F482720

General Info

Members Datasets Scaffolds Average Seq Length
832 337 1664 92

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100955821|Ga0075431_1009558212
Length 90
Sequence VAYFAASVDDAETNRKFAESLGLDYPILSDPDRQTARAYGVLEGEYANRHTFYIGKDGRILLVDRAVKPSTAGEDTARHLAELKVPRAAK

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
119 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
120 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
209 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
210 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
211 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
217 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
269 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
291 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
294 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
304 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.22
Metatranscriptomes 11.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 4.09
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 29.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100955821 3300006847 Bacteria 825
2 JGI24751J29686_10136194 3300002459 Bacteria 519
3 Ga0006778J45830_1047620 3300003162 Unclassified 579
4 Ga0007417J51691_1016039 3300003544 Unclassified 578
5 Ga0007410J51695_1017530 3300003574 Unclassified 576
6 Ga0007409J51694_1018177 3300003575 Unclassified 619
7 Ga0058859_10015558 3300004798 Bacteria 554
8 Ga0058859_10029500 3300004798 Unclassified 584
9 Ga0058859_11802446 3300004798 Unclassified 578
10 Ga0058861_10046562 3300004800 Unclassified 532
11 Ga0058861_10061482 3300004800 Bacteria 829
12 Ga0058860_10003761 3300004801 Bacteria 576
13 Ga0058860_10059047 3300004801 Viruses 699
14 Ga0058860_10103052 3300004801 Bacteria 693
15 Ga0058860_11769591 3300004801 Bacteria 644
16 Ga0058860_11974703 3300004801 Bacteria 791
17 Ga0058860_12057218 3300004801 Bacteria 620
18 Ga0058860_12173292 3300004801 Bacteria 737
19 Ga0058860_12198386 3300004801 Bacteria 594
20 Ga0058862_10068240 3300004803 Bacteria 616
21 Ga0058862_12323089 3300004803 Unclassified 645
22 Ga0058862_12852925 3300004803 Bacteria 701
23 Ga0065704_10826817 3300005289 Viruses 516
24 Ga0065712_10089387 3300005290 Bacteria 2472
25 Ga0065712_10098880 3300005290 Unclassified 2106
26 Ga0065712_10127091 3300005290 Bacteria 1594
27 Ga0065715_10024170 3300005293 Unclassified 2231
28 Ga0065715_10038432 3300005293 Unclassified 1154
29 Ga0065715_10053738 3300005293 Bacteria 641
30 Ga0065715_10116964 3300005293 Unclassified 2356
31 Ga0065715_10117928 3300005293 Bacteria 2332
32 Ga0065715_10702660 3300005293 Unclassified 652
33 Ga0065707_10043594 3300005295 Unclassified 829
34 Ga0065707_10314294 3300005295 Bacteria 969
35 Ga0065707_10328143 3300005295 Unclassified 954
36 Ga0065707_10556148 3300005295 Bacteria 717
37 Ga0065707_10558462 3300005295 Bacteria 716
38 Ga0065707_11069560 3300005295 Unclassified 522
39 Ga0070658_10034911 3300005327 Bacteria 4047
40 Ga0070658_11387658 3300005327 Bacteria 610
41 Ga0070676_10008730 3300005328 Bacteria 5468
42 Ga0070676_10731815 3300005328 Bacteria 725
43 Ga0070683_100046199 3300005329 Bacteria 4022
44 Ga0070683_100798706 3300005329 Unclassified 905
45 Ga0070683_100933684 3300005329 Bacteria 833
46 Ga0070690_100307222 3300005330 Bacteria 1139
47 Ga0070690_100495009 3300005330 Bacteria 914
48 Ga0070690_100514547 3300005330 Viruses 897
49 Ga0070690_100546828 3300005330 Unclassified 872
50 Ga0070690_100657941 3300005330 Bacteria 801
51 Ga0070670_100040713 3300005331 Bacteria 3994
52 Ga0070670_100265647 3300005331 Bacteria 1496
53 Ga0068869_100316443 3300005334 Bacteria 1265
54 Ga0068869_100349361 3300005334 Bacteria 1205
55 Ga0068869_101396563 3300005334 Bacteria 620
56 Ga0070666_10005352 3300005335 Bacteria 7868
57 Ga0070666_10019194 3300005335 Bacteria 4410
58 Ga0070666_10082492 3300005335 Unclassified 2199
59 Ga0070666_10367170 3300005335 Bacteria 1032
60 Ga0070666_10571308 3300005335 Bacteria 824
61 Ga0070680_101122063 3300005336 Bacteria 680
62 Ga0070680_101401941 3300005336 Bacteria 605
63 Ga0070680_101832991 3300005336 Bacteria 526
64 Ga0068868_100117035 3300005338 Unclassified 2171
65 Ga0068868_100180984 3300005338 Unclassified 1749
66 Ga0068868_100192172 3300005338 Bacteria 1698
67 Ga0068868_100551638 3300005338 Bacteria 1016
68 Ga0068868_101150926 3300005338 Bacteria 716
69 Ga0068868_101872745 3300005338 Bacteria 568
70 Ga0068868_102002397 3300005338 Viruses 550
71 Ga0070660_100001652 3300005339 Bacteria 15326
72 Ga0070660_100778974 3300005339 Bacteria 804
73 Ga0070689_100497384 3300005340 Viruses 1044
74 Ga0070689_100662162 3300005340 Bacteria 909
75 Ga0070691_10006391 3300005341 Bacteria 5386
76 Ga0070687_100003054 3300005343 Bacteria 6442
77 Ga0070687_100643913 3300005343 Unclassified 734
78 Ga0070692_10537395 3300005345 Bacteria 764
79 Ga0070668_100527032 3300005347 Bacteria 1026
80 Ga0070668_100758419 3300005347 Bacteria 859
81 Ga0070669_100045030 3300005353 Bacteria 3215
82 Ga0070669_100061650 3300005353 Bacteria 2756
83 Ga0070669_100104336 3300005353 Bacteria 2143
84 Ga0070675_100001159 3300005354 Bacteria 19044
85 Ga0070675_100361398 3300005354 Unclassified 1289
86 Ga0070675_100758082 3300005354 Unclassified 886
87 Ga0070675_101216106 3300005354 Bacteria 694
88 Ga0070671_100017557 3300005355 Bacteria 5797
89 Ga0070671_100212682 3300005355 Unclassified 1640
90 Ga0070671_101776807 3300005355 Unclassified 548
91 Ga0070674_100028431 3300005356 Bacteria 3673
92 Ga0070674_100171038 3300005356 Bacteria 1656
93 Ga0070674_100282571 3300005356 Bacteria 1316
94 Ga0070674_100532968 3300005356 Bacteria 983
95 Ga0070674_100724031 3300005356 Bacteria 852
96 Ga0070674_101608667 3300005356 Unclassified 586
97 Ga0070673_100966975 3300005364 Unclassified 792
98 Ga0070688_100176422 3300005365 Viruses 1479
99 Ga0070659_100299316 3300005366 Bacteria 1341
100 Ga0070667_100069980 3300005367 Bacteria 2986
101 Ga0070667_100301516 3300005367 Unclassified 1443
102 Ga0070667_102205872 3300005367 Bacteria 519
103 Ga0070703_10171197 3300005406 Bacteria 832
104 Ga0070709_10120921 3300005434 Bacteria 1775
105 Ga0070709_10244396 3300005434 Bacteria 1290
106 Ga0070714_100009490 3300005435 Bacteria 7652
107 Ga0070713_100055079 3300005436 Bacteria 3303
108 Ga0070701_10016043 3300005438 Bacteria 3474
109 Ga0070701_10156459 3300005438 Bacteria 1317
110 Ga0070711_100130229 3300005439 Unclassified 1873
111 Ga0070711_101658002 3300005439 Bacteria 560
112 Ga0070705_100031701 3300005440 Bacteria 2929
113 Ga0070705_100213829 3300005440 Unclassified 1331
114 Ga0070700_100004725 3300005441 Bacteria 7139
115 Ga0070700_100053989 3300005441 Unclassified 2510
116 Ga0070700_100150819 3300005441 Unclassified 1590
117 Ga0070694_100007642 3300005444 Bacteria 6598
118 Ga0070694_100070104 3300005444 Bacteria 2413
119 Ga0070694_100947623 3300005444 Bacteria 712
120 Ga0070708_100059377 3300005445 Bacteria 3410
121 Ga0070708_100864179 3300005445 Bacteria 850
122 Ga0070678_100625162 3300005456 Unclassified 964
123 Ga0070678_100702841 3300005456 Bacteria 911
124 Ga0070662_100697293 3300005457 Bacteria 859
125 Ga0070662_100755207 3300005457 Unclassified 825
126 Ga0070662_101763528 3300005457 Unclassified 535
127 Ga0070681_10219992 3300005458 Bacteria 1814
128 Ga0070681_10259257 3300005458 Bacteria 1651
129 Ga0070681_11002319 3300005458 Unclassified 755
130 Ga0068867_100023724 3300005459 Bacteria 4393
131 Ga0068867_100029667 3300005459 Bacteria 3941
132 Ga0068867_101579490 3300005459 Bacteria 613
133 Ga0068867_101676605 3300005459 Bacteria 596
134 Ga0070706_101974476 3300005467 Unclassified 529
135 Ga0070707_100018003 3300005468 Bacteria 6645
136 Ga0070707_100066005 3300005468 Unclassified 3477
137 Ga0070707_100845744 3300005468 Bacteria 879
138 Ga0070707_101064360 3300005468 Unclassified 775
139 Ga0070698_100197340 3300005471 Unclassified 1949
140 Ga0070698_100298757 3300005471 Bacteria 1541
141 Ga0070698_100747450 3300005471 Bacteria 921
142 Ga0070698_101232179 3300005471 Bacteria 698
143 Ga0070698_102069169 3300005471 Unclassified 523
144 Ga0070699_100091833 3300005518 Bacteria 2655
145 Ga0070699_100176638 3300005518 Bacteria 1894
146 Ga0070699_100298641 3300005518 Bacteria 1445
147 Ga0070699_100457896 3300005518 Bacteria 1157
148 Ga0070699_100559062 3300005518 Unclassified 1042
149 Ga0070699_100948062 3300005518 Bacteria 789
150 Ga0070679_100085080 3300005530 Bacteria 3149
151 Ga0070679_100265748 3300005530 Bacteria 1670
152 Ga0070679_100792118 3300005530 Bacteria 891
153 Ga0070684_100121089 3300005535 Unclassified 2354
154 Ga0070697_100024496 3300005536 Bacteria 4803
155 Ga0070697_100034692 3300005536 Unclassified 4069
156 Ga0070697_100762984 3300005536 Bacteria 855
157 Ga0070697_101066557 3300005536 Bacteria 719
158 Ga0070697_101116988 3300005536 Bacteria 702
159 Ga0070697_101187887 3300005536 Unclassified 680
160 Ga0070697_101949889 3300005536 Unclassified 526
161 Ga0068853_101987334 3300005539 Unclassified 564
162 Ga0070672_100297685 3300005543 Bacteria 1367
163 Ga0070672_100354179 3300005543 Unclassified 1252
164 Ga0070672_100592842 3300005543 Bacteria 965
165 Ga0070672_100986438 3300005543 Bacteria 746
166 Ga0070686_100002006 3300005544 Bacteria 11292
167 Ga0070686_100187596 3300005544 Bacteria 1474
168 Ga0070686_100344550 3300005544 Bacteria 1118
169 Ga0070686_101678977 3300005544 Bacteria 539
170 Ga0070695_100003105 3300005545 Bacteria 9671
171 Ga0070695_100121607 3300005545 Bacteria 1787
172 Ga0070695_100865651 3300005545 Unclassified 728
173 Ga0070695_101442113 3300005545 Unclassified 572
174 Ga0070696_100022102 3300005546 Bacteria 4320
175 Ga0070696_100242666 3300005546 Unclassified 1360
176 Ga0070696_100957858 3300005546 Bacteria 713
177 Ga0070696_101378474 3300005546 Unclassified 601
178 Ga0070665_100002229 3300005548 Bacteria 21597
179 Ga0070665_100005414 3300005548 Bacteria 13167
180 Ga0070665_100597970 3300005548 Bacteria 1116
181 Ga0070704_100102279 3300005549 Bacteria 2162
182 Ga0070704_100131299 3300005549 Bacteria 1942
183 Ga0070704_100401785 3300005549 Bacteria 1169
184 Ga0070704_101911612 3300005549 Unclassified 550
185 Ga0068855_100007572 3300005563 Bacteria 13139
186 Ga0068855_101434118 3300005563 Bacteria 711
187 Ga0068855_101684988 3300005563 Bacteria 647
188 Ga0070664_101066968 3300005564 Unclassified 760
189 Ga0068857_100791816 3300005577 Unclassified 905
190 Ga0068857_101519903 3300005577 Bacteria 653
191 Ga0068854_100081405 3300005578 Bacteria 2391
192 Ga0068854_101178188 3300005578 Bacteria 686
193 Ga0068854_101262587 3300005578 Bacteria 664
194 Ga0068854_101338088 3300005578 Bacteria 646
195 Ga0068856_100756199 3300005614 Unclassified 992
196 Ga0070702_100007355 3300005615 Bacteria 5269
197 Ga0070702_100032167 3300005615 Bacteria 2877
198 Ga0068852_100692449 3300005616 Unclassified 1029
199 Ga0068852_101037698 3300005616 Bacteria 839
200 Ga0068852_101316464 3300005616 Unclassified 744
201 Ga0068859_100099406 3300005617 Unclassified 2965
202 Ga0068859_100169727 3300005617 Bacteria 2262
203 Ga0068864_100053805 3300005618 Bacteria 3473
204 Ga0068864_100369779 3300005618 Bacteria 1356
205 Ga0068864_100802364 3300005618 Archaea 925
206 Ga0068866_10704984 3300005718 Bacteria 693
207 Ga0068866_11402939 3300005718 Unclassified 511
208 Ga0068861_100006984 3300005719 Bacteria 7715
209 Ga0068861_100027542 3300005719 Bacteria 4141
210 Ga0068861_100034197 3300005719 Bacteria 3757
211 Ga0068861_100115850 3300005719 Bacteria 2154
212 Ga0068861_100637807 3300005719 Bacteria 982
213 Ga0068851_10185293 3300005834 Unclassified 1155
214 Ga0068851_10309611 3300005834 Bacteria 910
215 Ga0068851_10518126 3300005834 Unclassified 717
216 Ga0068851_11022050 3300005834 Unclassified 522
217 Ga0068870_10533241 3300005840 Unclassified 788
218 Ga0068863_100001186 3300005841 Bacteria 26025
219 Ga0068863_100043758 3300005841 Bacteria 4250
220 Ga0068863_100156280 3300005841 Bacteria 2184
221 Ga0068863_100849435 3300005841 Unclassified 912
222 Ga0068863_101057369 3300005841 Bacteria 815
223 Ga0068858_100014615 3300005842 Bacteria 7395
224 Ga0068858_100140079 3300005842 Unclassified 2270
225 Ga0068858_100634387 3300005842 Bacteria 1038
226 Ga0068858_101155965 3300005842 Bacteria 760
227 Ga0068858_102057112 3300005842 Unclassified 565
228 Ga0068860_100168390 3300005843 Bacteria 2116
229 Ga0068860_100296564 3300005843 Unclassified 1583
230 Ga0068860_100299259 3300005843 Archaea 1576
231 Ga0068860_100447883 3300005843 Bacteria 1283
232 Ga0068860_101238561 3300005843 Bacteria 767
233 Ga0068860_101860989 3300005843 Bacteria 623
234 Ga0068860_102243107 3300005843 Bacteria 567
235 Ga0068862_100040286 3300005844 Bacteria 3971
236 Ga0068862_100100089 3300005844 Bacteria 2535
237 Ga0068862_100466796 3300005844 Bacteria 1192
238 Ga0068862_100652033 3300005844 Bacteria 1015
239 Ga0068862_100892220 3300005844 Unclassified 873
240 Ga0068862_101153941 3300005844 Viruses 772
241 Ga0068862_101195671 3300005844 Bacteria 758
242 Ga0068862_101559220 3300005844 Bacteria 667
243 Ga0081455_10057988 3300005937 Bacteria 3279
244 Ga0081455_10420522 3300005937 Bacteria 922
245 Ga0081455_10951655 3300005937 Unclassified 533
246 Ga0081539_10023900 3300005985 Bacteria 3986
247 Ga0070717_10473333 3300006028 Bacteria 1131
248 Ga0070717_11208095 3300006028 Bacteria 688
249 Ga0075432_10024561 3300006058 Bacteria 2066
250 Ga0075432_10328978 3300006058 Bacteria 642
251 Ga0070715_10409730 3300006163 Bacteria 755
252 Ga0070715_10624736 3300006163 Bacteria 634
253 Ga0070712_100524892 3300006175 Bacteria 995
254 Ga0075367_10588209 3300006178 Bacteria 707
255 Ga0075369_10169794 3300006186 Unclassified 1001
256 Ga0097621_100140543 3300006237 Bacteria 2063
257 Ga0097621_100540714 3300006237 Bacteria 1059
258 Ga0075370_10302005 3300006353 Bacteria 952
259 Ga0068871_100022025 3300006358 Bacteria 4909
260 Ga0068871_100216804 3300006358 Bacteria 1657
261 Ga0068871_100401456 3300006358 Unclassified 1221
262 Ga0068871_100453801 3300006358 Bacteria 1149
263 Ga0075428_100808141 3300006844 Unclassified 996
264 Ga0075428_101750208 3300006844 Unclassified 648
265 Ga0075428_101872737 3300006844 Bacteria 623
266 Ga0075430_100564988 3300006846 Bacteria 938
267 Ga0075430_100671090 3300006846 Bacteria 855
268 Ga0075431_100066457 3300006847 Bacteria 3723
269 Ga0075433_10026005 3300006852 Bacteria 4952
270 Ga0075433_10051027 3300006852 Unclassified 3601
271 Ga0075433_10076568 3300006852 Bacteria 2946
272 Ga0075433_10140662 3300006852 Bacteria 2145
273 Ga0075433_10165409 3300006852 Bacteria 1969
274 Ga0075433_10812671 3300006852 Unclassified 817
275 Ga0075433_10908312 3300006852 Bacteria 768
276 Ga0075433_11957171 3300006852 Unclassified 502
277 Ga0075433_11977163 3300006852 Bacteria 500
278 Ga0075434_100004496 3300006871 Bacteria 12582
279 Ga0075434_100004747 3300006871 Bacteria 12295
280 Ga0075434_100006859 3300006871 Bacteria 10488
281 Ga0075434_100041206 3300006871 Unclassified 4574
282 Ga0075434_100308047 3300006871 Unclassified 1604
283 Ga0075434_100328519 3300006871 Bacteria 1550
284 Ga0075434_100333469 3300006871 Bacteria 1537
285 Ga0075434_100581220 3300006871 Bacteria 1139
286 Ga0075434_100731315 3300006871 Unclassified 1007
287 Ga0075434_101251147 3300006871 Unclassified 754
288 Ga0075434_101940151 3300006871 Unclassified 594
289 Ga0075429_100070545 3300006880 Bacteria 3043
290 Ga0075429_100368486 3300006880 Bacteria 1258
291 Ga0075429_101018009 3300006880 Bacteria 724
292 Ga0068865_100093217 3300006881 Bacteria 2189
293 Ga0068865_100877072 3300006881 Bacteria 779
294 Ga0068865_100944768 3300006881 Bacteria 752
295 Ga0075436_100000773 3300006914 Bacteria 21195
296 Ga0075436_100015204 3300006914 Bacteria 5273
297 Ga0075436_100030276 3300006914 Bacteria 3725
298 Ga0075436_100065517 3300006914 Unclassified 2511
299 Ga0075436_100078869 3300006914 Bacteria 2281
300 Ga0075436_100338737 3300006914 Bacteria 1082
301 Ga0075436_101520499 3300006914 Unclassified 508
302 Ga0097620_100099406 3300006931 Unclassified 2965
303 Ga0097620_100169717 3300006931 Bacteria 2262
304 Ga0075435_100000146 3300007076 Bacteria 39892
305 Ga0075435_100001901 3300007076 Bacteria 13590
306 Ga0075435_100004569 3300007076 Bacteria 9525
307 Ga0075435_100048070 3300007076 Unclassified 3426
308 Ga0075435_100298523 3300007076 Unclassified 1377
309 Ga0075435_100304347 3300007076 Bacteria 1364
310 Ga0075435_100481678 3300007076 Bacteria 1072
311 Ga0075435_101049562 3300007076 Unclassified 712
312 Ga0075435_101871971 3300007076 Bacteria 527
313 Ga0099794_10094090 3300007265 Bacteria 1490
314 Ga0099794_10739483 3300007265 Unclassified 525
315 Ga0105244_10486989 3300009036 Bacteria 568
316 Ga0105240_10019896 3300009093 Bacteria 8965
317 Ga0105240_10105544 3300009093 Bacteria 3420
318 Ga0105240_10130186 3300009093 Bacteria 3019
319 Ga0105240_10297717 3300009093 Bacteria 1846
320 Ga0105240_12294938 3300009093 Bacteria 559
321 Ga0111539_10013716 3300009094 Bacteria 10122
322 Ga0111539_10049396 3300009094 Bacteria 5017
323 Ga0111539_10213302 3300009094 Bacteria 2249
324 Ga0111539_10227216 3300009094 Unclassified 2174
325 Ga0111539_10577581 3300009094 Unclassified 1309
326 Ga0111539_10749838 3300009094 Bacteria 1136
327 Ga0105245_10052933 3300009098 Bacteria 3642
328 Ga0105245_10073841 3300009098 Bacteria 3102
329 Ga0105245_10210466 3300009098 Unclassified 1871
330 Ga0105245_10815139 3300009098 Unclassified 972
331 Ga0105245_11575978 3300009098 Bacteria 708
332 Ga0105245_11868985 3300009098 Bacteria 654
333 Ga0105247_10015145 3300009101 Bacteria 4623
334 Ga0105247_10528125 3300009101 Viruses 864
335 Ga0105247_10684741 3300009101 Unclassified 770
336 Ga0105247_11810149 3300009101 Bacteria 508
337 Ga0114129_10000276 3300009147 Bacteria 58586
338 Ga0114129_10003924 3300009147 Bacteria 20997
339 Ga0114129_10008009 3300009147 Bacteria 15046
340 Ga0114129_10043314 3300009147 Bacteria 6333
341 Ga0114129_10058725 3300009147 Bacteria 5381
342 Ga0114129_10083857 3300009147 Unclassified 4425
343 Ga0114129_10174850 3300009147 Bacteria 2925
344 Ga0114129_10632717 3300009147 Unclassified 1383
345 Ga0114129_10641902 3300009147 Bacteria 1371
346 Ga0114129_10666147 3300009147 Bacteria 1341
347 Ga0114129_10938510 3300009147 Unclassified 1094
348 Ga0114129_11002587 3300009147 Unclassified 1052
349 Ga0114129_11462156 3300009147 Bacteria 841
350 Ga0114129_11519242 3300009147 Bacteria 822
351 Ga0114129_11704269 3300009147 Unclassified 769
352 Ga0105243_10010938 3300009148 Bacteria 6863
353 Ga0105243_10073016 3300009148 Bacteria 2779
354 Ga0105243_10094196 3300009148 Bacteria 2473
355 Ga0105242_10002080 3300009176 Bacteria 15763
356 Ga0105242_10299418 3300009176 Viruses 1467
357 Ga0105242_10434335 3300009176 Bacteria 1234
358 Ga0105242_11410505 3300009176 Bacteria 724
359 Ga0105248_10017318 3300009177 Bacteria 7941
360 Ga0105248_10023120 3300009177 Bacteria 6904
361 Ga0105248_10159482 3300009177 Unclassified 2545
362 Ga0105248_10384817 3300009177 Bacteria 1580
363 Ga0105248_10971235 3300009177 Bacteria 959
364 Ga0105248_11698049 3300009177 Unclassified 716
365 Ga0105248_12156891 3300009177 Bacteria 634
366 Ga0105237_10228495 3300009545 Bacteria 1861
367 Ga0105237_12075289 3300009545 Unclassified 577
368 Ga0105238_10229915 3300009551 Bacteria 1831
369 Ga0105238_10538579 3300009551 Unclassified 1171
370 Ga0105249_10180765 3300009553 Bacteria 2052
371 Ga0105249_10563562 3300009553 Bacteria 1191
372 Ga0105249_10591464 3300009553 Bacteria 1164
373 Ga0105249_10597949 3300009553 Unclassified 1157
374 Ga0105249_11102569 3300009553 Unclassified 864
375 Ga0105239_10511510 3300010375 Bacteria 1366
376 Ga0105239_11120748 3300010375 Bacteria 906
377 Ga0105239_11829456 3300010375 Unclassified 704
378 Ga0105246_11238210 3300011119 Bacteria 689
379 Ga0105246_11342185 3300011119 Unclassified 665
380 Ga0157341_1024136 3300012494 Viruses 619
381 Ga0157315_1017014 3300012508 Bacteria 726
382 Ga0157316_1045199 3300012510 Bacteria 589
383 Ga0157373_10907747 3300013100 Bacteria 654
384 Ga0157374_10237970 3300013296 Bacteria 1790
385 Ga0157374_10372435 3300013296 Unclassified 1422
386 Ga0157374_10541719 3300013296 Unclassified 1171
387 Ga0157374_11226772 3300013296 Bacteria 771
388 Ga0157374_12768935 3300013296 Unclassified 518
389 Ga0157378_10446663 3300013297 Unclassified 1283
390 Ga0163162_10036492 3300013306 Unclassified 4900
391 Ga0163162_10137941 3300013306 Bacteria 2550
392 Ga0163162_11181611 3300013306 Bacteria 868
393 Ga0163162_12485632 3300013306 Bacteria 596
394 Ga0157372_12360399 3300013307 Unclassified 611
395 Ga0157375_10024863 3300013308 Bacteria 5551
396 Ga0157375_10239334 3300013308 Unclassified 1975
397 Ga0157375_10318827 3300013308 Bacteria 1719
398 Ga0157375_10411451 3300013308 Unclassified 1519
399 Ga0157375_11915052 3300013308 Unclassified 704
400 Ga0157375_12607387 3300013308 Unclassified 604
401 Ga0163163_10049609 3300014325 Bacteria 4131
402 Ga0163163_10366111 3300014325 Unclassified 1498
403 Ga0163163_10442043 3300014325 Bacteria 1360
404 Ga0157380_10091978 3300014326 Bacteria 2505
405 Ga0157380_10240823 3300014326 Bacteria 1631
406 Ga0157380_11728377 3300014326 Bacteria 684
407 Ga0157377_10067021 3300014745 Bacteria 2066
408 Ga0157377_10661139 3300014745 Bacteria 753
409 Ga0157377_10787664 3300014745 Bacteria 700
410 Ga0157379_10033286 3300014968 Bacteria 4597
411 Ga0157379_10152320 3300014968 Bacteria 2086
412 Ga0157379_10421201 3300014968 Bacteria 1230
413 Ga0157379_10731748 3300014968 Bacteria 930
414 Ga0157379_10847682 3300014968 Bacteria 865
415 Ga0157376_10108215 3300014969 Unclassified 2442
416 Ga0157376_10310272 3300014969 Unclassified 1496
417 Ga0157376_11013590 3300014969 Bacteria 853
418 Ga0157376_11308726 3300014969 Unclassified 755
419 Ga0182007_10150593 3300015262 Unclassified 791
420 Ga0163161_10751274 3300017792 Bacteria 816
421 Ga0197907_11073421 3300020069 Bacteria 703
422 Ga0206356_11280093 3300020070 Bacteria 588
423 Ga0206356_11450779 3300020070 Unclassified 652
424 Ga0206354_10508403 3300020081 Bacteria 572
425 Ga0206353_10914929 3300020082 Bacteria 573
426 Ga0154015_1398253 3300020610 Bacteria 604
427 Ga0207697_10006540 3300025315 Bacteria 5259
428 Ga0207697_10108953 3300025315 Bacteria 1185
429 Ga0207656_10245524 3300025321 Bacteria 876
430 Ga0207653_10177990 3300025885 Bacteria 794
431 Ga0207642_10080677 3300025899 Bacteria 1579
432 Ga0207642_10698311 3300025899 Bacteria 639
433 Ga0207710_10007441 3300025900 Bacteria 4638
434 Ga0207688_10029839 3300025901 Bacteria 3006
435 Ga0207680_10036885 3300025903 Bacteria 2818
436 Ga0207680_10064705 3300025903 Unclassified 2243
437 Ga0207680_10617903 3300025903 Bacteria 775
438 Ga0207699_10099001 3300025906 Bacteria 1846
439 Ga0207645_10344897 3300025907 Bacteria 996
440 Ga0207643_10111420 3300025908 Bacteria 1613
441 Ga0207705_10170389 3300025909 Bacteria 1639
442 Ga0207684_11569266 3300025910 Unclassified 534
443 Ga0207654_11103233 3300025911 Bacteria 578
444 Ga0207707_10244726 3300025912 Bacteria 1558
445 Ga0207707_10954182 3300025912 Bacteria 706
446 Ga0207695_10053967 3300025913 Bacteria 4200
447 Ga0207695_10100024 3300025913 Bacteria 2896
448 Ga0207695_10859899 3300025913 Bacteria 787
449 Ga0207695_10865962 3300025913 Unclassified 783
450 Ga0207695_11083037 3300025913 Bacteria 681
451 Ga0207671_10365587 3300025914 Bacteria 1145
452 Ga0207671_10827532 3300025914 Unclassified 733
453 Ga0207693_10610157 3300025915 Bacteria 849
454 Ga0207662_10000766 3300025918 Bacteria 14752
455 Ga0207662_10985857 3300025918 Bacteria 598
456 Ga0207662_11290311 3300025918 Bacteria 519
457 Ga0207657_10000614 3300025919 Bacteria 37765
458 Ga0207657_10596700 3300025919 Bacteria 862
459 Ga0207657_10700609 3300025919 Bacteria 786
460 Ga0207652_10071836 3300025921 Bacteria 3008
461 Ga0207646_10034514 3300025922 Bacteria 4571
462 Ga0207646_10052102 3300025922 Unclassified 3662
463 Ga0207646_10194146 3300025922 Bacteria 1833
464 Ga0207681_10016696 3300025923 Bacteria 4599
465 Ga0207681_10031033 3300025923 Bacteria 3487
466 Ga0207681_10309501 3300025923 Bacteria 1252
467 Ga0207694_10317230 3300025924 Bacteria 1286
468 Ga0207694_10690430 3300025924 Unclassified 861
469 Ga0207650_10089089 3300025925 Unclassified 2354
470 Ga0207650_10421181 3300025925 Bacteria 1108
471 Ga0207659_10003548 3300025926 Bacteria 9384
472 Ga0207659_10715697 3300025926 Bacteria 858
473 Ga0207687_10030889 3300025927 Bacteria 3616
474 Ga0207687_10044005 3300025927 Bacteria 3078
475 Ga0207687_10360489 3300025927 Bacteria 1186
476 Ga0207687_10743963 3300025927 Unclassified 834
477 Ga0207700_10103035 3300025928 Bacteria 2281
478 Ga0207664_10072819 3300025929 Bacteria 2771
479 Ga0207644_10332507 3300025931 Viruses 1230
480 Ga0207644_10499721 3300025931 Unclassified 1003
481 Ga0207644_10864353 3300025931 Bacteria 757
482 Ga0207690_11390819 3300025932 Bacteria 587
483 Ga0207706_10098954 3300025933 Bacteria 2566
484 Ga0207706_10693250 3300025933 Bacteria 870
485 Ga0207706_10907875 3300025933 Bacteria 744
486 Ga0207686_10151110 3300025934 Bacteria 1617
487 Ga0207686_10370389 3300025934 Unclassified 1083
488 Ga0207686_10515884 3300025934 Bacteria 929
489 Ga0207686_10763713 3300025934 Viruses 773
490 Ga0207709_10036391 3300025935 Bacteria 2917
491 Ga0207709_10058957 3300025935 Bacteria 2388
492 Ga0207670_10881773 3300025936 Unclassified 749
493 Ga0207670_10976363 3300025936 Unclassified 712
494 Ga0207670_11737136 3300025936 Unclassified 531
495 Ga0207669_10009092 3300025937 Bacteria 4711
496 Ga0207669_10682416 3300025937 Bacteria 843
497 Ga0207669_10803518 3300025937 Bacteria 780
498 Ga0207691_10012538 3300025940 Bacteria 8126
499 Ga0207691_10302560 3300025940 Unclassified 1374
500 Ga0207711_10024462 3300025941 Bacteria 5061
501 Ga0207711_10214347 3300025941 Bacteria 1759
502 Ga0207711_10664058 3300025941 Unclassified 972
503 Ga0207711_11346827 3300025941 Bacteria 656
504 Ga0207689_10403179 3300025942 Unclassified 1140
505 Ga0207661_10313047 3300025944 Bacteria 1410
506 Ga0207679_10141274 3300025945 Bacteria 1947
507 Ga0207679_11193121 3300025945 Bacteria 698
508 Ga0207667_10059120 3300025949 Bacteria 4016
509 Ga0207667_10261196 3300025949 Bacteria 1771
510 Ga0207651_10833157 3300025960 Bacteria 819
511 Ga0207651_10835077 3300025960 Bacteria 818
512 Ga0207651_10969908 3300025960 Bacteria 759
513 Ga0207712_10038207 3300025961 Bacteria 3281
514 Ga0207712_10188719 3300025961 Bacteria 1625
515 Ga0207668_10939285 3300025972 Bacteria 771
516 Ga0207668_11567693 3300025972 Bacteria 594
517 Ga0207640_10004222 3300025981 Bacteria 7774
518 Ga0207640_10041988 3300025981 Bacteria 2913
519 Ga0207640_10132008 3300025981 Bacteria 1807
520 Ga0207658_10421848 3300025986 Viruses 1176
521 Ga0207658_10641620 3300025986 Unclassified 957
522 Ga0207677_10123684 3300026023 Unclassified 1951
523 Ga0207677_10325655 3300026023 Unclassified 1279
524 Ga0207677_10537407 3300026023 Bacteria 1017
525 Ga0207677_10744439 3300026023 Bacteria 873
526 Ga0207703_10149596 3300026035 Unclassified 2034
527 Ga0207703_10428169 3300026035 Bacteria 1232
528 Ga0207703_10435688 3300026035 Bacteria 1222
529 Ga0207703_11334417 3300026035 Unclassified 690
530 Ga0207678_10264454 3300026067 Bacteria 1474
531 Ga0207708_10000371 3300026075 Bacteria 35116
532 Ga0207708_10082621 3300026075 Bacteria 2470
533 Ga0207708_10128383 3300026075 Unclassified 1980
534 Ga0207708_10341164 3300026075 Bacteria 1227
535 Ga0207702_10087298 3300026078 Bacteria 2723
536 Ga0207641_10000636 3300026088 Bacteria 38316
537 Ga0207641_10071734 3300026088 Bacteria 2980
538 Ga0207641_10602756 3300026088 Unclassified 1075
539 Ga0207648_10012089 3300026089 Bacteria 8096
540 Ga0207648_10109724 3300026089 Bacteria 2422
541 Ga0207648_11180491 3300026089 Bacteria 719
542 Ga0207676_10042897 3300026095 Bacteria 3480
543 Ga0207676_10473161 3300026095 Bacteria 1185
544 Ga0207676_10491975 3300026095 Bacteria 1163
545 Ga0207676_11109196 3300026095 Unclassified 782
546 Ga0207676_11864619 3300026095 Bacteria 600
547 Ga0207674_10212822 3300026116 Bacteria 1882
548 Ga0207675_100002462 3300026118 Bacteria 18340
549 Ga0207675_100033222 3300026118 Bacteria 4808
550 Ga0207675_100062728 3300026118 Bacteria 3472
551 Ga0207675_100287839 3300026118 Unclassified 1598
552 Ga0207683_10215886 3300026121 Unclassified 1747
553 Ga0207683_10645864 3300026121 Unclassified 980
554 Ga0207698_10256554 3300026142 Bacteria 1604
555 Ga0207698_11290761 3300026142 Unclassified 745
556 Ga0207698_11745095 3300026142 Unclassified 638
557 Ga0209588_1223621 3300027671 Bacteria 581
558 Ga0207428_10049026 3300027907 Bacteria 3386
559 Ga0207428_10049977 3300027907 Bacteria 3347
560 Ga0207428_10265739 3300027907 Bacteria 1277
561 Ga0207428_10416468 3300027907 Bacteria 982
562 Ga0268266_10005953 3300028379 Bacteria 11274
563 Ga0268266_11338668 3300028379 Unclassified 691
564 Ga0268265_10013240 3300028380 Bacteria 5605
565 Ga0268265_10183828 3300028380 Bacteria 1798
566 Ga0268265_11134358 3300028380 Unclassified 777
567 Ga0268264_10097324 3300028381 Bacteria 2551
568 Ga0268264_10227865 3300028381 Bacteria 1719
569 Ga0268264_10251443 3300028381 Viruses 1642
570 Ga0268264_11410744 3300028381 Unclassified 707
571 Ga0307511_10184465 3300030521 Bacteria 1117
572 Ga0307509_10615061 3300031507 Bacteria 758
573 Ga0307408_100761858 3300031548 Viruses 875
574 Ga0307409_102750926 3300031995 Unclassified 520
575 Ga0307411_11627955 3300032005 Bacteria 596
576 Ga0373930_0001121 3300034816 Bacteria 3898
577 Ga0373950_0017945 3300034818 Bacteria 1224
578 Ga0373958_0011454 3300034819 Bacteria 1499
579 Ga0373959_0001280 3300034820 Bacteria 4041
580 Ga0373938_0001573 3300034957 Bacteria 3671
581 Ga0373928_0008711 3300035084 Bacteria 1974
582 Ga0373929_0003424 3300035085 Bacteria 2862
583 Ga0373940_0000443 3300035088 Bacteria 6337
584 Ga0373949_0001967 3300035090 Bacteria 5504
585 Ga0373951_0001112 3300035091 Bacteria 7139
586 Ga0373952_0011654 3300035092 Bacteria 1717
587 Ga0373923_0159336 3300035111 Bacteria 1029
588 Ga0373932_0002295 3300035112 Bacteria 4869
589 Ga0373939_0001306 3300035114 Bacteria 6053
590 Ga0373939_0069864 3300035114 Bacteria 1141
591 Ga0373941_0007020 3300035115 Bacteria 2738
592 Ga0373941_0020775 3300035115 Bacteria 1844
593 Ga0373941_0088755 3300035115 Bacteria 1057
594 Ga0373945_0161017 3300035116 Bacteria 915
595 Ga0373956_0147364 3300035119 Bacteria 1107
596 Ga0373957_0213360 3300035120 Bacteria 807
597 Ga0373960_0003363 3300035121 Bacteria 3618
598 Ga0373943_0436931 3300035170 Unclassified 759
599 Ga0373946_0276510 3300035171 Bacteria 825
600 Ga0373955_0520669 3300035172 Bacteria 727
601 Ga0373955_1056770 3300035172 Unclassified 500
602 Ga0373942_0000132 3300035207 Bacteria 17577
603 Ga0373961_0002112 3300035241 Bacteria 5275
604 Ga0373961_0053647 3300035241 Bacteria 1203
605 Ga0373962_0005309 3300035242 Bacteria 3118
606 Ga0373931_0004820 3300035691 Bacteria 6194
607 Ga0373935_0592610 3300035692 Unclassified 810
608 Ga0373933_0300608 3300035724 Unclassified 1039
609 Ga0373933_1102732 3300035724 Bacteria 523
610 Ga0373947_0759969 3300035725 Unclassified 661
611 Ga0373937_0113598 3300036401 Bacteria 2520
612 Ga0373937_0553223 3300036401 Bacteria 1093
613 Ga0373937_0871349 3300036401 Bacteria 849
614 Ga0373937_1926495 3300036401 Bacteria 537
615 Ga0373925_0124920 3300037068 Unclassified 2001
616 Ga0373925_0304287 3300037068 Bacteria 1288
617 Ga0451807_2653644 3300041486 Bacteria 792
618 Ga0439433_0065859 3300041999 Bacteria 869
619 Ga0439464_0239477 3300042439 Bacteria 585
620 Ga0466963_0178747 3300044694 Bacteria 1481
621 Ga0466957_1419823 3300044842 Unclassified 505
622 Ga0451576_0004536 3300045051 Bacteria 17983
623 Ga0451576_0907433 3300045051 Bacteria 924
624 Ga0466967_0049811 3300045976 Bacteria 3666
625 Ga0495603_0527410 3300046455 Unclassified 676
626 Ga0495590_0341675 3300046457 Bacteria 568
627 Ga0495580_0681999 3300046472 Bacteria 674
628 Ga0495608_0922441 3300046511 Bacteria 510
629 Ga0495628_0977856 3300046516 Bacteria 583
630 Ga0495630_0621415 3300046517 Unclassified 828
631 Ga0495630_1407836 3300046517 Bacteria 524
632 Ga0495640_0429279 3300046533 Bacteria 809
633 Ga0495587_0621394 3300046536 Bacteria 594
634 Ga0495598_0426794 3300046537 Viruses 522
635 Ga0495645_0008439 3300046543 Bacteria 7198
636 Ga0495667_0279953 3300046559 Bacteria 1059
637 Ga0495634_0252344 3300046642 Bacteria 1079
638 Ga0495635_0024254 3300046663 Bacteria 4229
639 Ga0495635_0088634 3300046663 Bacteria 2117
640 Ga0495659_0201242 3300046664 Unclassified 817
641 Ga0495647_0101965 3300046681 Unclassified 1189
642 Ga0495658_0110453 3300046683 Bacteria 1653
643 Ga0495658_1034349 3300046683 Bacteria 524
644 Ga0495669_0103025 3300046684 Bacteria 1327
645 Ga0495613_0285232 3300046689 Bacteria 1146
646 Ga0495613_0957730 3300046689 Bacteria 551
647 Ga0495670_0175118 3300046691 Archaea 1131
648 Ga0495600_0332005 3300046809 Bacteria 955
649 Ga0495581_0221674 3300047315 Bacteria 1106
650 Ga0495636_0573470 3300047318 Bacteria 550
651 Ga0495674_0654299 3300047319 Unclassified 828
652 Ga0495674_1326002 3300047319 Bacteria 539
653 Ga0495676_0585931 3300047321 Bacteria 727
654 Ga0495673_0303547 3300047469 Bacteria 572
655 Ga0495684_0303016 3300047471 Bacteria 1147
656 Ga0495593_0258015 3300047673 Unclassified 873
657 Ga0495602_1113101 3300048088 Bacteria 517
658 Ga0495615_0182323 3300048090 Bacteria 640
659 Ga0496101_0489537 3300048904 Viruses 971
660 Ga0496101_0698679 3300048904 Bacteria 801
661 Ga0496102_0206343 3300048905 Bacteria 1853
662 Ga0496102_1229919 3300048905 Bacteria 668
663 Ga0496102_1625808 3300048905 Unclassified 564
664 Ga0496103_0712189 3300048906 Unclassified 636
665 Ga0496104_0106509 3300048907 Bacteria 2687
666 Ga0496105_0451205 3300048908 Bacteria 1015
667 Ga0496106_0725102 3300048909 Bacteria 791
668 Ga0496106_1118297 3300048909 Unclassified 617
669 Ga0496107_0584676 3300048910 Bacteria 826
670 Ga0496108_0151095 3300048911 Bacteria 2004
671 Ga0496108_0449584 3300048911 Unclassified 1126
672 Ga0496108_1194999 3300048911 Unclassified 643
673 Ga0496109_0071488 3300048912 Bacteria 3186
674 Ga0496109_0450135 3300048912 Viruses 1216
675 Ga0496109_0806183 3300048912 Bacteria 877
676 Ga0496109_1751993 3300048912 Unclassified 555
677 Ga0496110_0035388 3300048913 Bacteria 4332
678 Ga0496110_0324383 3300048913 Unclassified 1403
679 Ga0496111_0643469 3300048914 Bacteria 774
680 Ga0496111_0945020 3300048914 Unclassified 619
681 Ga0496112_0005203 3300048915 Bacteria 11192
682 Ga0496112_0052613 3300048915 Bacteria 3997
683 Ga0496112_0199765 3300048915 Bacteria 1959
684 Ga0496112_0277395 3300048915 Unclassified 1624
685 Ga0496112_0442518 3300048915 Unclassified 1238
686 Ga0496113_0234177 3300048916 Unclassified 1465
687 Ga0496113_0639328 3300048916 Unclassified 851
688 Ga0496114_0018375 3300048917 Bacteria 5653
689 Ga0496114_0187913 3300048917 Unclassified 1806
690 Ga0496114_0649699 3300048917 Unclassified 928
691 Ga0496115_0235223 3300048918 Bacteria 1510
692 Ga0501069_0462260 3300049585 Bacteria 755
693 nmdc:mga05p37_11164_c1 3300050507 Bacteria 6678
694 nmdc:mga05p37_144452_c1 3300050507 Unclassified 2914
695 nmdc:mga05p37_146069_c1 3300050507 Bacteria 2896
696 nmdc:mga05p37_2024261_c1 3300050507 Unclassified 544
697 nmdc:mga05p37_2176416_c1 3300050507 Unclassified 516
698 nmdc:mga05p37_270903_c1 3300050507 Bacteria 2029
699 nmdc:mga05p37_42917_c1 3300050507 Bacteria 5560
700 nmdc:mga05p37_455343_c1 3300050507 Bacteria 1480
701 nmdc:mga05p37_53003_c1 3300050507 Bacteria 4989
702 nmdc:mga05p37_5360_c1 3300050507 Bacteria 15078
703 nmdc:mga05p37_5614_c1 3300050507 Bacteria 14743
704 nmdc:mga05p37_60970_c1 3300050507 Bacteria 4644
705 nmdc:mga09592_417597_c1 3300050508 Bacteria 1159
706 nmdc:mga09592_575398_c1 3300050508 Unclassified 966
707 nmdc:mga0qj67_497205_c1 3300050509 Bacteria 980
708 nmdc:mga0qj67_615356_c1 3300050509 Bacteria 868
709 nmdc:mga0qj67_790832_c1 3300050509 Bacteria 751
710 nmdc:mga06r32_57899_c1 3300050510 Bacteria 3723
711 nmdc:mga06r32_934767_c1 3300050510 Bacteria 822
712 nmdc:mga08y16_132443_c1 3300050511 Bacteria 2592
713 nmdc:mga08y16_1352430_c1 3300050511 Unclassified 677
714 nmdc:mga08y16_152011_c1 3300050511 Bacteria 2406
715 nmdc:mga08y16_185315_c1 3300050511 Unclassified 2160
716 nmdc:mga08y16_459380_c1 3300050511 Bacteria 1298
717 nmdc:mga08y16_6600_c1 3300050511 Bacteria 12171
718 nmdc:mga08y16_987450_c1 3300050511 Bacteria 823
719 nmdc:mga0n895_221529_c1 3300050512 Unclassified 1921
720 nmdc:mga0n895_26703_c1 3300050512 Bacteria 5474
721 nmdc:mga0n895_274022_c1 3300050512 Unclassified 1711
722 nmdc:mga0n895_289_c1 3300050512 Bacteria 33061
723 nmdc:mga0n895_30269_c1 3300050512 Bacteria 5171
724 nmdc:mga0n895_356556_c1 3300050512 Bacteria 1481
725 nmdc:mga0n895_4739_c1 3300050512 Bacteria 11235
726 nmdc:mga0n895_625828_c1 3300050512 Bacteria 1077
727 nmdc:mga0n895_632412_c1 3300050512 Bacteria 1070
728 nmdc:mga0n895_635270_c1 3300050512 Bacteria 1067
729 nmdc:mga0n895_640964_c1 3300050512 Unclassified 1062
730 nmdc:mga0n895_73354_c1 3300050512 Bacteria 3398
731 nmdc:mga0rr50_123926_c1 3300050513 Unclassified 2061
732 nmdc:mga0rr50_1628198_c1 3300050513 Unclassified 545
733 nmdc:mga0rr50_1770522_c1 3300050513 Unclassified 520
734 nmdc:mga0rr50_230_c1 3300050513 Bacteria 30282
735 nmdc:mga0rr50_3254_c1 3300050513 Bacteria 9309
736 nmdc:mga0rr50_47970_c1 3300050513 Unclassified 3155
737 nmdc:mga0rr50_507088_c1 3300050513 Unclassified 1026
738 nmdc:mga0rr50_5346_c1 3300050513 Bacteria 7649
739 nmdc:mga0rr50_81864_c1 3300050513 Unclassified 2492
740 nmdc:mga0rr50_965113_c1 3300050513 Bacteria 726
741 nmdc:mga08x19_1066400_c1 3300050514 Unclassified 574
742 nmdc:mga08x19_123043_c1 3300050514 Bacteria 1741
743 nmdc:mga08x19_169708_c1 3300050514 Bacteria 1485
744 nmdc:mga08x19_290_c1 3300050514 Bacteria 36986
745 nmdc:mga08x19_47969_c1 3300050514 Unclassified 2735
746 nmdc:mga08x19_57323_c1 3300050514 Bacteria 2517
747 nmdc:mga08x19_78359_c1 3300050514 Bacteria 2166
748 nmdc:mga08x19_92861_c1 3300050514 Bacteria 1994
749 nmdc:mga0a205_157496_c1 3300050515 Bacteria 2169
750 nmdc:mga0a205_228357_c1 3300050515 Unclassified 1745
751 nmdc:mga0a205_24266_c1 3300050515 Bacteria 5763
752 nmdc:mga0a205_270363_c1 3300050515 Unclassified 1577
753 nmdc:mga0a205_90569_c1 3300050515 Bacteria 2956
754 nmdc:mga0a205_98061_c1 3300050515 Unclassified 2829
755 nmdc:mga0sz30_70251_c1 3300050516 Bacteria 1506
756 Ga0495601_0066677 3300053077 Bacteria 2292
757 Ga0495595_0516831 3300053084 Bacteria 609
758 Ga0495619_0036137 3300053085 Bacteria 3216
759 Ga0495619_0879311 3300053085 Unclassified 603
760 Ga0500658_0304398 3300053134 Bacteria 733
761 Ga0587084_109721 3300059477 Unclassified 569
762 Ga0587084_150876 3300059477 Unclassified 511
763 Ga0587093_063886 3300059478 Unclassified 606
764 Ga0587066_058404 3300059490 Unclassified 780
765 Ga0587066_087384 3300059490 Unclassified 686
766 Ga0587066_088907 3300059490 Bacteria 682
767 Ga0587066_101321 3300059490 Bacteria 655
768 Ga0587066_108063 3300059490 Unclassified 641
769 Ga0587066_164395 3300059490 Bacteria 560
770 Ga0587070_096799 3300059491 Bacteria 673
771 Ga0587070_121001 3300059491 Unclassified 626
772 Ga0587070_133138 3300059491 Bacteria 607
773 Ga0587070_166438 3300059491 Bacteria 564
774 Ga0587073_0078608 3300059492 Bacteria 814
775 Ga0587073_0125577 3300059492 Bacteria 698
776 Ga0587077_126603 3300059493 Unclassified 643
777 Ga0587077_131113 3300059493 Unclassified 636
778 Ga0587077_263511 3300059493 Bacteria 503
779 Ga0587080_077693 3300059503 Unclassified 675
780 Ga0587080_091478 3300059503 Bacteria 639
781 Ga0587080_101638 3300059503 Bacteria 616
782 Ga0587082_081489 3300059504 Unclassified 675
783 Ga0587082_181294 3300059504 Bacteria 516
784 Ga0587083_0079176 3300059505 Unclassified 779
785 Ga0587083_0119054 3300059505 Unclassified 680
786 Ga0587083_0158184 3300059505 Bacteria 618
787 Ga0587085_017836 3300059506 Bacteria 1045
788 Ga0587085_070881 3300059506 Unclassified 681
789 Ga0587085_089730 3300059506 Bacteria 633
790 Ga0587085_091732 3300059506 Bacteria 628
791 Ga0587088_211059 3300059508 Unclassified 500
792 Ga0587090_071434 3300059510 Unclassified 679
793 Ga0587091_073614 3300059511 Unclassified 753
794 Ga0587091_094023 3300059511 Bacteria 693
795 Ga0587091_098529 3300059511 Unclassified 682
796 Ga0587091_125980 3300059511 Bacteria 627
797 Ga0587091_145476 3300059511 Unclassified 597
798 Ga0587092_093265 3300059512 Bacteria 611
799 Ga0587092_119094 3300059512 Unclassified 562
800 Ga0587125_044362 3300059607 Unclassified 610
801 Ga0587099_031954 3300059622 Unclassified 644
802 Ga0587101_102546 3300059623 Bacteria 571
803 Ga0587109_060110 3300059624 Bacteria 799
804 Ga0587109_156022 3300059624 Unclassified 568
805 Ga0587115_040710 3300059626 Unclassified 725
806 Ga0587117_055005 3300059627 Unclassified 670
807 Ga0587117_068679 3300059627 Bacteria 624
808 Ga0587128_059597 3300059630 Unclassified 718
809 Ga0587128_070278 3300059630 Unclassified 680
810 Ga0587062_101950 3300059639 Unclassified 560
811 Ga0587067_091914 3300059640 Unclassified 689
812 Ga0587067_112156 3300059640 Unclassified 645
813 Ga0587068_074326 3300059641 Unclassified 676
814 Ga0587068_109463 3300059641 Unclassified 589
815 Ga0587068_124245 3300059641 Unclassified 563
816 Ga0587069_044156 3300059642 Bacteria 771
817 Ga0587069_111144 3300059642 Unclassified 571
818 Ga0587072_101028 3300059643 Bacteria 647
819 Ga0587072_148032 3300059643 Unclassified 565
820 Ga0587075_037420 3300059644 Bacteria 799
821 Ga0587075_097215 3300059644 Bacteria 583
822 Ga0587079_078530 3300059647 Unclassified 750
823 Ga0587079_125514 3300059647 Unclassified 639
824 Ga0587079_160919 3300059647 Unclassified 587
825 Ga0587079_209667 3300059647 Bacteria 536
826 Ga0587102_029691 3300059649 Unclassified 662
827 Ga0587114_064558 3300059655 Unclassified 650
828 Ga0587119_035990 3300059658 Bacteria 694
829 Ga0587120_016081 3300059659 Unclassified 680
830 Ga0587071_107671 3300060344 Unclassified 652
831 Ga0587111_0102598 3300060346 Unclassified 714
832 Ga0587111_0117608 3300060346 Bacteria 681
833 Ga0075431_100955821
834 JGI24751J29686_10136194
835 Ga0006778J45830_1047620
836 Ga0007417J51691_1016039
837 Ga0007410J51695_1017530
838 Ga0007409J51694_1018177
839 Ga0058859_10015558
840 Ga0058859_10029500
841 Ga0058859_11802446
842 Ga0058861_10046562
843 Ga0058861_10061482
844 Ga0058860_10003761
845 Ga0058860_10059047
846 Ga0058860_10103052
847 Ga0058860_11769591
848 Ga0058860_11974703
849 Ga0058860_12057218
850 Ga0058860_12173292
851 Ga0058860_12198386
852 Ga0058862_10068240
853 Ga0058862_12323089
854 Ga0058862_12852925
855 Ga0065704_10826817
856 Ga0065712_10089387
857 Ga0065712_10098880
858 Ga0065712_10127091
859 Ga0065715_10024170
860 Ga0065715_10038432
861 Ga0065715_10053738
862 Ga0065715_10116964
863 Ga0065715_10117928
864 Ga0065715_10702660
865 Ga0065707_10043594
866 Ga0065707_10314294
867 Ga0065707_10328143
868 Ga0065707_10556148
869 Ga0065707_10558462
870 Ga0065707_11069560
871 Ga0070658_10034911
872 Ga0070658_11387658
873 Ga0070676_10008730
874 Ga0070676_10731815
875 Ga0070683_100046199
876 Ga0070683_100798706
877 Ga0070683_100933684
878 Ga0070690_100307222
879 Ga0070690_100495009
880 Ga0070690_100514547
881 Ga0070690_100546828
882 Ga0070690_100657941
883 Ga0070670_100040713
884 Ga0070670_100265647
885 Ga0068869_100316443
886 Ga0068869_100349361
887 Ga0068869_101396563
888 Ga0070666_10005352
889 Ga0070666_10019194
890 Ga0070666_10082492
891 Ga0070666_10367170
892 Ga0070666_10571308
893 Ga0070680_101122063
894 Ga0070680_101401941
895 Ga0070680_101832991
896 Ga0068868_100117035
897 Ga0068868_100180984
898 Ga0068868_100192172
899 Ga0068868_100551638
900 Ga0068868_101150926
901 Ga0068868_101872745
902 Ga0068868_102002397
903 Ga0070660_100001652
904 Ga0070660_100778974
905 Ga0070689_100497384
906 Ga0070689_100662162
907 Ga0070691_10006391
908 Ga0070687_100003054
909 Ga0070687_100643913
910 Ga0070692_10537395
911 Ga0070668_100527032
912 Ga0070668_100758419
913 Ga0070669_100045030
914 Ga0070669_100061650
915 Ga0070669_100104336
916 Ga0070675_100001159
917 Ga0070675_100361398
918 Ga0070675_100758082
919 Ga0070675_101216106
920 Ga0070671_100017557
921 Ga0070671_100212682
922 Ga0070671_101776807
923 Ga0070674_100028431
924 Ga0070674_100171038
925 Ga0070674_100282571
926 Ga0070674_100532968
927 Ga0070674_100724031
928 Ga0070674_101608667
929 Ga0070673_100966975
930 Ga0070688_100176422
931 Ga0070659_100299316
932 Ga0070667_100069980
933 Ga0070667_100301516
934 Ga0070667_102205872
935 Ga0070703_10171197
936 Ga0070709_10120921
937 Ga0070709_10244396
938 Ga0070714_100009490
939 Ga0070713_100055079
940 Ga0070701_10016043
941 Ga0070701_10156459
942 Ga0070711_100130229
943 Ga0070711_101658002
944 Ga0070705_100031701
945 Ga0070705_100213829
946 Ga0070700_100004725
947 Ga0070700_100053989
948 Ga0070700_100150819
949 Ga0070694_100007642
950 Ga0070694_100070104
951 Ga0070694_100947623
952 Ga0070708_100059377
953 Ga0070708_100864179
954 Ga0070678_100625162
955 Ga0070678_100702841
956 Ga0070662_100697293
957 Ga0070662_100755207
958 Ga0070662_101763528
959 Ga0070681_10219992
960 Ga0070681_10259257
961 Ga0070681_11002319
962 Ga0068867_100023724
963 Ga0068867_100029667
964 Ga0068867_101579490
965 Ga0068867_101676605
966 Ga0070706_101974476
967 Ga0070707_100018003
968 Ga0070707_100066005
969 Ga0070707_100845744
970 Ga0070707_101064360
971 Ga0070698_100197340
972 Ga0070698_100298757
973 Ga0070698_100747450
974 Ga0070698_101232179
975 Ga0070698_102069169
976 Ga0070699_100091833
977 Ga0070699_100176638
978 Ga0070699_100298641
979 Ga0070699_100457896
980 Ga0070699_100559062
981 Ga0070699_100948062
982 Ga0070679_100085080
983 Ga0070679_100265748
984 Ga0070679_100792118
985 Ga0070684_100121089
986 Ga0070697_100024496
987 Ga0070697_100034692
988 Ga0070697_100762984
989 Ga0070697_101066557
990 Ga0070697_101116988
991 Ga0070697_101187887
992 Ga0070697_101949889
993 Ga0068853_101987334
994 Ga0070672_100297685
995 Ga0070672_100354179
996 Ga0070672_100592842
997 Ga0070672_100986438
998 Ga0070686_100002006
999 Ga0070686_100187596
1000 Ga0070686_100344550
1001 Ga0070686_101678977
1002 Ga0070695_100003105
1003 Ga0070695_100121607
1004 Ga0070695_100865651
1005 Ga0070695_101442113
1006 Ga0070696_100022102
1007 Ga0070696_100242666
1008 Ga0070696_100957858
1009 Ga0070696_101378474
1010 Ga0070665_100002229
1011 Ga0070665_100005414
1012 Ga0070665_100597970
1013 Ga0070704_100102279
1014 Ga0070704_100131299
1015 Ga0070704_100401785
1016 Ga0070704_101911612
1017 Ga0068855_100007572
1018 Ga0068855_101434118
1019 Ga0068855_101684988
1020 Ga0070664_101066968
1021 Ga0068857_100791816
1022 Ga0068857_101519903
1023 Ga0068854_100081405
1024 Ga0068854_101178188
1025 Ga0068854_101262587
1026 Ga0068854_101338088
1027 Ga0068856_100756199
1028 Ga0070702_100007355
1029 Ga0070702_100032167
1030 Ga0068852_100692449
1031 Ga0068852_101037698
1032 Ga0068852_101316464
1033 Ga0068859_100099406
1034 Ga0068859_100169727
1035 Ga0068864_100053805
1036 Ga0068864_100369779
1037 Ga0068864_100802364
1038 Ga0068866_10704984
1039 Ga0068866_11402939
1040 Ga0068861_100006984
1041 Ga0068861_100027542
1042 Ga0068861_100034197
1043 Ga0068861_100115850
1044 Ga0068861_100637807
1045 Ga0068851_10185293
1046 Ga0068851_10309611
1047 Ga0068851_10518126
1048 Ga0068851_11022050
1049 Ga0068870_10533241
1050 Ga0068863_100001186
1051 Ga0068863_100043758
1052 Ga0068863_100156280
1053 Ga0068863_100849435
1054 Ga0068863_101057369
1055 Ga0068858_100014615
1056 Ga0068858_100140079
1057 Ga0068858_100634387
1058 Ga0068858_101155965
1059 Ga0068858_102057112
1060 Ga0068860_100168390
1061 Ga0068860_100296564
1062 Ga0068860_100299259
1063 Ga0068860_100447883
1064 Ga0068860_101238561
1065 Ga0068860_101860989
1066 Ga0068860_102243107
1067 Ga0068862_100040286
1068 Ga0068862_100100089
1069 Ga0068862_100466796
1070 Ga0068862_100652033
1071 Ga0068862_100892220
1072 Ga0068862_101153941
1073 Ga0068862_101195671
1074 Ga0068862_101559220
1075 Ga0081455_10057988
1076 Ga0081455_10420522
1077 Ga0081455_10951655
1078 Ga0081539_10023900
1079 Ga0070717_10473333
1080 Ga0070717_11208095
1081 Ga0075432_10024561
1082 Ga0075432_10328978
1083 Ga0070715_10409730
1084 Ga0070715_10624736
1085 Ga0070712_100524892
1086 Ga0075367_10588209
1087 Ga0075369_10169794
1088 Ga0097621_100140543
1089 Ga0097621_100540714
1090 Ga0075370_10302005
1091 Ga0068871_100022025
1092 Ga0068871_100216804
1093 Ga0068871_100401456
1094 Ga0068871_100453801
1095 Ga0075428_100808141
1096 Ga0075428_101750208
1097 Ga0075428_101872737
1098 Ga0075430_100564988
1099 Ga0075430_100671090
1100 Ga0075431_100066457
1101 Ga0075433_10026005
1102 Ga0075433_10051027
1103 Ga0075433_10076568
1104 Ga0075433_10140662
1105 Ga0075433_10165409
1106 Ga0075433_10812671
1107 Ga0075433_10908312
1108 Ga0075433_11957171
1109 Ga0075433_11977163
1110 Ga0075434_100004496
1111 Ga0075434_100004747
1112 Ga0075434_100006859
1113 Ga0075434_100041206
1114 Ga0075434_100308047
1115 Ga0075434_100328519
1116 Ga0075434_100333469
1117 Ga0075434_100581220
1118 Ga0075434_100731315
1119 Ga0075434_101251147
1120 Ga0075434_101940151
1121 Ga0075429_100070545
1122 Ga0075429_100368486
1123 Ga0075429_101018009
1124 Ga0068865_100093217
1125 Ga0068865_100877072
1126 Ga0068865_100944768
1127 Ga0075436_100000773
1128 Ga0075436_100015204
1129 Ga0075436_100030276
1130 Ga0075436_100065517
1131 Ga0075436_100078869
1132 Ga0075436_100338737
1133 Ga0075436_101520499
1134 Ga0097620_100099406
1135 Ga0097620_100169717
1136 Ga0075435_100000146
1137 Ga0075435_100001901
1138 Ga0075435_100004569
1139 Ga0075435_100048070
1140 Ga0075435_100298523
1141 Ga0075435_100304347
1142 Ga0075435_100481678
1143 Ga0075435_101049562
1144 Ga0075435_101871971
1145 Ga0099794_10094090
1146 Ga0099794_10739483
1147 Ga0105244_10486989
1148 Ga0105240_10019896
1149 Ga0105240_10105544
1150 Ga0105240_10130186
1151 Ga0105240_10297717
1152 Ga0105240_12294938
1153 Ga0111539_10013716
1154 Ga0111539_10049396
1155 Ga0111539_10213302
1156 Ga0111539_10227216
1157 Ga0111539_10577581
1158 Ga0111539_10749838
1159 Ga0105245_10052933
1160 Ga0105245_10073841
1161 Ga0105245_10210466
1162 Ga0105245_10815139
1163 Ga0105245_11575978
1164 Ga0105245_11868985
1165 Ga0105247_10015145
1166 Ga0105247_10528125
1167 Ga0105247_10684741
1168 Ga0105247_11810149
1169 Ga0114129_10000276
1170 Ga0114129_10003924
1171 Ga0114129_10008009
1172 Ga0114129_10043314
1173 Ga0114129_10058725
1174 Ga0114129_10083857
1175 Ga0114129_10174850
1176 Ga0114129_10632717
1177 Ga0114129_10641902
1178 Ga0114129_10666147
1179 Ga0114129_10938510
1180 Ga0114129_11002587
1181 Ga0114129_11462156
1182 Ga0114129_11519242
1183 Ga0114129_11704269
1184 Ga0105243_10010938
1185 Ga0105243_10073016
1186 Ga0105243_10094196
1187 Ga0105242_10002080
1188 Ga0105242_10299418
1189 Ga0105242_10434335
1190 Ga0105242_11410505
1191 Ga0105248_10017318
1192 Ga0105248_10023120
1193 Ga0105248_10159482
1194 Ga0105248_10384817
1195 Ga0105248_10971235
1196 Ga0105248_11698049
1197 Ga0105248_12156891
1198 Ga0105237_10228495
1199 Ga0105237_12075289
1200 Ga0105238_10229915
1201 Ga0105238_10538579
1202 Ga0105249_10180765
1203 Ga0105249_10563562
1204 Ga0105249_10591464
1205 Ga0105249_10597949
1206 Ga0105249_11102569
1207 Ga0105239_10511510
1208 Ga0105239_11120748
1209 Ga0105239_11829456
1210 Ga0105246_11238210
1211 Ga0105246_11342185
1212 Ga0157341_1024136
1213 Ga0157315_1017014
1214 Ga0157316_1045199
1215 Ga0157373_10907747
1216 Ga0157374_10237970
1217 Ga0157374_10372435
1218 Ga0157374_10541719
1219 Ga0157374_11226772
1220 Ga0157374_12768935
1221 Ga0157378_10446663
1222 Ga0163162_10036492
1223 Ga0163162_10137941
1224 Ga0163162_11181611
1225 Ga0163162_12485632
1226 Ga0157372_12360399
1227 Ga0157375_10024863
1228 Ga0157375_10239334
1229 Ga0157375_10318827
1230 Ga0157375_10411451
1231 Ga0157375_11915052
1232 Ga0157375_12607387
1233 Ga0163163_10049609
1234 Ga0163163_10366111
1235 Ga0163163_10442043
1236 Ga0157380_10091978
1237 Ga0157380_10240823
1238 Ga0157380_11728377
1239 Ga0157377_10067021
1240 Ga0157377_10661139
1241 Ga0157377_10787664
1242 Ga0157379_10033286
1243 Ga0157379_10152320
1244 Ga0157379_10421201
1245 Ga0157379_10731748
1246 Ga0157379_10847682
1247 Ga0157376_10108215
1248 Ga0157376_10310272
1249 Ga0157376_11013590
1250 Ga0157376_11308726
1251 Ga0182007_10150593
1252 Ga0163161_10751274
1253 Ga0197907_11073421
1254 Ga0206356_11280093
1255 Ga0206356_11450779
1256 Ga0206354_10508403
1257 Ga0206353_10914929
1258 Ga0154015_1398253
1259 Ga0207697_10006540
1260 Ga0207697_10108953
1261 Ga0207656_10245524
1262 Ga0207653_10177990
1263 Ga0207642_10080677
1264 Ga0207642_10698311
1265 Ga0207710_10007441
1266 Ga0207688_10029839
1267 Ga0207680_10036885
1268 Ga0207680_10064705
1269 Ga0207680_10617903
1270 Ga0207699_10099001
1271 Ga0207645_10344897
1272 Ga0207643_10111420
1273 Ga0207705_10170389
1274 Ga0207684_11569266
1275 Ga0207654_11103233
1276 Ga0207707_10244726
1277 Ga0207707_10954182
1278 Ga0207695_10053967
1279 Ga0207695_10100024
1280 Ga0207695_10859899
1281 Ga0207695_10865962
1282 Ga0207695_11083037
1283 Ga0207671_10365587
1284 Ga0207671_10827532
1285 Ga0207693_10610157
1286 Ga0207662_10000766
1287 Ga0207662_10985857
1288 Ga0207662_11290311
1289 Ga0207657_10000614
1290 Ga0207657_10596700
1291 Ga0207657_10700609
1292 Ga0207652_10071836
1293 Ga0207646_10034514
1294 Ga0207646_10052102
1295 Ga0207646_10194146
1296 Ga0207681_10016696
1297 Ga0207681_10031033
1298 Ga0207681_10309501
1299 Ga0207694_10317230
1300 Ga0207694_10690430
1301 Ga0207650_10089089
1302 Ga0207650_10421181
1303 Ga0207659_10003548
1304 Ga0207659_10715697
1305 Ga0207687_10030889
1306 Ga0207687_10044005
1307 Ga0207687_10360489
1308 Ga0207687_10743963
1309 Ga0207700_10103035
1310 Ga0207664_10072819
1311 Ga0207644_10332507
1312 Ga0207644_10499721
1313 Ga0207644_10864353
1314 Ga0207690_11390819
1315 Ga0207706_10098954
1316 Ga0207706_10693250
1317 Ga0207706_10907875
1318 Ga0207686_10151110
1319 Ga0207686_10370389
1320 Ga0207686_10515884
1321 Ga0207686_10763713
1322 Ga0207709_10036391
1323 Ga0207709_10058957
1324 Ga0207670_10881773
1325 Ga0207670_10976363
1326 Ga0207670_11737136
1327 Ga0207669_10009092
1328 Ga0207669_10682416
1329 Ga0207669_10803518
1330 Ga0207691_10012538
1331 Ga0207691_10302560
1332 Ga0207711_10024462
1333 Ga0207711_10214347
1334 Ga0207711_10664058
1335 Ga0207711_11346827
1336 Ga0207689_10403179
1337 Ga0207661_10313047
1338 Ga0207679_10141274
1339 Ga0207679_11193121
1340 Ga0207667_10059120
1341 Ga0207667_10261196
1342 Ga0207651_10833157
1343 Ga0207651_10835077
1344 Ga0207651_10969908
1345 Ga0207712_10038207
1346 Ga0207712_10188719
1347 Ga0207668_10939285
1348 Ga0207668_11567693
1349 Ga0207640_10004222
1350 Ga0207640_10041988
1351 Ga0207640_10132008
1352 Ga0207658_10421848
1353 Ga0207658_10641620
1354 Ga0207677_10123684
1355 Ga0207677_10325655
1356 Ga0207677_10537407
1357 Ga0207677_10744439
1358 Ga0207703_10149596
1359 Ga0207703_10428169
1360 Ga0207703_10435688
1361 Ga0207703_11334417
1362 Ga0207678_10264454
1363 Ga0207708_10000371
1364 Ga0207708_10082621
1365 Ga0207708_10128383
1366 Ga0207708_10341164
1367 Ga0207702_10087298
1368 Ga0207641_10000636
1369 Ga0207641_10071734
1370 Ga0207641_10602756
1371 Ga0207648_10012089
1372 Ga0207648_10109724
1373 Ga0207648_11180491
1374 Ga0207676_10042897
1375 Ga0207676_10473161
1376 Ga0207676_10491975
1377 Ga0207676_11109196
1378 Ga0207676_11864619
1379 Ga0207674_10212822
1380 Ga0207675_100002462
1381 Ga0207675_100033222
1382 Ga0207675_100062728
1383 Ga0207675_100287839
1384 Ga0207683_10215886
1385 Ga0207683_10645864
1386 Ga0207698_10256554
1387 Ga0207698_11290761
1388 Ga0207698_11745095
1389 Ga0209588_1223621
1390 Ga0207428_10049026
1391 Ga0207428_10049977
1392 Ga0207428_10265739
1393 Ga0207428_10416468
1394 Ga0268266_10005953
1395 Ga0268266_11338668
1396 Ga0268265_10013240
1397 Ga0268265_10183828
1398 Ga0268265_11134358
1399 Ga0268264_10097324
1400 Ga0268264_10227865
1401 Ga0268264_10251443
1402 Ga0268264_11410744
1403 Ga0307511_10184465
1404 Ga0307509_10615061
1405 Ga0307408_100761858
1406 Ga0307409_102750926
1407 Ga0307411_11627955
1408 Ga0373930_0001121
1409 Ga0373950_0017945
1410 Ga0373958_0011454
1411 Ga0373959_0001280
1412 Ga0373938_0001573
1413 Ga0373928_0008711
1414 Ga0373929_0003424
1415 Ga0373940_0000443
1416 Ga0373949_0001967
1417 Ga0373951_0001112
1418 Ga0373952_0011654
1419 Ga0373923_0159336
1420 Ga0373932_0002295
1421 Ga0373939_0001306
1422 Ga0373939_0069864
1423 Ga0373941_0007020
1424 Ga0373941_0020775
1425 Ga0373941_0088755
1426 Ga0373945_0161017
1427 Ga0373956_0147364
1428 Ga0373957_0213360
1429 Ga0373960_0003363
1430 Ga0373943_0436931
1431 Ga0373946_0276510
1432 Ga0373955_0520669
1433 Ga0373955_1056770
1434 Ga0373942_0000132
1435 Ga0373961_0002112
1436 Ga0373961_0053647
1437 Ga0373962_0005309
1438 Ga0373931_0004820
1439 Ga0373935_0592610
1440 Ga0373933_0300608
1441 Ga0373933_1102732
1442 Ga0373947_0759969
1443 Ga0373937_0113598
1444 Ga0373937_0553223
1445 Ga0373937_0871349
1446 Ga0373937_1926495
1447 Ga0373925_0124920
1448 Ga0373925_0304287
1449 Ga0451807_2653644
1450 Ga0439433_0065859
1451 Ga0439464_0239477
1452 Ga0466963_0178747
1453 Ga0466957_1419823
1454 Ga0451576_0004536
1455 Ga0451576_0907433
1456 Ga0466967_0049811
1457 Ga0495603_0527410
1458 Ga0495590_0341675
1459 Ga0495580_0681999
1460 Ga0495608_0922441
1461 Ga0495628_0977856
1462 Ga0495630_0621415
1463 Ga0495630_1407836
1464 Ga0495640_0429279
1465 Ga0495587_0621394
1466 Ga0495598_0426794
1467 Ga0495645_0008439
1468 Ga0495667_0279953
1469 Ga0495634_0252344
1470 Ga0495635_0024254
1471 Ga0495635_0088634
1472 Ga0495659_0201242
1473 Ga0495647_0101965
1474 Ga0495658_0110453
1475 Ga0495658_1034349
1476 Ga0495669_0103025
1477 Ga0495613_0285232
1478 Ga0495613_0957730
1479 Ga0495670_0175118
1480 Ga0495600_0332005
1481 Ga0495581_0221674
1482 Ga0495636_0573470
1483 Ga0495674_0654299
1484 Ga0495674_1326002
1485 Ga0495676_0585931
1486 Ga0495673_0303547
1487 Ga0495684_0303016
1488 Ga0495593_0258015
1489 Ga0495602_1113101
1490 Ga0495615_0182323
1491 Ga0496101_0489537
1492 Ga0496101_0698679
1493 Ga0496102_0206343
1494 Ga0496102_1229919
1495 Ga0496102_1625808
1496 Ga0496103_0712189
1497 Ga0496104_0106509
1498 Ga0496105_0451205
1499 Ga0496106_0725102
1500 Ga0496106_1118297
1501 Ga0496107_0584676
1502 Ga0496108_0151095
1503 Ga0496108_0449584
1504 Ga0496108_1194999
1505 Ga0496109_0071488
1506 Ga0496109_0450135
1507 Ga0496109_0806183
1508 Ga0496109_1751993
1509 Ga0496110_0035388
1510 Ga0496110_0324383
1511 Ga0496111_0643469
1512 Ga0496111_0945020
1513 Ga0496112_0005203
1514 Ga0496112_0052613
1515 Ga0496112_0199765
1516 Ga0496112_0277395
1517 Ga0496112_0442518
1518 Ga0496113_0234177
1519 Ga0496113_0639328
1520 Ga0496114_0018375
1521 Ga0496114_0187913
1522 Ga0496114_0649699
1523 Ga0496115_0235223
1524 Ga0501069_0462260
1525 nmdc:mga05p37_11164_c1
1526 nmdc:mga05p37_144452_c1
1527 nmdc:mga05p37_146069_c1
1528 nmdc:mga05p37_2024261_c1
1529 nmdc:mga05p37_2176416_c1
1530 nmdc:mga05p37_270903_c1
1531 nmdc:mga05p37_42917_c1
1532 nmdc:mga05p37_455343_c1
1533 nmdc:mga05p37_53003_c1
1534 nmdc:mga05p37_5360_c1
1535 nmdc:mga05p37_5614_c1
1536 nmdc:mga05p37_60970_c1
1537 nmdc:mga09592_417597_c1
1538 nmdc:mga09592_575398_c1
1539 nmdc:mga0qj67_497205_c1
1540 nmdc:mga0qj67_615356_c1
1541 nmdc:mga0qj67_790832_c1
1542 nmdc:mga06r32_57899_c1
1543 nmdc:mga06r32_934767_c1
1544 nmdc:mga08y16_132443_c1
1545 nmdc:mga08y16_1352430_c1
1546 nmdc:mga08y16_152011_c1
1547 nmdc:mga08y16_185315_c1
1548 nmdc:mga08y16_459380_c1
1549 nmdc:mga08y16_6600_c1
1550 nmdc:mga08y16_987450_c1
1551 nmdc:mga0n895_221529_c1
1552 nmdc:mga0n895_26703_c1
1553 nmdc:mga0n895_274022_c1
1554 nmdc:mga0n895_289_c1
1555 nmdc:mga0n895_30269_c1
1556 nmdc:mga0n895_356556_c1
1557 nmdc:mga0n895_4739_c1
1558 nmdc:mga0n895_625828_c1
1559 nmdc:mga0n895_632412_c1
1560 nmdc:mga0n895_635270_c1
1561 nmdc:mga0n895_640964_c1
1562 nmdc:mga0n895_73354_c1
1563 nmdc:mga0rr50_123926_c1
1564 nmdc:mga0rr50_1628198_c1
1565 nmdc:mga0rr50_1770522_c1
1566 nmdc:mga0rr50_230_c1
1567 nmdc:mga0rr50_3254_c1
1568 nmdc:mga0rr50_47970_c1
1569 nmdc:mga0rr50_507088_c1
1570 nmdc:mga0rr50_5346_c1
1571 nmdc:mga0rr50_81864_c1
1572 nmdc:mga0rr50_965113_c1
1573 nmdc:mga08x19_1066400_c1
1574 nmdc:mga08x19_123043_c1
1575 nmdc:mga08x19_169708_c1
1576 nmdc:mga08x19_290_c1
1577 nmdc:mga08x19_47969_c1
1578 nmdc:mga08x19_57323_c1
1579 nmdc:mga08x19_78359_c1
1580 nmdc:mga08x19_92861_c1
1581 nmdc:mga0a205_157496_c1
1582 nmdc:mga0a205_228357_c1
1583 nmdc:mga0a205_24266_c1
1584 nmdc:mga0a205_270363_c1
1585 nmdc:mga0a205_90569_c1
1586 nmdc:mga0a205_98061_c1
1587 nmdc:mga0sz30_70251_c1
1588 Ga0495601_0066677
1589 Ga0495595_0516831
1590 Ga0495619_0036137
1591 Ga0495619_0879311
1592 Ga0500658_0304398
1593 Ga0587084_109721
1594 Ga0587084_150876
1595 Ga0587093_063886
1596 Ga0587066_058404
1597 Ga0587066_087384
1598 Ga0587066_088907
1599 Ga0587066_101321
1600 Ga0587066_108063
1601 Ga0587066_164395
1602 Ga0587070_096799
1603 Ga0587070_121001
1604 Ga0587070_133138
1605 Ga0587070_166438
1606 Ga0587073_0078608
1607 Ga0587073_0125577
1608 Ga0587077_126603
1609 Ga0587077_131113
1610 Ga0587077_263511
1611 Ga0587080_077693
1612 Ga0587080_091478
1613 Ga0587080_101638
1614 Ga0587082_081489
1615 Ga0587082_181294
1616 Ga0587083_0079176
1617 Ga0587083_0119054
1618 Ga0587083_0158184
1619 Ga0587085_017836
1620 Ga0587085_070881
1621 Ga0587085_089730
1622 Ga0587085_091732
1623 Ga0587088_211059
1624 Ga0587090_071434
1625 Ga0587091_073614
1626 Ga0587091_094023
1627 Ga0587091_098529
1628 Ga0587091_125980
1629 Ga0587091_145476
1630 Ga0587092_093265
1631 Ga0587092_119094
1632 Ga0587125_044362
1633 Ga0587099_031954
1634 Ga0587101_102546
1635 Ga0587109_060110
1636 Ga0587109_156022
1637 Ga0587115_040710
1638 Ga0587117_055005
1639 Ga0587117_068679
1640 Ga0587128_059597
1641 Ga0587128_070278
1642 Ga0587062_101950
1643 Ga0587067_091914
1644 Ga0587067_112156
1645 Ga0587068_074326
1646 Ga0587068_109463
1647 Ga0587068_124245
1648 Ga0587069_044156
1649 Ga0587069_111144
1650 Ga0587072_101028
1651 Ga0587072_148032
1652 Ga0587075_037420
1653 Ga0587075_097215
1654 Ga0587079_078530
1655 Ga0587079_125514
1656 Ga0587079_160919
1657 Ga0587079_209667
1658 Ga0587102_029691
1659 Ga0587114_064558
1660 Ga0587119_035990
1661 Ga0587120_016081
1662 Ga0587071_107671
1663 Ga0587111_0102598
1664 Ga0587111_0117608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

63

0.93

PF08534

Redoxin

Redoxin

1

80

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.699 2 68
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.6624 2 84
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.6578 2 84
3vwu-assembly1.cif.gz_C crystal structure of peroxiredoxin 4 from m. musculus 0.6425 2 84
2h66-assembly1.cif.gz_I the crystal structure of plasmodium vivax 2-cys peroxiredoxin 0.6371 2 86
ID Description Score Start End Superfamily
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.699 2 68 3.40.30.10
af_Q55E48_3_135_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6868 2 73 3.40.30.10
3kebC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.637 2 86 3.40.30.10
af_Q5A7P9_48_194_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6358 2 86 3.40.30.10
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6353 2 84 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A358Y0W9-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.7787 2 49 GO:0016209
GO:0016491
AF-A0A1F6UWM2-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.7754 23 91
AF-A0A7V8XVV5-F1-model_v4 Peroxiredoxin family protein 0.7736 2 62 GO:0016209
GO:0016491
AF-A0A3B8R9B1-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.7728 2 62 GO:0016209
GO:0016491
AF-A0A1F6UWM2-F1-model_v4 Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant domain-containing protein 0.7656 23 91

Map