F482621
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 829 | 445 | 743 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300048922|Ga0496119_0081901|Ga0496119_0081901_16_1281 |
| Length | 421 |
| Sequence | MRQLEALAQEAQSFTPPQPAMTEQVVTWHGRGAGPASAPVTAEPGALSGDEAEVARVMQICNACRYCEGFCAVFPAMTRRLEFGKADLNYLANLCHNCGACLHACQYAPPHEFAVNVPQAMAQVRMQTYHDYAWPPAMGALYQRAGLTVALALAGGLALFLVLAVAMSGSLLHEPLAGNFYAIFPHNFLALVFGAVFLFVMFALAMGVRRFWREVSPSRDNVPAEVTGVRGAASAEAAQDALRLKYLGGGHGEGCNNEDDRFTLWRRRFHHFTFYGFMLCFASTCVATLYHYLFSLHAPYALTSLPVLLGTAGGIGLVVGPVGLLWLNLRRDPAHGDAAQRPMDRGFIALLLLTSLTGLALLAWRDTPFMALLLAVHLGVVMALFLTLPYGKFAHGIFRSAALLKFAIEKRLPNRLQLGAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 5 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 6 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 7 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 8 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 9 | 2551306352 | Acinetobacter sp. GG2 | Isolate | Rhizosphere |
| 10 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 11 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 12 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 13 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 14 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 15 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 16 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 17 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 18 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 19 | 2639762793 | Acinetobacter calcoaceticus GK1 | Isolate | Rhizosphere |
| 20 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 21 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 22 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 23 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 24 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 25 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 26 | 2675903507 | Acinetobacter calcoaceticus GK2 | Isolate | Unclassified |
| 27 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 28 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 29 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 30 | 2773857761 | Acinetobacter sp. 3664 | Isolate | Unclassified |
| 31 | 2773857770 | Acinetobacter sp. 3636 | Isolate | Unclassified |
| 32 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 33 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 34 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 35 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 36 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 37 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 38 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 39 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 40 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 41 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 42 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 43 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 44 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 45 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 46 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 47 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 48 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 49 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 50 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 51 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 52 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 53 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 54 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 55 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 56 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 57 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 58 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 59 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 60 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 61 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 62 | 2919182534 | Acinetobacter calcoaceticus 2589 | Isolate | Rhizosphere |
| 63 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 64 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 65 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 66 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 67 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 68 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 69 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 70 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 71 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 72 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 73 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 74 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 75 | 2941479691 | |||
| 76 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 77 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 78 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 79 | 2984568884 | Acinetobacter baylyi SORGH_AS893 | Isolate | Aerial Root |
| 80 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 81 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 82 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 83 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 84 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 85 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 86 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 87 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 88 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 89 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 90 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 91 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 92 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 93 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 94 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 97 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 98 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 99 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 100 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 101 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 102 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 103 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 104 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 105 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 106 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 107 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 110 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 113 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 115 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 124 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 132 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 133 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 135 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 136 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 138 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 140 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 142 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 143 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 144 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 145 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 146 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 147 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 148 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 149 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 150 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 151 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 152 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 153 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 154 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 155 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 156 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 157 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 158 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 159 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 161 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 162 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 163 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 185 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 188 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 265 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 266 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 268 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 269 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 270 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 271 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 272 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 273 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 274 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 275 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 277 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 278 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 279 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 280 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 281 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 282 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 283 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 284 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 285 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 288 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 289 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 290 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 291 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 292 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 293 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 294 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 295 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 296 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 297 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 298 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 299 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 300 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 301 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 302 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 303 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 304 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 305 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 308 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 309 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 310 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 386 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 387 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 388 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 389 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 390 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 391 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 392 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 393 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 394 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 395 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 396 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 402 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 406 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 407 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 408 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 410 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 412 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 413 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 414 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 416 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 417 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 418 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 419 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 421 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 423 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 426 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 427 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 428 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 430 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 431 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 432 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 433 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 434 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 435 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 436 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 437 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 438 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 439 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 440 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 441 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 442 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 443 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 444 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 445 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.51 |
| Metatranscriptomes | 0.12 |
| Isolates | 10.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 23.16 |
| Nodule | 1.09 |
| Rhizoplane | 3.5 |
| Rhizosphere | 57.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003716 | 3300002773 | Bacteria | 5110 |
| 2 | JGI25150J39212_1000516 | 3300002774 | Bacteria | 15942 |
| 3 | JGI25151J46595_10000493 | 3300003187 | Bacteria | 37285 |
| 4 | JGI25151J46595_10002663 | 3300003187 | Bacteria | 10475 |
| 5 | JGI25151J46595_10004960 | 3300003187 | Bacteria | 6945 |
| 6 | JGI25151J46595_10008047 | 3300003187 | Bacteria | 5110 |
| 7 | JGI25151J46595_10011420 | 3300003187 | Bacteria | 4082 |
| 8 | JGI25153J46596_10008011 | 3300003215 | Bacteria | 5110 |
| 9 | rootH1_10035044 | 3300003316 | Bacteria | 3297 |
| 10 | JGI25160J50197_1007467 | 3300003354 | Bacteria | 4273 |
| 11 | JGI25161J50226_1002008 | 3300003374 | Bacteria | 5558 |
| 12 | Ga0006562J51391_1181768 | 3300003578 | Bacteria | 6099 |
| 13 | Ga0055532_1000162 | 3300003758 | Bacteria | 58304 |
| 14 | Ga0055532_1002676 | 3300003758 | Bacteria | 3506 |
| 15 | Ga0055532_1002682 | 3300003758 | Bacteria | 3497 |
| 16 | Ga0055527_1000110 | 3300003760 | Bacteria | 58304 |
| 17 | Ga0055527_1000469 | 3300003760 | Bacteria | 15440 |
| 18 | Ga0055535_1000235 | 3300003761 | Bacteria | 58304 |
| 19 | Ga0055535_1000666 | 3300003761 | Bacteria | 27110 |
| 20 | Ga0055535_1001165 | 3300003761 | Bacteria | 15440 |
| 21 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 22 | Ga0055542_1000894 | 3300003762 | Bacteria | 20391 |
| 23 | Ga0055529_1002573 | 3300003763 | Bacteria | 3403 |
| 24 | Ga0055526_1002492 | 3300003771 | Bacteria | 12423 |
| 25 | Ga0055526_1004332 | 3300003771 | Bacteria | 8568 |
| 26 | Ga0055537_1003180 | 3300003773 | Bacteria | 5133 |
| 27 | Ga0055537_1004038 | 3300003773 | Bacteria | 4309 |
| 28 | Ga0055524_1001657 | 3300003775 | Bacteria | 12422 |
| 29 | Ga0055524_1002900 | 3300003775 | Bacteria | 8568 |
| 30 | Ga0055536_1001228 | 3300003781 | Bacteria | 15847 |
| 31 | Ga0055536_1002068 | 3300003781 | Bacteria | 11462 |
| 32 | Ga0055536_1014613 | 3300003781 | Bacteria | 2740 |
| 33 | Ga0055534_1002803 | 3300003784 | Bacteria | 5819 |
| 34 | Ga0055534_1003292 | 3300003784 | Bacteria | 5133 |
| 35 | Ga0055528_1003080 | 3300003790 | Bacteria | 8568 |
| 36 | Ga0055528_1008705 | 3300003790 | Bacteria | 4309 |
| 37 | Ga0055530_10002436 | 3300003791 | Bacteria | 12014 |
| 38 | Ga0055540_1001549 | 3300003792 | Bacteria | 13470 |
| 39 | Ga0055540_1002782 | 3300003792 | Bacteria | 8960 |
| 40 | Ga0055540_1002909 | 3300003792 | Bacteria | 8662 |
| 41 | Ga0055540_1004067 | 3300003792 | Bacteria | 6782 |
| 42 | Ga0055540_1007507 | 3300003792 | Bacteria | 4098 |
| 43 | Ga0055531_10001837 | 3300003794 | Bacteria | 14985 |
| 44 | Ga0055531_10002149 | 3300003794 | Bacteria | 13468 |
| 45 | Ga0055531_10002174 | 3300003794 | Bacteria | 13396 |
| 46 | Ga0055531_10011070 | 3300003794 | Bacteria | 4402 |
| 47 | Ga0058692_1000027 | 3300003856 | Bacteria | 198745 |
| 48 | Ga0055543_1005580 | 3300004625 | Bacteria | 3186 |
| 49 | Ga0065165_1002663 | 3300005262 | Bacteria | 14420 |
| 50 | Ga0065165_1007823 | 3300005262 | Bacteria | 5145 |
| 51 | Ga0065165_1008247 | 3300005262 | Bacteria | 4924 |
| 52 | Ga0065165_1018420 | 3300005262 | Bacteria | 2527 |
| 53 | Ga0065703_1000152 | 3300005272 | Bacteria | 30747 |
| 54 | Ga0065714_10006453 | 3300005288 | Bacteria | 6231 |
| 55 | Ga0065714_10011224 | 3300005288 | Bacteria | 1980 |
| 56 | Ga0065704_10086279 | 3300005289 | Bacteria | 3136 |
| 57 | Ga0065704_10106726 | 3300005289 | Bacteria | 2075 |
| 58 | Ga0070676_10005423 | 3300005328 | Bacteria | 6797 |
| 59 | Ga0070676_10087194 | 3300005328 | Bacteria | 1905 |
| 60 | Ga0070690_100032788 | 3300005330 | Bacteria | 3247 |
| 61 | Ga0070690_100116095 | 3300005330 | Bacteria | 1792 |
| 62 | Ga0070670_100018686 | 3300005331 | Bacteria | 5941 |
| 63 | Ga0070677_10009009 | 3300005333 | Bacteria | 3375 |
| 64 | Ga0068869_100001131 | 3300005334 | Bacteria | 15567 |
| 65 | Ga0068869_100019255 | 3300005334 | Bacteria | 4659 |
| 66 | Ga0070666_10001072 | 3300005335 | Bacteria | 16709 |
| 67 | Ga0070666_10088331 | 3300005335 | Bacteria | 2126 |
| 68 | Ga0070666_10156126 | 3300005335 | Bacteria | 1593 |
| 69 | Ga0068868_100000885 | 3300005338 | Bacteria | 20333 |
| 70 | Ga0068868_100004002 | 3300005338 | Bacteria | 10288 |
| 71 | Ga0068868_100160625 | 3300005338 | Bacteria | 1855 |
| 72 | Ga0070660_100000588 | 3300005339 | Bacteria | 24352 |
| 73 | Ga0070661_100060140 | 3300005344 | Bacteria | 2788 |
| 74 | Ga0070668_100017566 | 3300005347 | Bacteria | 5364 |
| 75 | Ga0070668_100038500 | 3300005347 | Bacteria | 3655 |
| 76 | Ga0070669_100001876 | 3300005353 | Bacteria | 15148 |
| 77 | Ga0070669_100004206 | 3300005353 | Bacteria | 10416 |
| 78 | Ga0070669_100027787 | 3300005353 | Bacteria | 4072 |
| 79 | Ga0070669_100045554 | 3300005353 | Bacteria | 3197 |
| 80 | Ga0070675_100000052 | 3300005354 | Bacteria | 71092 |
| 81 | Ga0070675_100225138 | 3300005354 | Bacteria | 1634 |
| 82 | Ga0070671_100011579 | 3300005355 | Bacteria | 7095 |
| 83 | Ga0070674_100002148 | 3300005356 | Bacteria | 10823 |
| 84 | Ga0070673_100019238 | 3300005364 | Bacteria | 4901 |
| 85 | Ga0070673_100107944 | 3300005364 | Bacteria | 2303 |
| 86 | Ga0070688_100194930 | 3300005365 | Bacteria | 1414 |
| 87 | Ga0070659_100000038 | 3300005366 | Bacteria | 110675 |
| 88 | Ga0070659_100274328 | 3300005366 | Bacteria | 1402 |
| 89 | Ga0070667_100010800 | 3300005367 | Bacteria | 7545 |
| 90 | Ga0070667_100036506 | 3300005367 | Bacteria | 4120 |
| 91 | Ga0070667_100088929 | 3300005367 | Bacteria | 2653 |
| 92 | Ga0070667_100109657 | 3300005367 | Bacteria | 2392 |
| 93 | Ga0070705_100034668 | 3300005440 | Bacteria | 2823 |
| 94 | Ga0070700_100153772 | 3300005441 | Bacteria | 1576 |
| 95 | Ga0070663_100002734 | 3300005455 | Bacteria | 9991 |
| 96 | Ga0070678_100083782 | 3300005456 | Bacteria | 2425 |
| 97 | Ga0070678_100085278 | 3300005456 | Bacteria | 2406 |
| 98 | Ga0070662_100033964 | 3300005457 | Bacteria | 3595 |
| 99 | Ga0070662_100048896 | 3300005457 | Bacteria | 3048 |
| 100 | Ga0070662_100069141 | 3300005457 | Bacteria | 2598 |
| 101 | Ga0070662_100096915 | 3300005457 | Bacteria | 2225 |
| 102 | Ga0068867_100006169 | 3300005459 | Bacteria | 8483 |
| 103 | Ga0068867_100047218 | 3300005459 | Bacteria | 3165 |
| 104 | Ga0068867_100061352 | 3300005459 | Bacteria | 2791 |
| 105 | Ga0068867_100213037 | 3300005459 | Bacteria | 1553 |
| 106 | Ga0070685_10020978 | 3300005466 | Bacteria | 3544 |
| 107 | Ga0070685_10209480 | 3300005466 | Bacteria | 1271 |
| 108 | Ga0070706_100114580 | 3300005467 | Bacteria | 2510 |
| 109 | Ga0070698_100164235 | 3300005471 | Bacteria | 2163 |
| 110 | Ga0068853_100040352 | 3300005539 | Bacteria | 3983 |
| 111 | Ga0068853_100329346 | 3300005539 | Bacteria | 1417 |
| 112 | Ga0070672_100000701 | 3300005543 | Bacteria | 19832 |
| 113 | Ga0070672_100226888 | 3300005543 | Bacteria | 1568 |
| 114 | Ga0070686_100029030 | 3300005544 | Bacteria | 3360 |
| 115 | Ga0070665_100008004 | 3300005548 | Bacteria | 10706 |
| 116 | Ga0068855_100067985 | 3300005563 | Bacteria | 4149 |
| 117 | Ga0068855_100223997 | 3300005563 | Bacteria | 2108 |
| 118 | Ga0068855_100289032 | 3300005563 | Bacteria | 1818 |
| 119 | Ga0070664_100027548 | 3300005564 | Bacteria | 4722 |
| 120 | Ga0070664_100205423 | 3300005564 | Bacteria | 1759 |
| 121 | Ga0068852_100011891 | 3300005616 | Bacteria | 6582 |
| 122 | Ga0068852_100027025 | 3300005616 | Bacteria | 4672 |
| 123 | Ga0068852_100031259 | 3300005616 | Bacteria | 4391 |
| 124 | Ga0068852_100328194 | 3300005616 | Bacteria | 1488 |
| 125 | Ga0068859_100003350 | 3300005617 | Bacteria | 16303 |
| 126 | Ga0068859_100031712 | 3300005617 | Bacteria | 5307 |
| 127 | Ga0068859_100240371 | 3300005617 | Bacteria | 1900 |
| 128 | Ga0068864_100001554 | 3300005618 | Bacteria | 18908 |
| 129 | Ga0068864_100009096 | 3300005618 | Bacteria | 8189 |
| 130 | Ga0068864_100023527 | 3300005618 | Bacteria | 5174 |
| 131 | Ga0068866_10001392 | 3300005718 | Bacteria | 10426 |
| 132 | Ga0068866_10013798 | 3300005718 | Bacteria | 3553 |
| 133 | Ga0068861_100001224 | 3300005719 | Bacteria | 15979 |
| 134 | Ga0068861_100027008 | 3300005719 | Bacteria | 4178 |
| 135 | Ga0068861_100034174 | 3300005719 | Bacteria | 3758 |
| 136 | Ga0068861_100095333 | 3300005719 | Bacteria | 2356 |
| 137 | Ga0068863_100001886 | 3300005841 | Bacteria | 20819 |
| 138 | Ga0068863_100002851 | 3300005841 | Bacteria | 17124 |
| 139 | Ga0068858_100000312 | 3300005842 | Bacteria | 51731 |
| 140 | Ga0068858_100001000 | 3300005842 | Bacteria | 29221 |
| 141 | Ga0068858_100034439 | 3300005842 | Bacteria | 4698 |
| 142 | Ga0068860_100001048 | 3300005843 | Bacteria | 30480 |
| 143 | Ga0068860_100006491 | 3300005843 | Bacteria | 11745 |
| 144 | Ga0068860_100236303 | 3300005843 | Bacteria | 1777 |
| 145 | Ga0068862_100028430 | 3300005844 | Bacteria | 4708 |
| 146 | Ga0068862_100037636 | 3300005844 | Bacteria | 4101 |
| 147 | Ga0068862_100185416 | 3300005844 | Bacteria | 1869 |
| 148 | Ga0068862_100290944 | 3300005844 | Bacteria | 1500 |
| 149 | Ga0075365_10003966 | 3300006038 | Bacteria | 7751 |
| 150 | Ga0075365_10035205 | 3300006038 | Bacteria | 3238 |
| 151 | Ga0075368_10011398 | 3300006042 | Bacteria | 3233 |
| 152 | Ga0075363_100019723 | 3300006048 | Bacteria | 3374 |
| 153 | Ga0075363_100031238 | 3300006048 | Bacteria | 2760 |
| 154 | Ga0075364_10000869 | 3300006051 | Bacteria | 15941 |
| 155 | Ga0075364_10009415 | 3300006051 | Bacteria | 5860 |
| 156 | Ga0075364_10041760 | 3300006051 | Bacteria | 2979 |
| 157 | Ga0075364_10175781 | 3300006051 | Bacteria | 1448 |
| 158 | Ga0075432_10005731 | 3300006058 | Bacteria | 4229 |
| 159 | Ga0075362_10004798 | 3300006177 | Bacteria | 4883 |
| 160 | Ga0075362_10026108 | 3300006177 | Bacteria | 2492 |
| 161 | Ga0075367_10011041 | 3300006178 | Bacteria | 4764 |
| 162 | Ga0075369_10000645 | 3300006186 | Bacteria | 11097 |
| 163 | Ga0075369_10003695 | 3300006186 | Bacteria | 5592 |
| 164 | Ga0075366_10001544 | 3300006195 | Bacteria | 11516 |
| 165 | Ga0075366_10051788 | 3300006195 | Bacteria | 2439 |
| 166 | Ga0097621_100009557 | 3300006237 | Bacteria | 7047 |
| 167 | Ga0075370_10060462 | 3300006353 | Bacteria | 2158 |
| 168 | Ga0075370_10111819 | 3300006353 | Bacteria | 1586 |
| 169 | Ga0068871_100004541 | 3300006358 | Bacteria | 9677 |
| 170 | Ga0068871_100041352 | 3300006358 | Bacteria | 3696 |
| 171 | Ga0068865_100002084 | 3300006881 | Bacteria | 11817 |
| 172 | Ga0068865_100024466 | 3300006881 | Bacteria | 3962 |
| 173 | Ga0068865_100133914 | 3300006881 | Bacteria | 1859 |
| 174 | Ga0097620_100003350 | 3300006931 | Bacteria | 16303 |
| 175 | Ga0097620_100031712 | 3300006931 | Bacteria | 5307 |
| 176 | Ga0097620_100240368 | 3300006931 | Bacteria | 1900 |
| 177 | Ga0105244_10000640 | 3300009036 | Bacteria | 30838 |
| 178 | Ga0105244_10009231 | 3300009036 | Bacteria | 6083 |
| 179 | Ga0105244_10043425 | 3300009036 | Bacteria | 2319 |
| 180 | Ga0105250_10001390 | 3300009092 | Bacteria | 13081 |
| 181 | Ga0105240_10000553 | 3300009093 | Bacteria | 69247 |
| 182 | Ga0105240_10022111 | 3300009093 | Bacteria | 8440 |
| 183 | Ga0105240_10028605 | 3300009093 | Bacteria | 7275 |
| 184 | Ga0105240_10469942 | 3300009093 | Bacteria | 1404 |
| 185 | Ga0105245_10033391 | 3300009098 | Bacteria | 4561 |
| 186 | Ga0105245_10064850 | 3300009098 | Bacteria | 3302 |
| 187 | Ga0105247_10000221 | 3300009101 | Bacteria | 54565 |
| 188 | Ga0105243_10000020 | 3300009148 | Bacteria | 214279 |
| 189 | Ga0105243_10000343 | 3300009148 | Bacteria | 50175 |
| 190 | Ga0105243_10006509 | 3300009148 | Bacteria | 9031 |
| 191 | Ga0105243_10016686 | 3300009148 | Bacteria | 5552 |
| 192 | Ga0105243_10077502 | 3300009148 | Bacteria | 2703 |
| 193 | Ga0105243_10240189 | 3300009148 | Bacteria | 1612 |
| 194 | Ga0105248_10003174 | 3300009177 | Bacteria | 18211 |
| 195 | Ga0105248_10081641 | 3300009177 | Bacteria | 3634 |
| 196 | Ga0105248_10175872 | 3300009177 | Bacteria | 2412 |
| 197 | Ga0105237_10006553 | 3300009545 | Bacteria | 12878 |
| 198 | Ga0105237_10384795 | 3300009545 | Bacteria | 1408 |
| 199 | Ga0105238_10009733 | 3300009551 | Bacteria | 9625 |
| 200 | Ga0105249_10009083 | 3300009553 | Bacteria | 8691 |
| 201 | Ga0105249_10074259 | 3300009553 | Bacteria | 3147 |
| 202 | Ga0105249_10090429 | 3300009553 | Bacteria | 2862 |
| 203 | Ga0105239_10022668 | 3300010375 | Bacteria | 6922 |
| 204 | Ga0105246_10000031 | 3300011119 | Bacteria | 52056 |
| 205 | Ga0105246_10011288 | 3300011119 | Bacteria | 5543 |
| 206 | Ga0105246_10011450 | 3300011119 | Bacteria | 5504 |
| 207 | Ga0157371_10087744 | 3300013102 | Bacteria | 2203 |
| 208 | Ga0157369_10028090 | 3300013105 | Bacteria | 6229 |
| 209 | Ga0157374_10063727 | 3300013296 | Bacteria | 3457 |
| 210 | Ga0157378_10008090 | 3300013297 | Bacteria | 9177 |
| 211 | Ga0157378_10154427 | 3300013297 | Bacteria | 2141 |
| 212 | Ga0163162_10000998 | 3300013306 | Bacteria | 26303 |
| 213 | Ga0163162_10003327 | 3300013306 | Bacteria | 15381 |
| 214 | Ga0163162_10010534 | 3300013306 | Bacteria | 8992 |
| 215 | Ga0163162_10017500 | 3300013306 | Bacteria | 7012 |
| 216 | Ga0163162_10023284 | 3300013306 | Bacteria | 6111 |
| 217 | Ga0163162_10030016 | 3300013306 | Bacteria | 5384 |
| 218 | Ga0157375_10004479 | 3300013308 | Bacteria | 12137 |
| 219 | Ga0157375_10009254 | 3300013308 | Bacteria | 8644 |
| 220 | Ga0157375_10030818 | 3300013308 | Bacteria | 5063 |
| 221 | Ga0157375_10140549 | 3300013308 | Bacteria | 2541 |
| 222 | Ga0157375_10290384 | 3300013308 | Bacteria | 1798 |
| 223 | Ga0157375_10308863 | 3300013308 | Bacteria | 1746 |
| 224 | Ga0157375_10422314 | 3300013308 | Bacteria | 1499 |
| 225 | Ga0163163_10001116 | 3300014325 | Bacteria | 22834 |
| 226 | Ga0163163_10113694 | 3300014325 | Bacteria | 2737 |
| 227 | Ga0163163_10260526 | 3300014325 | Bacteria | 1785 |
| 228 | Ga0157380_10002558 | 3300014326 | Bacteria | 12287 |
| 229 | Ga0157380_10032362 | 3300014326 | Bacteria | 4022 |
| 230 | Ga0182008_10000316 | 3300014497 | Bacteria | 37971 |
| 231 | Ga0182008_10008507 | 3300014497 | Bacteria | 5604 |
| 232 | Ga0182008_10074379 | 3300014497 | Bacteria | 1672 |
| 233 | Ga0157379_10001049 | 3300014968 | Bacteria | 22458 |
| 234 | Ga0157379_10026574 | 3300014968 | Bacteria | 5152 |
| 235 | Ga0182006_1012334 | 3300015261 | Bacteria | 3736 |
| 236 | Ga0182007_10001268 | 3300015262 | Bacteria | 13720 |
| 237 | Ga0163161_10000112 | 3300017792 | Bacteria | 77235 |
| 238 | Ga0163161_10003777 | 3300017792 | Bacteria | 10610 |
| 239 | Ga0163161_10017588 | 3300017792 | Bacteria | 5005 |
| 240 | Ga0163161_10044730 | 3300017792 | Bacteria | 3190 |
| 241 | Ga0163161_10048349 | 3300017792 | Bacteria | 3072 |
| 242 | Ga0163161_10055885 | 3300017792 | Bacteria | 2866 |
| 243 | Ga0163161_10085888 | 3300017792 | Bacteria | 2322 |
| 244 | Ga0163161_10096833 | 3300017792 | Bacteria | 2191 |
| 245 | Ga0209436_102418 | 3300025208 | Bacteria | 5638 |
| 246 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 247 | Ga0209672_100059 | 3300025228 | Bacteria | 209692 |
| 248 | Ga0209672_101446 | 3300025228 | Bacteria | 8496 |
| 249 | Ga0209147_100072 | 3300025229 | Bacteria | 209692 |
| 250 | Ga0209147_100094 | 3300025229 | Bacteria | 167145 |
| 251 | Ga0209147_100534 | 3300025229 | Bacteria | 21873 |
| 252 | Ga0209147_102086 | 3300025229 | Bacteria | 5616 |
| 253 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 254 | Ga0209258_100102 | 3300025242 | Bacteria | 209692 |
| 255 | Ga0209258_100142 | 3300025242 | Bacteria | 165865 |
| 256 | Ga0209258_106361 | 3300025242 | Bacteria | 1861 |
| 257 | Ga0207425_1000138 | 3300025245 | Bacteria | 65477 |
| 258 | Ga0209677_100180 | 3300025253 | Bacteria | 53251 |
| 259 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 260 | Ga0209148_1000404 | 3300025254 | Bacteria | 50146 |
| 261 | Ga0209148_1001094 | 3300025254 | Bacteria | 16351 |
| 262 | Ga0209759_1001212 | 3300025256 | Bacteria | 15888 |
| 263 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 264 | Ga0209129_1000558 | 3300025258 | Bacteria | 25653 |
| 265 | Ga0209129_1000953 | 3300025258 | Bacteria | 17414 |
| 266 | Ga0209129_1010257 | 3300025258 | Bacteria | 2361 |
| 267 | Ga0209233_1004721 | 3300025261 | Bacteria | 4593 |
| 268 | Ga0209565_1000403 | 3300025263 | Bacteria | 36050 |
| 269 | Ga0209565_1001326 | 3300025263 | Bacteria | 11331 |
| 270 | Ga0209455_1000385 | 3300025272 | Bacteria | 39421 |
| 271 | Ga0209455_1000398 | 3300025272 | Bacteria | 37150 |
| 272 | Ga0209455_1000634 | 3300025272 | Bacteria | 21681 |
| 273 | Ga0209673_1000673 | 3300025273 | Bacteria | 49581 |
| 274 | Ga0209673_1000928 | 3300025273 | Bacteria | 36961 |
| 275 | Ga0209673_1001532 | 3300025273 | Bacteria | 21046 |
| 276 | Ga0209673_1003066 | 3300025273 | Bacteria | 10280 |
| 277 | Ga0209130_1000222 | 3300025284 | Bacteria | 74607 |
| 278 | Ga0209130_1000763 | 3300025284 | Bacteria | 27891 |
| 279 | Ga0209675_1000600 | 3300025291 | Bacteria | 25848 |
| 280 | Ga0209675_1001514 | 3300025291 | Bacteria | 13290 |
| 281 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 282 | Ga0209676_1000595 | 3300025292 | Bacteria | 53773 |
| 283 | Ga0209676_1001458 | 3300025292 | Bacteria | 22149 |
| 284 | Ga0209676_1001885 | 3300025292 | Bacteria | 17116 |
| 285 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 286 | Ga0209025_1000157 | 3300025294 | Bacteria | 168790 |
| 287 | Ga0209025_1000476 | 3300025294 | Bacteria | 77754 |
| 288 | Ga0209025_1002440 | 3300025294 | Bacteria | 19709 |
| 289 | Ga0209025_1014572 | 3300025294 | Bacteria | 4819 |
| 290 | Ga0209564_1000400 | 3300025295 | Bacteria | 77039 |
| 291 | Ga0209564_1000500 | 3300025295 | Bacteria | 64540 |
| 292 | Ga0209564_1000898 | 3300025295 | Bacteria | 39109 |
| 293 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 294 | Ga0209758_1027615 | 3300025297 | Bacteria | 2420 |
| 295 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 296 | Ga0209050_1001787 | 3300025298 | Bacteria | 21163 |
| 297 | Ga0209050_1004848 | 3300025298 | Bacteria | 8830 |
| 298 | Ga0209050_1006373 | 3300025298 | Bacteria | 7002 |
| 299 | Ga0209256_1000038 | 3300025299 | Bacteria | 375225 |
| 300 | Ga0209256_1000115 | 3300025299 | Bacteria | 173607 |
| 301 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 302 | Ga0207426_1000785 | 3300025302 | Bacteria | 34741 |
| 303 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 304 | Ga0209051_1000369 | 3300025303 | Bacteria | 64656 |
| 305 | Ga0209051_1000490 | 3300025303 | Bacteria | 51070 |
| 306 | Ga0209051_1000787 | 3300025303 | Bacteria | 33471 |
| 307 | Ga0209051_1001013 | 3300025303 | Bacteria | 26927 |
| 308 | Ga0209051_1009860 | 3300025303 | Bacteria | 4884 |
| 309 | Ga0209051_1036657 | 3300025303 | Bacteria | 1808 |
| 310 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 311 | Ga0209257_1000317 | 3300025304 | Bacteria | 101723 |
| 312 | Ga0209257_1000508 | 3300025304 | Bacteria | 68156 |
| 313 | Ga0209257_1004648 | 3300025304 | Bacteria | 10373 |
| 314 | Ga0209257_1006472 | 3300025304 | Bacteria | 7520 |
| 315 | Ga0207696_1003494 | 3300025711 | Bacteria | 7123 |
| 316 | Ga0207696_1008402 | 3300025711 | Bacteria | 3953 |
| 317 | Ga0207655_1000098 | 3300025728 | Bacteria | 190699 |
| 318 | Ga0207655_1000687 | 3300025728 | Bacteria | 39384 |
| 319 | Ga0207655_1000755 | 3300025728 | Bacteria | 36265 |
| 320 | Ga0207655_1010657 | 3300025728 | Bacteria | 5558 |
| 321 | Ga0207655_1015186 | 3300025728 | Bacteria | 4298 |
| 322 | Ga0207655_1031674 | 3300025728 | Bacteria | 2432 |
| 323 | Ga0207713_1001757 | 3300025735 | Bacteria | 16631 |
| 324 | Ga0207713_1030788 | 3300025735 | Bacteria | 2385 |
| 325 | Ga0207682_10002802 | 3300025893 | Bacteria | 7710 |
| 326 | Ga0207682_10036883 | 3300025893 | Bacteria | 1979 |
| 327 | Ga0207682_10047107 | 3300025893 | Bacteria | 1774 |
| 328 | Ga0207642_10056071 | 3300025899 | Bacteria | 1806 |
| 329 | Ga0207710_10000057 | 3300025900 | Bacteria | 177544 |
| 330 | Ga0207688_10086733 | 3300025901 | Bacteria | 1794 |
| 331 | Ga0207680_10175460 | 3300025903 | Bacteria | 1446 |
| 332 | Ga0207645_10017116 | 3300025907 | Bacteria | 4788 |
| 333 | Ga0207645_10023668 | 3300025907 | Bacteria | 3988 |
| 334 | Ga0207645_10130883 | 3300025907 | Bacteria | 1633 |
| 335 | Ga0207684_10005739 | 3300025910 | Bacteria | 11396 |
| 336 | Ga0207695_10000912 | 3300025913 | Bacteria | 53029 |
| 337 | Ga0207695_10029742 | 3300025913 | Bacteria | 6028 |
| 338 | Ga0207695_10142170 | 3300025913 | Bacteria | 2347 |
| 339 | Ga0207671_10045264 | 3300025914 | Bacteria | 3254 |
| 340 | Ga0207662_10048198 | 3300025918 | Bacteria | 2523 |
| 341 | Ga0207657_10000063 | 3300025919 | Bacteria | 100065 |
| 342 | Ga0207681_10000308 | 3300025923 | Bacteria | 35918 |
| 343 | Ga0207681_10000821 | 3300025923 | Bacteria | 20470 |
| 344 | Ga0207694_10017805 | 3300025924 | Bacteria | 5370 |
| 345 | Ga0207650_10001370 | 3300025925 | Bacteria | 17590 |
| 346 | Ga0207659_10015718 | 3300025926 | Bacteria | 4913 |
| 347 | Ga0207687_10073307 | 3300025927 | Bacteria | 2451 |
| 348 | Ga0207644_10338194 | 3300025931 | Bacteria | 1220 |
| 349 | Ga0207690_10000025 | 3300025932 | Bacteria | 179019 |
| 350 | Ga0207690_10092910 | 3300025932 | Bacteria | 2136 |
| 351 | Ga0207706_10011277 | 3300025933 | Bacteria | 8145 |
| 352 | Ga0207706_10062189 | 3300025933 | Bacteria | 3288 |
| 353 | Ga0207706_10063353 | 3300025933 | Bacteria | 3255 |
| 354 | Ga0207706_10076233 | 3300025933 | Bacteria | 2949 |
| 355 | Ga0207686_10093888 | 3300025934 | Bacteria | 1987 |
| 356 | Ga0207709_10000004 | 3300025935 | Bacteria | 825156 |
| 357 | Ga0207709_10000057 | 3300025935 | Bacteria | 216617 |
| 358 | Ga0207709_10000768 | 3300025935 | Bacteria | 25259 |
| 359 | Ga0207709_10001944 | 3300025935 | Bacteria | 13527 |
| 360 | Ga0207709_10089856 | 3300025935 | Bacteria | 2004 |
| 361 | Ga0207670_10237078 | 3300025936 | Bacteria | 1404 |
| 362 | Ga0207669_10073142 | 3300025937 | Bacteria | 2161 |
| 363 | Ga0207704_10005851 | 3300025938 | Bacteria | 5690 |
| 364 | Ga0207691_10027277 | 3300025940 | Bacteria | 5357 |
| 365 | Ga0207691_10028559 | 3300025940 | Bacteria | 5221 |
| 366 | Ga0207691_10059490 | 3300025940 | Bacteria | 3473 |
| 367 | Ga0207691_10088308 | 3300025940 | Bacteria | 2780 |
| 368 | Ga0207691_10135734 | 3300025940 | Bacteria | 2170 |
| 369 | Ga0207711_10001139 | 3300025941 | Bacteria | 25374 |
| 370 | Ga0207711_10030653 | 3300025941 | Bacteria | 4537 |
| 371 | Ga0207689_10002245 | 3300025942 | Bacteria | 18103 |
| 372 | Ga0207689_10023495 | 3300025942 | Bacteria | 5173 |
| 373 | Ga0207679_10145666 | 3300025945 | Bacteria | 1920 |
| 374 | Ga0207667_10002610 | 3300025949 | Bacteria | 22346 |
| 375 | Ga0207667_10037909 | 3300025949 | Bacteria | 5151 |
| 376 | Ga0207651_10001026 | 3300025960 | Bacteria | 12333 |
| 377 | Ga0207651_10018646 | 3300025960 | Bacteria | 4136 |
| 378 | Ga0207651_10196028 | 3300025960 | Bacteria | 1615 |
| 379 | Ga0207668_10079683 | 3300025972 | Bacteria | 2370 |
| 380 | Ga0207658_10000495 | 3300025986 | Bacteria | 36167 |
| 381 | Ga0207658_10066451 | 3300025986 | Bacteria | 2712 |
| 382 | Ga0207677_10022286 | 3300026023 | Bacteria | 3890 |
| 383 | Ga0207677_10168164 | 3300026023 | Bacteria | 1711 |
| 384 | Ga0207703_10000414 | 3300026035 | Bacteria | 45564 |
| 385 | Ga0207703_10001421 | 3300026035 | Bacteria | 21841 |
| 386 | Ga0207703_10052657 | 3300026035 | Bacteria | 3306 |
| 387 | Ga0207639_10003076 | 3300026041 | Bacteria | 11213 |
| 388 | Ga0207639_10031709 | 3300026041 | Bacteria | 3886 |
| 389 | Ga0207678_10003127 | 3300026067 | Bacteria | 14982 |
| 390 | Ga0207678_10101396 | 3300026067 | Bacteria | 2458 |
| 391 | Ga0207678_10217122 | 3300026067 | Bacteria | 1636 |
| 392 | Ga0207678_10295625 | 3300026067 | Bacteria | 1391 |
| 393 | Ga0207641_10000615 | 3300026088 | Bacteria | 38942 |
| 394 | Ga0207641_10002352 | 3300026088 | Bacteria | 17480 |
| 395 | Ga0207641_10429515 | 3300026088 | Bacteria | 1273 |
| 396 | Ga0207648_10005514 | 3300026089 | Bacteria | 12756 |
| 397 | Ga0207648_10024226 | 3300026089 | Bacteria | 5422 |
| 398 | Ga0207648_10043439 | 3300026089 | Bacteria | 3945 |
| 399 | Ga0207648_10061792 | 3300026089 | Bacteria | 3266 |
| 400 | Ga0207648_10067585 | 3300026089 | Bacteria | 3115 |
| 401 | Ga0207648_10100166 | 3300026089 | Bacteria | 2538 |
| 402 | Ga0207648_10273811 | 3300026089 | Bacteria | 1508 |
| 403 | Ga0207676_10001317 | 3300026095 | Bacteria | 18460 |
| 404 | Ga0207676_10110171 | 3300026095 | Bacteria | 2302 |
| 405 | Ga0207674_10053254 | 3300026116 | Bacteria | 4125 |
| 406 | Ga0207675_100003069 | 3300026118 | Bacteria | 16383 |
| 407 | Ga0207675_100005031 | 3300026118 | Bacteria | 12728 |
| 408 | Ga0207675_100018840 | 3300026118 | Bacteria | 6441 |
| 409 | Ga0207675_100129547 | 3300026118 | Bacteria | 2392 |
| 410 | Ga0207683_10002265 | 3300026121 | Bacteria | 16869 |
| 411 | Ga0207683_10014063 | 3300026121 | Bacteria | 6823 |
| 412 | Ga0207683_10033430 | 3300026121 | Bacteria | 4466 |
| 413 | Ga0207683_10049515 | 3300026121 | Bacteria | 3679 |
| 414 | Ga0207698_10008619 | 3300026142 | Bacteria | 6459 |
| 415 | Ga0207698_10188848 | 3300026142 | Bacteria | 1833 |
| 416 | Ga0209371_1000074 | 3300027312 | Bacteria | 198823 |
| 417 | Ga0209813_10012910 | 3300027866 | Bacteria | 2219 |
| 418 | Ga0268266_10070330 | 3300028379 | Bacteria | 3032 |
| 419 | Ga0268265_10012608 | 3300028380 | Bacteria | 5732 |
| 420 | Ga0268265_10031470 | 3300028380 | Bacteria | 3831 |
| 421 | Ga0268265_10100728 | 3300028380 | Bacteria | 2332 |
| 422 | Ga0268265_10269005 | 3300028380 | Bacteria | 1519 |
| 423 | Ga0268264_10000780 | 3300028381 | Bacteria | 35025 |
| 424 | Ga0268264_10001577 | 3300028381 | Bacteria | 21132 |
| 425 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 426 | Ga0307515_10000658 | 3300028794 | Bacteria | 79766 |
| 427 | Ga0307515_10001006 | 3300028794 | Bacteria | 64436 |
| 428 | Ga0307515_10029059 | 3300028794 | Bacteria | 9364 |
| 429 | Ga0307515_10089463 | 3300028794 | Bacteria | 3876 |
| 430 | Ga0265338_10002421 | 3300028800 | Bacteria | 28057 |
| 431 | Ga0268256_1000067 | 3300030500 | Bacteria | 198823 |
| 432 | Ga0307511_10000485 | 3300030521 | Bacteria | 42928 |
| 433 | Ga0316177_1038652 | 3300030731 | Bacteria | 7631 |
| 434 | Ga0316176_1212641 | 3300030732 | Bacteria | 2150 |
| 435 | Ga0314311_1250941 | 3300030733 | Bacteria | 12243 |
| 436 | Ga0316178_1183912 | 3300030735 | Bacteria | 7997 |
| 437 | Ga0316180_1159745 | 3300030736 | Bacteria | 1650 |
| 438 | Ga0316183_1085212 | 3300030742 | Bacteria | 2380 |
| 439 | Ga0316181_1093548 | 3300030744 | Bacteria | 6655 |
| 440 | Ga0265332_10000027 | 3300031238 | Bacteria | 190796 |
| 441 | Ga0307513_10000034 | 3300031456 | Bacteria | 185012 |
| 442 | Ga0307513_10012028 | 3300031456 | Bacteria | 10709 |
| 443 | Ga0307509_10078280 | 3300031507 | Bacteria | 3426 |
| 444 | Ga0307408_100016284 | 3300031548 | Bacteria | 4960 |
| 445 | Ga0307516_10003466 | 3300031730 | Bacteria | 20215 |
| 446 | Ga0307405_10017652 | 3300031731 | Bacteria | 3921 |
| 447 | Ga0307405_10161809 | 3300031731 | Bacteria | 1586 |
| 448 | Ga0307405_10163598 | 3300031731 | Bacteria | 1579 |
| 449 | Ga0307406_10000822 | 3300031901 | Bacteria | 17415 |
| 450 | Ga0307412_10000129 | 3300031911 | Bacteria | 55318 |
| 451 | Ga0307412_10005492 | 3300031911 | Bacteria | 7119 |
| 452 | Ga0307412_10059873 | 3300031911 | Bacteria | 2554 |
| 453 | Ga0307412_10135580 | 3300031911 | Bacteria | 1795 |
| 454 | Ga0307411_10065567 | 3300032005 | Bacteria | 2436 |
| 455 | Ga0307507_10020829 | 3300033179 | Bacteria | 7325 |
| 456 | Ga0373955_0052098 | 3300035172 | Bacteria | 2232 |
| 457 | Ga0373937_0057331 | 3300036401 | Bacteria | 3578 |
| 458 | Ga0395899_0035639 | 3300037312 | Bacteria | 3734 |
| 459 | Ga0395900_0012763 | 3300037418 | Bacteria | 8586 |
| 460 | Ga0395900_0083050 | 3300037418 | Bacteria | 3291 |
| 461 | Ga0395900_0118912 | 3300037418 | Bacteria | 2712 |
| 462 | Ga0395898_0031026 | 3300037466 | Bacteria | 5345 |
| 463 | Ga0395898_0119398 | 3300037466 | Bacteria | 2526 |
| 464 | Ga0395905_0000963 | 3300037471 | Bacteria | 36996 |
| 465 | Ga0395905_0047336 | 3300037471 | Bacteria | 4031 |
| 466 | Ga0395905_0223151 | 3300037471 | Bacteria | 1763 |
| 467 | Ga0395901_0005950 | 3300038443 | Bacteria | 12352 |
| 468 | Ga0395901_0027834 | 3300038443 | Bacteria | 5812 |
| 469 | Ga0439447_011098 | 3300041407 | Bacteria | 2645 |
| 470 | Ga0439466_0013209 | 3300041411 | Bacteria | 3025 |
| 471 | Ga0439432_047533 | 3300042006 | Bacteria | 1346 |
| 472 | Ga0450911_000549 | 3300042115 | Bacteria | 11658 |
| 473 | Ga0450920_000742 | 3300042122 | Bacteria | 5258 |
| 474 | Ga0450903_001624 | 3300042138 | Bacteria | 4181 |
| 475 | Ga0450893_0005595 | 3300042532 | Bacteria | 2019 |
| 476 | Ga0451577_0152810 | 3300042876 | Bacteria | 2077 |
| 477 | Ga0453683_0011381 | 3300044673 | Bacteria | 5862 |
| 478 | Ga0466965_0175946 | 3300044683 | Bacteria | 1127 |
| 479 | Ga0453684_0017188 | 3300044712 | Bacteria | 11235 |
| 480 | Ga0466968_0018100 | 3300044735 | Bacteria | 2824 |
| 481 | Ga0466970_0006300 | 3300044765 | Bacteria | 5926 |
| 482 | Ga0466960_0147607 | 3300044901 | Bacteria | 1254 |
| 483 | Ga0466959_0001542 | 3300045049 | Bacteria | 14167 |
| 484 | Ga0466959_0115238 | 3300045049 | Bacteria | 1915 |
| 485 | Ga0451576_0006640 | 3300045051 | Bacteria | 14132 |
| 486 | Ga0451576_0250992 | 3300045051 | Bacteria | 1849 |
| 487 | Ga0466958_0157360 | 3300045836 | Bacteria | 1434 |
| 488 | Ga0466967_0119783 | 3300045976 | Bacteria | 2430 |
| 489 | Ga0495617_013070 | 3300046452 | Bacteria | 2828 |
| 490 | Ga0495627_043010 | 3300046453 | Bacteria | 1382 |
| 491 | Ga0495629_0079421 | 3300046459 | Bacteria | 2291 |
| 492 | Ga0495629_0127673 | 3300046459 | Bacteria | 1772 |
| 493 | Ga0495629_0136179 | 3300046459 | Bacteria | 1710 |
| 494 | Ga0495638_0000537 | 3300046460 | Bacteria | 43749 |
| 495 | Ga0495638_0130496 | 3300046460 | Bacteria | 1476 |
| 496 | Ga0495653_0112344 | 3300046463 | Bacteria | 1955 |
| 497 | Ga0495580_0035293 | 3300046472 | Bacteria | 3596 |
| 498 | Ga0495580_0131156 | 3300046472 | Bacteria | 1738 |
| 499 | Ga0495605_0000848 | 3300046474 | Bacteria | 21346 |
| 500 | Ga0495585_0051193 | 3300046492 | Bacteria | 2289 |
| 501 | Ga0495585_0112495 | 3300046492 | Bacteria | 1446 |
| 502 | Ga0495596_0038054 | 3300046500 | Bacteria | 1902 |
| 503 | Ga0495607_0000501 | 3300046501 | Bacteria | 39192 |
| 504 | Ga0495606_0049368 | 3300046507 | Bacteria | 2760 |
| 505 | Ga0495610_0036035 | 3300046512 | Bacteria | 2533 |
| 506 | Ga0495610_0083231 | 3300046512 | Bacteria | 1465 |
| 507 | Ga0495616_0056455 | 3300046513 | Bacteria | 1939 |
| 508 | Ga0495616_0067432 | 3300046513 | Bacteria | 1739 |
| 509 | Ga0495620_0016498 | 3300046515 | Bacteria | 3702 |
| 510 | Ga0495628_0003869 | 3300046516 | Bacteria | 13338 |
| 511 | Ga0495630_0062548 | 3300046517 | Bacteria | 2796 |
| 512 | Ga0495630_0079323 | 3300046517 | Bacteria | 2476 |
| 513 | Ga0495631_0001035 | 3300046518 | Bacteria | 17254 |
| 514 | Ga0495632_0036707 | 3300046519 | Bacteria | 2491 |
| 515 | Ga0495632_0080090 | 3300046519 | Bacteria | 1558 |
| 516 | Ga0495632_0126798 | 3300046519 | Bacteria | 1189 |
| 517 | Ga0495637_0048836 | 3300046520 | Bacteria | 1780 |
| 518 | Ga0495643_0026180 | 3300046522 | Bacteria | 3294 |
| 519 | Ga0495643_0051401 | 3300046522 | Bacteria | 2216 |
| 520 | Ga0495644_0002111 | 3300046523 | Bacteria | 7989 |
| 521 | Ga0495648_0010582 | 3300046524 | Bacteria | 7014 |
| 522 | Ga0495663_0028520 | 3300046525 | Bacteria | 1644 |
| 523 | Ga0495666_0009465 | 3300046526 | Bacteria | 4869 |
| 524 | Ga0495666_0012854 | 3300046526 | Bacteria | 4173 |
| 525 | Ga0495654_0004411 | 3300046530 | Bacteria | 8358 |
| 526 | Ga0495654_0014979 | 3300046530 | Bacteria | 4121 |
| 527 | Ga0495654_0137897 | 3300046530 | Bacteria | 1089 |
| 528 | Ga0495587_0000479 | 3300046536 | Bacteria | 27722 |
| 529 | Ga0495609_0013875 | 3300046538 | Bacteria | 3798 |
| 530 | Ga0495621_0005626 | 3300046539 | Bacteria | 3615 |
| 531 | Ga0495621_0033574 | 3300046539 | Bacteria | 1769 |
| 532 | Ga0495621_0034102 | 3300046539 | Bacteria | 1757 |
| 533 | Ga0495597_0007304 | 3300046542 | Bacteria | 5628 |
| 534 | Ga0495597_0050143 | 3300046542 | Bacteria | 1843 |
| 535 | Ga0495645_0021607 | 3300046543 | Bacteria | 4651 |
| 536 | Ga0495622_0024167 | 3300046557 | Bacteria | 2837 |
| 537 | Ga0495622_0029261 | 3300046557 | Bacteria | 2574 |
| 538 | Ga0495622_0042417 | 3300046557 | Bacteria | 2115 |
| 539 | Ga0495633_0000091 | 3300046558 | Bacteria | 122383 |
| 540 | Ga0495633_0000612 | 3300046558 | Bacteria | 33866 |
| 541 | Ga0495668_0034669 | 3300046616 | Bacteria | 2830 |
| 542 | Ga0495668_0103705 | 3300046616 | Bacteria | 1556 |
| 543 | Ga0495634_0000025 | 3300046642 | Bacteria | 115964 |
| 544 | Ga0495611_0030363 | 3300046648 | Bacteria | 2375 |
| 545 | Ga0495625_0166652 | 3300046660 | Bacteria | 1472 |
| 546 | Ga0495635_0000298 | 3300046663 | Bacteria | 31939 |
| 547 | Ga0495635_0059902 | 3300046663 | Bacteria | 2618 |
| 548 | Ga0495661_0044447 | 3300046665 | Bacteria | 2722 |
| 549 | Ga0495661_0075987 | 3300046665 | Bacteria | 1950 |
| 550 | Ga0495661_0082297 | 3300046665 | Bacteria | 1853 |
| 551 | Ga0495588_0027877 | 3300046674 | Bacteria | 2824 |
| 552 | Ga0495623_0004546 | 3300046679 | Bacteria | 9110 |
| 553 | Ga0495646_0020344 | 3300046680 | Bacteria | 4198 |
| 554 | Ga0495658_0021874 | 3300046683 | Bacteria | 3376 |
| 555 | Ga0495658_0041874 | 3300046683 | Bacteria | 2555 |
| 556 | Ga0495613_0009208 | 3300046689 | Bacteria | 7322 |
| 557 | Ga0495613_0147989 | 3300046689 | Bacteria | 1676 |
| 558 | Ga0495671_0000069 | 3300046692 | Bacteria | 98738 |
| 559 | Ga0495649_0072655 | 3300046694 | Bacteria | 1844 |
| 560 | Ga0495589_0017485 | 3300046794 | Bacteria | 3678 |
| 561 | Ga0495589_0021028 | 3300046794 | Bacteria | 3335 |
| 562 | Ga0495604_0012794 | 3300047317 | Bacteria | 6681 |
| 563 | Ga0495604_0024673 | 3300047317 | Bacteria | 4797 |
| 564 | Ga0495674_0003207 | 3300047319 | Bacteria | 15884 |
| 565 | Ga0495674_0007659 | 3300047319 | Bacteria | 10314 |
| 566 | Ga0495674_0047291 | 3300047319 | Bacteria | 3815 |
| 567 | Ga0495674_0162958 | 3300047319 | Bacteria | 1865 |
| 568 | Ga0495672_0009892 | 3300047320 | Bacteria | 6853 |
| 569 | Ga0495672_0010898 | 3300047320 | Bacteria | 6449 |
| 570 | Ga0495676_0201586 | 3300047321 | Bacteria | 1382 |
| 571 | Ga0495680_0097134 | 3300047322 | Bacteria | 2199 |
| 572 | Ga0495683_0000290 | 3300047323 | Bacteria | 43279 |
| 573 | Ga0495683_0005559 | 3300047323 | Bacteria | 6988 |
| 574 | Ga0495687_033169 | 3300047443 | Bacteria | 2346 |
| 575 | Ga0495675_0013353 | 3300047444 | Bacteria | 5184 |
| 576 | Ga0495679_002783 | 3300047446 | Bacteria | 8698 |
| 577 | Ga0495673_0005428 | 3300047469 | Bacteria | 7705 |
| 578 | Ga0495673_0012224 | 3300047469 | Bacteria | 4567 |
| 579 | Ga0495673_0060841 | 3300047469 | Bacteria | 1618 |
| 580 | Ga0495681_0004895 | 3300047470 | Bacteria | 9048 |
| 581 | Ga0495681_0047572 | 3300047470 | Bacteria | 2039 |
| 582 | Ga0495681_0073773 | 3300047470 | Bacteria | 1540 |
| 583 | Ga0495681_0075825 | 3300047470 | Bacteria | 1512 |
| 584 | Ga0495686_0000012 | 3300047472 | Bacteria | 508428 |
| 585 | Ga0495686_0071363 | 3300047472 | Bacteria | 2138 |
| 586 | Ga0495686_0100189 | 3300047472 | Bacteria | 1748 |
| 587 | Ga0495593_0040256 | 3300047673 | Bacteria | 2516 |
| 588 | Ga0495602_0056983 | 3300048088 | Bacteria | 3432 |
| 589 | Ga0495614_0009428 | 3300048089 | Bacteria | 4316 |
| 590 | Ga0495626_0001873 | 3300048091 | Bacteria | 15758 |
| 591 | Ga0495626_0029522 | 3300048091 | Bacteria | 2654 |
| 592 | Ga0496100_0042413 | 3300048903 | Bacteria | 2906 |
| 593 | Ga0496101_0016397 | 3300048904 | Bacteria | 5004 |
| 594 | Ga0496101_0049520 | 3300048904 | Bacteria | 3023 |
| 595 | Ga0496102_0000038 | 3300048905 | Bacteria | 198844 |
| 596 | Ga0496102_0078332 | 3300048905 | Bacteria | 3042 |
| 597 | Ga0496102_0140832 | 3300048905 | Bacteria | 2261 |
| 598 | Ga0496103_0000137 | 3300048906 | Bacteria | 76353 |
| 599 | Ga0496104_0062960 | 3300048907 | Bacteria | 3517 |
| 600 | Ga0496104_0070138 | 3300048907 | Bacteria | 3332 |
| 601 | Ga0496104_0103395 | 3300048907 | Bacteria | 2729 |
| 602 | Ga0496105_0015662 | 3300048908 | Bacteria | 6049 |
| 603 | Ga0496105_0073508 | 3300048908 | Bacteria | 2824 |
| 604 | Ga0496106_0066059 | 3300048909 | Bacteria | 2754 |
| 605 | Ga0496107_0128726 | 3300048910 | Bacteria | 1868 |
| 606 | Ga0496108_0085776 | 3300048911 | Bacteria | 2673 |
| 607 | Ga0496109_0128065 | 3300048912 | Bacteria | 2368 |
| 608 | Ga0496109_0134074 | 3300048912 | Bacteria | 2313 |
| 609 | Ga0496112_0090145 | 3300048915 | Bacteria | 3035 |
| 610 | Ga0496113_0193026 | 3300048916 | Bacteria | 1616 |
| 611 | Ga0496114_0040436 | 3300048917 | Bacteria | 3861 |
| 612 | Ga0496114_0073181 | 3300048917 | Bacteria | 2884 |
| 613 | Ga0496116_0007511 | 3300048919 | Bacteria | 9649 |
| 614 | Ga0496116_0015789 | 3300048919 | Bacteria | 5948 |
| 615 | Ga0496116_0015902 | 3300048919 | Bacteria | 5919 |
| 616 | Ga0496116_0022818 | 3300048919 | Bacteria | 4677 |
| 617 | Ga0496116_0055289 | 3300048919 | Bacteria | 2608 |
| 618 | Ga0496117_0003381 | 3300048920 | Bacteria | 18583 |
| 619 | Ga0496117_0006162 | 3300048920 | Bacteria | 12255 |
| 620 | Ga0496117_0006767 | 3300048920 | Bacteria | 11447 |
| 621 | Ga0496117_0009563 | 3300048920 | Bacteria | 8989 |
| 622 | Ga0496117_0014705 | 3300048920 | Bacteria | 6723 |
| 623 | Ga0496117_0034713 | 3300048920 | Bacteria | 3796 |
| 624 | Ga0496117_0044104 | 3300048920 | Bacteria | 3233 |
| 625 | Ga0496117_0086822 | 3300048920 | Bacteria | 2031 |
| 626 | Ga0496118_0007452 | 3300048921 | Bacteria | 11588 |
| 627 | Ga0496118_0009975 | 3300048921 | Bacteria | 9483 |
| 628 | Ga0496118_0011018 | 3300048921 | Bacteria | 8880 |
| 629 | Ga0496118_0013975 | 3300048921 | Bacteria | 7544 |
| 630 | Ga0496118_0014147 | 3300048921 | Bacteria | 7484 |
| 631 | Ga0496118_0017416 | 3300048921 | Bacteria | 6541 |
| 632 | Ga0496118_0067984 | 3300048921 | Bacteria | 2590 |
| 633 | Ga0496118_0109577 | 3300048921 | Bacteria | 1837 |
| 634 | Ga0496119_0076902 | 3300048922 | Bacteria | 1935 |
| 635 | Ga0496119_0081901 | 3300048922 | Bacteria | 1857 |
| 636 | Ga0496120_0070086 | 3300048923 | Bacteria | 1929 |
| 637 | Ga0496121_0000137 | 3300048924 | Bacteria | 164043 |
| 638 | Ga0496121_0000186 | 3300048924 | Bacteria | 138418 |
| 639 | Ga0496121_0001220 | 3300048924 | Bacteria | 44787 |
| 640 | Ga0496121_0013018 | 3300048924 | Bacteria | 8988 |
| 641 | Ga0496121_0027666 | 3300048924 | Bacteria | 5300 |
| 642 | Ga0496121_0044191 | 3300048924 | Bacteria | 3847 |
| 643 | Ga0496121_0051703 | 3300048924 | Bacteria | 3458 |
| 644 | Ga0496121_0055186 | 3300048924 | Bacteria | 3312 |
| 645 | Ga0496121_0079138 | 3300048924 | Bacteria | 2610 |
| 646 | Ga0496121_0085261 | 3300048924 | Bacteria | 2487 |
| 647 | Ga0496121_0103589 | 3300048924 | Bacteria | 2188 |
| 648 | Ga0496121_0163518 | 3300048924 | Bacteria | 1625 |
| 649 | Ga0496122_0000102 | 3300048925 | Bacteria | 197296 |
| 650 | Ga0496122_0000383 | 3300048925 | Bacteria | 94797 |
| 651 | Ga0496122_0013251 | 3300048925 | Bacteria | 8085 |
| 652 | Ga0496123_0000110 | 3300048926 | Bacteria | 165766 |
| 653 | Ga0496123_0000249 | 3300048926 | Bacteria | 108969 |
| 654 | Ga0496123_0011403 | 3300048926 | Bacteria | 7706 |
| 655 | Ga0496123_0015207 | 3300048926 | Bacteria | 6328 |
| 656 | Ga0496123_0020883 | 3300048926 | Bacteria | 5106 |
| 657 | Ga0496123_0087819 | 3300048926 | Bacteria | 1859 |
| 658 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 659 | Ga0496124_0003855 | 3300048927 | Bacteria | 17946 |
| 660 | Ga0496124_0111470 | 3300048927 | Bacteria | 2201 |
| 661 | Ga0496125_0003063 | 3300048928 | Bacteria | 20872 |
| 662 | Ga0496125_0007429 | 3300048928 | Bacteria | 11657 |
| 663 | Ga0496125_0010419 | 3300048928 | Bacteria | 9406 |
| 664 | Ga0496125_0028699 | 3300048928 | Bacteria | 5017 |
| 665 | Ga0496125_0033809 | 3300048928 | Bacteria | 4517 |
| 666 | Ga0496125_0081548 | 3300048928 | Bacteria | 2471 |
| 667 | Ga0496125_0091310 | 3300048928 | Bacteria | 2282 |
| 668 | Ga0496125_0110318 | 3300048928 | Bacteria | 1995 |
| 669 | Ga0496126_0000328 | 3300048929 | Bacteria | 101511 |
| 670 | Ga0496126_0000681 | 3300048929 | Bacteria | 62495 |
| 671 | Ga0496126_0057773 | 3300048929 | Bacteria | 3500 |
| 672 | Ga0496126_0093192 | 3300048929 | Bacteria | 2645 |
| 673 | Ga0496126_0108265 | 3300048929 | Bacteria | 2423 |
| 674 | Ga0496126_0109182 | 3300048929 | Bacteria | 2411 |
| 675 | Ga0495678_028750 | 3300049459 | Bacteria | 2341 |
| 676 | Ga0501033_0242784 | 3300049570 | Bacteria | 1278 |
| 677 | Ga0501043_0000097 | 3300049579 | Bacteria | 79736 |
| 678 | Ga0501046_0000047 | 3300049580 | Bacteria | 140344 |
| 679 | Ga0501047_0000058 | 3300049581 | Bacteria | 139202 |
| 680 | Ga0501047_0202045 | 3300049581 | Bacteria | 1848 |
| 681 | Ga0501262_000753 | 3300049759 | Bacteria | 3735 |
| 682 | Ga0501035_0017152 | 3300049822 | Bacteria | 6673 |
| 683 | Ga0501035_0044595 | 3300049822 | Bacteria | 3993 |
| 684 | Ga0501035_0057558 | 3300049822 | Bacteria | 3466 |
| 685 | Ga0501035_0074936 | 3300049822 | Bacteria | 2993 |
| 686 | Ga0501044_0000022 | 3300049823 | Bacteria | 201689 |
| 687 | Ga0501044_0295264 | 3300049823 | Bacteria | 1551 |
| 688 | Ga0501045_0007269 | 3300049824 | Bacteria | 7691 |
| 689 | nmdc:mga03683_1531_c1 | 3300050489 | Bacteria | 6890 |
| 690 | nmdc:mga03683_44651_c1 | 3300050489 | Bacteria | 1832 |
| 691 | nmdc:mga03683_5516_c1 | 3300050489 | Bacteria | 2314 |
| 692 | nmdc:mga03n38_33802_c1 | 3300050490 | Bacteria | 2179 |
| 693 | nmdc:mga03n38_81335_c1 | 3300050490 | Bacteria | 1523 |
| 694 | nmdc:mga00v17_26459_c1 | 3300050491 | Bacteria | 3381 |
| 695 | nmdc:mga00v17_28640_c1 | 3300050491 | Bacteria | 3264 |
| 696 | nmdc:mga00v17_40362_c1 | 3300050491 | Bacteria | 2799 |
| 697 | nmdc:mga00v17_6114_c1 | 3300050491 | Bacteria | 6375 |
| 698 | nmdc:mga0yw44_77831_c1 | 3300050492 | Bacteria | 2073 |
| 699 | nmdc:mga0yw44_77833_c1 | 3300050492 | Bacteria | 2073 |
| 700 | nmdc:mga0k408_169_c1 | 3300050493 | Bacteria | 34402 |
| 701 | nmdc:mga0k408_32408_c1 | 3300050493 | Bacteria | 2986 |
| 702 | nmdc:mga0k408_7920_c1 | 3300050493 | Bacteria | 5690 |
| 703 | nmdc:mga04h51_3736_c1 | 3300050495 | Bacteria | 3729 |
| 704 | nmdc:mga07m45_36764_c1 | 3300050496 | Bacteria | 2729 |
| 705 | nmdc:mga0sz30_4052_c1 | 3300050516 | Bacteria | 5276 |
| 706 | nmdc:mga0sz30_46182_c1 | 3300050516 | Bacteria | 1838 |
| 707 | nmdc:mga0sz30_7297_c1 | 3300050516 | Bacteria | 4141 |
| 708 | Ga0500610_0000129 | 3300053079 | Bacteria | 22906 |
| 709 | Ga0500610_0000353 | 3300053079 | Bacteria | 13908 |
| 710 | Ga0495619_0053804 | 3300053085 | Bacteria | 2664 |
| 711 | Ga0500578_0103777 | 3300053086 | Bacteria | 1797 |
| 712 | Ga0500643_009332 | 3300053087 | Bacteria | 3755 |
| 713 | Ga0500643_014841 | 3300053087 | Bacteria | 2690 |
| 714 | Ga0500643_026819 | 3300053087 | Bacteria | 1798 |
| 715 | Ga0500644_0021117 | 3300053088 | Bacteria | 1946 |
| 716 | Ga0500651_0004536 | 3300053093 | Bacteria | 7790 |
| 717 | Ga0500566_0000208 | 3300053094 | Bacteria | 31057 |
| 718 | Ga0500554_021801 | 3300053102 | Bacteria | 1782 |
| 719 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 720 | Ga0500562_002197 | 3300053108 | Bacteria | 4879 |
| 721 | Ga0500562_017120 | 3300053108 | Bacteria | 1866 |
| 722 | Ga0500571_000069 | 3300053110 | Bacteria | 32297 |
| 723 | Ga0500594_0006047 | 3300053118 | Bacteria | 2705 |
| 724 | Ga0500607_002984 | 3300053121 | Bacteria | 12836 |
| 725 | Ga0500652_003004 | 3300053131 | Bacteria | 5092 |
| 726 | Ga0500655_007412 | 3300053133 | Bacteria | 1974 |
| 727 | Ga0500658_0000431 | 3300053134 | Bacteria | 18048 |
| 728 | Ga0500559_0000413 | 3300053136 | Bacteria | 30711 |
| 729 | Ga0500559_0028652 | 3300053136 | Bacteria | 2380 |
| 730 | Ga0500568_0000940 | 3300053139 | Bacteria | 20068 |
| 731 | Ga0500568_0016093 | 3300053139 | Bacteria | 3332 |
| 732 | Ga0500573_0055894 | 3300053140 | Bacteria | 2265 |
| 733 | Ga0500586_000957 | 3300053145 | Bacteria | 5947 |
| 734 | Ga0500590_002212 | 3300053148 | Bacteria | 8499 |
| 735 | Ga0500590_027759 | 3300053148 | Bacteria | 2937 |
| 736 | Ga0500604_0003122 | 3300053151 | Bacteria | 4452 |
| 737 | Ga0500616_0000114 | 3300053153 | Bacteria | 148574 |
| 738 | Ga0500622_0000073 | 3300053156 | Bacteria | 111045 |
| 739 | Ga0500627_0022641 | 3300053158 | Bacteria | 2550 |
| 740 | Ga0500634_0038196 | 3300053161 | Bacteria | 2611 |
| 741 | Ga0500634_0085113 | 3300053161 | Bacteria | 1618 |
| 742 | Ga0500636_0004440 | 3300053177 | Bacteria | 7934 |
| 743 | Ga0500636_0016826 | 3300053177 | Bacteria | 4311 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044673 | Ga0453683_0011381 | Ga0453683_0011381_4808_5830 | 303 |
| 2 | 3300046453 | Ga0495627_043010 | Ga0495627_043010_45_1067 | 306 |
| 3 | 3300046530 | Ga0495654_0137897 | Ga0495654_0137897_15_1037 | 306 |
| 4 | 3300046665 | Ga0495661_0075987 | Ga0495661_0075987_914_1936 | 306 |
| 5 | 3300047469 | Ga0495673_0060841 | Ga0495673_0060841_48_1070 | 306 |
| 6 | 3300049570 | Ga0501033_0242784 | Ga0501033_0242784_30_1070 | 307 |
| 7 | 3300046519 | Ga0495632_0080090 | Ga0495632_0080090_471_1475 | 311 |
| 8 | 3300028794 | Ga0307515_10000049 | Ga0307515_10000049168 | 314 |
| 9 | 3300046694 | Ga0495649_0072655 | Ga0495649_0072655_86_1153 | 315 |
| 10 | 3300037471 | Ga0395905_0047336 | Ga0395905_0047336_2449_3660 | 316 |
| 11 | 3300048929 | Ga0496126_0109182 | Ga0496126_0109182_1356_2378 | 316 |
| 12 | 3300028794 | Ga0307515_10000658 | Ga0307515_1000065816 | 317 |
| 13 | 3300046519 | Ga0495632_0126798 | Ga0495632_0126798_147_1169 | 317 |
| 14 | 3300047470 | Ga0495681_0047572 | Ga0495681_0047572_997_2019 | 317 |
| 15 | 3300044683 | Ga0466965_0175946 | Ga0466965_0175946_24_1034 | 318 |
| 16 | 3300048916 | Ga0496113_0193026 | Ga0496113_0193026_16_1032 | 320 |
| 17 | 3300048924 | Ga0496121_0051703 | Ga0496121_0051703_843_2057 | 320 |
| 18 | 3300049822 | Ga0501035_0044595 | Ga0501035_0044595_259_1404 | 320 |
| 19 | 3300048091 | Ga0495626_0001873 | Ga0495626_0001873_14658_15725 | 322 |
| 20 | 3300005539 | Ga0068853_100329346 | Ga0068853_1003293461 | 325 |
| 21 | 3300046492 | Ga0495585_0112495 | Ga0495585_0112495_29_1108 | 325 |
| 22 | 3300053087 | Ga0500643_014841 | Ga0500643_014841_1593_2639 | 326 |
| 23 | 3300048924 | Ga0496121_0163518 | Ga0496121_0163518_16_1062 | 327 |
| 24 | 3300005328 | Ga0070676_10087194 | Ga0070676_100871942 | 329 |
| 25 | 3300005330 | Ga0070690_100032788 | Ga0070690_1000327882 | 329 |
| 26 | 3300005333 | Ga0070677_10009009 | Ga0070677_100090092 | 329 |
| 27 | 3300005334 | Ga0068869_100019255 | Ga0068869_1000192552 | 329 |
| 28 | 3300005335 | Ga0070666_10001072 | Ga0070666_100010727 | 329 |
| 29 | 3300005338 | Ga0068868_100000885 | Ga0068868_1000008853 | 329 |
| 30 | 3300005354 | Ga0070675_100000052 | Ga0070675_10000005254 | 329 |
| 31 | 3300005367 | Ga0070667_100010800 | Ga0070667_1000108003 | 329 |
| 32 | 3300005456 | Ga0070678_100083782 | Ga0070678_1000837822 | 329 |
| 33 | 3300005459 | Ga0068867_100047218 | Ga0068867_1000472183 | 329 |
| 34 | 3300005466 | Ga0070685_10020978 | Ga0070685_100209783 | 329 |
| 35 | 3300005544 | Ga0070686_100029030 | Ga0070686_1000290302 | 329 |
| 36 | 3300005616 | Ga0068852_100027025 | Ga0068852_1000270254 | 329 |
| 37 | 3300005617 | Ga0068859_100003350 | Ga0068859_1000033508 | 329 |
| 38 | 3300005618 | Ga0068864_100001554 | Ga0068864_1000015548 | 329 |
| 39 | 3300005841 | Ga0068863_100002851 | Ga0068863_10000285111 | 329 |
| 40 | 3300005842 | Ga0068858_100000312 | Ga0068858_10000031235 | 329 |
| 41 | 3300005843 | Ga0068860_100236303 | Ga0068860_1002363032 | 329 |
| 42 | 3300006237 | Ga0097621_100009557 | Ga0097621_1000095576 | 329 |
| 43 | 3300006358 | Ga0068871_100004541 | Ga0068871_10000454110 | 329 |
| 44 | 3300006931 | Ga0097620_100003350 | Ga0097620_1000033509 | 329 |
| 45 | 3300009177 | Ga0105248_10003174 | Ga0105248_1000317413 | 329 |
| 46 | 3300013297 | Ga0157378_10154427 | Ga0157378_101544272 | 329 |
| 47 | 3300013306 | Ga0163162_10010534 | Ga0163162_100105346 | 329 |
| 48 | 3300013308 | Ga0157375_10009254 | Ga0157375_100092542 | 329 |
| 49 | 3300014325 | Ga0163163_10001116 | Ga0163163_1000111611 | 329 |
| 50 | 3300014968 | Ga0157379_10001049 | Ga0157379_1000104910 | 329 |
| 51 | 3300017792 | Ga0163161_10055885 | Ga0163161_100558852 | 329 |
| 52 | 3300025893 | Ga0207682_10036883 | Ga0207682_100368832 | 329 |
| 53 | 3300025899 | Ga0207642_10056071 | Ga0207642_100560712 | 329 |
| 54 | 3300025933 | Ga0207706_10063353 | Ga0207706_100633532 | 329 |
| 55 | 3300025940 | Ga0207691_10059490 | Ga0207691_100594902 | 329 |
| 56 | 3300025941 | Ga0207711_10001139 | Ga0207711_1000113910 | 329 |
| 57 | 3300025960 | Ga0207651_10001026 | Ga0207651_100010263 | 329 |
| 58 | 3300025986 | Ga0207658_10066451 | Ga0207658_100664512 | 329 |
| 59 | 3300026023 | Ga0207677_10022286 | Ga0207677_100222863 | 329 |
| 60 | 3300026035 | Ga0207703_10001421 | Ga0207703_100014215 | 329 |
| 61 | 3300026067 | Ga0207678_10295625 | Ga0207678_102956252 | 329 |
| 62 | 3300026088 | Ga0207641_10002352 | Ga0207641_1000235211 | 329 |
| 63 | 3300026095 | Ga0207676_10001317 | Ga0207676_100013173 | 329 |
| 64 | 3300026121 | Ga0207683_10002265 | Ga0207683_100022652 | 329 |
| 65 | 3300026142 | Ga0207698_10188848 | Ga0207698_101888481 | 329 |
| 66 | 3300048911 | Ga0496108_0085776 | Ga0496108_0085776_614_1783 | 329 |
| 67 | 3300028800 | Ga0265338_10002421 | Ga0265338_1000242117 | 330 |
| 68 | 3300048912 | Ga0496109_0128065 | Ga0496109_0128065_810_1979 | 330 |
| 69 | 3300048919 | Ga0496116_0007511 | Ga0496116_0007511_512_1720 | 330 |
| 70 | 3300048924 | Ga0496121_0000186 | Ga0496121_0000186_56877_58082 | 330 |
| 71 | 3300048929 | Ga0496126_0000681 | Ga0496126_0000681_35180_36385 | 330 |
| 72 | 3300048909 | Ga0496106_0066059 | Ga0496106_0066059_369_1607 | 331 |
| 73 | 3300048927 | Ga0496124_0003855 | Ga0496124_0003855_12227_13384 | 331 |
| 74 | 3300005347 | Ga0070668_100017566 | Ga0070668_1000175664 | 332 |
| 75 | 3300009036 | Ga0105244_10000640 | Ga0105244_100006404 | 332 |
| 76 | 3300009148 | Ga0105243_10000020 | Ga0105243_1000002092 | 332 |
| 77 | 3300011119 | Ga0105246_10000031 | Ga0105246_1000003139 | 332 |
| 78 | 3300025728 | Ga0207655_1000098 | Ga0207655_100009856 | 332 |
| 79 | 3300025935 | Ga0207709_10000004 | Ga0207709_10000004459 | 332 |
| 80 | 3300046557 | Ga0495622_0029261 | Ga0495622_0029261_681_1853 | 332 |
| 81 | 3300046558 | Ga0495633_0000091 | Ga0495633_0000091_47540_48712 | 332 |
| 82 | 3300005719 | Ga0068861_100095333 | Ga0068861_1000953333 | 333 |
| 83 | 3300005844 | Ga0068862_100185416 | Ga0068862_1001854162 | 333 |
| 84 | 3300009553 | Ga0105249_10074259 | Ga0105249_100742593 | 333 |
| 85 | 3300025940 | Ga0207691_10088308 | Ga0207691_100883082 | 333 |
| 86 | 3300026089 | Ga0207648_10043439 | Ga0207648_100434394 | 333 |
| 87 | 3300026118 | Ga0207675_100129547 | Ga0207675_1001295472 | 333 |
| 88 | 3300042115 | Ga0450911_000549 | Ga0450911_000549_2977_4134 | 333 |
| 89 | 3300048908 | Ga0496105_0073508 | Ga0496105_0073508_802_1974 | 334 |
| 90 | 3300009148 | Ga0105243_10077502 | Ga0105243_100775022 | 335 |
| 91 | 3300013306 | Ga0163162_10030016 | Ga0163162_100300165 | 335 |
| 92 | 3300017792 | Ga0163161_10085888 | Ga0163161_100858882 | 335 |
| 93 | 3300044901 | Ga0466960_0147607 | Ga0466960_0147607_120_1187 | 335 |
| 94 | 3300046683 | Ga0495658_0041874 | Ga0495658_0041874_462_1634 | 335 |
| 95 | 3300048917 | Ga0496114_0073181 | Ga0496114_0073181_1583_2752 | 335 |
| 96 | 3300006881 | Ga0068865_100133914 | Ga0068865_1001339142 | 336 |
| 97 | 3300009545 | Ga0105237_10384795 | Ga0105237_103847951 | 337 |
| 98 | 3300025931 | Ga0207644_10338194 | Ga0207644_103381941 | 337 |
| 99 | 3300031507 | Ga0307509_10078280 | Ga0307509_100782802 | 337 |
| 100 | 3300046517 | Ga0495630_0079323 | Ga0495630_0079323_1338_2462 | 338 |
| 101 | 3300033179 | Ga0307507_10020829 | Ga0307507_100208292 | 339 |
| 102 | 3300046683 | Ga0495658_0021874 | Ga0495658_0021874_799_1950 | 339 |
| 103 | 3300053086 | Ga0500578_0103777 | Ga0500578_0103777_345_1583 | 339 |
| 104 | 3300005466 | Ga0070685_10209480 | Ga0070685_102094802 | 340 |
| 105 | 3300009098 | Ga0105245_10033391 | Ga0105245_100333915 | 340 |
| 106 | 3300025927 | Ga0207687_10073307 | Ga0207687_100733072 | 340 |
| 107 | 3300026089 | Ga0207648_10067585 | Ga0207648_100675852 | 340 |
| 108 | 3300042122 | Ga0450920_000742 | Ga0450920_000742_175_1332 | 340 |
| 109 | 3300003758 | Ga0055532_1000162 | Ga0055532_100016231 | 342 |
| 110 | 3300003760 | Ga0055527_1000110 | Ga0055527_100011031 | 342 |
| 111 | 3300003761 | Ga0055535_1000235 | Ga0055535_100023531 | 342 |
| 112 | 3300003762 | Ga0055542_1000894 | Ga0055542_10008943 | 342 |
| 113 | 3300003763 | Ga0055529_1002573 | Ga0055529_10025733 | 342 |
| 114 | 3300025228 | Ga0209672_100059 | Ga0209672_100059157 | 342 |
| 115 | 3300025229 | Ga0209147_100072 | Ga0209147_100072157 | 342 |
| 116 | 3300025242 | Ga0209258_100102 | Ga0209258_100102157 | 342 |
| 117 | 3300025254 | Ga0209148_1000404 | Ga0209148_100040419 | 342 |
| 118 | 3300025272 | Ga0209455_1000385 | Ga0209455_100038511 | 342 |
| 119 | 3300031456 | Ga0307513_10012028 | Ga0307513_100120285 | 342 |
| 120 | 3300037471 | Ga0395905_0000963 | Ga0395905_0000963_31969_33183 | 342 |
| 121 | 3300048925 | Ga0496122_0013251 | Ga0496122_0013251_6815_7972 | 343 |
| 122 | 3300048926 | Ga0496123_0011403 | Ga0496123_0011403_114_1271 | 343 |
| 123 | 3300048928 | Ga0496125_0007429 | Ga0496125_0007429_3802_4959 | 343 |
| 124 | 3300044735 | Ga0466968_0018100 | Ga0466968_0018100_947_2161 | 344 |
| 125 | 3300006186 | Ga0075369_10003695 | Ga0075369_100036952 | 345 |
| 126 | 3300013296 | Ga0157374_10063727 | Ga0157374_100637274 | 345 |
| 127 | 3300050516 | nmdc:mga0sz30_7297_c1 | nmdc:mga0sz30_7297_c1_90_1247 | 345 |
| 128 | 3300046522 | Ga0495643_0026180 | Ga0495643_0026180_1662_2873 | 346 |
| 129 | 3300046616 | Ga0495668_0103705 | Ga0495668_0103705_282_1493 | 346 |
| 130 | 3300046642 | Ga0495634_0000025 | Ga0495634_0000025_81165_82322 | 346 |
| 131 | 3300046665 | Ga0495661_0082297 | Ga0495661_0082297_427_1638 | 346 |
| 132 | 3300046680 | Ga0495646_0020344 | Ga0495646_0020344_65_1222 | 346 |
| 133 | 3300049581 | Ga0501047_0202045 | Ga0501047_0202045_315_1493 | 346 |
| 134 | 3300028794 | Ga0307515_10029059 | Ga0307515_100290598 | 347 |
| 135 | 3300045051 | Ga0451576_0250992 | Ga0451576_0250992_261_1421 | 347 |
| 136 | 3300048928 | Ga0496125_0110318 | Ga0496125_0110318_19_1161 | 347 |
| 137 | 3300005459 | Ga0068867_100213037 | Ga0068867_1002130372 | 348 |
| 138 | 3300025940 | Ga0207691_10027277 | Ga0207691_100272772 | 348 |
| 139 | 3300026089 | Ga0207648_10061792 | Ga0207648_100617924 | 348 |
| 140 | 3300048912 | Ga0496109_0134074 | Ga0496109_0134074_16_1116 | 348 |
| 141 | iso_pu_bacteria | 2984568884 | 2984569345 | 348 |
| 142 | 3300003792 | Ga0055540_1002909 | Ga0055540_10029098 | 349 |
| 143 | 3300006177 | Ga0075362_10004798 | Ga0075362_100047982 | 349 |
| 144 | 3300013308 | Ga0157375_10290384 | Ga0157375_102903842 | 349 |
| 145 | 3300025303 | Ga0209051_1001013 | Ga0209051_100101313 | 349 |
| 146 | 3300028380 | Ga0268265_10031470 | Ga0268265_100314704 | 349 |
| 147 | 3300044712 | Ga0453684_0017188 | Ga0453684_0017188_2153_3325 | 349 |
| 148 | 3300045051 | Ga0451576_0006640 | Ga0451576_0006640_3545_4717 | 349 |
| 149 | 3300046501 | Ga0495607_0000501 | Ga0495607_0000501_34680_35837 | 349 |
| 150 | 3300046517 | Ga0495630_0062548 | Ga0495630_0062548_1617_2774 | 349 |
| 151 | 3300046536 | Ga0495587_0000479 | Ga0495587_0000479_5031_6188 | 349 |
| 152 | 3300046663 | Ga0495635_0000298 | Ga0495635_0000298_13051_14208 | 349 |
| 153 | 3300048088 | Ga0495602_0056983 | Ga0495602_0056983_1218_2375 | 349 |
| 154 | 3300048905 | Ga0496102_0000038 | Ga0496102_0000038_151719_152876 | 349 |
| 155 | 3300048906 | Ga0496103_0000137 | Ga0496103_0000137_8028_9185 | 349 |
| 156 | 3300048919 | Ga0496116_0022818 | Ga0496116_0022818_2303_3460 | 349 |
| 157 | 3300048920 | Ga0496117_0006767 | Ga0496117_0006767_2169_3326 | 349 |
| 158 | 3300048921 | Ga0496118_0017416 | Ga0496118_0017416_3863_5020 | 349 |
| 159 | 3300049822 | Ga0501035_0057558 | Ga0501035_0057558_721_1899 | 349 |
| 160 | 3300050489 | nmdc:mga03683_1531_c1 | nmdc:mga03683_1531_c1_1778_2935 | 349 |
| 161 | 3300006051 | Ga0075364_10009415 | Ga0075364_100094154 | 350 |
| 162 | 3300013102 | Ga0157371_10087744 | Ga0157371_100877442 | 350 |
| 163 | 3300013308 | Ga0157375_10422314 | Ga0157375_104223142 | 350 |
| 164 | 3300025918 | Ga0207662_10048198 | Ga0207662_100481982 | 350 |
| 165 | 3300031456 | Ga0307513_10000034 | Ga0307513_1000003457 | 350 |
| 166 | 3300031730 | Ga0307516_10003466 | Ga0307516_1000346619 | 350 |
| 167 | 3300042876 | Ga0451577_0152810 | Ga0451577_0152810_417_1619 | 350 |
| 168 | 3300045976 | Ga0466967_0119783 | Ga0466967_0119783_202_1401 | 350 |
| 169 | 3300046452 | Ga0495617_013070 | Ga0495617_013070_512_1669 | 350 |
| 170 | 3300046463 | Ga0495653_0112344 | Ga0495653_0112344_781_1938 | 350 |
| 171 | 3300046507 | Ga0495606_0049368 | Ga0495606_0049368_640_1797 | 350 |
| 172 | 3300046512 | Ga0495610_0083231 | Ga0495610_0083231_218_1375 | 350 |
| 173 | 3300046513 | Ga0495616_0067432 | Ga0495616_0067432_530_1687 | 350 |
| 174 | 3300046515 | Ga0495620_0016498 | Ga0495620_0016498_2240_3397 | 350 |
| 175 | 3300046520 | Ga0495637_0048836 | Ga0495637_0048836_155_1312 | 350 |
| 176 | 3300046523 | Ga0495644_0002111 | Ga0495644_0002111_1519_2676 | 350 |
| 177 | 3300046526 | Ga0495666_0009465 | Ga0495666_0009465_2361_3518 | 350 |
| 178 | 3300046530 | Ga0495654_0004411 | Ga0495654_0004411_5883_7040 | 350 |
| 179 | 3300046542 | Ga0495597_0007304 | Ga0495597_0007304_694_1851 | 350 |
| 180 | 3300046557 | Ga0495622_0024167 | Ga0495622_0024167_851_2008 | 350 |
| 181 | 3300046558 | Ga0495633_0000612 | Ga0495633_0000612_13289_14446 | 350 |
| 182 | 3300046660 | Ga0495625_0166652 | Ga0495625_0166652_156_1313 | 350 |
| 183 | 3300046665 | Ga0495661_0044447 | Ga0495661_0044447_677_1834 | 350 |
| 184 | 3300046679 | Ga0495623_0004546 | Ga0495623_0004546_1135_2292 | 350 |
| 185 | 3300046689 | Ga0495613_0009208 | Ga0495613_0009208_1333_2490 | 350 |
| 186 | 3300046692 | Ga0495671_0000069 | Ga0495671_0000069_16168_17325 | 350 |
| 187 | 3300047317 | Ga0495604_0012794 | Ga0495604_0012794_2253_3410 | 350 |
| 188 | 3300047319 | Ga0495674_0047291 | Ga0495674_0047291_882_2039 | 350 |
| 189 | 3300047322 | Ga0495680_0097134 | Ga0495680_0097134_646_1803 | 350 |
| 190 | 3300047323 | Ga0495683_0005559 | Ga0495683_0005559_5264_6421 | 350 |
| 191 | 3300047444 | Ga0495675_0013353 | Ga0495675_0013353_2870_4027 | 350 |
| 192 | 3300047446 | Ga0495679_002783 | Ga0495679_002783_5701_6858 | 350 |
| 193 | 3300047469 | Ga0495673_0005428 | Ga0495673_0005428_669_1826 | 350 |
| 194 | 3300047470 | Ga0495681_0004895 | Ga0495681_0004895_2608_3765 | 350 |
| 195 | 3300047470 | Ga0495681_0075825 | Ga0495681_0075825_277_1434 | 350 |
| 196 | 3300048924 | Ga0496121_0044191 | Ga0496121_0044191_1957_3114 | 350 |
| 197 | iso_pu_bacteria | 2551306352 | 2552746059 | 350 |
| 198 | iso_pu_bacteria | 2639762793 | 2640736965 | 350 |
| 199 | iso_pu_bacteria | 2675903507 | 2678229796 | 350 |
| 200 | iso_pu_bacteria | 2773857761 | 2774391468 | 350 |
| 201 | iso_pu_bacteria | 2773857770 | 2774439532 | 350 |
| 202 | iso_pu_bacteria | 2919182534 | 2919185575 | 350 |
| 203 | 3300049459 | Ga0495678_028750 | Ga0495678_028750_486_1643 | 351 |
| 204 | 3300042006 | Ga0439432_047533 | Ga0439432_047533_16_1194 | 352 |
| 205 | 3300047320 | Ga0495672_0010898 | Ga0495672_0010898_851_2059 | 352 |
| 206 | 3300049823 | Ga0501044_0295264 | Ga0501044_0295264_329_1534 | 352 |
| 207 | 3300005367 | Ga0070667_100088929 | Ga0070667_1000889292 | 353 |
| 208 | 3300009177 | Ga0105248_10081641 | Ga0105248_100816412 | 353 |
| 209 | 3300013306 | Ga0163162_10000998 | Ga0163162_100009989 | 353 |
| 210 | 3300013308 | Ga0157375_10140549 | Ga0157375_101405492 | 353 |
| 211 | 3300014325 | Ga0163163_10260526 | Ga0163163_102605261 | 353 |
| 212 | 3300025903 | Ga0207680_10175460 | Ga0207680_101754602 | 353 |
| 213 | 3300026089 | Ga0207648_10100166 | Ga0207648_101001662 | 353 |
| 214 | 3300030521 | Ga0307511_10000485 | Ga0307511_1000048512 | 353 |
| 215 | 3300046459 | Ga0495629_0136179 | Ga0495629_0136179_231_1400 | 353 |
| 216 | 3300046474 | Ga0495605_0000848 | Ga0495605_0000848_9341_10510 | 353 |
| 217 | 3300046492 | Ga0495585_0051193 | Ga0495585_0051193_569_1738 | 353 |
| 218 | 3300046500 | Ga0495596_0038054 | Ga0495596_0038054_429_1598 | 353 |
| 219 | 3300046542 | Ga0495597_0050143 | Ga0495597_0050143_255_1424 | 353 |
| 220 | 3300046794 | Ga0495589_0017485 | Ga0495589_0017485_1399_2568 | 353 |
| 221 | 3300047319 | Ga0495674_0007659 | Ga0495674_0007659_982_2151 | 353 |
| 222 | 3300047320 | Ga0495672_0009892 | Ga0495672_0009892_2858_4027 | 353 |
| 223 | 3300047469 | Ga0495673_0012224 | Ga0495673_0012224_708_1877 | 353 |
| 224 | 3300048091 | Ga0495626_0029522 | Ga0495626_0029522_512_1681 | 353 |
| 225 | 3300048903 | Ga0496100_0042413 | Ga0496100_0042413_1169_2338 | 353 |
| 226 | 3300048904 | Ga0496101_0049520 | Ga0496101_0049520_673_1842 | 353 |
| 227 | 3300048905 | Ga0496102_0078332 | Ga0496102_0078332_624_1793 | 353 |
| 228 | 3300048910 | Ga0496107_0128726 | Ga0496107_0128726_334_1503 | 353 |
| 229 | 3300048917 | Ga0496114_0040436 | Ga0496114_0040436_242_1411 | 353 |
| 230 | 3300048920 | Ga0496117_0086822 | Ga0496117_0086822_587_1756 | 353 |
| 231 | 3300003856 | Ga0058692_1000027 | Ga0058692_100002747 | 354 |
| 232 | 3300005272 | Ga0065703_1000152 | Ga0065703_100015211 | 354 |
| 233 | 3300005289 | Ga0065704_10086279 | Ga0065704_100862793 | 354 |
| 234 | 3300005289 | Ga0065704_10106726 | Ga0065704_101067262 | 354 |
| 235 | 3300005353 | Ga0070669_100001876 | Ga0070669_1000018769 | 354 |
| 236 | 3300005364 | Ga0070673_100019238 | Ga0070673_1000192385 | 354 |
| 237 | 3300005548 | Ga0070665_100008004 | Ga0070665_1000080048 | 354 |
| 238 | 3300009036 | Ga0105244_10009231 | Ga0105244_100092312 | 354 |
| 239 | 3300009093 | Ga0105240_10022111 | Ga0105240_100221117 | 354 |
| 240 | 3300009101 | Ga0105247_10000221 | Ga0105247_1000022136 | 354 |
| 241 | 3300009148 | Ga0105243_10000343 | Ga0105243_1000034320 | 354 |
| 242 | 3300013306 | Ga0163162_10023284 | Ga0163162_100232841 | 354 |
| 243 | 3300017792 | Ga0163161_10044730 | Ga0163161_100447302 | 354 |
| 244 | 3300025711 | Ga0207696_1003494 | Ga0207696_10034942 | 354 |
| 245 | 3300025711 | Ga0207696_1008402 | Ga0207696_10084025 | 354 |
| 246 | 3300025728 | Ga0207655_1000755 | Ga0207655_100075523 | 354 |
| 247 | 3300025728 | Ga0207655_1010657 | Ga0207655_10106572 | 354 |
| 248 | 3300025735 | Ga0207713_1001757 | Ga0207713_10017579 | 354 |
| 249 | 3300025735 | Ga0207713_1030788 | Ga0207713_10307882 | 354 |
| 250 | 3300025900 | Ga0207710_10000057 | Ga0207710_1000005747 | 354 |
| 251 | 3300025913 | Ga0207695_10142170 | Ga0207695_101421702 | 354 |
| 252 | 3300025923 | Ga0207681_10000821 | Ga0207681_100008216 | 354 |
| 253 | 3300027312 | Ga0209371_1000074 | Ga0209371_100007447 | 354 |
| 254 | 3300030500 | Ga0268256_1000067 | Ga0268256_100006747 | 354 |
| 255 | 3300046616 | Ga0495668_0034669 | Ga0495668_0034669_606_1793 | 354 |
| 256 | 3300046794 | Ga0495589_0021028 | Ga0495589_0021028_618_1793 | 354 |
| 257 | 3300047472 | Ga0495686_0000012 | Ga0495686_0000012_444456_445631 | 354 |
| 258 | 3300053148 | Ga0500590_002212 | Ga0500590_002212_7205_8365 | 354 |
| 259 | iso_pu_bacteria | 2515154123 | 2515687802 | 354 |
| 260 | iso_pu_bacteria | 8055301274 | 8055307956 | 354 |
| 261 | 3300005262 | Ga0065165_1002663 | Ga0065165_100266313 | 355 |
| 262 | 3300005338 | Ga0068868_100004002 | Ga0068868_1000040027 | 355 |
| 263 | 3300005355 | Ga0070671_100011579 | Ga0070671_1000115794 | 355 |
| 264 | 3300005440 | Ga0070705_100034668 | Ga0070705_1000346682 | 355 |
| 265 | 3300005457 | Ga0070662_100033964 | Ga0070662_1000339642 | 355 |
| 266 | 3300005459 | Ga0068867_100061352 | Ga0068867_1000613522 | 355 |
| 267 | 3300005467 | Ga0070706_100114580 | Ga0070706_1001145802 | 355 |
| 268 | 3300005471 | Ga0070698_100164235 | Ga0070698_1001642351 | 355 |
| 269 | 3300005618 | Ga0068864_100023527 | Ga0068864_1000235275 | 355 |
| 270 | 3300005718 | Ga0068866_10013798 | Ga0068866_100137982 | 355 |
| 271 | 3300005719 | Ga0068861_100027008 | Ga0068861_1000270084 | 355 |
| 272 | 3300006048 | Ga0075363_100019723 | Ga0075363_1000197234 | 355 |
| 273 | 3300006051 | Ga0075364_10041760 | Ga0075364_100417602 | 355 |
| 274 | 3300006058 | Ga0075432_10005731 | Ga0075432_100057313 | 355 |
| 275 | 3300006178 | Ga0075367_10011041 | Ga0075367_100110414 | 355 |
| 276 | 3300006186 | Ga0075369_10000645 | Ga0075369_100006455 | 355 |
| 277 | 3300006358 | Ga0068871_100041352 | Ga0068871_1000413522 | 355 |
| 278 | 3300009093 | Ga0105240_10469942 | Ga0105240_104699421 | 355 |
| 279 | 3300009098 | Ga0105245_10064850 | Ga0105245_100648503 | 355 |
| 280 | 3300009148 | Ga0105243_10016686 | Ga0105243_100166863 | 355 |
| 281 | 3300011119 | Ga0105246_10011288 | Ga0105246_100112883 | 355 |
| 282 | 3300017792 | Ga0163161_10003777 | Ga0163161_100037777 | 355 |
| 283 | 3300025273 | Ga0209673_1003066 | Ga0209673_100306610 | 355 |
| 284 | 3300025907 | Ga0207645_10023668 | Ga0207645_100236682 | 355 |
| 285 | 3300025910 | Ga0207684_10005739 | Ga0207684_100057393 | 355 |
| 286 | 3300025933 | Ga0207706_10076233 | Ga0207706_100762332 | 355 |
| 287 | 3300025942 | Ga0207689_10023495 | Ga0207689_100234953 | 355 |
| 288 | 3300026088 | Ga0207641_10429515 | Ga0207641_104295151 | 355 |
| 289 | 3300026089 | Ga0207648_10024226 | Ga0207648_100242263 | 355 |
| 290 | 3300026118 | Ga0207675_100018840 | Ga0207675_1000188404 | 355 |
| 291 | 3300037418 | Ga0395900_0118912 | Ga0395900_0118912_110_1231 | 355 |
| 292 | 3300048924 | Ga0496121_0027666 | Ga0496121_0027666_3439_4692 | 355 |
| 293 | 3300048925 | Ga0496122_0000102 | Ga0496122_0000102_73528_74781 | 355 |
| 294 | 3300048926 | Ga0496123_0000110 | Ga0496123_0000110_154365_155618 | 355 |
| 295 | 3300048928 | Ga0496125_0028699 | Ga0496125_0028699_1119_2372 | 355 |
| 296 | 3300049579 | Ga0501043_0000097 | Ga0501043_0000097_22611_23789 | 355 |
| 297 | 3300049580 | Ga0501046_0000047 | Ga0501046_0000047_116766_117944 | 355 |
| 298 | 3300049581 | Ga0501047_0000058 | Ga0501047_0000058_22803_23981 | 355 |
| 299 | 3300049824 | Ga0501045_0007269 | Ga0501045_0007269_4607_5785 | 355 |
| 300 | 3300050489 | nmdc:mga03683_5516_c1 | nmdc:mga03683_5516_c1_581_1765 | 355 |
| 301 | 3300050493 | nmdc:mga0k408_169_c1 | nmdc:mga0k408_169_c1_13866_15050 | 355 |
| 302 | 3300050516 | nmdc:mga0sz30_4052_c1 | nmdc:mga0sz30_4052_c1_750_1934 | 355 |
| 303 | 3300014497 | Ga0182008_10000316 | Ga0182008_1000031613 | 356 |
| 304 | 3300017792 | Ga0163161_10096833 | Ga0163161_100968332 | 356 |
| 305 | 3300031911 | Ga0307412_10059873 | Ga0307412_100598731 | 356 |
| 306 | 3300045836 | Ga0466958_0157360 | Ga0466958_0157360_281_1405 | 356 |
| 307 | 3300049822 | Ga0501035_0017152 | Ga0501035_0017152_4989_6155 | 356 |
| 308 | 3300049823 | Ga0501044_0000022 | Ga0501044_0000022_50969_52135 | 356 |
| 309 | 3300005616 | Ga0068852_100328194 | Ga0068852_1003281942 | 357 |
| 310 | 3300025901 | Ga0207688_10086733 | Ga0207688_100867331 | 357 |
| 311 | 3300031238 | Ga0265332_10000027 | Ga0265332_1000002720 | 357 |
| 312 | 3300041407 | Ga0439447_011098 | Ga0439447_011098_1165_2334 | 357 |
| 313 | 3300042138 | Ga0450903_001624 | Ga0450903_001624_51_1220 | 357 |
| 314 | 3300046519 | Ga0495632_0036707 | Ga0495632_0036707_639_1808 | 357 |
| 315 | 3300048907 | Ga0496104_0070138 | Ga0496104_0070138_1342_2547 | 357 |
| 316 | 3300048920 | Ga0496117_0003381 | Ga0496117_0003381_14671_15846 | 357 |
| 317 | 3300048929 | Ga0496126_0000328 | Ga0496126_0000328_24128_25303 | 357 |
| 318 | 3300006038 | Ga0075365_10003966 | Ga0075365_100039662 | 358 |
| 319 | 3300025960 | Ga0207651_10196028 | Ga0207651_101960282 | 358 |
| 320 | 3300026116 | Ga0207674_10053254 | Ga0207674_100532541 | 358 |
| 321 | 3300026121 | Ga0207683_10033430 | Ga0207683_100334303 | 358 |
| 322 | 3300028379 | Ga0268266_10070330 | Ga0268266_100703303 | 358 |
| 323 | 3300046522 | Ga0495643_0051401 | Ga0495643_0051401_873_2072 | 358 |
| 324 | 3300046538 | Ga0495609_0013875 | Ga0495609_0013875_1353_2552 | 358 |
| 325 | 3300046648 | Ga0495611_0030363 | Ga0495611_0030363_717_1916 | 358 |
| 326 | 3300005564 | Ga0070664_100205423 | Ga0070664_1002054232 | 359 |
| 327 | 3300053151 | Ga0500604_0003122 | Ga0500604_0003122_687_1847 | 359 |
| 328 | iso_pu_bacteria | 2501025502 | 2501079053 | 359 |
| 329 | iso_pu_bacteria | 2510917013 | 2511093053 | 359 |
| 330 | 3300005288 | Ga0065714_10006453 | Ga0065714_100064532 | 360 |
| 331 | 3300005328 | Ga0070676_10005423 | Ga0070676_100054232 | 360 |
| 332 | 3300005330 | Ga0070690_100116095 | Ga0070690_1001160952 | 360 |
| 333 | 3300005331 | Ga0070670_100018686 | Ga0070670_1000186865 | 360 |
| 334 | 3300005334 | Ga0068869_100001131 | Ga0068869_1000011316 | 360 |
| 335 | 3300005338 | Ga0068868_100160625 | Ga0068868_1001606252 | 360 |
| 336 | 3300005353 | Ga0070669_100004206 | Ga0070669_10000420611 | 360 |
| 337 | 3300005354 | Ga0070675_100225138 | Ga0070675_1002251382 | 360 |
| 338 | 3300005356 | Ga0070674_100002148 | Ga0070674_1000021489 | 360 |
| 339 | 3300005364 | Ga0070673_100107944 | Ga0070673_1001079442 | 360 |
| 340 | 3300005365 | Ga0070688_100194930 | Ga0070688_1001949302 | 360 |
| 341 | 3300005367 | Ga0070667_100109657 | Ga0070667_1001096572 | 360 |
| 342 | 3300005441 | Ga0070700_100153772 | Ga0070700_1001537722 | 360 |
| 343 | 3300005456 | Ga0070678_100085278 | Ga0070678_1000852781 | 360 |
| 344 | 3300005457 | Ga0070662_100096915 | Ga0070662_1000969152 | 360 |
| 345 | 3300005543 | Ga0070672_100000701 | Ga0070672_10000070111 | 360 |
| 346 | 3300005616 | Ga0068852_100031259 | Ga0068852_1000312592 | 360 |
| 347 | 3300005617 | Ga0068859_100031712 | Ga0068859_1000317124 | 360 |
| 348 | 3300005618 | Ga0068864_100009096 | Ga0068864_1000090968 | 360 |
| 349 | 3300005718 | Ga0068866_10001392 | Ga0068866_1000139212 | 360 |
| 350 | 3300005719 | Ga0068861_100001224 | Ga0068861_10000122414 | 360 |
| 351 | 3300005841 | Ga0068863_100001886 | Ga0068863_1000018862 | 360 |
| 352 | 3300005842 | Ga0068858_100001000 | Ga0068858_10000100034 | 360 |
| 353 | 3300005843 | Ga0068860_100001048 | Ga0068860_1000010483 | 360 |
| 354 | 3300005844 | Ga0068862_100028430 | Ga0068862_1000284305 | 360 |
| 355 | 3300006195 | Ga0075366_10051788 | Ga0075366_100517882 | 360 |
| 356 | 3300006881 | Ga0068865_100024466 | Ga0068865_1000244663 | 360 |
| 357 | 3300006931 | Ga0097620_100031712 | Ga0097620_1000317123 | 360 |
| 358 | 3300009148 | Ga0105243_10240189 | Ga0105243_102401892 | 360 |
| 359 | 3300009177 | Ga0105248_10175872 | Ga0105248_101758722 | 360 |
| 360 | 3300009553 | Ga0105249_10090429 | Ga0105249_100904292 | 360 |
| 361 | 3300013306 | Ga0163162_10017500 | Ga0163162_100175002 | 360 |
| 362 | 3300013308 | Ga0157375_10004479 | Ga0157375_1000447910 | 360 |
| 363 | 3300013308 | Ga0157375_10308863 | Ga0157375_103088632 | 360 |
| 364 | 3300014325 | Ga0163163_10113694 | Ga0163163_101136942 | 360 |
| 365 | 3300014326 | Ga0157380_10002558 | Ga0157380_1000255811 | 360 |
| 366 | 3300014968 | Ga0157379_10026574 | Ga0157379_100265742 | 360 |
| 367 | 3300025298 | Ga0209050_1001787 | Ga0209050_10017872 | 360 |
| 368 | 3300025893 | Ga0207682_10047107 | Ga0207682_100471072 | 360 |
| 369 | 3300025907 | Ga0207645_10017116 | Ga0207645_100171164 | 360 |
| 370 | 3300025923 | Ga0207681_10000308 | Ga0207681_1000030834 | 360 |
| 371 | 3300025925 | Ga0207650_10001370 | Ga0207650_1000137013 | 360 |
| 372 | 3300025926 | Ga0207659_10015718 | Ga0207659_100157185 | 360 |
| 373 | 3300025933 | Ga0207706_10062189 | Ga0207706_100621892 | 360 |
| 374 | 3300025935 | Ga0207709_10089856 | Ga0207709_100898562 | 360 |
| 375 | 3300025936 | Ga0207670_10237078 | Ga0207670_102370782 | 360 |
| 376 | 3300025937 | Ga0207669_10073142 | Ga0207669_100731422 | 360 |
| 377 | 3300025938 | Ga0207704_10005851 | Ga0207704_100058512 | 360 |
| 378 | 3300025940 | Ga0207691_10028559 | Ga0207691_100285592 | 360 |
| 379 | 3300025941 | Ga0207711_10030653 | Ga0207711_100306532 | 360 |
| 380 | 3300025942 | Ga0207689_10002245 | Ga0207689_100022456 | 360 |
| 381 | 3300025960 | Ga0207651_10018646 | Ga0207651_100186464 | 360 |
| 382 | 3300025986 | Ga0207658_10000495 | Ga0207658_1000049534 | 360 |
| 383 | 3300026023 | Ga0207677_10168164 | Ga0207677_101681642 | 360 |
| 384 | 3300026035 | Ga0207703_10000414 | Ga0207703_100004142 | 360 |
| 385 | 3300026088 | Ga0207641_10000615 | Ga0207641_1000061514 | 360 |
| 386 | 3300026095 | Ga0207676_10110171 | Ga0207676_101101712 | 360 |
| 387 | 3300026118 | Ga0207675_100005031 | Ga0207675_10000503110 | 360 |
| 388 | 3300026121 | Ga0207683_10049515 | Ga0207683_100495152 | 360 |
| 389 | 3300028380 | Ga0268265_10012608 | Ga0268265_100126086 | 360 |
| 390 | 3300028381 | Ga0268264_10000780 | Ga0268264_1000078036 | 360 |
| 391 | 3300041411 | Ga0439466_0013209 | Ga0439466_0013209_1412_2569 | 360 |
| 392 | 3300050491 | nmdc:mga00v17_40362_c1 | nmdc:mga00v17_40362_c1_159_1373 | 360 |
| 393 | 3300005288 | Ga0065714_10011224 | Ga0065714_100112242 | 361 |
| 394 | 3300005335 | Ga0070666_10088331 | Ga0070666_100883312 | 361 |
| 395 | 3300005347 | Ga0070668_100038500 | Ga0070668_1000385002 | 361 |
| 396 | 3300005353 | Ga0070669_100045554 | Ga0070669_1000455542 | 361 |
| 397 | 3300005366 | Ga0070659_100274328 | Ga0070659_1002743281 | 361 |
| 398 | 3300005367 | Ga0070667_100036506 | Ga0070667_1000365062 | 361 |
| 399 | 3300005459 | Ga0068867_100006169 | Ga0068867_1000061694 | 361 |
| 400 | 3300005617 | Ga0068859_100240371 | Ga0068859_1002403712 | 361 |
| 401 | 3300005719 | Ga0068861_100034174 | Ga0068861_1000341744 | 361 |
| 402 | 3300005842 | Ga0068858_100034439 | Ga0068858_1000344395 | 361 |
| 403 | 3300005843 | Ga0068860_100006491 | Ga0068860_10000649112 | 361 |
| 404 | 3300005844 | Ga0068862_100037636 | Ga0068862_1000376364 | 361 |
| 405 | 3300006881 | Ga0068865_100002084 | Ga0068865_1000020849 | 361 |
| 406 | 3300006931 | Ga0097620_100240368 | Ga0097620_1002403682 | 361 |
| 407 | 3300009553 | Ga0105249_10009083 | Ga0105249_100090835 | 361 |
| 408 | 3300013297 | Ga0157378_10008090 | Ga0157378_100080905 | 361 |
| 409 | 3300013306 | Ga0163162_10003327 | Ga0163162_100033272 | 361 |
| 410 | 3300013308 | Ga0157375_10030818 | Ga0157375_100308182 | 361 |
| 411 | 3300014326 | Ga0157380_10032362 | Ga0157380_100323622 | 361 |
| 412 | 3300025893 | Ga0207682_10002802 | Ga0207682_100028022 | 361 |
| 413 | 3300025907 | Ga0207645_10130883 | Ga0207645_101308832 | 361 |
| 414 | 3300025932 | Ga0207690_10092910 | Ga0207690_100929102 | 361 |
| 415 | 3300025934 | Ga0207686_10093888 | Ga0207686_100938882 | 361 |
| 416 | 3300025940 | Ga0207691_10135734 | Ga0207691_101357341 | 361 |
| 417 | 3300025972 | Ga0207668_10079683 | Ga0207668_100796832 | 361 |
| 418 | 3300026035 | Ga0207703_10052657 | Ga0207703_100526572 | 361 |
| 419 | 3300026067 | Ga0207678_10101396 | Ga0207678_101013962 | 361 |
| 420 | 3300026067 | Ga0207678_10217122 | Ga0207678_102171222 | 361 |
| 421 | 3300026089 | Ga0207648_10005514 | Ga0207648_100055142 | 361 |
| 422 | 3300026089 | Ga0207648_10273811 | Ga0207648_102738112 | 361 |
| 423 | 3300026118 | Ga0207675_100003069 | Ga0207675_10000306913 | 361 |
| 424 | 3300026121 | Ga0207683_10014063 | Ga0207683_100140635 | 361 |
| 425 | 3300028380 | Ga0268265_10100728 | Ga0268265_101007282 | 361 |
| 426 | 3300028381 | Ga0268264_10001577 | Ga0268264_100015778 | 361 |
| 427 | 3300035172 | Ga0373955_0052098 | Ga0373955_0052098_994_2133 | 361 |
| 428 | 3300036401 | Ga0373937_0057331 | Ga0373937_0057331_23_1162 | 361 |
| 429 | 3300046459 | Ga0495629_0079421 | Ga0495629_0079421_457_1596 | 361 |
| 430 | 3300046516 | Ga0495628_0003869 | Ga0495628_0003869_8090_9265 | 361 |
| 431 | 3300046539 | Ga0495621_0034102 | Ga0495621_0034102_247_1386 | 361 |
| 432 | 3300046543 | Ga0495645_0021607 | Ga0495645_0021607_821_1960 | 361 |
| 433 | 3300046663 | Ga0495635_0059902 | Ga0495635_0059902_629_1768 | 361 |
| 434 | 3300046689 | Ga0495613_0147989 | Ga0495613_0147989_137_1276 | 361 |
| 435 | 3300047319 | Ga0495674_0162958 | Ga0495674_0162958_319_1458 | 361 |
| 436 | 3300047323 | Ga0495683_0000290 | Ga0495683_0000290_13602_14759 | 361 |
| 437 | 3300048924 | Ga0496121_0000137 | Ga0496121_0000137_80535_81764 | 361 |
| 438 | 3300050490 | nmdc:mga03n38_81335_c1 | nmdc:mga03n38_81335_c1_269_1453 | 361 |
| 439 | 3300053085 | Ga0495619_0053804 | Ga0495619_0053804_1177_2316 | 361 |
| 440 | 3300025253 | Ga0209677_100180 | Ga0209677_10018023 | 362 |
| 441 | 3300025728 | Ga0207655_1000687 | Ga0207655_100068712 | 362 |
| 442 | 3300025935 | Ga0207709_10000057 | Ga0207709_10000057156 | 362 |
| 443 | 3300048920 | Ga0496117_0009563 | Ga0496117_0009563_5651_6826 | 362 |
| 444 | 3300048921 | Ga0496118_0067984 | Ga0496118_0067984_906_2111 | 362 |
| 445 | 3300048924 | Ga0496121_0055186 | Ga0496121_0055186_1274_2470 | 362 |
| 446 | 3300048924 | Ga0496121_0079138 | Ga0496121_0079138_211_1416 | 362 |
| 447 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_336287_337483 | 362 |
| 448 | 3300003792 | Ga0055540_1004067 | Ga0055540_10040672 | 363 |
| 449 | 3300003794 | Ga0055531_10001837 | Ga0055531_100018374 | 363 |
| 450 | 3300025303 | Ga0209051_1000369 | Ga0209051_100036937 | 363 |
| 451 | 3300025304 | Ga0209257_1000317 | Ga0209257_100031766 | 363 |
| 452 | 3300037471 | Ga0395905_0223151 | Ga0395905_0223151_65_1210 | 363 |
| 453 | 3300045049 | Ga0466959_0001542 | Ga0466959_0001542_9094_10263 | 363 |
| 454 | 3300003316 | rootH1_10035044 | rootH1_100350442 | 364 |
| 455 | 3300003758 | Ga0055532_1002676 | Ga0055532_10026763 | 364 |
| 456 | 3300006042 | Ga0075368_10011398 | Ga0075368_100113983 | 364 |
| 457 | 3300025229 | Ga0209147_100534 | Ga0209147_1005345 | 364 |
| 458 | 3300027866 | Ga0209813_10012910 | Ga0209813_100129102 | 364 |
| 459 | 3300031911 | Ga0307412_10000129 | Ga0307412_1000012919 | 364 |
| 460 | 3300050489 | nmdc:mga03683_44651_c1 | nmdc:mga03683_44651_c1_492_1652 | 364 |
| 461 | 3300050490 | nmdc:mga03n38_33802_c1 | nmdc:mga03n38_33802_c1_174_1334 | 364 |
| 462 | 3300050491 | nmdc:mga00v17_28640_c1 | nmdc:mga00v17_28640_c1_1858_3018 | 364 |
| 463 | 3300050491 | nmdc:mga00v17_6114_c1 | nmdc:mga00v17_6114_c1_47_1207 | 364 |
| 464 | 3300050492 | nmdc:mga0yw44_77831_c1 | nmdc:mga0yw44_77831_c1_866_2026 | 364 |
| 465 | 3300050492 | nmdc:mga0yw44_77833_c1 | nmdc:mga0yw44_77833_c1_866_2026 | 364 |
| 466 | 3300050493 | nmdc:mga0k408_32408_c1 | nmdc:mga0k408_32408_c1_99_1259 | 364 |
| 467 | 3300050495 | nmdc:mga04h51_3736_c1 | nmdc:mga04h51_3736_c1_492_1652 | 364 |
| 468 | 3300050516 | nmdc:mga0sz30_46182_c1 | nmdc:mga0sz30_46182_c1_267_1427 | 364 |
| 469 | iso_pu_bacteria | 2515154123 | 2515691095 | 364 |
| 470 | iso_pu_bacteria | 2939631187 | 2939634478 | 364 |
| 471 | 3300031731 | Ga0307405_10161809 | Ga0307405_101618092 | 365 |
| 472 | 3300037312 | Ga0395899_0035639 | Ga0395899_0035639_302_1498 | 365 |
| 473 | 3300037418 | Ga0395900_0012763 | Ga0395900_0012763_3507_4703 | 365 |
| 474 | 3300037466 | Ga0395898_0031026 | Ga0395898_0031026_3852_5048 | 365 |
| 475 | 3300038443 | Ga0395901_0027834 | Ga0395901_0027834_3342_4538 | 365 |
| 476 | 3300045049 | Ga0466959_0115238 | Ga0466959_0115238_95_1291 | 365 |
| 477 | 3300046674 | Ga0495588_0027877 | Ga0495588_0027877_554_1717 | 365 |
| 478 | iso_pu_bacteria | 2721755763 | 2723879888 | 365 |
| 479 | 3300025228 | Ga0209672_101446 | Ga0209672_1014466 | 366 |
| 480 | 3300025242 | Ga0209258_106361 | Ga0209258_1063612 | 366 |
| 481 | 3300025272 | Ga0209455_1000398 | Ga0209455_100039828 | 366 |
| 482 | 3300025728 | Ga0207655_1031674 | Ga0207655_10316742 | 366 |
| 483 | 3300047443 | Ga0495687_033169 | Ga0495687_033169_1122_2333 | 366 |
| 484 | 3300049822 | Ga0501035_0074936 | Ga0501035_0074936_859_2025 | 366 |
| 485 | iso_pu_bacteria | 2548876994 | 2550695725 | 366 |
| 486 | iso_pu_bacteria | 2855730933 | 2855732013 | 366 |
| 487 | iso_pu_bacteria | 2855767633 | 2855768720 | 366 |
| 488 | iso_pu_bacteria | 2881412998 | 2881415338 | 366 |
| 489 | 3300005539 | Ga0068853_100040352 | Ga0068853_1000403523 | 367 |
| 490 | 3300005563 | Ga0068855_100289032 | Ga0068855_1002890322 | 367 |
| 491 | 3300025935 | Ga0207709_10000768 | Ga0207709_1000076823 | 367 |
| 492 | 3300026041 | Ga0207639_10003076 | Ga0207639_100030767 | 367 |
| 493 | 3300028794 | Ga0307515_10001006 | Ga0307515_1000100651 | 367 |
| 494 | 3300037418 | Ga0395900_0083050 | Ga0395900_0083050_583_1758 | 367 |
| 495 | 3300038443 | Ga0395901_0005950 | Ga0395901_0005950_9855_11039 | 368 |
| 496 | 3300053136 | Ga0500559_0000413 | Ga0500559_0000413_11188_12399 | 368 |
| 497 | 3300030731 | Ga0316177_1038652 | Ga0316177_10386525 | 369 |
| 498 | 3300030732 | Ga0316176_1212641 | Ga0316176_12126412 | 369 |
| 499 | 3300030733 | Ga0314311_1250941 | Ga0314311_12509415 | 369 |
| 500 | 3300030735 | Ga0316178_1183912 | Ga0316178_11839126 | 369 |
| 501 | 3300030736 | Ga0316180_1159745 | Ga0316180_11597452 | 369 |
| 502 | 3300030742 | Ga0316183_1085212 | Ga0316183_10852122 | 369 |
| 503 | 3300030744 | Ga0316181_1093548 | Ga0316181_10935482 | 369 |
| 504 | 3300031911 | Ga0307412_10005492 | Ga0307412_100054923 | 369 |
| 505 | 3300049759 | Ga0501262_000753 | Ga0501262_000753_1922_3148 | 369 |
| 506 | 3300053108 | Ga0500562_017120 | Ga0500562_017120_507_1718 | 369 |
| 507 | 3300053145 | Ga0500586_000957 | Ga0500586_000957_1542_2753 | 369 |
| 508 | 3300053156 | Ga0500622_0000073 | Ga0500622_0000073_14962_16173 | 369 |
| 509 | 3300053177 | Ga0500636_0004440 | Ga0500636_0004440_4923_6122 | 369 |
| 510 | iso_pu_bacteria | 2599185240 | 2599745996 | 369 |
| 511 | iso_pu_bacteria | 2599185292 | 2599905388 | 369 |
| 512 | iso_pu_bacteria | 2599185355 | 2600207745 | 369 |
| 513 | iso_pu_bacteria | 2643221569 | 2643858853 | 369 |
| 514 | iso_pu_bacteria | 2643221594 | 2643981982 | 369 |
| 515 | iso_pu_bacteria | 2643221621 | 2644122699 | 369 |
| 516 | iso_pu_bacteria | 2675903129 | 2676744058 | 369 |
| 517 | iso_pu_bacteria | 2808606395 | 2809034085 | 369 |
| 518 | iso_pu_bacteria | 2857537821 | 2857539906 | 369 |
| 519 | iso_pu_bacteria | 2858950400 | 2858955022 | 369 |
| 520 | iso_pu_bacteria | 2870068957 | 2870073521 | 369 |
| 521 | iso_pu_bacteria | 2881927736 | 2881929993 | 369 |
| 522 | iso_pu_bacteria | 2941479691 | 2941479874 | 369 |
| 523 | iso_pu_bacteria | 641736154 | 642414993 | 369 |
| 524 | iso_pu_bacteria | 8020945358 | 8020945915 | 369 |
| 525 | 3300003187 | JGI25151J46595_10000493 | JGI25151J46595_1000049325 | 370 |
| 526 | 3300025261 | Ga0209233_1004721 | Ga0209233_10047212 | 370 |
| 527 | 3300025294 | Ga0209025_1000018 | Ga0209025_100001811 | 370 |
| 528 | 3300046472 | Ga0495580_0035293 | Ga0495580_0035293_1922_3139 | 370 |
| 529 | 3300046524 | Ga0495648_0010582 | Ga0495648_0010582_3857_5074 | 370 |
| 530 | 3300046557 | Ga0495622_0042417 | Ga0495622_0042417_767_1978 | 370 |
| 531 | 3300053094 | Ga0500566_0000208 | Ga0500566_0000208_22214_23425 | 370 |
| 532 | 3300053102 | Ga0500554_021801 | Ga0500554_021801_375_1586 | 370 |
| 533 | 3300053148 | Ga0500590_027759 | Ga0500590_027759_38_1249 | 370 |
| 534 | 3300053177 | Ga0500636_0016826 | Ga0500636_0016826_640_1851 | 370 |
| 535 | iso_pu_bacteria | 2857542790 | 2857543258 | 370 |
| 536 | iso_pu_bacteria | 2904615490 | 2904623138 | 370 |
| 537 | iso_pu_bacteria | 2928115317 | 2928119057 | 370 |
| 538 | 3300031731 | Ga0307405_10163598 | Ga0307405_101635982 | 371 |
| 539 | iso_pu_bacteria | 2513237151 | 2513958335 | 371 |
| 540 | iso_pu_bacteria | 2515154122 | 2515681573 | 371 |
| 541 | iso_pu_bacteria | 2515154189 | 2516019860 | 371 |
| 542 | iso_pu_bacteria | 2551306416 | 2553003427 | 371 |
| 543 | iso_pu_bacteria | 2599185239 | 2599735341 | 371 |
| 544 | iso_pu_bacteria | 2857524615 | 2857529749 | 371 |
| 545 | iso_pu_bacteria | 2893066018 | 2893066168 | 371 |
| 546 | iso_pu_bacteria | 2902682994 | 2902685745 | 371 |
| 547 | iso_pu_bacteria | 2919046199 | 2919046835 | 371 |
| 548 | iso_pu_bacteria | 2919073203 | 2919075124 | 371 |
| 549 | iso_pu_bacteria | 8018845410 | 8018851679 | 371 |
| 550 | iso_pu_bacteria | 8039098773 | 8039099617 | 371 |
| 551 | iso_pu_bacteria | 8055225921 | 8055228534 | 371 |
| 552 | 3300003781 | Ga0055536_1002068 | Ga0055536_100206810 | 372 |
| 553 | 3300025292 | Ga0209676_1000595 | Ga0209676_100059515 | 372 |
| 554 | 3300025303 | Ga0209051_1000787 | Ga0209051_100078723 | 372 |
| 555 | 3300025304 | Ga0209257_1006472 | Ga0209257_10064724 | 372 |
| 556 | 3300031548 | Ga0307408_100016284 | Ga0307408_1000162845 | 372 |
| 557 | 3300031901 | Ga0307406_10000822 | Ga0307406_1000082212 | 372 |
| 558 | 3300031911 | Ga0307412_10135580 | Ga0307412_101355801 | 372 |
| 559 | 3300037466 | Ga0395898_0119398 | Ga0395898_0119398_316_1551 | 372 |
| 560 | 3300042532 | Ga0450893_0005595 | Ga0450893_0005595_672_1880 | 372 |
| 561 | 3300046460 | Ga0495638_0000537 | Ga0495638_0000537_30221_31432 | 372 |
| 562 | 3300046472 | Ga0495580_0131156 | Ga0495580_0131156_261_1466 | 372 |
| 563 | 3300046526 | Ga0495666_0012854 | Ga0495666_0012854_2668_3873 | 372 |
| 564 | 3300047317 | Ga0495604_0024673 | Ga0495604_0024673_2159_3364 | 372 |
| 565 | 3300047319 | Ga0495674_0003207 | Ga0495674_0003207_8647_9843 | 372 |
| 566 | 3300048921 | Ga0496118_0109577 | Ga0496118_0109577_314_1525 | 372 |
| 567 | 3300053131 | Ga0500652_003004 | Ga0500652_003004_2976_4187 | 372 |
| 568 | 3300053139 | Ga0500568_0000940 | Ga0500568_0000940_10429_11640 | 372 |
| 569 | iso_pu_bacteria | 2856287931 | 2856289707 | 372 |
| 570 | iso_pu_bacteria | 2857357740 | 2857364439 | 372 |
| 571 | 3300003758 | Ga0055532_1002682 | Ga0055532_10026823 | 373 |
| 572 | 3300003760 | Ga0055527_1000469 | Ga0055527_10004694 | 373 |
| 573 | 3300003761 | Ga0055535_1001165 | Ga0055535_10011654 | 373 |
| 574 | 3300005563 | Ga0068855_100223997 | Ga0068855_1002239972 | 373 |
| 575 | 3300009093 | Ga0105240_10000553 | Ga0105240_100005533 | 373 |
| 576 | 3300025228 | Ga0209672_100023 | Ga0209672_100023327 | 373 |
| 577 | 3300025229 | Ga0209147_100094 | Ga0209147_10009415 | 373 |
| 578 | 3300025242 | Ga0209258_100142 | Ga0209258_1001424 | 373 |
| 579 | 3300025254 | Ga0209148_1001094 | Ga0209148_100109410 | 373 |
| 580 | 3300025256 | Ga0209759_1001212 | Ga0209759_100121216 | 373 |
| 581 | 3300025272 | Ga0209455_1000634 | Ga0209455_10006349 | 373 |
| 582 | 3300025913 | Ga0207695_10000912 | Ga0207695_1000091216 | 373 |
| 583 | 3300025949 | Ga0207667_10037909 | Ga0207667_100379091 | 373 |
| 584 | 3300048919 | Ga0496116_0015789 | Ga0496116_0015789_2890_4098 | 373 |
| 585 | 3300048921 | Ga0496118_0011018 | Ga0496118_0011018_2050_3258 | 373 |
| 586 | iso_pu_bacteria | 2923510766 | 2923511555 | 373 |
| 587 | 3300005262 | Ga0065165_1018420 | Ga0065165_10184202 | 374 |
| 588 | 3300005543 | Ga0070672_100226888 | Ga0070672_1002268881 | 374 |
| 589 | 3300006051 | Ga0075364_10175781 | Ga0075364_101757811 | 374 |
| 590 | 3300025295 | Ga0209564_1000500 | Ga0209564_100050040 | 374 |
| 591 | 3300046512 | Ga0495610_0036035 | Ga0495610_0036035_1267_2478 | 374 |
| 592 | 3300046539 | Ga0495621_0033574 | Ga0495621_0033574_82_1293 | 374 |
| 593 | 3300047472 | Ga0495686_0071363 | Ga0495686_0071363_267_1478 | 374 |
| 594 | 3300048905 | Ga0496102_0140832 | Ga0496102_0140832_335_1546 | 374 |
| 595 | 3300048907 | Ga0496104_0103395 | Ga0496104_0103395_1485_2696 | 374 |
| 596 | 3300048920 | Ga0496117_0014705 | Ga0496117_0014705_4770_6008 | 374 |
| 597 | 3300048921 | Ga0496118_0014147 | Ga0496118_0014147_746_1984 | 374 |
| 598 | 3300048929 | Ga0496126_0093192 | Ga0496126_0093192_240_1439 | 374 |
| 599 | 3300050496 | nmdc:mga07m45_36764_c1 | nmdc:mga07m45_36764_c1_276_1505 | 374 |
| 600 | 3300053088 | Ga0500644_0021117 | Ga0500644_0021117_634_1845 | 374 |
| 601 | 3300053104 | Ga0500556_0000003 | Ga0500556_0000003_441668_442879 | 374 |
| 602 | 3300053108 | Ga0500562_002197 | Ga0500562_002197_1295_2506 | 374 |
| 603 | 3300053153 | Ga0500616_0000114 | Ga0500616_0000114_34993_36204 | 374 |
| 604 | iso_pu_bacteria | 2791355137 | 2792835128 | 374 |
| 605 | 3300005339 | Ga0070660_100000588 | Ga0070660_10000058814 | 375 |
| 606 | 3300005344 | Ga0070661_100060140 | Ga0070661_1000601401 | 375 |
| 607 | 3300005353 | Ga0070669_100027787 | Ga0070669_1000277872 | 375 |
| 608 | 3300005366 | Ga0070659_100000038 | Ga0070659_10000003813 | 375 |
| 609 | 3300005455 | Ga0070663_100002734 | Ga0070663_1000027342 | 375 |
| 610 | 3300005563 | Ga0068855_100067985 | Ga0068855_1000679853 | 375 |
| 611 | 3300005616 | Ga0068852_100011891 | Ga0068852_1000118914 | 375 |
| 612 | 3300009092 | Ga0105250_10001390 | Ga0105250_100013904 | 375 |
| 613 | 3300009093 | Ga0105240_10028605 | Ga0105240_100286053 | 375 |
| 614 | 3300009545 | Ga0105237_10006553 | Ga0105237_100065532 | 375 |
| 615 | 3300009551 | Ga0105238_10009733 | Ga0105238_100097335 | 375 |
| 616 | 3300010375 | Ga0105239_10022668 | Ga0105239_100226684 | 375 |
| 617 | 3300013105 | Ga0157369_10028090 | Ga0157369_100280904 | 375 |
| 618 | 3300017792 | Ga0163161_10048349 | Ga0163161_100483492 | 375 |
| 619 | 3300025913 | Ga0207695_10029742 | Ga0207695_100297424 | 375 |
| 620 | 3300025914 | Ga0207671_10045264 | Ga0207671_100452642 | 375 |
| 621 | 3300025919 | Ga0207657_10000063 | Ga0207657_1000006315 | 375 |
| 622 | 3300025924 | Ga0207694_10017805 | Ga0207694_100178053 | 375 |
| 623 | 3300025932 | Ga0207690_10000025 | Ga0207690_10000025154 | 375 |
| 624 | 3300025949 | Ga0207667_10002610 | Ga0207667_1000261012 | 375 |
| 625 | 3300026067 | Ga0207678_10003127 | Ga0207678_100031276 | 375 |
| 626 | 3300026142 | Ga0207698_10008619 | Ga0207698_100086194 | 375 |
| 627 | 3300044765 | Ga0466970_0006300 | Ga0466970_0006300_657_1871 | 375 |
| 628 | 3300047470 | Ga0495681_0073773 | Ga0495681_0073773_152_1363 | 375 |
| 629 | 3300047472 | Ga0495686_0100189 | Ga0495686_0100189_150_1364 | 375 |
| 630 | 3300048907 | Ga0496104_0062960 | Ga0496104_0062960_1135_2349 | 375 |
| 631 | 3300048908 | Ga0496105_0015662 | Ga0496105_0015662_2888_4102 | 375 |
| 632 | 3300048915 | Ga0496112_0090145 | Ga0496112_0090145_1793_3007 | 375 |
| 633 | 3300048920 | Ga0496117_0006162 | Ga0496117_0006162_7325_8536 | 375 |
| 634 | 3300048920 | Ga0496117_0034713 | Ga0496117_0034713_701_1915 | 375 |
| 635 | 3300048921 | Ga0496118_0007452 | Ga0496118_0007452_8332_9543 | 375 |
| 636 | 3300048921 | Ga0496118_0013975 | Ga0496118_0013975_4070_5284 | 375 |
| 637 | 3300048922 | Ga0496119_0076902 | Ga0496119_0076902_458_1672 | 375 |
| 638 | 3300048923 | Ga0496120_0070086 | Ga0496120_0070086_323_1537 | 375 |
| 639 | 3300048924 | Ga0496121_0001220 | Ga0496121_0001220_6512_7723 | 375 |
| 640 | 3300048924 | Ga0496121_0013018 | Ga0496121_0013018_3784_4998 | 375 |
| 641 | 3300048926 | Ga0496123_0015207 | Ga0496123_0015207_3189_4403 | 375 |
