||
| 1578 | Ga0501036_0673924 | |||
| 1579 | Ga0501037_0190470 | |||
| 1580 | Ga0501038_0037802 | |||
| 1581 | Ga0501039_0050276 | |||
| 1582 | Ga0501039_0191892 | |||
| 1583 | Ga0501040_0062746 | |||
| 1584 | Ga0501040_0111947 | |||
| 1585 | Ga0501040_1245992 | |||
| 1586 | Ga0501041_0070252 | |||
| 1587 | Ga0501041_0994736 | |||
| 1588 | Ga0501042_0110195 | |||
| 1589 | Ga0501042_1194997 | |||
| 1590 | Ga0501043_0140836 | |||
| 1591 | Ga0501046_0092984 | |||
| 1592 | Ga0501046_0458901 | |||
| 1593 | Ga0501048_0079467 | |||
| 1594 | Ga0501067_0000043 | |||
| 1595 | Ga0501067_0222689 | |||
| 1596 | Ga0501067_0357469 | |||
| 1597 | Ga0501068_0001284 | |||
| 1598 | Ga0501068_0039711 | |||
| 1599 | Ga0501068_0111296 | |||
| 1600 | Ga0501069_0083837 | |||
| 1601 | Ga0501069_0146366 | |||
| 1602 | Ga0501070_0087944 | |||
| 1603 | Ga0501070_0181016 | |||
| 1604 | Ga0501070_0465293 | |||
| 1605 | Ga0501071_0024066 | |||
| 1606 | Ga0501071_0056430 | |||
| 1607 | Ga0501071_0117586 | |||
| 1608 | Ga0501071_0156159 | |||
| 1609 | Ga0501072_0039011 | |||
| 1610 | Ga0501074_0015410 | |||
| 1611 | Ga0501074_0150496 | |||
| 1612 | Ga0501074_0355475 | |||
| 1613 | Ga0501074_0728538 | |||
| 1614 | Ga0501075_0650688 | |||
| 1615 | Ga0501075_0931206 | |||
| 1616 | Ga0501076_0058684 | |||
| 1617 | Ga0501077_0031255 | |||
| 1618 | Ga0501077_0150926 | |||
| 1619 | Ga0501079_0004193 | |||
| 1620 | Ga0501079_0083042 | |||
| 1621 | Ga0501079_0209330 | |||
| 1622 | Ga0501080_0032368 | |||
| 1623 | Ga0501080_0421194 | |||
| 1624 | Ga0501080_1001711 | |||
| 1625 | Ga0501081_0022740 | |||
| 1626 | Ga0501081_0084297 | |||
| 1627 | Ga0501081_0112489 | |||
| 1628 | Ga0501083_0421347 | |||
| 1629 | Ga0501083_0432497 | |||
| 1630 | Ga0501035_0393325 | |||
| 1631 | Ga0501044_0602425 | |||
| 1632 | Ga0501045_0361928 | |||
| 1633 | Ga0501045_0576657 | |||
| 1634 | nmdc:mga0yw44_72825_c1 | |||
| 1635 | nmdc:mga05p37_1054757_c1 | |||
| 1636 | nmdc:mga05p37_41885_c1 | |||
| 1637 | nmdc:mga05p37_943518_c1 | |||
| 1638 | nmdc:mga08y16_213134_c1 | |||
| 1639 | nmdc:mga08y16_242897_c1 | |||
| 1640 | nmdc:mga08y16_99361_c1 | |||
| 1641 | nmdc:mga0n895_1136349_c1 | |||
| 1642 | nmdc:mga0n895_1436_c1 | |||
| 1643 | nmdc:mga0n895_553678_c1 | |||
| 1644 | nmdc:mga0n895_80274_c1 | |||
| 1645 | nmdc:mga0n895_849478_c1 | |||
| 1646 | nmdc:mga0n895_869809_c1 | |||
| 1647 | nmdc:mga0rr50_342979_c1 | |||
| 1648 | nmdc:mga0rr50_371124_c1 | |||
| 1649 | nmdc:mga0rr50_40302_c1 | |||
| 1650 | nmdc:mga08x19_100000_c1 | |||
| 1651 | nmdc:mga08x19_220738_c1 | |||
| 1652 | nmdc:mga08x19_9167_c1 | |||
| 1653 | nmdc:mga0a205_21069_c1 | |||
| 1654 | nmdc:mga0a205_585832_c1 | |||
| 1655 | Ga0495601_0168268 | |||
| 1656 | Ga0495612_0007220 | |||
| 1657 | Ga0495612_0078357 | |||
| 1658 | Ga0495612_0131412 | |||
| 1659 | Ga0495612_0154034 | |||
| 1660 | Ga0495612_0227276 | |||
| 1661 | Ga0495595_0727679 | |||
| 1662 | Ga0495619_0267562 | |||
| 1663 | Ga0500566_0257370 | |||
| 1664 | Ga0501082_0170276 | |||
| 1665 | Ga0501082_0360981 | |||
| 1666 | Ga0530510_0052716 | |||
| 1667 | Ga0530510_0055755 | |||
| 1668 | Ga0530510_0593107 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy