F482776

General Info

Members Datasets Scaffolds Average Seq Length
834 345 1668 130

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100415377|Ga0070699_1004153773
Length 160
Sequence MWARAARSAYDVYVFMPKQRAKPMDRSIRVGEAAELLGVSVDTLRRWTASGRLRVRRSAGDQRLVALSDIHRLQTELRQKRARPIVAQSARNRFPGVVTRVEKDRVAAVVEVQAGAHRLVSLMTAEAAEELALRPGIEVVCVVKATNVVVEIAQSPRRSS

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
190 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
191 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
231 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
264 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
265 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
317 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
318 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
319 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
320 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
325 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
336 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 11.27
Rhizosphere 87.29
Stem 0
Stem Tuber 0
Unclassified 16.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100415377 3300005518 Bacteria 1217
2 Ga0070683_100000409 3300005329 Bacteria 29689
3 Ga0070683_100183818 3300005329 Bacteria 1984
4 Ga0070683_100311533 3300005329 Bacteria 1498
5 Ga0070683_100368863 3300005329 Bacteria 1367
6 Ga0070683_101082797 3300005329 Bacteria 770
7 Ga0070683_101121834 3300005329 Bacteria 756
8 Ga0070683_101201325 3300005329 Unclassified 729
9 Ga0070690_100131387 3300005330 Bacteria 1691
10 Ga0070690_100149997 3300005330 Bacteria 1590
11 Ga0070670_100281079 3300005331 Unclassified 1453
12 Ga0068869_100058575 3300005334 Bacteria 2817
13 Ga0070680_100035001 3300005336 Bacteria 4052
14 Ga0070680_100186998 3300005336 Bacteria 1745
15 Ga0070680_100251412 3300005336 Bacteria 1494
16 Ga0070680_100515540 3300005336 Unclassified 1023
17 Ga0070682_100055291 3300005337 Bacteria 2492
18 Ga0070682_100109646 3300005337 Archaea 1837
19 Ga0070682_100149819 3300005337 Bacteria 1600
20 Ga0068868_100003392 3300005338 Bacteria 11085
21 Ga0068868_100097563 3300005338 Bacteria 2375
22 Ga0068868_100107077 3300005338 Bacteria 2268
23 Ga0068868_100119954 3300005338 Bacteria 2144
24 Ga0070660_100740936 3300005339 Unclassified 825
25 Ga0070689_100019607 3300005340 Bacteria 5003
26 Ga0070689_100094471 3300005340 Bacteria 2361
27 Ga0070691_10049323 3300005341 Archaea 2005
28 Ga0070691_10150068 3300005341 Bacteria 1194
29 Ga0070691_10356527 3300005341 Unclassified 814
30 Ga0070687_100094466 3300005343 Unclassified 1661
31 Ga0070687_100285845 3300005343 Bacteria 1040
32 Ga0070687_100754111 3300005343 Bacteria 685
33 Ga0070661_100266865 3300005344 Bacteria 1324
34 Ga0070661_100276493 3300005344 Bacteria 1301
35 Ga0070661_100633014 3300005344 Bacteria 867
36 Ga0070661_100917863 3300005344 Unclassified 723
37 Ga0070661_101044007 3300005344 Bacteria 679
38 Ga0070692_10012117 3300005345 Bacteria 3979
39 Ga0070668_100894891 3300005347 Bacteria 793
40 Ga0070668_101024406 3300005347 Bacteria 743
41 Ga0070669_101353301 3300005353 Unclassified 617
42 Ga0070669_101854198 3300005353 Bacteria 526
43 Ga0070675_100254108 3300005354 Unclassified 1539
44 Ga0070675_100515841 3300005354 Bacteria 1078
45 Ga0070675_100909260 3300005354 Bacteria 807
46 Ga0070671_100317398 3300005355 Archaea 1327
47 Ga0070671_101786634 3300005355 Bacteria 546
48 Ga0070674_100784644 3300005356 Bacteria 821
49 Ga0070674_100864662 3300005356 Bacteria 785
50 Ga0070674_100881816 3300005356 Bacteria 778
51 Ga0070673_100097429 3300005364 Bacteria 2415
52 Ga0070688_100121877 3300005365 Bacteria 1748
53 Ga0070659_100158169 3300005366 Bacteria 1852
54 Ga0070659_100253663 3300005366 Unclassified 1458
55 Ga0070659_101168414 3300005366 Bacteria 680
56 Ga0070709_10573870 3300005434 Bacteria 866
57 Ga0070714_100023957 3300005435 Bacteria 5020
58 Ga0070714_100175540 3300005435 Bacteria 1947
59 Ga0070714_100345189 3300005435 Bacteria 1397
60 Ga0070713_100437244 3300005436 Bacteria 1227
61 Ga0070713_100669906 3300005436 Bacteria 989
62 Ga0070713_100843319 3300005436 Bacteria 880
63 Ga0070713_101288108 3300005436 Unclassified 708
64 Ga0070713_101645881 3300005436 Bacteria 623
65 Ga0070710_10075684 3300005437 Bacteria 1951
66 Ga0070710_10376453 3300005437 Unclassified 946
67 Ga0070701_10124968 3300005438 Bacteria 1455
68 Ga0070701_10700493 3300005438 Bacteria 681
69 Ga0070711_100823246 3300005439 Bacteria 788
70 Ga0070705_100107287 3300005440 Bacteria 1777
71 Ga0070705_101418738 3300005440 Unclassified 579
72 Ga0070700_100004549 3300005441 Bacteria 7256
73 Ga0070700_100026823 3300005441 Bacteria 3407
74 Ga0070700_100406520 3300005441 Bacteria 1025
75 Ga0070700_100841180 3300005441 Bacteria 742
76 Ga0070700_101557865 3300005441 Bacteria 563
77 Ga0070694_100291550 3300005444 Bacteria 1247
78 Ga0070708_100015116 3300005445 Bacteria 6366
79 Ga0070708_100032221 3300005445 Bacteria 4544
80 Ga0070708_100043562 3300005445 Bacteria 3944
81 Ga0070708_100515654 3300005445 Unclassified 1128
82 Ga0070708_100561404 3300005445 Unclassified 1076
83 Ga0070708_101063652 3300005445 Bacteria 758
84 Ga0070708_101622281 3300005445 Unclassified 602
85 Ga0070663_100208658 3300005455 Bacteria 1528
86 Ga0070663_100239977 3300005455 Bacteria 1430
87 Ga0070663_101044577 3300005455 Bacteria 712
88 Ga0070678_100399505 3300005456 Archaea 1194
89 Ga0070678_101458436 3300005456 Bacteria 640
90 Ga0070662_100045621 3300005457 Bacteria 3146
91 Ga0070662_100131374 3300005457 Bacteria 1931
92 Ga0070662_101131780 3300005457 Bacteria 672
93 Ga0070681_10054890 3300005458 Bacteria 3969
94 Ga0070681_10200498 3300005458 Archaea 1914
95 Ga0070681_11479485 3300005458 Unclassified 603
96 Ga0070685_10029046 3300005466 Bacteria 3069
97 Ga0070685_10863733 3300005466 Bacteria 671
98 Ga0070706_100039381 3300005467 Bacteria 4363
99 Ga0070706_100569452 3300005467 Unclassified 1053
100 Ga0070707_100022662 3300005468 Bacteria 5937
101 Ga0070707_100044147 3300005468 Bacteria 4266
102 Ga0070707_100764785 3300005468 Unclassified 929
103 Ga0070698_100077635 3300005471 Bacteria 3320
104 Ga0070698_100149654 3300005471 Bacteria 2282
105 Ga0070698_100151084 3300005471 Bacteria 2270
106 Ga0070699_100019776 3300005518 Bacteria 5804
107 Ga0070699_100248770 3300005518 Bacteria 1588
108 Ga0070699_100593947 3300005518 Bacteria 1009
109 Ga0070699_101368517 3300005518 Bacteria 649
110 Ga0070679_100044827 3300005530 Bacteria 4406
111 Ga0070679_100052034 3300005530 Bacteria 4080
112 Ga0070679_100068834 3300005530 Bacteria 3531
113 Ga0070679_100318192 3300005530 Bacteria 1505
114 Ga0070679_100928903 3300005530 Bacteria 814
115 Ga0070684_100003119 3300005535 Bacteria 12375
116 Ga0070684_100042042 3300005535 Bacteria 3944
117 Ga0070684_100252893 3300005535 Unclassified 1611
118 Ga0070684_100524915 3300005535 Bacteria 1097
119 Ga0070684_100844525 3300005535 Bacteria 857
120 Ga0070697_100089102 3300005536 Bacteria 2549
121 Ga0070697_100618883 3300005536 Bacteria 952
122 Ga0070697_100673615 3300005536 Bacteria 912
123 Ga0070697_101223270 3300005536 Unclassified 669
124 Ga0070672_101888820 3300005543 Bacteria 537
125 Ga0070695_100163800 3300005545 Bacteria 1563
126 Ga0070695_100269044 3300005545 Unclassified 1248
127 Ga0070695_100435832 3300005545 Unclassified 1001
128 Ga0070696_100200153 3300005546 Bacteria 1491
129 Ga0070696_100399957 3300005546 Bacteria 1074
130 Ga0070696_100405217 3300005546 Bacteria 1068
131 Ga0070696_100469323 3300005546 Unclassified 996
132 Ga0070696_100509287 3300005546 Bacteria 959
133 Ga0070693_100016592 3300005547 Bacteria 3815
134 Ga0070693_100126729 3300005547 Bacteria 1591
135 Ga0070693_100135511 3300005547 Bacteria 1544
136 Ga0070693_100343435 3300005547 Bacteria 1019
137 Ga0070693_101046110 3300005547 Bacteria 620
138 Ga0070665_100002833 3300005548 Bacteria 18780
139 Ga0070665_100090543 3300005548 Bacteria 3065
140 Ga0070704_101573803 3300005549 Bacteria 606
141 Ga0068855_100012319 3300005563 Bacteria 10331
142 Ga0068855_100041751 3300005563 Bacteria 5435
143 Ga0068855_100372881 3300005563 Unclassified 1568
144 Ga0070664_100138732 3300005564 Bacteria 2140
145 Ga0070664_100559943 3300005564 Bacteria 1057
146 Ga0070664_101393235 3300005564 Unclassified 663
147 Ga0068857_100048327 3300005577 Bacteria 3777
148 Ga0068854_100021504 3300005578 Bacteria 4379
149 Ga0068854_100067494 3300005578 Bacteria 2606
150 Ga0068854_100312805 3300005578 Bacteria 1274
151 Ga0068854_101851498 3300005578 Bacteria 554
152 Ga0068854_101857238 3300005578 Bacteria 553
153 Ga0068856_100097048 3300005614 Bacteria 2936
154 Ga0068856_100195995 3300005614 Archaea 2034
155 Ga0068856_100450983 3300005614 Bacteria 1307
156 Ga0068856_100688831 3300005614 Bacteria 1042
157 Ga0068856_101603886 3300005614 Unclassified 664
158 Ga0070702_100016763 3300005615 Bacteria 3766
159 Ga0070702_100045922 3300005615 Bacteria 2474
160 Ga0070702_100255446 3300005615 Bacteria 1190
161 Ga0070702_100945359 3300005615 Bacteria 678
162 Ga0070702_100954865 3300005615 Bacteria 675
163 Ga0068852_100033281 3300005616 Bacteria 4277
164 Ga0068852_100045150 3300005616 Bacteria 3746
165 Ga0068852_100070890 3300005616 Bacteria 3058
166 Ga0068852_100131191 3300005616 Bacteria 2308
167 Ga0068852_101312007 3300005616 Bacteria 745
168 Ga0068859_100121155 3300005617 Archaea 2682
169 Ga0068859_101390845 3300005617 Unclassified 774
170 Ga0068864_100374360 3300005618 Bacteria 1348
171 Ga0068864_100935291 3300005618 Unclassified 857
172 Ga0068864_101628634 3300005618 Unclassified 650
173 Ga0068866_10038776 3300005718 Bacteria 2348
174 Ga0068866_10168679 3300005718 Unclassified 1283
175 Ga0068861_100034200 3300005719 Bacteria 3757
176 Ga0068861_102165155 3300005719 Bacteria 557
177 Ga0068851_10532543 3300005834 Unclassified 708
178 Ga0068851_10553286 3300005834 Bacteria 695
179 Ga0068870_10184433 3300005840 Bacteria 1255
180 Ga0068870_10731522 3300005840 Bacteria 685
181 Ga0068863_100492468 3300005841 Bacteria 1206
182 Ga0068863_100579273 3300005841 Bacteria 1110
183 Ga0068858_100067362 3300005842 Bacteria 3316
184 Ga0068862_100229116 3300005844 Bacteria 1685
185 Ga0081455_10081058 3300005937 Bacteria 2659
186 Ga0081538_10001737 3300005981 Bacteria 22139
187 Ga0081540_1125186 3300005983 Bacteria 1059
188 Ga0081539_10002515 3300005985 Bacteria 25631
189 Ga0081539_10412008 3300005985 Unclassified 561
190 Ga0081539_10499265 3300005985 Bacteria 504
191 Ga0070717_10021733 3300006028 Bacteria 5060
192 Ga0070717_10367856 3300006028 Bacteria 1288
193 Ga0075365_10305807 3300006038 Bacteria 1119
194 Ga0075365_10622961 3300006038 Bacteria 763
195 Ga0070715_10314148 3300006163 Unclassified 843
196 Ga0070715_10479997 3300006163 Bacteria 708
197 Ga0070716_100169572 3300006173 Bacteria 1423
198 Ga0070716_100298399 3300006173 Bacteria 1120
199 Ga0070712_100614386 3300006175 Bacteria 921
200 Ga0070712_101184026 3300006175 Archaea 665
201 Ga0070712_101865873 3300006175 Unclassified 526
202 Ga0097621_100288737 3300006237 Bacteria 1446
203 Ga0097621_100378339 3300006237 Bacteria 1264
204 Ga0068871_100397193 3300006358 Unclassified 1227
205 Ga0075428_101243371 3300006844 Bacteria 784
206 Ga0075431_102179447 3300006847 Unclassified 509
207 Ga0075433_10132119 3300006852 Archaea 2218
208 Ga0075433_10340602 3300006852 Bacteria 1325
209 Ga0075433_10405932 3300006852 Bacteria 1202
210 Ga0075434_100008954 3300006871 Bacteria 9321
211 Ga0075434_100010480 3300006871 Bacteria 8690
212 Ga0075434_100070271 3300006871 Bacteria 3492
213 Ga0075434_100213043 3300006871 Bacteria 1952
214 Ga0075434_100588174 3300006871 Bacteria 1132
215 Ga0075434_100816015 3300006871 Bacteria 949
216 Ga0075434_101074695 3300006871 Bacteria 818
217 Ga0075434_101883145 3300006871 Bacteria 604
218 Ga0075429_100454834 3300006880 Unclassified 1122
219 Ga0075429_100887107 3300006880 Bacteria 781
220 Ga0068865_100571989 3300006881 Bacteria 952
221 Ga0068865_100672824 3300006881 Bacteria 882
222 Ga0075436_100015200 3300006914 Bacteria 5273
223 Ga0075436_100086955 3300006914 Bacteria 2171
224 Ga0075436_100965219 3300006914 Bacteria 639
225 Ga0097620_100121155 3300006931 Archaea 2682
226 Ga0097620_101390521 3300006931 Unclassified 774
227 Ga0075435_100039171 3300007076 Bacteria 3782
228 Ga0075435_100239591 3300007076 Bacteria 1543
229 Ga0075435_100356513 3300007076 Bacteria 1254
230 Ga0075435_100683505 3300007076 Unclassified 892
231 Ga0099794_10203765 3300007265 Bacteria 1013
232 Ga0105240_10195183 3300009093 Bacteria 2378
233 Ga0105240_10729610 3300009093 Unclassified 1079
234 Ga0111539_10020732 3300009094 Bacteria 8092
235 Ga0111539_10069136 3300009094 Bacteria 4170
236 Ga0111539_10102369 3300009094 Bacteria 3361
237 Ga0111539_10210536 3300009094 Bacteria 2265
238 Ga0111539_10450470 3300009094 Bacteria 1499
239 Ga0111539_11262726 3300009094 Unclassified 857
240 Ga0111539_11521685 3300009094 Bacteria 776
241 Ga0105245_10003127 3300009098 Bacteria 14810
242 Ga0105245_10007097 3300009098 Bacteria 9831
243 Ga0105245_10129917 3300009098 Bacteria 2362
244 Ga0105245_10751783 3300009098 Unclassified 1011
245 Ga0105245_10897997 3300009098 Unclassified 928
246 Ga0105245_11134024 3300009098 Bacteria 829
247 Ga0105245_11214806 3300009098 Unclassified 802
248 Ga0105247_11098742 3300009101 Bacteria 627
249 Ga0114129_10003826 3300009147 Bacteria 21203
250 Ga0114129_11759174 3300009147 Bacteria 755
251 Ga0105243_10377391 3300009148 Bacteria 1310
252 Ga0105243_10653782 3300009148 Unclassified 1019
253 Ga0105243_11294941 3300009148 Bacteria 746
254 Ga0105243_11990012 3300009148 Unclassified 615
255 Ga0105241_10087621 3300009174 Bacteria 2451
256 Ga0105241_10595818 3300009174 Bacteria 998
257 Ga0105241_10866326 3300009174 Unclassified 836
258 Ga0105242_10017630 3300009176 Bacteria 5569
259 Ga0105242_10149759 3300009176 Unclassified 2034
260 Ga0105242_10632528 3300009176 Bacteria 1038
261 Ga0105248_10115826 3300009177 Bacteria 3023
262 Ga0105248_10233821 3300009177 Archaea 2069
263 Ga0105248_11292554 3300009177 Bacteria 825
264 Ga0105248_11479737 3300009177 Bacteria 769
265 Ga0105237_10054714 3300009545 Bacteria 3998
266 Ga0105237_10107191 3300009545 Bacteria 2786
267 Ga0105237_10525161 3300009545 Bacteria 1190
268 Ga0105238_10019519 3300009551 Bacteria 6903
269 Ga0105238_10056329 3300009551 Bacteria 3944
270 Ga0105238_10206064 3300009551 Bacteria 1942
271 Ga0105238_10345092 3300009551 Bacteria 1477
272 Ga0105238_12577811 3300009551 Unclassified 545
273 Ga0105249_10034555 3300009553 Bacteria 4583
274 Ga0105249_10127677 3300009553 Bacteria 2423
275 Ga0105249_10154799 3300009553 Bacteria 2210
276 Ga0105249_10211267 3300009553 Bacteria 1905
277 Ga0105239_10093826 3300010375 Bacteria 3314
278 Ga0105239_10106834 3300010375 Bacteria 3101
279 Ga0105239_10132362 3300010375 Bacteria 2775
280 Ga0105239_10325684 3300010375 Bacteria 1733
281 Ga0105239_10451366 3300010375 Bacteria 1458
282 Ga0105239_10452574 3300010375 Bacteria 1457
283 Ga0105239_13050484 3300010375 Bacteria 546
284 Ga0105246_10007499 3300011119 Bacteria 6689
285 Ga0105246_10206303 3300011119 Archaea 1531
286 Ga0105246_11030376 3300011119 Bacteria 747
287 Ga0157373_10057890 3300013100 Bacteria 2748
288 Ga0157370_10172620 3300013104 Bacteria 2009
289 Ga0157370_10335049 3300013104 Bacteria 1395
290 Ga0157370_10817446 3300013104 Bacteria 848
291 Ga0157369_10490393 3300013105 Bacteria 1271
292 Ga0157369_10559470 3300013105 Bacteria 1182
293 Ga0157369_10725762 3300013105 Bacteria 1023
294 Ga0157374_10062947 3300013296 Bacteria 3479
295 Ga0157374_10107933 3300013296 Bacteria 2675
296 Ga0157374_10130187 3300013296 Bacteria 2435
297 Ga0157374_10357674 3300013296 Bacteria 1451
298 Ga0157374_11148051 3300013296 Bacteria 798
299 Ga0157374_11846146 3300013296 Bacteria 630
300 Ga0157378_10179001 3300013297 Bacteria 1993
301 Ga0157378_11788323 3300013297 Bacteria 662
302 Ga0163162_10089703 3300013306 Bacteria 3155
303 Ga0163162_10255565 3300013306 Archaea 1884
304 Ga0157372_10021233 3300013307 Bacteria 7014
305 Ga0157372_10059797 3300013307 Bacteria 4263
306 Ga0157372_10146035 3300013307 Bacteria 2727
307 Ga0157372_10221775 3300013307 Bacteria 2191
308 Ga0157372_11443327 3300013307 Bacteria 793
309 Ga0157372_12954706 3300013307 Unclassified 544
310 Ga0157375_10372127 3300013308 Bacteria 1595
311 Ga0157375_10565568 3300013308 Bacteria 1298
312 Ga0157375_13032810 3300013308 Unclassified 561
313 Ga0157375_13108012 3300013308 Bacteria 554
314 Ga0163163_10002871 3300014325 Bacteria 14576
315 Ga0163163_10243207 3300014325 Bacteria 1849
316 Ga0163163_10676844 3300014325 Bacteria 1095
317 Ga0163163_10781222 3300014325 Bacteria 1018
318 Ga0163163_11721019 3300014325 Bacteria 688
319 Ga0157380_10089740 3300014326 Bacteria 2533
320 Ga0157380_10615177 3300014326 Bacteria 1077
321 Ga0157380_10673710 3300014326 Bacteria 1035
322 Ga0182008_10121724 3300014497 Bacteria 1297
323 Ga0182008_10460038 3300014497 Unclassified 693
324 Ga0157377_10207508 3300014745 Unclassified 1247
325 Ga0157377_10721102 3300014745 Bacteria 726
326 Ga0157379_10097654 3300014968 Bacteria 2637
327 Ga0157379_11299795 3300014968 Bacteria 702
328 Ga0157376_10049452 3300014969 Bacteria 3482
329 Ga0157376_10166689 3300014969 Bacteria 2002
330 Ga0197907_11034745 3300020069 Bacteria 706
331 Ga0206356_10092015 3300020070 Bacteria 654
332 Ga0206353_10146378 3300020082 Bacteria 1688
333 Ga0206353_10898528 3300020082 Bacteria 556
334 Ga0213876_10215121 3300021384 Bacteria 1022
335 Ga0224712_10144675 3300022467 Unclassified 1049
336 Ga0207692_10051514 3300025898 Bacteria 2088
337 Ga0207642_10098926 3300025899 Bacteria 1459
338 Ga0207688_10011795 3300025901 Bacteria 4755
339 Ga0207688_10063286 3300025901 Unclassified 2087
340 Ga0207688_10269500 3300025901 Unclassified 1035
341 Ga0207688_10929409 3300025901 Unclassified 550
342 Ga0207680_10102351 3300025903 Unclassified 1843
343 Ga0207647_10385905 3300025904 Bacteria 790
344 Ga0207705_10639352 3300025909 Unclassified 827
345 Ga0207684_10052654 3300025910 Bacteria 3455
346 Ga0207684_10083346 3300025910 Bacteria 2723
347 Ga0207684_10488739 3300025910 Archaea 1055
348 Ga0207707_10038754 3300025912 Bacteria 4165
349 Ga0207707_11446167 3300025912 Unclassified 547
350 Ga0207695_10114009 3300025913 Bacteria 2679
351 Ga0207695_10118603 3300025913 Bacteria 2617
352 Ga0207695_10303291 3300025913 Archaea 1488
353 Ga0207671_10120188 3300025914 Bacteria 2008
354 Ga0207671_10189397 3300025914 Archaea 1604
355 Ga0207671_10483735 3300025914 Unclassified 987
356 Ga0207693_10065551 3300025915 Bacteria 2844
357 Ga0207693_10886218 3300025915 Archaea 685
358 Ga0207663_10967092 3300025916 Bacteria 682
359 Ga0207660_10064040 3300025917 Bacteria 2652
360 Ga0207660_10364438 3300025917 Bacteria 1160
361 Ga0207660_10797317 3300025917 Bacteria 771
362 Ga0207662_10060721 3300025918 Bacteria 2268
363 Ga0207657_10001018 3300025919 Bacteria 29759
364 Ga0207657_10097609 3300025919 Bacteria 2443
365 Ga0207657_10972787 3300025919 Unclassified 652
366 Ga0207649_10273807 3300025920 Bacteria 1225
367 Ga0207649_10714208 3300025920 Unclassified 778
368 Ga0207652_10051763 3300025921 Bacteria 3522
369 Ga0207652_10148030 3300025921 Bacteria 2102
370 Ga0207652_10515141 3300025921 Unclassified 1076
371 Ga0207646_10003120 3300025922 Bacteria 19012
372 Ga0207646_10017500 3300025922 Bacteria 6706
373 Ga0207646_10034473 3300025922 Bacteria 4574
374 Ga0207646_10979512 3300025922 Bacteria 748
375 Ga0207694_10035285 3300025924 Bacteria 3836
376 Ga0207694_10105774 3300025924 Bacteria 2234
377 Ga0207694_10183804 3300025924 Bacteria 1696
378 Ga0207650_10345102 3300025925 Bacteria 1223
379 Ga0207659_10618775 3300025926 Bacteria 924
380 Ga0207687_10001051 3300025927 Bacteria 18717
381 Ga0207687_10012543 3300025927 Bacteria 5537
382 Ga0207687_10029105 3300025927 Bacteria 3714
383 Ga0207687_10079444 3300025927 Bacteria 2365
384 Ga0207687_10180754 3300025927 Bacteria 1634
385 Ga0207687_10630961 3300025927 Bacteria 905
386 Ga0207687_11171132 3300025927 Bacteria 661
387 Ga0207700_10446095 3300025928 Unclassified 1140
388 Ga0207700_10575936 3300025928 Bacteria 1001
389 Ga0207700_10644302 3300025928 Bacteria 944
390 Ga0207700_10832802 3300025928 Unclassified 825
391 Ga0207664_10038120 3300025929 Bacteria 3725
392 Ga0207664_10101940 3300025929 Bacteria 2373
393 Ga0207664_10153797 3300025929 Archaea 1956
394 Ga0207664_11664078 3300025929 Unclassified 560
395 Ga0207644_10080219 3300025931 Bacteria 2410
396 Ga0207690_10017626 3300025932 Bacteria 4366
397 Ga0207706_10066880 3300025933 Bacteria 3163
398 Ga0207706_10157411 3300025933 Bacteria 1997
399 Ga0207706_10297867 3300025933 Unclassified 1406
400 Ga0207686_11349846 3300025934 Bacteria 586
401 Ga0207709_10244377 3300025935 Bacteria 1307
402 Ga0207709_11415170 3300025935 Bacteria 576
403 Ga0207670_10104248 3300025936 Bacteria 2031
404 Ga0207669_10717973 3300025937 Bacteria 823
405 Ga0207669_10991561 3300025937 Unclassified 706
406 Ga0207704_10169000 3300025938 Unclassified 1566
407 Ga0207704_10562814 3300025938 Bacteria 928
408 Ga0207665_10128047 3300025939 Bacteria 1799
409 Ga0207665_10239665 3300025939 Bacteria 1336
410 Ga0207665_10646357 3300025939 Bacteria 829
411 Ga0207711_10840270 3300025941 Bacteria 855
412 Ga0207711_10967288 3300025941 Unclassified 790
413 Ga0207689_10041949 3300025942 Bacteria 3786
414 Ga0207689_11228772 3300025942 Bacteria 630
415 Ga0207661_10006305 3300025944 Bacteria 8392
416 Ga0207661_10167107 3300025944 Bacteria 1913
417 Ga0207661_10735340 3300025944 Bacteria 908
418 Ga0207661_12053924 3300025944 Unclassified 517
419 Ga0207679_10051753 3300025945 Bacteria 3008
420 Ga0207679_10268653 3300025945 Unclassified 1458
421 Ga0207679_10576345 3300025945 Unclassified 1012
422 Ga0207667_10005782 3300025949 Bacteria 15087
423 Ga0207667_10149234 3300025949 Bacteria 2406
424 Ga0207667_10482522 3300025949 Bacteria 1258
425 Ga0207651_10385558 3300025960 Archaea 1189
426 Ga0207651_10461158 3300025960 Bacteria 1092
427 Ga0207712_10503429 3300025961 Bacteria 1036
428 Ga0207712_10902827 3300025961 Bacteria 781
429 Ga0207668_10320562 3300025972 Bacteria 1286
430 Ga0207668_10441853 3300025972 Bacteria 1108
431 Ga0207668_11339361 3300025972 Bacteria 645
432 Ga0207640_10065456 3300025981 Bacteria 2425
433 Ga0207640_10178334 3300025981 Bacteria 1591
434 Ga0207640_10378494 3300025981 Bacteria 1146
435 Ga0207640_10439734 3300025981 Bacteria 1072
436 Ga0207640_10601685 3300025981 Bacteria 931
437 Ga0207640_10722211 3300025981 Unclassified 856
438 Ga0207640_11588933 3300025981 Bacteria 589
439 Ga0207658_10684939 3300025986 Bacteria 926
440 Ga0207677_10008302 3300026023 Bacteria 5790
441 Ga0207677_10112583 3300026023 Bacteria 2030
442 Ga0207677_10129194 3300026023 Bacteria 1915
443 Ga0207677_10739278 3300026023 Bacteria 876
444 Ga0207703_10020306 3300026035 Bacteria 5194
445 Ga0207639_10244474 3300026041 Bacteria 1562
446 Ga0207678_10039010 3300026067 Bacteria 4123
447 Ga0207678_10072343 3300026067 Bacteria 2954
448 Ga0207678_10661029 3300026067 Unclassified 918
449 Ga0207708_10018938 3300026075 Bacteria 5184
450 Ga0207708_10041559 3300026075 Bacteria 3505
451 Ga0207708_10055701 3300026075 Bacteria 3015
452 Ga0207708_10176315 3300026075 Unclassified 1695
453 Ga0207708_10312020 3300026075 Bacteria 1281
454 Ga0207708_10659728 3300026075 Bacteria 891
455 Ga0207702_10009665 3300026078 Bacteria 8098
456 Ga0207702_10144358 3300026078 Archaea 2158
457 Ga0207702_10181594 3300026078 Bacteria 1938
458 Ga0207702_11267174 3300026078 Bacteria 731
459 Ga0207702_11267584 3300026078 Bacteria 731
460 Ga0207702_12392555 3300026078 Unclassified 515
461 Ga0207641_10098045 3300026088 Bacteria 2577
462 Ga0207648_10138491 3300026089 Bacteria 2145
463 Ga0207648_10402849 3300026089 Bacteria 1240
464 Ga0207676_11498708 3300026095 Bacteria 671
465 Ga0207674_10059570 3300026116 Bacteria 3863
466 Ga0207674_10541267 3300026116 Bacteria 1125
467 Ga0207675_100035337 3300026118 Bacteria 4661
468 Ga0207675_101970610 3300026118 Bacteria 602
469 Ga0207683_10300567 3300026121 Bacteria 1468
470 Ga0207698_10138761 3300026142 Unclassified 2090
471 Ga0207698_10165542 3300026142 Bacteria 1940
472 Ga0209999_1041414 3300027543 Bacteria 863
473 Ga0209966_1015799 3300027695 Bacteria 1421
474 Ga0207428_10108885 3300027907 Bacteria 2134
475 Ga0207428_10852845 3300027907 Bacteria 645
476 Ga0207428_10901853 3300027907 Bacteria 624
477 Ga0268266_10005645 3300028379 Bacteria 11605
478 Ga0268266_10149800 3300028379 Bacteria 2102
479 Ga0268265_10201549 3300028380 Bacteria 1727
480 Ga0265326_10008590 3300028558 Bacteria 3075
481 Ga0265319_1011852 3300028563 Bacteria 3548
482 Ga0265334_10107478 3300028573 Unclassified 1005
483 Ga0265318_10019491 3300028577 Bacteria 2750
484 Ga0265322_10041864 3300028654 Bacteria 1304
485 Ga0265338_10006047 3300028800 Bacteria 15544
486 Ga0265338_10317865 3300028800 Unclassified 1128
487 Ga0265320_10009345 3300031240 Bacteria 5921
488 Ga0265325_10012878 3300031241 Bacteria 4772
489 Ga0265329_10004307 3300031242 Bacteria 5953
490 Ga0265339_10115406 3300031249 Bacteria 1385
491 Ga0265331_10026006 3300031250 Bacteria 2949
492 Ga0265327_10001417 3300031251 Bacteria 30531
493 Ga0265327_10456348 3300031251 Bacteria 552
494 Ga0265313_10021437 3300031595 Bacteria 3534
495 Ga0265314_10035744 3300031711 Bacteria 3619
496 Ga0265314_10667097 3300031711 Unclassified 529
497 Ga0307413_10562878 3300031824 Unclassified 927
498 Ga0307410_10201664 3300031852 Bacteria 1519
499 Ga0307410_10809036 3300031852 Bacteria 798
500 Ga0307406_10257712 3300031901 Bacteria 1318
501 Ga0307406_10605895 3300031901 Bacteria 904
502 Ga0307407_10454519 3300031903 Bacteria 930
503 Ga0307407_10685047 3300031903 Bacteria 771
504 Ga0307412_10885483 3300031911 Bacteria 781
505 Ga0307409_100217799 3300031995 Bacteria 1721
506 Ga0307409_100434472 3300031995 Bacteria 1263
507 Ga0307409_101047701 3300031995 Bacteria 835
508 Ga0307409_102156078 3300031995 Unclassified 587
509 Ga0307416_100012974 3300032002 Bacteria 5643
510 Ga0307416_100188035 3300032002 Bacteria 1944
511 Ga0307416_100338117 3300032002 Bacteria 1517
512 Ga0307416_103726350 3300032002 Bacteria 510
513 Ga0307414_10725323 3300032004 Bacteria 902
514 Ga0307411_10023699 3300032005 Bacteria 3642
515 Ga0307411_10346079 3300032005 Bacteria 1210
516 Ga0307411_12194601 3300032005 Bacteria 518
517 Ga0307415_100037952 3300032126 Bacteria 3171
518 Ga0307415_100172627 3300032126 Bacteria 1688
519 Ga0307415_100182072 3300032126 Unclassified 1650
520 Ga0373928_0279224 3300035084 Unclassified 506
521 Ga0373929_0094457 3300035085 Bacteria 746
522 Ga0373944_0007872 3300035089 Bacteria 2868
523 Ga0373949_0224020 3300035090 Bacteria 573
524 Ga0373923_0260462 3300035111 Unclassified 813
525 Ga0373932_0162351 3300035112 Bacteria 774
526 Ga0373936_0015357 3300035113 Bacteria 2935
527 Ga0373945_0025360 3300035116 Bacteria 2059
528 Ga0373953_0448925 3300035117 Unclassified 570
529 Ga0373954_0130733 3300035118 Unclassified 1222
530 Ga0373957_0390337 3300035120 Unclassified 598
531 Ga0373943_0010870 3300035170 Bacteria 4087
532 Ga0373943_0079186 3300035170 Bacteria 1681
533 Ga0373946_0006819 3300035171 Bacteria 4156
534 Ga0373931_0118261 3300035691 Unclassified 1512
535 Ga0373935_0530105 3300035692 Bacteria 857
536 Ga0373927_0186204 3300035695 Unclassified 1362
537 Ga0373927_0226215 3300035695 Bacteria 1229
538 Ga0373933_0041817 3300035724 Bacteria 2707
539 Ga0373947_0010630 3300035725 Bacteria 5280
540 Ga0373947_0481418 3300035725 Bacteria 842
541 Ga0373947_1045431 3300035725 Bacteria 557
542 Ga0373937_0115033 3300036401 Bacteria 2504
543 Ga0373925_0007670 3300037068 Bacteria 7861
544 Ga0395899_0340819 3300037312 Unclassified 1005
545 Ga0395899_0884010 3300037312 Unclassified 546
546 Ga0395905_0576929 3300037471 Bacteria 1026
547 Ga0395901_0108378 3300038443 Unclassified 2916
548 Ga0395901_0506327 3300038443 Unclassified 1229
549 Ga0395901_1134368 3300038443 Bacteria 751
550 Ga0436365_0401447 3300039437 Bacteria 1431
551 Ga0436365_0446258 3300039437 Bacteria 1033
552 Ga0439466_0124823 3300041411 Unclassified 794
553 Ga0451798_0066473 3300041458 Bacteria 1264
554 Ga0451835_1130578 3300041492 Bacteria 730
555 Ga0466961_0927488 3300044693 Unclassified 518
556 Ga0466963_0694395 3300044694 Unclassified 718
557 Ga0466964_0097874 3300044706 Bacteria 1288
558 Ga0466957_1349774 3300044842 Bacteria 518
559 Ga0466960_0085131 3300044901 Bacteria 1601
560 Ga0466960_0356284 3300044901 Unclassified 835
561 Ga0466967_0264963 3300045976 Bacteria 1645
562 Ga0466967_0771636 3300045976 Unclassified 954
563 Ga0466967_1027553 3300045976 Bacteria 821
564 Ga0495603_0106419 3300046455 Bacteria 1637
565 Ga0495603_0110674 3300046455 Bacteria 1602
566 Ga0495629_0735519 3300046459 Unclassified 654
567 Ga0495641_0013468 3300046461 Bacteria 4491
568 Ga0495641_0096582 3300046461 Bacteria 1319
569 Ga0495641_0099701 3300046461 Bacteria 1296
570 Ga0495651_0079924 3300046462 Bacteria 2470
571 Ga0495651_0141171 3300046462 Bacteria 1747
572 Ga0495653_0510160 3300046463 Unclassified 748
573 Ga0495580_0012998 3300046472 Bacteria 6374
574 Ga0495582_0003843 3300046473 Bacteria 8453
575 Ga0495582_0117218 3300046473 Unclassified 1498
576 Ga0495582_0166129 3300046473 Unclassified 1256
577 Ga0495582_0478159 3300046473 Bacteria 720
578 Ga0495639_0001097 3300046475 Bacteria 12206
579 Ga0495662_0007574 3300046476 Bacteria 5358
580 Ga0495662_0038728 3300046476 Bacteria 2304
581 Ga0495662_0289653 3300046476 Bacteria 806
582 Ga0495664_0081717 3300046477 Bacteria 1937
583 Ga0495594_0063078 3300046499 Bacteria 2053
584 Ga0495608_0015849 3300046511 Bacteria 5215
585 Ga0495618_0296959 3300046514 Unclassified 1004
586 Ga0495628_0051470 3300046516 Bacteria 3256
587 Ga0495628_0206562 3300046516 Unclassified 1478
588 Ga0495628_1144475 3300046516 Bacteria 530
589 Ga0495630_0035913 3300046517 Bacteria 3704
590 Ga0495630_0270433 3300046517 Bacteria 1298
591 Ga0495666_0009932 3300046526 Bacteria 4754
592 Ga0495652_0097892 3300046529 Bacteria 2385
593 Ga0495665_0010415 3300046531 Bacteria 5030
594 Ga0495640_0191325 3300046533 Bacteria 1300
595 Ga0495640_0681250 3300046533 Unclassified 617
596 Ga0495586_0027249 3300046535 Bacteria 3058
597 Ga0495586_0107578 3300046535 Bacteria 1551
598 Ga0495645_0315045 3300046543 Unclassified 1018
599 Ga0495645_0443493 3300046543 Bacteria 820
600 Ga0495622_0291350 3300046557 Bacteria 712
601 Ga0495667_0000710 3300046559 Bacteria 21319
602 Ga0495667_0699038 3300046559 Unclassified 628
603 Ga0495656_0167470 3300046615 Bacteria 1072
604 Ga0495634_0041133 3300046642 Bacteria 3139
605 Ga0495635_0027662 3300046663 Bacteria 3943
606 Ga0495588_0050404 3300046674 Bacteria 2142
607 Ga0495588_0276745 3300046674 Unclassified 884
608 Ga0495657_0014819 3300046675 Bacteria 5720
609 Ga0495657_0129792 3300046675 Bacteria 1580
610 Ga0495623_0524952 3300046679 Unclassified 622
611 Ga0495646_0055215 3300046680 Bacteria 2386
612 Ga0495647_0070696 3300046681 Unclassified 1396
613 Ga0495647_0135196 3300046681 Unclassified 1048
614 Ga0495658_0150827 3300046683 Unclassified 1427
615 Ga0495658_0180806 3300046683 Bacteria 1308
616 Ga0495658_0194658 3300046683 Bacteria 1262
617 Ga0495658_0927551 3300046683 Bacteria 556
618 Ga0495613_0002744 3300046689 Bacteria 13227
619 Ga0495613_0031525 3300046689 Bacteria 3938
620 Ga0495613_0176990 3300046689 Bacteria 1512
621 Ga0495624_0058538 3300046690 Bacteria 2419
622 Ga0495600_0001198 3300046809 Bacteria 14193
623 Ga0495581_0013950 3300047315 Bacteria 4660
624 Ga0495581_0113220 3300047315 Archaea 1577
625 Ga0495604_0602150 3300047317 Unclassified 704
626 Ga0495604_0696646 3300047317 Unclassified 645
627 Ga0495674_0018517 3300047319 Bacteria 6482
628 Ga0495674_0044450 3300047319 Bacteria 3949
629 Ga0495674_0201171 3300047319 Bacteria 1652
630 Ga0495674_0907549 3300047319 Unclassified 680
631 Ga0495676_0003675 3300047321 Bacteria 13924
632 Ga0495676_0146297 3300047321 Archaea 1687
633 Ga0495676_0812418 3300047321 Bacteria 602
634 Ga0495680_0278639 3300047322 Unclassified 1179
635 Ga0495680_0323199 3300047322 Unclassified 1079
636 Ga0495675_0117233 3300047444 Bacteria 1660
637 Ga0495684_0206667 3300047471 Archaea 1445
638 Ga0495684_0242719 3300047471 Bacteria 1313
639 Ga0495593_0014511 3300047673 Bacteria 4477
640 Ga0495602_0175189 3300048088 Archaea 1660
641 Ga0495614_0003581 3300048089 Bacteria 6960
642 Ga0496100_0049574 3300048903 Archaea 2716
643 Ga0496100_0060617 3300048903 Bacteria 2490
644 Ga0496100_0067397 3300048903 Unclassified 2377
645 Ga0496100_0116117 3300048903 Bacteria 1867
646 Ga0496100_0192098 3300048903 Bacteria 1483
647 Ga0496100_0487486 3300048903 Unclassified 948
648 Ga0496100_1384466 3300048903 Bacteria 555
649 Ga0496101_0012809 3300048904 Bacteria 5608
650 Ga0496101_0014379 3300048904 Bacteria 5317
651 Ga0496101_0095332 3300048904 Bacteria 2219
652 Ga0496101_0281753 3300048904 Bacteria 1299
653 Ga0496101_0333362 3300048904 Unclassified 1191
654 Ga0496102_0007406 3300048905 Bacteria 9376
655 Ga0496102_0081837 3300048905 Bacteria 2978
656 Ga0496102_0204067 3300048905 Bacteria 1863
657 Ga0496102_0225590 3300048905 Unclassified 1766
658 Ga0496102_0368102 3300048905 Bacteria 1353
659 Ga0496102_0611852 3300048905 Bacteria 1013
660 Ga0496102_0682790 3300048905 Bacteria 950
661 Ga0496103_0003232 3300048906 Bacteria 10001
662 Ga0496103_0278943 3300048906 Unclassified 1075
663 Ga0496103_0623215 3300048906 Unclassified 686
664 Ga0496103_0784758 3300048906 Unclassified 601
665 Ga0496104_0081495 3300048907 Bacteria 3086
666 Ga0496104_0112043 3300048907 Bacteria 2616
667 Ga0496104_0119132 3300048907 Bacteria 2535
668 Ga0496104_0156727 3300048907 Bacteria 2185
669 Ga0496104_0475701 3300048907 Bacteria 1161
670 Ga0496104_0789002 3300048907 Bacteria 856
671 Ga0496104_0917562 3300048907 Bacteria 781
672 Ga0496105_0007763 3300048908 Bacteria 8325
673 Ga0496105_0350588 3300048908 Archaea 1179
674 Ga0496105_0385406 3300048908 Bacteria 1115
675 Ga0496105_0701800 3300048908 Bacteria 777
676 Ga0496106_0025917 3300048909 Bacteria 4362
677 Ga0496106_0053480 3300048909 Bacteria 3049
678 Ga0496106_0056212 3300048909 Bacteria 2975
679 Ga0496106_0073335 3300048909 Bacteria 2619
680 Ga0496106_1022478 3300048909 Bacteria 649
681 Ga0496107_0073461 3300048910 Bacteria 2487
682 Ga0496107_0088835 3300048910 Bacteria 2256
683 Ga0496107_0222436 3300048910 Bacteria 1404
684 Ga0496107_0247418 3300048910 Bacteria 1327
685 Ga0496107_0402774 3300048910 Bacteria 1017
686 Ga0496108_0008774 3300048911 Bacteria 8195
687 Ga0496108_0012674 3300048911 Bacteria 6869
688 Ga0496108_0013319 3300048911 Bacteria 6705
689 Ga0496108_0023541 3300048911 Bacteria 5069
690 Ga0496108_0236317 3300048911 Bacteria 1589
691 Ga0496108_0381350 3300048911 Bacteria 1231
692 Ga0496108_0397236 3300048911 Unclassified 1204
693 Ga0496108_0618854 3300048911 Bacteria 943
694 Ga0496108_1026893 3300048911 Bacteria 703
695 Ga0496109_0004944 3300048912 Bacteria 11127
696 Ga0496109_0012839 3300048912 Bacteria 7239
697 Ga0496109_0015520 3300048912 Bacteria 6641
698 Ga0496109_0024292 3300048912 Bacteria 5386
699 Ga0496109_0056579 3300048912 Bacteria 3579
700 Ga0496109_0074235 3300048912 Bacteria 3126
701 Ga0496109_0590666 3300048912 Bacteria 1046
702 Ga0496109_0833684 3300048912 Bacteria 860
703 Ga0496110_0001680 3300048913 Bacteria 16243
704 Ga0496110_0048255 3300048913 Bacteria 3732
705 Ga0496110_0351388 3300048913 Bacteria 1343
706 Ga0496110_0511086 3300048913 Unclassified 1093
707 Ga0496110_0917959 3300048913 Bacteria 782
708 Ga0496111_0000680 3300048914 Bacteria 17874
709 Ga0496111_0047288 3300048914 Bacteria 3098
710 Ga0496111_0049846 3300048914 Bacteria 3019
711 Ga0496111_0057617 3300048914 Bacteria 2813
712 Ga0496111_0405908 3300048914 Bacteria 1007
713 Ga0496112_0003319 3300048915 Bacteria 13282
714 Ga0496112_0006106 3300048915 Bacteria 10531
715 Ga0496112_0027826 3300048915 Bacteria 5453
716 Ga0496112_0038496 3300048915 Bacteria 4670
717 Ga0496112_0132586 3300048915 Bacteria 2462
718 Ga0496112_0403900 3300048915 Bacteria 1306
719 Ga0496112_0417923 3300048915 Bacteria 1280
720 Ga0496113_0018993 3300048916 Bacteria 4800
721 Ga0496113_0034272 3300048916 Bacteria 3703
722 Ga0496113_0679947 3300048916 Bacteria 822
723 Ga0496113_0823470 3300048916 Bacteria 737
724 Ga0496113_0940567 3300048916 Bacteria 682
725 Ga0496114_0013817 3300048917 Bacteria 6472
726 Ga0496114_0032535 3300048917 Bacteria 4294
727 Ga0496114_0037856 3300048917 Bacteria 3991
728 Ga0496114_0097108 3300048917 Bacteria 2509
729 Ga0496114_0316222 3300048917 Unclassified 1379
730 Ga0496114_0793642 3300048917 Bacteria 825
731 Ga0496115_0013903 3300048918 Bacteria 6091
732 Ga0496115_0061273 3300048918 Bacteria 3033
733 Ga0496115_0389391 3300048918 Bacteria 1132
734 Ga0496115_0508301 3300048918 Bacteria 967
735 Ga0496116_0000014 3300048919 Bacteria 569049
736 Ga0496117_0050073 3300048920 Bacteria 2965
737 Ga0496118_0033183 3300048921 Bacteria 4241
738 Ga0496119_0000639 3300048922 Bacteria 47198
739 Ga0501031_0069733 3300049568 Bacteria 2290
740 Ga0501031_0192059 3300049568 Bacteria 1333
741 Ga0501032_0062822 3300049569 Bacteria 2488
742 Ga0501032_0177791 3300049569 Bacteria 1394
743 Ga0501036_0169686 3300049572 Bacteria 1838
744 Ga0501036_0673924 3300049572 Bacteria 855
745 Ga0501037_0190470 3300049573 Bacteria 1452
746 Ga0501038_0037802 3300049574 Bacteria 4231
747 Ga0501039_0050276 3300049575 Bacteria 3224
748 Ga0501039_0191892 3300049575 Bacteria 1606
749 Ga0501040_0062746 3300049576 Bacteria 2556
750 Ga0501040_0111947 3300049576 Bacteria 1909
751 Ga0501040_1245992 3300049576 Bacteria 540
752 Ga0501041_0070252 3300049577 Bacteria 2149
753 Ga0501041_0994736 3300049577 Bacteria 539
754 Ga0501042_0110195 3300049578 Bacteria 1982
755 Ga0501042_1194997 3300049578 Bacteria 554
756 Ga0501043_0140836 3300049579 Bacteria 1889
757 Ga0501046_0092984 3300049580 Bacteria 2318
758 Ga0501046_0458901 3300049580 Bacteria 916
759 Ga0501048_0079467 3300049582 Bacteria 2314
760 Ga0501067_0000043 3300049583 Bacteria 75533
761 Ga0501067_0222689 3300049583 Bacteria 1051
762 Ga0501067_0357469 3300049583 Bacteria 814
763 Ga0501068_0001284 3300049584 Bacteria 13333
764 Ga0501068_0039711 3300049584 Bacteria 2823
765 Ga0501068_0111296 3300049584 Bacteria 1703
766 Ga0501069_0083837 3300049585 Bacteria 1797
767 Ga0501069_0146366 3300049585 Bacteria 1356
768 Ga0501070_0087944 3300049586 Bacteria 2572
769 Ga0501070_0181016 3300049586 Bacteria 1734
770 Ga0501070_0465293 3300049586 Bacteria 1018
771 Ga0501071_0024066 3300049587 Bacteria 4257
772 Ga0501071_0056430 3300049587 Bacteria 2837
773 Ga0501071_0117586 3300049587 Bacteria 1969
774 Ga0501071_0156159 3300049587 Bacteria 1703
775 Ga0501072_0039011 3300049588 Bacteria 3729
776 Ga0501074_0015410 3300049590 Bacteria 5557
777 Ga0501074_0150496 3300049590 Unclassified 1664
778 Ga0501074_0355475 3300049590 Bacteria 1040
779 Ga0501074_0728538 3300049590 Bacteria 699
780 Ga0501075_0650688 3300049591 Bacteria 803
781 Ga0501075_0931206 3300049591 Bacteria 660
782 Ga0501076_0058684 3300049592 Bacteria 3059
783 Ga0501077_0031255 3300049593 Bacteria 3387
784 Ga0501077_0150926 3300049593 Bacteria 1474
785 Ga0501079_0004193 3300049741 Bacteria 10687
786 Ga0501079_0083042 3300049741 Bacteria 2478
787 Ga0501079_0209330 3300049741 Bacteria 1523
788 Ga0501080_0032368 3300049742 Bacteria 4876
789 Ga0501080_0421194 3300049742 Bacteria 1199
790 Ga0501080_1001711 3300049742 Bacteria 725
791 Ga0501081_0022740 3300049743 Bacteria 4196
792 Ga0501081_0084297 3300049743 Bacteria 2229
793 Ga0501081_0112489 3300049743 Unclassified 1933
794 Ga0501083_0421347 3300049744 Bacteria 869
795 Ga0501083_0432497 3300049744 Bacteria 856
796 Ga0501035_0393325 3300049822 Bacteria 1154
797 Ga0501044_0602425 3300049823 Bacteria 992
798 Ga0501045_0361928 3300049824 Bacteria 1079
799 Ga0501045_0576657 3300049824 Bacteria 834
800 nmdc:mga0yw44_72825_c1 3300050492 Bacteria 2136
801 nmdc:mga05p37_1054757_c1 3300050507 Bacteria 857
802 nmdc:mga05p37_41885_c1 3300050507 Bacteria 5624
803 nmdc:mga05p37_943518_c1 3300050507 Bacteria 924
804 nmdc:mga08y16_213134_c1 3300050511 Bacteria 2000
805 nmdc:mga08y16_242897_c1 3300050511 Bacteria 1861
806 nmdc:mga08y16_99361_c1 3300050511 Bacteria 3030
807 nmdc:mga0n895_1136349_c1 3300050512 Bacteria 757
808 nmdc:mga0n895_1436_c1 3300050512 Bacteria 17804
809 nmdc:mga0n895_553678_c1 3300050512 Bacteria 1156
810 nmdc:mga0n895_80274_c1 3300050512 Bacteria 3250
811 nmdc:mga0n895_849478_c1 3300050512 Unclassified 901
812 nmdc:mga0n895_869809_c1 3300050512 Bacteria 888
813 nmdc:mga0rr50_342979_c1 3300050513 Bacteria 1255
814 nmdc:mga0rr50_371124_c1 3300050513 Bacteria 1205
815 nmdc:mga0rr50_40302_c1 3300050513 Bacteria 3395
816 nmdc:mga08x19_100000_c1 3300050514 Bacteria 1923
817 nmdc:mga08x19_220738_c1 3300050514 Archaea 1302
818 nmdc:mga08x19_9167_c1 3300050514 Bacteria 5907
819 nmdc:mga0a205_21069_c1 3300050515 Bacteria 6163
820 nmdc:mga0a205_585832_c1 3300050515 Bacteria 969
821 Ga0495601_0168268 3300053077 Unclassified 1432
822 Ga0495612_0007220 3300053078 Bacteria 4545
823 Ga0495612_0078357 3300053078 Bacteria 1386
824 Ga0495612_0131412 3300053078 Bacteria 1082
825 Ga0495612_0154034 3300053078 Unclassified 1001
826 Ga0495612_0227276 3300053078 Bacteria 827
827 Ga0495595_0727679 3300053084 Unclassified 509
828 Ga0495619_0267562 3300053085 Unclassified 1184
829 Ga0500566_0257370 3300053094 Bacteria 845
830 Ga0501082_0170276 3300060353 Bacteria 1893
831 Ga0501082_0360981 3300060353 Bacteria 1267
832 Ga0530510_0052716 3300061734 Bacteria 2939
833 Ga0530510_0055755 3300061734 Bacteria 2855
834 Ga0530510_0593107 3300061734 Bacteria 842
835 Ga0070699_100415377
836 Ga0070683_100000409
837 Ga0070683_100183818
838 Ga0070683_100311533
839 Ga0070683_100368863
840 Ga0070683_101082797
841 Ga0070683_101121834
842 Ga0070683_101201325
843 Ga0070690_100131387
844 Ga0070690_100149997
845 Ga0070670_100281079
846 Ga0068869_100058575
847 Ga0070680_100035001
848 Ga0070680_100186998
849 Ga0070680_100251412
850 Ga0070680_100515540
851 Ga0070682_100055291
852 Ga0070682_100109646
853 Ga0070682_100149819
854 Ga0068868_100003392
855 Ga0068868_100097563
856 Ga0068868_100107077
857 Ga0068868_100119954
858 Ga0070660_100740936
859 Ga0070689_100019607
860 Ga0070689_100094471
861 Ga0070691_10049323
862 Ga0070691_10150068
863 Ga0070691_10356527
864 Ga0070687_100094466
865 Ga0070687_100285845
866 Ga0070687_100754111
867 Ga0070661_100266865
868 Ga0070661_100276493
869 Ga0070661_100633014
870 Ga0070661_100917863
871 Ga0070661_101044007
872 Ga0070692_10012117
873 Ga0070668_100894891
874 Ga0070668_101024406
875 Ga0070669_101353301
876 Ga0070669_101854198
877 Ga0070675_100254108
878 Ga0070675_100515841
879 Ga0070675_100909260
880 Ga0070671_100317398
881 Ga0070671_101786634
882 Ga0070674_100784644
883 Ga0070674_100864662
884 Ga0070674_100881816
885 Ga0070673_100097429
886 Ga0070688_100121877
887 Ga0070659_100158169
888 Ga0070659_100253663
889 Ga0070659_101168414
890 Ga0070709_10573870
891 Ga0070714_100023957
892 Ga0070714_100175540
893 Ga0070714_100345189
894 Ga0070713_100437244
895 Ga0070713_100669906
896 Ga0070713_100843319
897 Ga0070713_101288108
898 Ga0070713_101645881
899 Ga0070710_10075684
900 Ga0070710_10376453
901 Ga0070701_10124968
902 Ga0070701_10700493
903 Ga0070711_100823246
904 Ga0070705_100107287
905 Ga0070705_101418738
906 Ga0070700_100004549
907 Ga0070700_100026823
908 Ga0070700_100406520
909 Ga0070700_100841180
910 Ga0070700_101557865
911 Ga0070694_100291550
912 Ga0070708_100015116
913 Ga0070708_100032221
914 Ga0070708_100043562
915 Ga0070708_100515654
916 Ga0070708_100561404
917 Ga0070708_101063652
918 Ga0070708_101622281
919 Ga0070663_100208658
920 Ga0070663_100239977
921 Ga0070663_101044577
922 Ga0070678_100399505
923 Ga0070678_101458436
924 Ga0070662_100045621
925 Ga0070662_100131374
926 Ga0070662_101131780
927 Ga0070681_10054890
928 Ga0070681_10200498
929 Ga0070681_11479485
930 Ga0070685_10029046
931 Ga0070685_10863733
932 Ga0070706_100039381
933 Ga0070706_100569452
934 Ga0070707_100022662
935 Ga0070707_100044147
936 Ga0070707_100764785
937 Ga0070698_100077635
938 Ga0070698_100149654
939 Ga0070698_100151084
940 Ga0070699_100019776
941 Ga0070699_100248770
942 Ga0070699_100593947
943 Ga0070699_101368517
944 Ga0070679_100044827
945 Ga0070679_100052034
946 Ga0070679_100068834
947 Ga0070679_100318192
948 Ga0070679_100928903
949 Ga0070684_100003119
950 Ga0070684_100042042
951 Ga0070684_100252893
952 Ga0070684_100524915
953 Ga0070684_100844525
954 Ga0070697_100089102
955 Ga0070697_100618883
956 Ga0070697_100673615
957 Ga0070697_101223270
958 Ga0070672_101888820
959 Ga0070695_100163800
960 Ga0070695_100269044
961 Ga0070695_100435832
962 Ga0070696_100200153
963 Ga0070696_100399957
964 Ga0070696_100405217
965 Ga0070696_100469323
966 Ga0070696_100509287
967 Ga0070693_100016592
968 Ga0070693_100126729
969 Ga0070693_100135511
970 Ga0070693_100343435
971 Ga0070693_101046110
972 Ga0070665_100002833
973 Ga0070665_100090543
974 Ga0070704_101573803
975 Ga0068855_100012319
976 Ga0068855_100041751
977 Ga0068855_100372881
978 Ga0070664_100138732
979 Ga0070664_100559943
980 Ga0070664_101393235
981 Ga0068857_100048327
982 Ga0068854_100021504
983 Ga0068854_100067494
984 Ga0068854_100312805
985 Ga0068854_101851498
986 Ga0068854_101857238
987 Ga0068856_100097048
988 Ga0068856_100195995
989 Ga0068856_100450983
990 Ga0068856_100688831
991 Ga0068856_101603886
992 Ga0070702_100016763
993 Ga0070702_100045922
994 Ga0070702_100255446
995 Ga0070702_100945359
996 Ga0070702_100954865
997 Ga0068852_100033281
998 Ga0068852_100045150
999 Ga0068852_100070890
1000 Ga0068852_100131191
1001 Ga0068852_101312007
1002 Ga0068859_100121155
1003 Ga0068859_101390845
1004 Ga0068864_100374360
1005 Ga0068864_100935291
1006 Ga0068864_101628634
1007 Ga0068866_10038776
1008 Ga0068866_10168679
1009 Ga0068861_100034200
1010 Ga0068861_102165155
1011 Ga0068851_10532543
1012 Ga0068851_10553286
1013 Ga0068870_10184433
1014 Ga0068870_10731522
1015 Ga0068863_100492468
1016 Ga0068863_100579273
1017 Ga0068858_100067362
1018 Ga0068862_100229116
1019 Ga0081455_10081058
1020 Ga0081538_10001737
1021 Ga0081540_1125186
1022 Ga0081539_10002515
1023 Ga0081539_10412008
1024 Ga0081539_10499265
1025 Ga0070717_10021733
1026 Ga0070717_10367856
1027 Ga0075365_10305807
1028 Ga0075365_10622961
1029 Ga0070715_10314148
1030 Ga0070715_10479997
1031 Ga0070716_100169572
1032 Ga0070716_100298399
1033 Ga0070712_100614386
1034 Ga0070712_101184026
1035 Ga0070712_101865873
1036 Ga0097621_100288737
1037 Ga0097621_100378339
1038 Ga0068871_100397193
1039 Ga0075428_101243371
1040 Ga0075431_102179447
1041 Ga0075433_10132119
1042 Ga0075433_10340602
1043 Ga0075433_10405932
1044 Ga0075434_100008954
1045 Ga0075434_100010480
1046 Ga0075434_100070271
1047 Ga0075434_100213043
1048 Ga0075434_100588174
1049 Ga0075434_100816015
1050 Ga0075434_101074695
1051 Ga0075434_101883145
1052 Ga0075429_100454834
1053 Ga0075429_100887107
1054 Ga0068865_100571989
1055 Ga0068865_100672824
1056 Ga0075436_100015200
1057 Ga0075436_100086955
1058 Ga0075436_100965219
1059 Ga0097620_100121155
1060 Ga0097620_101390521
1061 Ga0075435_100039171
1062 Ga0075435_100239591
1063 Ga0075435_100356513
1064 Ga0075435_100683505
1065 Ga0099794_10203765
1066 Ga0105240_10195183
1067 Ga0105240_10729610
1068 Ga0111539_10020732
1069 Ga0111539_10069136
1070 Ga0111539_10102369
1071 Ga0111539_10210536
1072 Ga0111539_10450470
1073 Ga0111539_11262726
1074 Ga0111539_11521685
1075 Ga0105245_10003127
1076 Ga0105245_10007097
1077 Ga0105245_10129917
1078 Ga0105245_10751783
1079 Ga0105245_10897997
1080 Ga0105245_11134024
1081 Ga0105245_11214806
1082 Ga0105247_11098742
1083 Ga0114129_10003826
1084 Ga0114129_11759174
1085 Ga0105243_10377391
1086 Ga0105243_10653782
1087 Ga0105243_11294941
1088 Ga0105243_11990012
1089 Ga0105241_10087621
1090 Ga0105241_10595818
1091 Ga0105241_10866326
1092 Ga0105242_10017630
1093 Ga0105242_10149759
1094 Ga0105242_10632528
1095 Ga0105248_10115826
1096 Ga0105248_10233821
1097 Ga0105248_11292554
1098 Ga0105248_11479737
1099 Ga0105237_10054714
1100 Ga0105237_10107191
1101 Ga0105237_10525161
1102 Ga0105238_10019519
1103 Ga0105238_10056329
1104 Ga0105238_10206064
1105 Ga0105238_10345092
1106 Ga0105238_12577811
1107 Ga0105249_10034555
1108 Ga0105249_10127677
1109 Ga0105249_10154799
1110 Ga0105249_10211267
1111 Ga0105239_10093826
1112 Ga0105239_10106834
1113 Ga0105239_10132362
1114 Ga0105239_10325684
1115 Ga0105239_10451366
1116 Ga0105239_10452574
1117 Ga0105239_13050484
1118 Ga0105246_10007499
1119 Ga0105246_10206303
1120 Ga0105246_11030376
1121 Ga0157373_10057890
1122 Ga0157370_10172620
1123 Ga0157370_10335049
1124 Ga0157370_10817446
1125 Ga0157369_10490393
1126 Ga0157369_10559470
1127 Ga0157369_10725762
1128 Ga0157374_10062947
1129 Ga0157374_10107933
1130 Ga0157374_10130187
1131 Ga0157374_10357674
1132 Ga0157374_11148051
1133 Ga0157374_11846146
1134 Ga0157378_10179001
1135 Ga0157378_11788323
1136 Ga0163162_10089703
1137 Ga0163162_10255565
1138 Ga0157372_10021233
1139 Ga0157372_10059797
1140 Ga0157372_10146035
1141 Ga0157372_10221775
1142 Ga0157372_11443327
1143 Ga0157372_12954706
1144 Ga0157375_10372127
1145 Ga0157375_10565568
1146 Ga0157375_13032810
1147 Ga0157375_13108012
1148 Ga0163163_10002871
1149 Ga0163163_10243207
1150 Ga0163163_10676844
1151 Ga0163163_10781222
1152 Ga0163163_11721019
1153 Ga0157380_10089740
1154 Ga0157380_10615177
1155 Ga0157380_10673710
1156 Ga0182008_10121724
1157 Ga0182008_10460038
1158 Ga0157377_10207508
1159 Ga0157377_10721102
1160 Ga0157379_10097654
1161 Ga0157379_11299795
1162 Ga0157376_10049452
1163 Ga0157376_10166689
1164 Ga0197907_11034745
1165 Ga0206356_10092015
1166 Ga0206353_10146378
1167 Ga0206353_10898528
1168 Ga0213876_10215121
1169 Ga0224712_10144675
1170 Ga0207692_10051514
1171 Ga0207642_10098926
1172 Ga0207688_10011795
1173 Ga0207688_10063286
1174 Ga0207688_10269500
1175 Ga0207688_10929409
1176 Ga0207680_10102351
1177 Ga0207647_10385905
1178 Ga0207705_10639352
1179 Ga0207684_10052654
1180 Ga0207684_10083346
1181 Ga0207684_10488739
1182 Ga0207707_10038754
1183 Ga0207707_11446167
1184 Ga0207695_10114009
1185 Ga0207695_10118603
1186 Ga0207695_10303291
1187 Ga0207671_10120188
1188 Ga0207671_10189397
1189 Ga0207671_10483735
1190 Ga0207693_10065551
1191 Ga0207693_10886218
1192 Ga0207663_10967092
1193 Ga0207660_10064040
1194 Ga0207660_10364438
1195 Ga0207660_10797317
1196 Ga0207662_10060721
1197 Ga0207657_10001018
1198 Ga0207657_10097609
1199 Ga0207657_10972787
1200 Ga0207649_10273807
1201 Ga0207649_10714208
1202 Ga0207652_10051763
1203 Ga0207652_10148030
1204 Ga0207652_10515141
1205 Ga0207646_10003120
1206 Ga0207646_10017500
1207 Ga0207646_10034473
1208 Ga0207646_10979512
1209 Ga0207694_10035285
1210 Ga0207694_10105774
1211 Ga0207694_10183804
1212 Ga0207650_10345102
1213 Ga0207659_10618775
1214 Ga0207687_10001051
1215 Ga0207687_10012543
1216 Ga0207687_10029105
1217 Ga0207687_10079444
1218 Ga0207687_10180754
1219 Ga0207687_10630961
1220 Ga0207687_11171132
1221 Ga0207700_10446095
1222 Ga0207700_10575936
1223 Ga0207700_10644302
1224 Ga0207700_10832802
1225 Ga0207664_10038120
1226 Ga0207664_10101940
1227 Ga0207664_10153797
1228 Ga0207664_11664078
1229 Ga0207644_10080219
1230 Ga0207690_10017626
1231 Ga0207706_10066880
1232 Ga0207706_10157411
1233 Ga0207706_10297867
1234 Ga0207686_11349846
1235 Ga0207709_10244377
1236 Ga0207709_11415170
1237 Ga0207670_10104248
1238 Ga0207669_10717973
1239 Ga0207669_10991561
1240 Ga0207704_10169000
1241 Ga0207704_10562814
1242 Ga0207665_10128047
1243 Ga0207665_10239665
1244 Ga0207665_10646357
1245 Ga0207711_10840270
1246 Ga0207711_10967288
1247 Ga0207689_10041949
1248 Ga0207689_11228772
1249 Ga0207661_10006305
1250 Ga0207661_10167107
1251 Ga0207661_10735340
1252 Ga0207661_12053924
1253 Ga0207679_10051753
1254 Ga0207679_10268653
1255 Ga0207679_10576345
1256 Ga0207667_10005782
1257 Ga0207667_10149234
1258 Ga0207667_10482522
1259 Ga0207651_10385558
1260 Ga0207651_10461158
1261 Ga0207712_10503429
1262 Ga0207712_10902827
1263 Ga0207668_10320562
1264 Ga0207668_10441853
1265 Ga0207668_11339361
1266 Ga0207640_10065456
1267 Ga0207640_10178334
1268 Ga0207640_10378494
1269 Ga0207640_10439734
1270 Ga0207640_10601685
1271 Ga0207640_10722211
1272 Ga0207640_11588933
1273 Ga0207658_10684939
1274 Ga0207677_10008302
1275 Ga0207677_10112583
1276 Ga0207677_10129194
1277 Ga0207677_10739278
1278 Ga0207703_10020306
1279 Ga0207639_10244474
1280 Ga0207678_10039010
1281 Ga0207678_10072343
1282 Ga0207678_10661029
1283 Ga0207708_10018938
1284 Ga0207708_10041559
1285 Ga0207708_10055701
1286 Ga0207708_10176315
1287 Ga0207708_10312020
1288 Ga0207708_10659728
1289 Ga0207702_10009665
1290 Ga0207702_10144358
1291 Ga0207702_10181594
1292 Ga0207702_11267174
1293 Ga0207702_11267584
1294 Ga0207702_12392555
1295 Ga0207641_10098045
1296 Ga0207648_10138491
1297 Ga0207648_10402849
1298 Ga0207676_11498708
1299 Ga0207674_10059570
1300 Ga0207674_10541267
1301 Ga0207675_100035337
1302 Ga0207675_101970610
1303 Ga0207683_10300567
1304 Ga0207698_10138761
1305 Ga0207698_10165542
1306 Ga0209999_1041414
1307 Ga0209966_1015799
1308 Ga0207428_10108885
1309 Ga0207428_10852845
1310 Ga0207428_10901853
1311 Ga0268266_10005645
1312 Ga0268266_10149800
1313 Ga0268265_10201549
1314 Ga0265326_10008590
1315 Ga0265319_1011852
1316 Ga0265334_10107478
1317 Ga0265318_10019491
1318 Ga0265322_10041864
1319 Ga0265338_10006047
1320 Ga0265338_10317865
1321 Ga0265320_10009345
1322 Ga0265325_10012878
1323 Ga0265329_10004307
1324 Ga0265339_10115406
1325 Ga0265331_10026006
1326 Ga0265327_10001417
1327 Ga0265327_10456348
1328 Ga0265313_10021437
1329 Ga0265314_10035744
1330 Ga0265314_10667097
1331 Ga0307413_10562878
1332 Ga0307410_10201664
1333 Ga0307410_10809036
1334 Ga0307406_10257712
1335 Ga0307406_10605895
1336 Ga0307407_10454519
1337 Ga0307407_10685047
1338 Ga0307412_10885483
1339 Ga0307409_100217799
1340 Ga0307409_100434472
1341 Ga0307409_101047701
1342 Ga0307409_102156078
1343 Ga0307416_100012974
1344 Ga0307416_100188035
1345 Ga0307416_100338117
1346 Ga0307416_103726350
1347 Ga0307414_10725323
1348 Ga0307411_10023699
1349 Ga0307411_10346079
1350 Ga0307411_12194601
1351 Ga0307415_100037952
1352 Ga0307415_100172627
1353 Ga0307415_100182072
1354 Ga0373928_0279224
1355 Ga0373929_0094457
1356 Ga0373944_0007872
1357 Ga0373949_0224020
1358 Ga0373923_0260462
1359 Ga0373932_0162351
1360 Ga0373936_0015357
1361 Ga0373945_0025360
1362 Ga0373953_0448925
1363 Ga0373954_0130733
1364 Ga0373957_0390337
1365 Ga0373943_0010870
1366 Ga0373943_0079186
1367 Ga0373946_0006819
1368 Ga0373931_0118261
1369 Ga0373935_0530105
1370 Ga0373927_0186204
1371 Ga0373927_0226215
1372 Ga0373933_0041817
1373 Ga0373947_0010630
1374 Ga0373947_0481418
1375 Ga0373947_1045431
1376 Ga0373937_0115033
1377 Ga0373925_0007670
1378 Ga0395899_0340819
1379 Ga0395899_0884010
1380 Ga0395905_0576929
1381 Ga0395901_0108378
1382 Ga0395901_0506327
1383 Ga0395901_1134368
1384 Ga0436365_0401447
1385 Ga0436365_0446258
1386 Ga0439466_0124823
1387 Ga0451798_0066473
1388 Ga0451835_1130578
1389 Ga0466961_0927488
1390 Ga0466963_0694395
1391 Ga0466964_0097874
1392 Ga0466957_1349774
1393 Ga0466960_0085131
1394 Ga0466960_0356284
1395 Ga0466967_0264963
1396 Ga0466967_0771636
1397 Ga0466967_1027553
1398 Ga0495603_0106419
1399 Ga0495603_0110674
1400 Ga0495629_0735519
1401 Ga0495641_0013468
1402 Ga0495641_0096582
1403 Ga0495641_0099701
1404 Ga0495651_0079924
1405 Ga0495651_0141171
1406 Ga0495653_0510160
1407 Ga0495580_0012998
1408 Ga0495582_0003843
1409 Ga0495582_0117218
1410 Ga0495582_0166129
1411 Ga0495582_0478159
1412 Ga0495639_0001097
1413 Ga0495662_0007574
1414 Ga0495662_0038728
1415 Ga0495662_0289653
1416 Ga0495664_0081717
1417 Ga0495594_0063078
1418 Ga0495608_0015849
1419 Ga0495618_0296959
1420 Ga0495628_0051470
1421 Ga0495628_0206562
1422 Ga0495628_1144475
1423 Ga0495630_0035913
1424 Ga0495630_0270433
1425 Ga0495666_0009932
1426 Ga0495652_0097892
1427 Ga0495665_0010415
1428 Ga0495640_0191325
1429 Ga0495640_0681250
1430 Ga0495586_0027249
1431 Ga0495586_0107578
1432 Ga0495645_0315045
1433 Ga0495645_0443493
1434 Ga0495622_0291350
1435 Ga0495667_0000710
1436 Ga0495667_0699038
1437 Ga0495656_0167470
1438 Ga0495634_0041133
1439 Ga0495635_0027662
1440 Ga0495588_0050404
1441 Ga0495588_0276745
1442 Ga0495657_0014819
1443 Ga0495657_0129792
1444 Ga0495623_0524952
1445 Ga0495646_0055215
1446 Ga0495647_0070696
1447 Ga0495647_0135196
1448 Ga0495658_0150827
1449 Ga0495658_0180806
1450 Ga0495658_0194658
1451 Ga0495658_0927551
1452 Ga0495613_0002744
1453 Ga0495613_0031525
1454 Ga0495613_0176990
1455 Ga0495624_0058538
1456 Ga0495600_0001198
1457 Ga0495581_0013950
1458 Ga0495581_0113220
1459 Ga0495604_0602150
1460 Ga0495604_0696646
1461 Ga0495674_0018517
1462 Ga0495674_0044450
1463 Ga0495674_0201171
1464 Ga0495674_0907549
1465 Ga0495676_0003675
1466 Ga0495676_0146297
1467 Ga0495676_0812418
1468 Ga0495680_0278639
1469 Ga0495680_0323199
1470 Ga0495675_0117233
1471 Ga0495684_0206667
1472 Ga0495684_0242719
1473 Ga0495593_0014511
1474 Ga0495602_0175189
1475 Ga0495614_0003581
1476 Ga0496100_0049574
1477 Ga0496100_0060617
1478 Ga0496100_0067397
1479 Ga0496100_0116117
1480 Ga0496100_0192098
1481 Ga0496100_0487486
1482 Ga0496100_1384466
1483 Ga0496101_0012809
1484 Ga0496101_0014379
1485 Ga0496101_0095332
1486 Ga0496101_0281753
1487 Ga0496101_0333362
1488 Ga0496102_0007406
1489 Ga0496102_0081837
1490 Ga0496102_0204067
1491 Ga0496102_0225590
1492 Ga0496102_0368102
1493 Ga0496102_0611852
1494 Ga0496102_0682790
1495 Ga0496103_0003232
1496 Ga0496103_0278943
1497 Ga0496103_0623215
1498 Ga0496103_0784758
1499 Ga0496104_0081495
1500 Ga0496104_0112043
1501 Ga0496104_0119132
1502 Ga0496104_0156727
1503 Ga0496104_0475701
1504 Ga0496104_0789002
1505 Ga0496104_0917562
1506 Ga0496105_0007763
1507 Ga0496105_0350588
1508 Ga0496105_0385406
1509 Ga0496105_0701800
1510 Ga0496106_0025917
1511 Ga0496106_0053480
1512 Ga0496106_0056212
1513 Ga0496106_0073335
1514 Ga0496106_1022478
1515 Ga0496107_0073461
1516 Ga0496107_0088835
1517 Ga0496107_0222436
1518 Ga0496107_0247418
1519 Ga0496107_0402774
1520 Ga0496108_0008774
1521 Ga0496108_0012674
1522 Ga0496108_0013319
1523 Ga0496108_0023541
1524 Ga0496108_0236317
1525 Ga0496108_0381350
1526 Ga0496108_0397236
1527 Ga0496108_0618854
1528 Ga0496108_1026893
1529 Ga0496109_0004944
1530 Ga0496109_0012839
1531 Ga0496109_0015520
1532 Ga0496109_0024292
1533 Ga0496109_0056579
1534 Ga0496109_0074235
1535 Ga0496109_0590666
1536 Ga0496109_0833684
1537 Ga0496110_0001680
1538 Ga0496110_0048255
1539 Ga0496110_0351388
1540 Ga0496110_0511086
1541 Ga0496110_0917959
1542 Ga0496111_0000680
1543 Ga0496111_0047288
1544 Ga0496111_0049846
1545 Ga0496111_0057617
1546 Ga0496111_0405908
1547 Ga0496112_0003319
1548 Ga0496112_0006106
1549 Ga0496112_0027826
1550 Ga0496112_0038496
1551 Ga0496112_0132586
1552 Ga0496112_0403900
1553 Ga0496112_0417923
1554 Ga0496113_0018993
1555 Ga0496113_0034272
1556 Ga0496113_0679947
1557 Ga0496113_0823470
1558 Ga0496113_0940567
1559 Ga0496114_0013817
1560 Ga0496114_0032535
1561 Ga0496114_0037856
1562 Ga0496114_0097108
1563 Ga0496114_0316222
1564 Ga0496114_0793642
1565 Ga0496115_0013903
1566 Ga0496115_0061273
1567 Ga0496115_0389391
1568 Ga0496115_0508301
1569 Ga0496116_0000014
1570 Ga0496117_0050073
1571 Ga0496118_0033183
1572 Ga0496119_0000639
1573 Ga0501031_0069733
1574 Ga0501031_0192059
1575 Ga0501032_0062822
1576 Ga0501032_0177791
1577 Ga0501036_0169686
1578 Ga0501036_0673924
1579 Ga0501037_0190470
1580 Ga0501038_0037802
1581 Ga0501039_0050276
1582 Ga0501039_0191892
1583 Ga0501040_0062746
1584 Ga0501040_0111947
1585 Ga0501040_1245992
1586 Ga0501041_0070252
1587 Ga0501041_0994736
1588 Ga0501042_0110195
1589 Ga0501042_1194997
1590 Ga0501043_0140836
1591 Ga0501046_0092984
1592 Ga0501046_0458901
1593 Ga0501048_0079467
1594 Ga0501067_0000043
1595 Ga0501067_0222689
1596 Ga0501067_0357469
1597 Ga0501068_0001284
1598 Ga0501068_0039711
1599 Ga0501068_0111296
1600 Ga0501069_0083837
1601 Ga0501069_0146366
1602 Ga0501070_0087944
1603 Ga0501070_0181016
1604 Ga0501070_0465293
1605 Ga0501071_0024066
1606 Ga0501071_0056430
1607 Ga0501071_0117586
1608 Ga0501071_0156159
1609 Ga0501072_0039011
1610 Ga0501074_0015410
1611 Ga0501074_0150496
1612 Ga0501074_0355475
1613 Ga0501074_0728538
1614 Ga0501075_0650688
1615 Ga0501075_0931206
1616 Ga0501076_0058684
1617 Ga0501077_0031255
1618 Ga0501077_0150926
1619 Ga0501079_0004193
1620 Ga0501079_0083042
1621 Ga0501079_0209330
1622 Ga0501080_0032368
1623 Ga0501080_0421194
1624 Ga0501080_1001711
1625 Ga0501081_0022740
1626 Ga0501081_0084297
1627 Ga0501081_0112489
1628 Ga0501083_0421347
1629 Ga0501083_0432497
1630 Ga0501035_0393325
1631 Ga0501044_0602425
1632 Ga0501045_0361928
1633 Ga0501045_0576657
1634 nmdc:mga0yw44_72825_c1
1635 nmdc:mga05p37_1054757_c1
1636 nmdc:mga05p37_41885_c1
1637 nmdc:mga05p37_943518_c1
1638 nmdc:mga08y16_213134_c1
1639 nmdc:mga08y16_242897_c1
1640 nmdc:mga08y16_99361_c1
1641 nmdc:mga0n895_1136349_c1
1642 nmdc:mga0n895_1436_c1
1643 nmdc:mga0n895_553678_c1
1644 nmdc:mga0n895_80274_c1
1645 nmdc:mga0n895_849478_c1
1646 nmdc:mga0n895_869809_c1
1647 nmdc:mga0rr50_342979_c1
1648 nmdc:mga0rr50_371124_c1
1649 nmdc:mga0rr50_40302_c1
1650 nmdc:mga08x19_100000_c1
1651 nmdc:mga08x19_220738_c1
1652 nmdc:mga08x19_9167_c1
1653 nmdc:mga0a205_21069_c1
1654 nmdc:mga0a205_585832_c1
1655 Ga0495601_0168268
1656 Ga0495612_0007220
1657 Ga0495612_0078357
1658 Ga0495612_0131412
1659 Ga0495612_0154034
1660 Ga0495612_0227276
1661 Ga0495595_0727679
1662 Ga0495619_0267562
1663 Ga0500566_0257370
1664 Ga0501082_0170276
1665 Ga0501082_0360981
1666 Ga0530510_0052716
1667 Ga0530510_0055755
1668 Ga0530510_0593107

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03459

TOBE

TOBE domain

88

150

0.98

PF00376

MerR

MerR family regulatory protein

29

65

0.96

PF13411

MerR_1

MerR HTH family regulatory protein

28

81

0.93

PF12728

HTH_17

Helix-turn-helix domain

28

78

0.91

Map