| 642 | 3300048926 | Ga0496123_0020883 | Ga0496123_0020883_2812_4023 | 375 |
| 643 | 3300048927 | Ga0496124_0111470 | Ga0496124_0111470_246_1460 | 375 |
| 644 | 3300048928 | Ga0496125_0003063 | Ga0496125_0003063_3056_4267 | 375 |
| 645 | 3300048928 | Ga0496125_0010419 | Ga0496125_0010419_7775_8986 | 375 |
| 646 | 3300048928 | Ga0496125_0033809 | Ga0496125_0033809_3033_4247 | 375 |
| 647 | 3300048929 | Ga0496126_0057773 | Ga0496126_0057773_2261_3472 | 375 |
| 648 | 3300048929 | Ga0496126_0108265 | Ga0496126_0108265_29_1240 | 375 |
| 649 | 3300003578 | Ga0006562J51391_1181768 | Ga0006562J51391_11817683 | 376 |
| 650 | 3300005457 | Ga0070662_100069141 | Ga0070662_1000691413 | 376 |
| 651 | 3300005844 | Ga0068862_100290944 | Ga0068862_1002909442 | 376 |
| 652 | 3300028380 | Ga0268265_10269005 | Ga0268265_102690052 | 376 |
| 653 | 3300048925 | Ga0496122_0000383 | Ga0496122_0000383_47060_48286 | 376 |
| 654 | 3300048926 | Ga0496123_0000249 | Ga0496123_0000249_46426_47652 | 376 |
| 655 | iso_pu_bacteria | 2842733646 | 2842736557 | 376 |
| 656 | 3300005335 | Ga0070666_10156126 | Ga0070666_101561261 | 377 |
| 657 | 3300006353 | Ga0075370_10060462 | Ga0075370_100604622 | 378 |
| 658 | 3300048904 | Ga0496101_0016397 | Ga0496101_0016397_392_1627 | 378 |
| 659 | 3300053136 | Ga0500559_0028652 | Ga0500559_0028652_493_1728 | 379 |
| 660 | 3300017792 | Ga0163161_10000112 | Ga0163161_1000011230 | 380 |
| 661 | iso_pu_bacteria | 2842747753 | 2842751811 | 381 |
| 662 | iso_pu_bacteria | 2842677519 | 2842680011 | 382 |
| 663 | iso_pu_bacteria | 2904449895 | 2904455369 | 382 |
| 664 | iso_pu_bacteria | 2904456579 | 2904460537 | 382 |
| 665 | iso_pu_bacteria | 2919462493 | 2919464321 | 382 |
| 666 | iso_pu_bacteria | 2929520902 | 2929524745 | 382 |
| 667 | iso_pu_bacteria | 2945945610 | 2945947140 | 382 |
| 668 | iso_pu_bacteria | 2643221683 | 2644468757 | 383 |
| 669 | iso_pu_bacteria | 2928084124 | 2928085098 | 383 |
| 670 | iso_pu_bacteria | 2904541872 | 2904548518 | 384 |
| 671 | iso_pu_bacteria | 2929160207 | 2929163916 | 384 |
| 672 | iso_pu_bacteria | 2945909444 | 2945912618 | 384 |
| 673 | iso_pu_bacteria | 2945984333 | 2945985095 | 384 |
| 674 | 3300053140 | Ga0500573_0055894 | Ga0500573_0055894_489_1715 | 385 |
| 675 | iso_pu_bacteria | 2513020051 | 2513229919 | 385 |
| 676 | iso_pu_bacteria | 2599185214 | 2599624668 | 385 |
| 677 | iso_pu_bacteria | 2599185226 | 2599672470 | 385 |
| 678 | iso_pu_bacteria | 2599185227 | 2599683470 | 385 |
| 679 | iso_pu_bacteria | 2599185229 | 2599694079 | 385 |
| 680 | iso_pu_bacteria | 2643221672 | 2644398491 | 385 |
| 681 | iso_pu_bacteria | 2738541277 | 2738720063 | 385 |
| 682 | iso_pu_bacteria | 2738543019 | 2739279262 | 385 |
| 683 | iso_pu_bacteria | 2885198086 | 2885201403 | 385 |
| 684 | iso_pu_bacteria | 2885211737 | 2885215017 | 385 |
| 685 | iso_pu_bacteria | 2928070936 | 2928070941 | 385 |
| 686 | 3300006038 | Ga0075365_10035205 | Ga0075365_100352052 | 386 |
| 687 | 3300006048 | Ga0075363_100031238 | Ga0075363_1000312382 | 386 |
| 688 | 3300006051 | Ga0075364_10000869 | Ga0075364_100008698 | 386 |
| 689 | 3300006177 | Ga0075362_10026108 | Ga0075362_100261082 | 386 |
| 690 | 3300006195 | Ga0075366_10001544 | Ga0075366_100015447 | 386 |
| 691 | 3300014497 | Ga0182008_10074379 | Ga0182008_100743791 | 386 |
| 692 | 3300048922 | Ga0496119_0081901 | Ga0496119_0081901_16_1281 | 386 |
| 693 | 3300050491 | nmdc:mga00v17_26459_c1 | nmdc:mga00v17_26459_c1_849_2075 | 386 |
| 694 | 3300050493 | nmdc:mga0k408_7920_c1 | nmdc:mga0k408_7920_c1_4226_5452 | 386 |
| 695 | iso_pu_bacteria | 2818991446 | 2819596056 | 386 |
| 696 | iso_pu_bacteria | 2831265667 | 2831270626 | 386 |
| 697 | iso_pu_bacteria | 2838054893 | 2838056850 | 386 |
| 698 | iso_pu_bacteria | 2899924645 | 2899925406 | 386 |
| 699 | iso_pu_bacteria | 2928037797 | 2928038472 | 386 |
| 700 | iso_pu_bacteria | 2928044640 | 2928045923 | 386 |
| 701 | iso_pu_bacteria | 2928051484 | 2928053598 | 386 |
| 702 | iso_pu_bacteria | 2928064002 | 2928067145 | 386 |
| 703 | 3300003187 | JGI25151J46595_10002663 | JGI25151J46595_100026634 | 387 |
| 704 | 3300017792 | Ga0163161_10017588 | Ga0163161_100175882 | 387 |
| 705 | 3300025258 | Ga0209129_1000953 | Ga0209129_100095316 | 387 |
| 706 | 3300025294 | Ga0209025_1000157 | Ga0209025_1000157137 | 387 |
| 707 | 3300028794 | Ga0307515_10089463 | Ga0307515_100894632 | 387 |
| 708 | 3300046459 | Ga0495629_0127673 | Ga0495629_0127673_109_1338 | 387 |
| 709 | 3300046460 | Ga0495638_0130496 | Ga0495638_0130496_129_1358 | 387 |
| 710 | 3300046513 | Ga0495616_0056455 | Ga0495616_0056455_477_1706 | 387 |
| 711 | 3300046518 | Ga0495631_0001035 | Ga0495631_0001035_11452_12681 | 387 |
| 712 | 3300046525 | Ga0495663_0028520 | Ga0495663_0028520_396_1625 | 387 |
| 713 | 3300046530 | Ga0495654_0014979 | Ga0495654_0014979_2326_3555 | 387 |
| 714 | 3300046539 | Ga0495621_0005626 | Ga0495621_0005626_1869_3098 | 387 |
| 715 | 3300047321 | Ga0495676_0201586 | Ga0495676_0201586_42_1271 | 387 |
| 716 | 3300047673 | Ga0495593_0040256 | Ga0495593_0040256_238_1467 | 387 |
| 717 | 3300048089 | Ga0495614_0009428 | Ga0495614_0009428_1278_2507 | 387 |
| 718 | 3300048924 | Ga0496121_0103589 | Ga0496121_0103589_62_1291 | 387 |
| 719 | 3300048926 | Ga0496123_0087819 | Ga0496123_0087819_387_1616 | 387 |
| 720 | 3300048928 | Ga0496125_0081548 | Ga0496125_0081548_821_2050 | 387 |
| 721 | 3300053087 | Ga0500643_009332 | Ga0500643_009332_572_1801 | 387 |
| 722 | 3300053087 | Ga0500643_026819 | Ga0500643_026819_77_1306 | 387 |
| 723 | 3300053093 | Ga0500651_0004536 | Ga0500651_0004536_3166_4395 | 387 |
| 724 | 3300053110 | Ga0500571_000069 | Ga0500571_000069_10661_11890 | 387 |
| 725 | 3300053118 | Ga0500594_0006047 | Ga0500594_0006047_865_2094 | 387 |
| 726 | 3300053133 | Ga0500655_007412 | Ga0500655_007412_286_1515 | 387 |
| 727 | 3300053134 | Ga0500658_0000431 | Ga0500658_0000431_12191_13420 | 387 |
| 728 | 3300053139 | Ga0500568_0016093 | Ga0500568_0016093_442_1671 | 387 |
| 729 | 3300053161 | Ga0500634_0085113 | Ga0500634_0085113_135_1364 | 387 |
| 730 | 3300003187 | JGI25151J46595_10011420 | JGI25151J46595_100114202 | 388 |
| 731 | 3300025294 | Ga0209025_1002440 | Ga0209025_10024403 | 388 |
| 732 | 3300025298 | Ga0209050_1006373 | Ga0209050_10063732 | 388 |
| 733 | 3300031731 | Ga0307405_10017652 | Ga0307405_100176522 | 388 |
| 734 | 3300048919 | Ga0496116_0055289 | Ga0496116_0055289_396_1625 | 388 |
| 735 | 3300048920 | Ga0496117_0044104 | Ga0496117_0044104_303_1532 | 388 |
| 736 | 3300048924 | Ga0496121_0085261 | Ga0496121_0085261_861_2090 | 388 |
| 737 | 3300003761 | Ga0055535_1000666 | Ga0055535_100066610 | 389 |
| 738 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004263 | 389 |
| 739 | 3300003781 | Ga0055536_1014613 | Ga0055536_10146132 | 389 |
| 740 | 3300003792 | Ga0055540_1001549 | Ga0055540_10015492 | 389 |
| 741 | 3300003794 | Ga0055531_10002149 | Ga0055531_100021492 | 389 |
| 742 | 3300005457 | Ga0070662_100048896 | Ga0070662_1000488962 | 389 |
| 743 | 3300005564 | Ga0070664_100027548 | Ga0070664_1000275485 | 389 |
| 744 | 3300009036 | Ga0105244_10043425 | Ga0105244_100434252 | 389 |
| 745 | 3300009148 | Ga0105243_10006509 | Ga0105243_100065092 | 389 |
| 746 | 3300011119 | Ga0105246_10011450 | Ga0105246_100114503 | 389 |
| 747 | 3300014497 | Ga0182008_10008507 | Ga0182008_100085073 | 389 |
| 748 | 3300015261 | Ga0182006_1012334 | Ga0182006_10123343 | 389 |
| 749 | 3300015262 | Ga0182007_10001268 | Ga0182007_1000126810 | 389 |
| 750 | 3300025229 | Ga0209147_102086 | Ga0209147_1020862 | 389 |
| 751 | 3300025242 | Ga0209258_100022 | Ga0209258_100022263 | 389 |
| 752 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034263 | 389 |
| 753 | 3300025292 | Ga0209676_1001458 | Ga0209676_10014587 | 389 |
| 754 | 3300025298 | Ga0209050_1004848 | Ga0209050_10048484 | 389 |
| 755 | 3300025303 | Ga0209051_1000490 | Ga0209051_100049018 | 389 |
| 756 | 3300025304 | Ga0209257_1000508 | Ga0209257_100050828 | 389 |
| 757 | 3300025728 | Ga0207655_1015186 | Ga0207655_10151863 | 389 |
| 758 | 3300025933 | Ga0207706_10011277 | Ga0207706_100112772 | 389 |
| 759 | 3300025935 | Ga0207709_10001944 | Ga0207709_1000194413 | 389 |
| 760 | 3300025945 | Ga0207679_10145666 | Ga0207679_101456662 | 389 |
| 761 | 3300026041 | Ga0207639_10031709 | Ga0207639_100317093 | 389 |
| 762 | 3300032005 | Ga0307411_10065567 | Ga0307411_100655672 | 389 |
| 763 | 3300048919 | Ga0496116_0015902 | Ga0496116_0015902_1746_2978 | 389 |
| 764 | 3300048921 | Ga0496118_0009975 | Ga0496118_0009975_1245_2477 | 389 |
| 765 | 3300048928 | Ga0496125_0091310 | Ga0496125_0091310_829_2061 | 389 |
| 766 | 3300053079 | Ga0500610_0000129 | Ga0500610_0000129_19536_20771 | 389 |
| 767 | 3300053079 | Ga0500610_0000353 | Ga0500610_0000353_2136_3371 | 389 |
| 768 | 3300053121 | Ga0500607_002984 | Ga0500607_002984_473_1708 | 389 |
| 769 | 3300053158 | Ga0500627_0022641 | Ga0500627_0022641_841_2076 | 389 |
| 770 | 3300053161 | Ga0500634_0038196 | Ga0500634_0038196_675_1910 | 389 |
| 771 | 3300002773 | JGI25152J39213_1003716 | JGI25152J39213_10037164 | 390 |
| 772 | 3300002774 | JGI25150J39212_1000516 | JGI25150J39212_10005167 | 390 |
| 773 | 3300003187 | JGI25151J46595_10004960 | JGI25151J46595_100049605 | 390 |
| 774 | 3300003187 | JGI25151J46595_10008047 | JGI25151J46595_100080474 | 390 |
| 775 | 3300003215 | JGI25153J46596_10008011 | JGI25153J46596_100080114 | 390 |
| 776 | 3300003354 | JGI25160J50197_1007467 | JGI25160J50197_10074672 | 390 |
| 777 | 3300003374 | JGI25161J50226_1002008 | JGI25161J50226_10020084 | 390 |
| 778 | 3300003771 | Ga0055526_1002492 | Ga0055526_10024925 | 390 |
| 779 | 3300003771 | Ga0055526_1004332 | Ga0055526_10043322 | 390 |
| 780 | 3300003773 | Ga0055537_1003180 | Ga0055537_10031804 | 390 |
| 781 | 3300003773 | Ga0055537_1004038 | Ga0055537_10040384 | 390 |
| 782 | 3300003775 | Ga0055524_1001657 | Ga0055524_10016579 | 390 |
| 783 | 3300003775 | Ga0055524_1002900 | Ga0055524_10029002 | 390 |
| 784 | 3300003781 | Ga0055536_1001228 | Ga0055536_10012287 | 390 |
| 785 | 3300003784 | Ga0055534_1002803 | Ga0055534_10028031 | 390 |
| 786 | 3300003784 | Ga0055534_1003292 | Ga0055534_10032922 | 390 |
| 787 | 3300003790 | Ga0055528_1003080 | Ga0055528_10030808 | 390 |
| 788 | 3300003790 | Ga0055528_1008705 | Ga0055528_10087054 | 390 |
| 789 | 3300003791 | Ga0055530_10002436 | Ga0055530_1000243610 | 390 |
| 790 | 3300003792 | Ga0055540_1002782 | Ga0055540_10027825 | 390 |
| 791 | 3300003792 | Ga0055540_1007507 | Ga0055540_10075073 | 390 |
| 792 | 3300003794 | Ga0055531_10002174 | Ga0055531_100021749 | 390 |
| 793 | 3300003794 | Ga0055531_10011070 | Ga0055531_100110702 | 390 |
| 794 | 3300004625 | Ga0055543_1005580 | Ga0055543_10055802 | 390 |
| 795 | 3300005262 | Ga0065165_1007823 | Ga0065165_10078233 | 390 |
| 796 | 3300005262 | Ga0065165_1008247 | Ga0065165_10082472 | 390 |
| 797 | 3300006353 | Ga0075370_10111819 | Ga0075370_101118192 | 390 |
| 798 | 3300025208 | Ga0209436_102418 | Ga0209436_1024185 | 390 |
| 799 | 3300025245 | Ga0207425_1000138 | Ga0207425_100013839 | 390 |
| 800 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023344 | 390 |
| 801 | 3300025258 | Ga0209129_1000558 | Ga0209129_100055824 | 390 |
| 802 | 3300025258 | Ga0209129_1010257 | Ga0209129_10102572 | 390 |
| 803 | 3300025263 | Ga0209565_1000403 | Ga0209565_100040323 | 390 |
| 804 | 3300025263 | Ga0209565_1001326 | Ga0209565_10013269 | 390 |
| 805 | 3300025273 | Ga0209673_1000673 | Ga0209673_100067324 | 390 |
| 806 | 3300025273 | Ga0209673_1000928 | Ga0209673_100092815 | 390 |
| 807 | 3300025273 | Ga0209673_1001532 | Ga0209673_10015329 | 390 |
| 808 | 3300025284 | Ga0209130_1000222 | Ga0209130_100022224 | 390 |
| 809 | 3300025284 | Ga0209130_1000763 | Ga0209130_100076322 | 390 |
| 810 | 3300025291 | Ga0209675_1000600 | Ga0209675_100060018 | 390 |
| 811 | 3300025291 | Ga0209675_1001514 | Ga0209675_10015149 | 390 |
| 812 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005456 | 390 |
| 813 | 3300025292 | Ga0209676_1001885 | Ga0209676_10018855 | 390 |
| 814 | 3300025294 | Ga0209025_1000476 | Ga0209025_100047652 | 390 |
| 815 | 3300025294 | Ga0209025_1014572 | Ga0209025_10145722 | 390 |
| 816 | 3300025295 | Ga0209564_1000400 | Ga0209564_100040049 | 390 |
| 817 | 3300025295 | Ga0209564_1000898 | Ga0209564_100089816 | 390 |
| 818 | 3300025297 | Ga0209758_1000064 | Ga0209758_1000064245 | 390 |
| 819 | 3300025297 | Ga0209758_1027615 | Ga0209758_10276152 | 390 |
| 820 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007641 | 390 |
| 821 | 3300025299 | Ga0209256_1000038 | Ga0209256_1000038321 | 390 |
| 822 | 3300025299 | Ga0209256_1000115 | Ga0209256_100011552 | 390 |
| 823 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011251 | 390 |
| 824 | 3300025302 | Ga0207426_1000785 | Ga0207426_100078510 | 390 |
| 825 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009456 | 390 |
| 826 | 3300025303 | Ga0209051_1009860 | Ga0209051_10098605 | 390 |
| 827 | 3300025303 | Ga0209051_1036657 | Ga0209051_10366571 | 390 |
| 828 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011430 | 390 |
| 829 | 3300025304 | Ga0209257_1004648 | Ga0209257_10046482 | 390 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mhx-assembly1.cif.gz_B | structure of human trpv3 in the presence of 2-apb in c2 symmetry (2) | 0.5992 | 233 | 359 |
| 7xj0-assembly1.cif.gz_A | structure of human trpv3 in complex with trpvicin | 0.5959 | 234 | 357 |
| 7xj0-assembly1.cif.gz_C | structure of human trpv3 in complex with trpvicin | 0.5959 | 234 | 357 |
| 7xj1-assembly1.cif.gz_C | structure of human trpv3_g573s in complex with trpvicin in c2 symmetry | 0.5958 | 234 | 357 |
| 8slx-assembly1.cif.gz_A | rat trpv2 bound with 1 cbd ligand in nanodiscs | 0.5904 | 233 | 357 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVM4_1_215_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.5657 | 195 | 364 | 1.20.950.20 |
| af_Q4DRV6_12_200_1.20.1420.10 | Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain | 0.5568 | 202 | 354 | 1.20.1420.10 |
| af_Q3TQR0_18_241_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5438 | 199 | 375 | 1.20.1070.10 |
| af_Q8MSU3_391_577_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.5419 | 233 | 357 | 1.20.120.1770 |
| af_K7LCP6_14_173_1.20.85.10 | Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like | 0.5252 | 206 | 325 | 1.20.85.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847J9X4-F1-model_v4 | Tricarballylate utilization protein TcuB | 0.9418 | 176 | 390 |
GO:0016020
|
| AF-A0A7G2M127-F1-model_v4 | 4Fe-4S ferredoxin | 0.9411 | 269 | 365 |
GO:0016020
|
| AF-A0A238IZX3-F1-model_v4 | Uncharacterized protein | 0.9301 | 236 | 381 |
GO:0016020
|
| AF-A0A6N6X985-F1-model_v4 | deleted | 0.9266 | 266 | 380 |
|
| AF-A0A4U6MF78-F1-model_v4 | Tricarballylate utilization protein TcuB | 0.9233 | 273 | 371 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar