F482621

General Info

Members Datasets Scaffolds Average Seq Length
829 445 743 381

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0081901|Ga0496119_0081901_16_1281
Length 421
Sequence MRQLEALAQEAQSFTPPQPAMTEQVVTWHGRGAGPASAPVTAEPGALSGDEAEVARVMQICNACRYCEGFCAVFPAMTRRLEFGKADLNYLANLCHNCGACLHACQYAPPHEFAVNVPQAMAQVRMQTYHDYAWPPAMGALYQRAGLTVALALAGGLALFLVLAVAMSGSLLHEPLAGNFYAIFPHNFLALVFGAVFLFVMFALAMGVRRFWREVSPSRDNVPAEVTGVRGAASAEAAQDALRLKYLGGGHGEGCNNEDDRFTLWRRRFHHFTFYGFMLCFASTCVATLYHYLFSLHAPYALTSLPVLLGTAGGIGLVVGPVGLLWLNLRRDPAHGDAAQRPMDRGFIALLLLTSLTGLALLAWRDTPFMALLLAVHLGVVMALFLTLPYGKFAHGIFRSAALLKFAIEKRLPNRLQLGAD

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
6 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
7 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
8 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
9 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
10 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
11 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
12 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
13 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
14 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
15 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
16 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
17 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
18 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
19 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
20 2643221569 Achromobacter sp. Root565 Isolate Unclassified
21 2643221594 Achromobacter sp. Root170 Isolate Unclassified
22 2643221621 Achromobacter sp. Root83 Isolate Unclassified
23 2643221672 Variovorax sp. Root434 Isolate Unclassified
24 2643221683 Variovorax sp. Root473 Isolate Unclassified
25 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
26 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
27 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
28 2738541277 Variovorax sp. GV051 Isolate Unclassified
29 2738543019 Variovorax sp. GV040 Isolate Unclassified
30 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
31 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
32 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
33 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
34 2818991446 Variovorax sp. 1180 Isolate Unclassified
35 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
36 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
37 2842677519 Variovorax sp. R-72495 Isolate Unclassified
38 2842733646 Variovorax sp. R-72446 Isolate Unclassified
39 2842747753 Variovorax sp. R-72060 Isolate Unclassified
40 2855730933 Achromobacter sp. HZ28 Isolate Nodule
41 2855767633 Achromobacter sp. HZ34 Isolate Nodule
42 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
43 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
44 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
45 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
46 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
47 2858950400 Achromobacter sp. K91 Isolate Unclassified
48 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
49 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
50 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
51 2885198086 Variovorax sp. 679 Isolate Unclassified
52 2885211737 Variovorax sp. 553 Isolate Unclassified
53 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
54 2899924645 Variovorax sp. 369 Isolate Unclassified
55 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
56 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
57 2904456579 Variovorax sp. 2002 Isolate Unclassified
58 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
59 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
60 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
61 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
62 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
63 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
64 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
65 2928037797 Variovorax sp. 1126 Isolate Unclassified
66 2928044640 Variovorax sp. 1128 Isolate Unclassified
67 2928051484 Variovorax sp. 1133 Isolate Unclassified
68 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
69 2928070936 Variovorax gossypii 1167 Isolate Unclassified
70 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
71 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
72 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
73 2929520902 Variovorax beijingensis 502 Isolate Unclassified
74 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
75 2941479691
76 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
77 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
78 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
79 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
80 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
81 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
82 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
83 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
84 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
85 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
86 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
87 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
88 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
89 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
90 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
91 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
92 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
93 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
94 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
97 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
98 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
99 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
100 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
101 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
102 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
103 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
104 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
105 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
106 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
109 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
110 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
111 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
112 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
113 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
114 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
115 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
116 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
117 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
118 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
119 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
122 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
123 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
124 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
127 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
128 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
129 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
130 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
131 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
132 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
133 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
134 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
139 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
140 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
141 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
142 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
143 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
144 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
145 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
146 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
147 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
148 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
149 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
150 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
151 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
152 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
153 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
154 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
155 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
156 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
157 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
158 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
159 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
161 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
162 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
163 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
164 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
165 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
168 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
169 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
178 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
179 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
180 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
183 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
184 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
185 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
186 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
187 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
188 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
189 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
194 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
197 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
265 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
266 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
267 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
268 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
269 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
270 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
271 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
272 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
273 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
274 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
277 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
278 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
279 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
280 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
283 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
284 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
285 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
293 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
294 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
295 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
296 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
297 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
298 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
299 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
302 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
303 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
304 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
308 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
309 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
310 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
311 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
312 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
313 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
314 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
319 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
320 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
321 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
322 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
323 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
324 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
325 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
326 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
327 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
328 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
329 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
330 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
331 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
332 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
333 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
334 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
335 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
336 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
339 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
340 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
341 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
342 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
343 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
344 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
345 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
346 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
347 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
348 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
353 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
354 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
355 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
356 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
357 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
358 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
359 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
360 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
361 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
362 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
365 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
366 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
367 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
368 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
369 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
370 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
371 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
386 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
387 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
390 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
391 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
392 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
393 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
394 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
395 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
396 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
397 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
402 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
405 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
406 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
407 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
408 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
409 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
410 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
411 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
412 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
413 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
414 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
415 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
416 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
417 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
418 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
419 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
420 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
421 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
422 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
423 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
424 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
425 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
426 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
427 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
428 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
429 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
430 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
431 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
432 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
433 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
434 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
437 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
440 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
441 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
442 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
443 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
444 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
445 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.51
Metatranscriptomes 0.12
Isolates 10.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 23.16
Nodule 1.09
Rhizoplane 3.5
Rhizosphere 57.9
Stem 0
Stem Tuber 0
Unclassified 14.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003716 3300002773 Bacteria 5110
2 JGI25150J39212_1000516 3300002774 Bacteria 15942
3 JGI25151J46595_10000493 3300003187 Bacteria 37285
4 JGI25151J46595_10002663 3300003187 Bacteria 10475
5 JGI25151J46595_10004960 3300003187 Bacteria 6945
6 JGI25151J46595_10008047 3300003187 Bacteria 5110
7 JGI25151J46595_10011420 3300003187 Bacteria 4082
8 JGI25153J46596_10008011 3300003215 Bacteria 5110
9 rootH1_10035044 3300003316 Bacteria 3297
10 JGI25160J50197_1007467 3300003354 Bacteria 4273
11 JGI25161J50226_1002008 3300003374 Bacteria 5558
12 Ga0006562J51391_1181768 3300003578 Bacteria 6099
13 Ga0055532_1000162 3300003758 Bacteria 58304
14 Ga0055532_1002676 3300003758 Bacteria 3506
15 Ga0055532_1002682 3300003758 Bacteria 3497
16 Ga0055527_1000110 3300003760 Bacteria 58304
17 Ga0055527_1000469 3300003760 Bacteria 15440
18 Ga0055535_1000235 3300003761 Bacteria 58304
19 Ga0055535_1000666 3300003761 Bacteria 27110
20 Ga0055535_1001165 3300003761 Bacteria 15440
21 Ga0055542_1000004 3300003762 Bacteria 553532
22 Ga0055542_1000894 3300003762 Bacteria 20391
23 Ga0055529_1002573 3300003763 Bacteria 3403
24 Ga0055526_1002492 3300003771 Bacteria 12423
25 Ga0055526_1004332 3300003771 Bacteria 8568
26 Ga0055537_1003180 3300003773 Bacteria 5133
27 Ga0055537_1004038 3300003773 Bacteria 4309
28 Ga0055524_1001657 3300003775 Bacteria 12422
29 Ga0055524_1002900 3300003775 Bacteria 8568
30 Ga0055536_1001228 3300003781 Bacteria 15847
31 Ga0055536_1002068 3300003781 Bacteria 11462
32 Ga0055536_1014613 3300003781 Bacteria 2740
33 Ga0055534_1002803 3300003784 Bacteria 5819
34 Ga0055534_1003292 3300003784 Bacteria 5133
35 Ga0055528_1003080 3300003790 Bacteria 8568
36 Ga0055528_1008705 3300003790 Bacteria 4309
37 Ga0055530_10002436 3300003791 Bacteria 12014
38 Ga0055540_1001549 3300003792 Bacteria 13470
39 Ga0055540_1002782 3300003792 Bacteria 8960
40 Ga0055540_1002909 3300003792 Bacteria 8662
41 Ga0055540_1004067 3300003792 Bacteria 6782
42 Ga0055540_1007507 3300003792 Bacteria 4098
43 Ga0055531_10001837 3300003794 Bacteria 14985
44 Ga0055531_10002149 3300003794 Bacteria 13468
45 Ga0055531_10002174 3300003794 Bacteria 13396
46 Ga0055531_10011070 3300003794 Bacteria 4402
47 Ga0058692_1000027 3300003856 Bacteria 198745
48 Ga0055543_1005580 3300004625 Bacteria 3186
49 Ga0065165_1002663 3300005262 Bacteria 14420
50 Ga0065165_1007823 3300005262 Bacteria 5145
51 Ga0065165_1008247 3300005262 Bacteria 4924
52 Ga0065165_1018420 3300005262 Bacteria 2527
53 Ga0065703_1000152 3300005272 Bacteria 30747
54 Ga0065714_10006453 3300005288 Bacteria 6231
55 Ga0065714_10011224 3300005288 Bacteria 1980
56 Ga0065704_10086279 3300005289 Bacteria 3136
57 Ga0065704_10106726 3300005289 Bacteria 2075
58 Ga0070676_10005423 3300005328 Bacteria 6797
59 Ga0070676_10087194 3300005328 Bacteria 1905
60 Ga0070690_100032788 3300005330 Bacteria 3247
61 Ga0070690_100116095 3300005330 Bacteria 1792
62 Ga0070670_100018686 3300005331 Bacteria 5941
63 Ga0070677_10009009 3300005333 Bacteria 3375
64 Ga0068869_100001131 3300005334 Bacteria 15567
65 Ga0068869_100019255 3300005334 Bacteria 4659
66 Ga0070666_10001072 3300005335 Bacteria 16709
67 Ga0070666_10088331 3300005335 Bacteria 2126
68 Ga0070666_10156126 3300005335 Bacteria 1593
69 Ga0068868_100000885 3300005338 Bacteria 20333
70 Ga0068868_100004002 3300005338 Bacteria 10288
71 Ga0068868_100160625 3300005338 Bacteria 1855
72 Ga0070660_100000588 3300005339 Bacteria 24352
73 Ga0070661_100060140 3300005344 Bacteria 2788
74 Ga0070668_100017566 3300005347 Bacteria 5364
75 Ga0070668_100038500 3300005347 Bacteria 3655
76 Ga0070669_100001876 3300005353 Bacteria 15148
77 Ga0070669_100004206 3300005353 Bacteria 10416
78 Ga0070669_100027787 3300005353 Bacteria 4072
79 Ga0070669_100045554 3300005353 Bacteria 3197
80 Ga0070675_100000052 3300005354 Bacteria 71092
81 Ga0070675_100225138 3300005354 Bacteria 1634
82 Ga0070671_100011579 3300005355 Bacteria 7095
83 Ga0070674_100002148 3300005356 Bacteria 10823
84 Ga0070673_100019238 3300005364 Bacteria 4901
85 Ga0070673_100107944 3300005364 Bacteria 2303
86 Ga0070688_100194930 3300005365 Bacteria 1414
87 Ga0070659_100000038 3300005366 Bacteria 110675
88 Ga0070659_100274328 3300005366 Bacteria 1402
89 Ga0070667_100010800 3300005367 Bacteria 7545
90 Ga0070667_100036506 3300005367 Bacteria 4120
91 Ga0070667_100088929 3300005367 Bacteria 2653
92 Ga0070667_100109657 3300005367 Bacteria 2392
93 Ga0070705_100034668 3300005440 Bacteria 2823
94 Ga0070700_100153772 3300005441 Bacteria 1576
95 Ga0070663_100002734 3300005455 Bacteria 9991
96 Ga0070678_100083782 3300005456 Bacteria 2425
97 Ga0070678_100085278 3300005456 Bacteria 2406
98 Ga0070662_100033964 3300005457 Bacteria 3595
99 Ga0070662_100048896 3300005457 Bacteria 3048
100 Ga0070662_100069141 3300005457 Bacteria 2598
101 Ga0070662_100096915 3300005457 Bacteria 2225
102 Ga0068867_100006169 3300005459 Bacteria 8483
103 Ga0068867_100047218 3300005459 Bacteria 3165
104 Ga0068867_100061352 3300005459 Bacteria 2791
105 Ga0068867_100213037 3300005459 Bacteria 1553
106 Ga0070685_10020978 3300005466 Bacteria 3544
107 Ga0070685_10209480 3300005466 Bacteria 1271
108 Ga0070706_100114580 3300005467 Bacteria 2510
109 Ga0070698_100164235 3300005471 Bacteria 2163
110 Ga0068853_100040352 3300005539 Bacteria 3983
111 Ga0068853_100329346 3300005539 Bacteria 1417
112 Ga0070672_100000701 3300005543 Bacteria 19832
113 Ga0070672_100226888 3300005543 Bacteria 1568
114 Ga0070686_100029030 3300005544 Bacteria 3360
115 Ga0070665_100008004 3300005548 Bacteria 10706
116 Ga0068855_100067985 3300005563 Bacteria 4149
117 Ga0068855_100223997 3300005563 Bacteria 2108
118 Ga0068855_100289032 3300005563 Bacteria 1818
119 Ga0070664_100027548 3300005564 Bacteria 4722
120 Ga0070664_100205423 3300005564 Bacteria 1759
121 Ga0068852_100011891 3300005616 Bacteria 6582
122 Ga0068852_100027025 3300005616 Bacteria 4672
123 Ga0068852_100031259 3300005616 Bacteria 4391
124 Ga0068852_100328194 3300005616 Bacteria 1488
125 Ga0068859_100003350 3300005617 Bacteria 16303
126 Ga0068859_100031712 3300005617 Bacteria 5307
127 Ga0068859_100240371 3300005617 Bacteria 1900
128 Ga0068864_100001554 3300005618 Bacteria 18908
129 Ga0068864_100009096 3300005618 Bacteria 8189
130 Ga0068864_100023527 3300005618 Bacteria 5174
131 Ga0068866_10001392 3300005718 Bacteria 10426
132 Ga0068866_10013798 3300005718 Bacteria 3553
133 Ga0068861_100001224 3300005719 Bacteria 15979
134 Ga0068861_100027008 3300005719 Bacteria 4178
135 Ga0068861_100034174 3300005719 Bacteria 3758
136 Ga0068861_100095333 3300005719 Bacteria 2356
137 Ga0068863_100001886 3300005841 Bacteria 20819
138 Ga0068863_100002851 3300005841 Bacteria 17124
139 Ga0068858_100000312 3300005842 Bacteria 51731
140 Ga0068858_100001000 3300005842 Bacteria 29221
141 Ga0068858_100034439 3300005842 Bacteria 4698
142 Ga0068860_100001048 3300005843 Bacteria 30480
143 Ga0068860_100006491 3300005843 Bacteria 11745
144 Ga0068860_100236303 3300005843 Bacteria 1777
145 Ga0068862_100028430 3300005844 Bacteria 4708
146 Ga0068862_100037636 3300005844 Bacteria 4101
147 Ga0068862_100185416 3300005844 Bacteria 1869
148 Ga0068862_100290944 3300005844 Bacteria 1500
149 Ga0075365_10003966 3300006038 Bacteria 7751
150 Ga0075365_10035205 3300006038 Bacteria 3238
151 Ga0075368_10011398 3300006042 Bacteria 3233
152 Ga0075363_100019723 3300006048 Bacteria 3374
153 Ga0075363_100031238 3300006048 Bacteria 2760
154 Ga0075364_10000869 3300006051 Bacteria 15941
155 Ga0075364_10009415 3300006051 Bacteria 5860
156 Ga0075364_10041760 3300006051 Bacteria 2979
157 Ga0075364_10175781 3300006051 Bacteria 1448
158 Ga0075432_10005731 3300006058 Bacteria 4229
159 Ga0075362_10004798 3300006177 Bacteria 4883
160 Ga0075362_10026108 3300006177 Bacteria 2492
161 Ga0075367_10011041 3300006178 Bacteria 4764
162 Ga0075369_10000645 3300006186 Bacteria 11097
163 Ga0075369_10003695 3300006186 Bacteria 5592
164 Ga0075366_10001544 3300006195 Bacteria 11516
165 Ga0075366_10051788 3300006195 Bacteria 2439
166 Ga0097621_100009557 3300006237 Bacteria 7047
167 Ga0075370_10060462 3300006353 Bacteria 2158
168 Ga0075370_10111819 3300006353 Bacteria 1586
169 Ga0068871_100004541 3300006358 Bacteria 9677
170 Ga0068871_100041352 3300006358 Bacteria 3696
171 Ga0068865_100002084 3300006881 Bacteria 11817
172 Ga0068865_100024466 3300006881 Bacteria 3962
173 Ga0068865_100133914 3300006881 Bacteria 1859
174 Ga0097620_100003350 3300006931 Bacteria 16303
175 Ga0097620_100031712 3300006931 Bacteria 5307
176 Ga0097620_100240368 3300006931 Bacteria 1900
177 Ga0105244_10000640 3300009036 Bacteria 30838
178 Ga0105244_10009231 3300009036 Bacteria 6083
179 Ga0105244_10043425 3300009036 Bacteria 2319
180 Ga0105250_10001390 3300009092 Bacteria 13081
181 Ga0105240_10000553 3300009093 Bacteria 69247
182 Ga0105240_10022111 3300009093 Bacteria 8440
183 Ga0105240_10028605 3300009093 Bacteria 7275
184 Ga0105240_10469942 3300009093 Bacteria 1404
185 Ga0105245_10033391 3300009098 Bacteria 4561
186 Ga0105245_10064850 3300009098 Bacteria 3302
187 Ga0105247_10000221 3300009101 Bacteria 54565
188 Ga0105243_10000020 3300009148 Bacteria 214279
189 Ga0105243_10000343 3300009148 Bacteria 50175
190 Ga0105243_10006509 3300009148 Bacteria 9031
191 Ga0105243_10016686 3300009148 Bacteria 5552
192 Ga0105243_10077502 3300009148 Bacteria 2703
193 Ga0105243_10240189 3300009148 Bacteria 1612
194 Ga0105248_10003174 3300009177 Bacteria 18211
195 Ga0105248_10081641 3300009177 Bacteria 3634
196 Ga0105248_10175872 3300009177 Bacteria 2412
197 Ga0105237_10006553 3300009545 Bacteria 12878
198 Ga0105237_10384795 3300009545 Bacteria 1408
199 Ga0105238_10009733 3300009551 Bacteria 9625
200 Ga0105249_10009083 3300009553 Bacteria 8691
201 Ga0105249_10074259 3300009553 Bacteria 3147
202 Ga0105249_10090429 3300009553 Bacteria 2862
203 Ga0105239_10022668 3300010375 Bacteria 6922
204 Ga0105246_10000031 3300011119 Bacteria 52056
205 Ga0105246_10011288 3300011119 Bacteria 5543
206 Ga0105246_10011450 3300011119 Bacteria 5504
207 Ga0157371_10087744 3300013102 Bacteria 2203
208 Ga0157369_10028090 3300013105 Bacteria 6229
209 Ga0157374_10063727 3300013296 Bacteria 3457
210 Ga0157378_10008090 3300013297 Bacteria 9177
211 Ga0157378_10154427 3300013297 Bacteria 2141
212 Ga0163162_10000998 3300013306 Bacteria 26303
213 Ga0163162_10003327 3300013306 Bacteria 15381
214 Ga0163162_10010534 3300013306 Bacteria 8992
215 Ga0163162_10017500 3300013306 Bacteria 7012
216 Ga0163162_10023284 3300013306 Bacteria 6111
217 Ga0163162_10030016 3300013306 Bacteria 5384
218 Ga0157375_10004479 3300013308 Bacteria 12137
219 Ga0157375_10009254 3300013308 Bacteria 8644
220 Ga0157375_10030818 3300013308 Bacteria 5063
221 Ga0157375_10140549 3300013308 Bacteria 2541
222 Ga0157375_10290384 3300013308 Bacteria 1798
223 Ga0157375_10308863 3300013308 Bacteria 1746
224 Ga0157375_10422314 3300013308 Bacteria 1499
225 Ga0163163_10001116 3300014325 Bacteria 22834
226 Ga0163163_10113694 3300014325 Bacteria 2737
227 Ga0163163_10260526 3300014325 Bacteria 1785
228 Ga0157380_10002558 3300014326 Bacteria 12287
229 Ga0157380_10032362 3300014326 Bacteria 4022
230 Ga0182008_10000316 3300014497 Bacteria 37971
231 Ga0182008_10008507 3300014497 Bacteria 5604
232 Ga0182008_10074379 3300014497 Bacteria 1672
233 Ga0157379_10001049 3300014968 Bacteria 22458
234 Ga0157379_10026574 3300014968 Bacteria 5152
235 Ga0182006_1012334 3300015261 Bacteria 3736
236 Ga0182007_10001268 3300015262 Bacteria 13720
237 Ga0163161_10000112 3300017792 Bacteria 77235
238 Ga0163161_10003777 3300017792 Bacteria 10610
239 Ga0163161_10017588 3300017792 Bacteria 5005
240 Ga0163161_10044730 3300017792 Bacteria 3190
241 Ga0163161_10048349 3300017792 Bacteria 3072
242 Ga0163161_10055885 3300017792 Bacteria 2866
243 Ga0163161_10085888 3300017792 Bacteria 2322
244 Ga0163161_10096833 3300017792 Bacteria 2191
245 Ga0209436_102418 3300025208 Bacteria 5638
246 Ga0209672_100023 3300025228 Bacteria 371758
247 Ga0209672_100059 3300025228 Bacteria 209692
248 Ga0209672_101446 3300025228 Bacteria 8496
249 Ga0209147_100072 3300025229 Bacteria 209692
250 Ga0209147_100094 3300025229 Bacteria 167145
251 Ga0209147_100534 3300025229 Bacteria 21873
252 Ga0209147_102086 3300025229 Bacteria 5616
253 Ga0209258_100022 3300025242 Bacteria 553584
254 Ga0209258_100102 3300025242 Bacteria 209692
255 Ga0209258_100142 3300025242 Bacteria 165865
256 Ga0209258_106361 3300025242 Bacteria 1861
257 Ga0207425_1000138 3300025245 Bacteria 65477
258 Ga0209677_100180 3300025253 Bacteria 53251
259 Ga0209148_1000034 3300025254 Bacteria 553584
260 Ga0209148_1000404 3300025254 Bacteria 50146
261 Ga0209148_1001094 3300025254 Bacteria 16351
262 Ga0209759_1001212 3300025256 Bacteria 15888
263 Ga0209129_1000023 3300025258 Bacteria 420646
264 Ga0209129_1000558 3300025258 Bacteria 25653
265 Ga0209129_1000953 3300025258 Bacteria 17414
266 Ga0209129_1010257 3300025258 Bacteria 2361
267 Ga0209233_1004721 3300025261 Bacteria 4593
268 Ga0209565_1000403 3300025263 Bacteria 36050
269 Ga0209565_1001326 3300025263 Bacteria 11331
270 Ga0209455_1000385 3300025272 Bacteria 39421
271 Ga0209455_1000398 3300025272 Bacteria 37150
272 Ga0209455_1000634 3300025272 Bacteria 21681
273 Ga0209673_1000673 3300025273 Bacteria 49581
274 Ga0209673_1000928 3300025273 Bacteria 36961
275 Ga0209673_1001532 3300025273 Bacteria 21046
276 Ga0209673_1003066 3300025273 Bacteria 10280
277 Ga0209130_1000222 3300025284 Bacteria 74607
278 Ga0209130_1000763 3300025284 Bacteria 27891
279 Ga0209675_1000600 3300025291 Bacteria 25848
280 Ga0209675_1001514 3300025291 Bacteria 13290
281 Ga0209676_1000005 3300025292 Bacteria 1076001
282 Ga0209676_1000595 3300025292 Bacteria 53773
283 Ga0209676_1001458 3300025292 Bacteria 22149
284 Ga0209676_1001885 3300025292 Bacteria 17116
285 Ga0209025_1000018 3300025294 Bacteria 686898
286 Ga0209025_1000157 3300025294 Bacteria 168790
287 Ga0209025_1000476 3300025294 Bacteria 77754
288 Ga0209025_1002440 3300025294 Bacteria 19709
289 Ga0209025_1014572 3300025294 Bacteria 4819
290 Ga0209564_1000400 3300025295 Bacteria 77039
291 Ga0209564_1000500 3300025295 Bacteria 64540
292 Ga0209564_1000898 3300025295 Bacteria 39109
293 Ga0209758_1000064 3300025297 Bacteria 311812
294 Ga0209758_1027615 3300025297 Bacteria 2420
295 Ga0209050_1000007 3300025298 Bacteria 1187891
296 Ga0209050_1001787 3300025298 Bacteria 21163
297 Ga0209050_1004848 3300025298 Bacteria 8830
298 Ga0209050_1006373 3300025298 Bacteria 7002
299 Ga0209256_1000038 3300025299 Bacteria 375225
300 Ga0209256_1000115 3300025299 Bacteria 173607
301 Ga0207426_1000001 3300025302 Bacteria 1341301
302 Ga0207426_1000785 3300025302 Bacteria 34741
303 Ga0209051_1000009 3300025303 Bacteria 706778
304 Ga0209051_1000369 3300025303 Bacteria 64656
305 Ga0209051_1000490 3300025303 Bacteria 51070
306 Ga0209051_1000787 3300025303 Bacteria 33471
307 Ga0209051_1001013 3300025303 Bacteria 26927
308 Ga0209051_1009860 3300025303 Bacteria 4884
309 Ga0209051_1036657 3300025303 Bacteria 1808
310 Ga0209257_1000011 3300025304 Bacteria 1112630
311 Ga0209257_1000317 3300025304 Bacteria 101723
312 Ga0209257_1000508 3300025304 Bacteria 68156
313 Ga0209257_1004648 3300025304 Bacteria 10373
314 Ga0209257_1006472 3300025304 Bacteria 7520
315 Ga0207696_1003494 3300025711 Bacteria 7123
316 Ga0207696_1008402 3300025711 Bacteria 3953
317 Ga0207655_1000098 3300025728 Bacteria 190699
318 Ga0207655_1000687 3300025728 Bacteria 39384
319 Ga0207655_1000755 3300025728 Bacteria 36265
320 Ga0207655_1010657 3300025728 Bacteria 5558
321 Ga0207655_1015186 3300025728 Bacteria 4298
322 Ga0207655_1031674 3300025728 Bacteria 2432
323 Ga0207713_1001757 3300025735 Bacteria 16631
324 Ga0207713_1030788 3300025735 Bacteria 2385
325 Ga0207682_10002802 3300025893 Bacteria 7710
326 Ga0207682_10036883 3300025893 Bacteria 1979
327 Ga0207682_10047107 3300025893 Bacteria 1774
328 Ga0207642_10056071 3300025899 Bacteria 1806
329 Ga0207710_10000057 3300025900 Bacteria 177544
330 Ga0207688_10086733 3300025901 Bacteria 1794
331 Ga0207680_10175460 3300025903 Bacteria 1446
332 Ga0207645_10017116 3300025907 Bacteria 4788
333 Ga0207645_10023668 3300025907 Bacteria 3988
334 Ga0207645_10130883 3300025907 Bacteria 1633
335 Ga0207684_10005739 3300025910 Bacteria 11396
336 Ga0207695_10000912 3300025913 Bacteria 53029
337 Ga0207695_10029742 3300025913 Bacteria 6028
338 Ga0207695_10142170 3300025913 Bacteria 2347
339 Ga0207671_10045264 3300025914 Bacteria 3254
340 Ga0207662_10048198 3300025918 Bacteria 2523
341 Ga0207657_10000063 3300025919 Bacteria 100065
342 Ga0207681_10000308 3300025923 Bacteria 35918
343 Ga0207681_10000821 3300025923 Bacteria 20470
344 Ga0207694_10017805 3300025924 Bacteria 5370
345 Ga0207650_10001370 3300025925 Bacteria 17590
346 Ga0207659_10015718 3300025926 Bacteria 4913
347 Ga0207687_10073307 3300025927 Bacteria 2451
348 Ga0207644_10338194 3300025931 Bacteria 1220
349 Ga0207690_10000025 3300025932 Bacteria 179019
350 Ga0207690_10092910 3300025932 Bacteria 2136
351 Ga0207706_10011277 3300025933 Bacteria 8145
352 Ga0207706_10062189 3300025933 Bacteria 3288
353 Ga0207706_10063353 3300025933 Bacteria 3255
354 Ga0207706_10076233 3300025933 Bacteria 2949
355 Ga0207686_10093888 3300025934 Bacteria 1987
356 Ga0207709_10000004 3300025935 Bacteria 825156
357 Ga0207709_10000057 3300025935 Bacteria 216617
358 Ga0207709_10000768 3300025935 Bacteria 25259
359 Ga0207709_10001944 3300025935 Bacteria 13527
360 Ga0207709_10089856 3300025935 Bacteria 2004
361 Ga0207670_10237078 3300025936 Bacteria 1404
362 Ga0207669_10073142 3300025937 Bacteria 2161
363 Ga0207704_10005851 3300025938 Bacteria 5690
364 Ga0207691_10027277 3300025940 Bacteria 5357
365 Ga0207691_10028559 3300025940 Bacteria 5221
366 Ga0207691_10059490 3300025940 Bacteria 3473
367 Ga0207691_10088308 3300025940 Bacteria 2780
368 Ga0207691_10135734 3300025940 Bacteria 2170
369 Ga0207711_10001139 3300025941 Bacteria 25374
370 Ga0207711_10030653 3300025941 Bacteria 4537
371 Ga0207689_10002245 3300025942 Bacteria 18103
372 Ga0207689_10023495 3300025942 Bacteria 5173
373 Ga0207679_10145666 3300025945 Bacteria 1920
374 Ga0207667_10002610 3300025949 Bacteria 22346
375 Ga0207667_10037909 3300025949 Bacteria 5151
376 Ga0207651_10001026 3300025960 Bacteria 12333
377 Ga0207651_10018646 3300025960 Bacteria 4136
378 Ga0207651_10196028 3300025960 Bacteria 1615
379 Ga0207668_10079683 3300025972 Bacteria 2370
380 Ga0207658_10000495 3300025986 Bacteria 36167
381 Ga0207658_10066451 3300025986 Bacteria 2712
382 Ga0207677_10022286 3300026023 Bacteria 3890
383 Ga0207677_10168164 3300026023 Bacteria 1711
384 Ga0207703_10000414 3300026035 Bacteria 45564
385 Ga0207703_10001421 3300026035 Bacteria 21841
386 Ga0207703_10052657 3300026035 Bacteria 3306
387 Ga0207639_10003076 3300026041 Bacteria 11213
388 Ga0207639_10031709 3300026041 Bacteria 3886
389 Ga0207678_10003127 3300026067 Bacteria 14982
390 Ga0207678_10101396 3300026067 Bacteria 2458
391 Ga0207678_10217122 3300026067 Bacteria 1636
392 Ga0207678_10295625 3300026067 Bacteria 1391
393 Ga0207641_10000615 3300026088 Bacteria 38942
394 Ga0207641_10002352 3300026088 Bacteria 17480
395 Ga0207641_10429515 3300026088 Bacteria 1273
396 Ga0207648_10005514 3300026089 Bacteria 12756
397 Ga0207648_10024226 3300026089 Bacteria 5422
398 Ga0207648_10043439 3300026089 Bacteria 3945
399 Ga0207648_10061792 3300026089 Bacteria 3266
400 Ga0207648_10067585 3300026089 Bacteria 3115
401 Ga0207648_10100166 3300026089 Bacteria 2538
402 Ga0207648_10273811 3300026089 Bacteria 1508
403 Ga0207676_10001317 3300026095 Bacteria 18460
404 Ga0207676_10110171 3300026095 Bacteria 2302
405 Ga0207674_10053254 3300026116 Bacteria 4125
406 Ga0207675_100003069 3300026118 Bacteria 16383
407 Ga0207675_100005031 3300026118 Bacteria 12728
408 Ga0207675_100018840 3300026118 Bacteria 6441
409 Ga0207675_100129547 3300026118 Bacteria 2392
410 Ga0207683_10002265 3300026121 Bacteria 16869
411 Ga0207683_10014063 3300026121 Bacteria 6823
412 Ga0207683_10033430 3300026121 Bacteria 4466
413 Ga0207683_10049515 3300026121 Bacteria 3679
414 Ga0207698_10008619 3300026142 Bacteria 6459
415 Ga0207698_10188848 3300026142 Bacteria 1833
416 Ga0209371_1000074 3300027312 Bacteria 198823
417 Ga0209813_10012910 3300027866 Bacteria 2219
418 Ga0268266_10070330 3300028379 Bacteria 3032
419 Ga0268265_10012608 3300028380 Bacteria 5732
420 Ga0268265_10031470 3300028380 Bacteria 3831
421 Ga0268265_10100728 3300028380 Bacteria 2332
422 Ga0268265_10269005 3300028380 Bacteria 1519
423 Ga0268264_10000780 3300028381 Bacteria 35025
424 Ga0268264_10001577 3300028381 Bacteria 21132
425 Ga0307515_10000049 3300028794 Bacteria 278611
426 Ga0307515_10000658 3300028794 Bacteria 79766
427 Ga0307515_10001006 3300028794 Bacteria 64436
428 Ga0307515_10029059 3300028794 Bacteria 9364
429 Ga0307515_10089463 3300028794 Bacteria 3876
430 Ga0265338_10002421 3300028800 Bacteria 28057
431 Ga0268256_1000067 3300030500 Bacteria 198823
432 Ga0307511_10000485 3300030521 Bacteria 42928
433 Ga0316177_1038652 3300030731 Bacteria 7631
434 Ga0316176_1212641 3300030732 Bacteria 2150
435 Ga0314311_1250941 3300030733 Bacteria 12243
436 Ga0316178_1183912 3300030735 Bacteria 7997
437 Ga0316180_1159745 3300030736 Bacteria 1650
438 Ga0316183_1085212 3300030742 Bacteria 2380
439 Ga0316181_1093548 3300030744 Bacteria 6655
440 Ga0265332_10000027 3300031238 Bacteria 190796
441 Ga0307513_10000034 3300031456 Bacteria 185012
442 Ga0307513_10012028 3300031456 Bacteria 10709
443 Ga0307509_10078280 3300031507 Bacteria 3426
444 Ga0307408_100016284 3300031548 Bacteria 4960
445 Ga0307516_10003466 3300031730 Bacteria 20215
446 Ga0307405_10017652 3300031731 Bacteria 3921
447 Ga0307405_10161809 3300031731 Bacteria 1586
448 Ga0307405_10163598 3300031731 Bacteria 1579
449 Ga0307406_10000822 3300031901 Bacteria 17415
450 Ga0307412_10000129 3300031911 Bacteria 55318
451 Ga0307412_10005492 3300031911 Bacteria 7119
452 Ga0307412_10059873 3300031911 Bacteria 2554
453 Ga0307412_10135580 3300031911 Bacteria 1795
454 Ga0307411_10065567 3300032005 Bacteria 2436
455 Ga0307507_10020829 3300033179 Bacteria 7325
456 Ga0373955_0052098 3300035172 Bacteria 2232
457 Ga0373937_0057331 3300036401 Bacteria 3578
458 Ga0395899_0035639 3300037312 Bacteria 3734
459 Ga0395900_0012763 3300037418 Bacteria 8586
460 Ga0395900_0083050 3300037418 Bacteria 3291
461 Ga0395900_0118912 3300037418 Bacteria 2712
462 Ga0395898_0031026 3300037466 Bacteria 5345
463 Ga0395898_0119398 3300037466 Bacteria 2526
464 Ga0395905_0000963 3300037471 Bacteria 36996
465 Ga0395905_0047336 3300037471 Bacteria 4031
466 Ga0395905_0223151 3300037471 Bacteria 1763
467 Ga0395901_0005950 3300038443 Bacteria 12352
468 Ga0395901_0027834 3300038443 Bacteria 5812
469 Ga0439447_011098 3300041407 Bacteria 2645
470 Ga0439466_0013209 3300041411 Bacteria 3025
471 Ga0439432_047533 3300042006 Bacteria 1346
472 Ga0450911_000549 3300042115 Bacteria 11658
473 Ga0450920_000742 3300042122 Bacteria 5258
474 Ga0450903_001624 3300042138 Bacteria 4181
475 Ga0450893_0005595 3300042532 Bacteria 2019
476 Ga0451577_0152810 3300042876 Bacteria 2077
477 Ga0453683_0011381 3300044673 Bacteria 5862
478 Ga0466965_0175946 3300044683 Bacteria 1127
479 Ga0453684_0017188 3300044712 Bacteria 11235
480 Ga0466968_0018100 3300044735 Bacteria 2824
481 Ga0466970_0006300 3300044765 Bacteria 5926
482 Ga0466960_0147607 3300044901 Bacteria 1254
483 Ga0466959_0001542 3300045049 Bacteria 14167
484 Ga0466959_0115238 3300045049 Bacteria 1915
485 Ga0451576_0006640 3300045051 Bacteria 14132
486 Ga0451576_0250992 3300045051 Bacteria 1849
487 Ga0466958_0157360 3300045836 Bacteria 1434
488 Ga0466967_0119783 3300045976 Bacteria 2430
489 Ga0495617_013070 3300046452 Bacteria 2828
490 Ga0495627_043010 3300046453 Bacteria 1382
491 Ga0495629_0079421 3300046459 Bacteria 2291
492 Ga0495629_0127673 3300046459 Bacteria 1772
493 Ga0495629_0136179 3300046459 Bacteria 1710
494 Ga0495638_0000537 3300046460 Bacteria 43749
495 Ga0495638_0130496 3300046460 Bacteria 1476
496 Ga0495653_0112344 3300046463 Bacteria 1955
497 Ga0495580_0035293 3300046472 Bacteria 3596
498 Ga0495580_0131156 3300046472 Bacteria 1738
499 Ga0495605_0000848 3300046474 Bacteria 21346
500 Ga0495585_0051193 3300046492 Bacteria 2289
501 Ga0495585_0112495 3300046492 Bacteria 1446
502 Ga0495596_0038054 3300046500 Bacteria 1902
503 Ga0495607_0000501 3300046501 Bacteria 39192
504 Ga0495606_0049368 3300046507 Bacteria 2760
505 Ga0495610_0036035 3300046512 Bacteria 2533
506 Ga0495610_0083231 3300046512 Bacteria 1465
507 Ga0495616_0056455 3300046513 Bacteria 1939
508 Ga0495616_0067432 3300046513 Bacteria 1739
509 Ga0495620_0016498 3300046515 Bacteria 3702
510 Ga0495628_0003869 3300046516 Bacteria 13338
511 Ga0495630_0062548 3300046517 Bacteria 2796
512 Ga0495630_0079323 3300046517 Bacteria 2476
513 Ga0495631_0001035 3300046518 Bacteria 17254
514 Ga0495632_0036707 3300046519 Bacteria 2491
515 Ga0495632_0080090 3300046519 Bacteria 1558
516 Ga0495632_0126798 3300046519 Bacteria 1189
517 Ga0495637_0048836 3300046520 Bacteria 1780
518 Ga0495643_0026180 3300046522 Bacteria 3294
519 Ga0495643_0051401 3300046522 Bacteria 2216
520 Ga0495644_0002111 3300046523 Bacteria 7989
521 Ga0495648_0010582 3300046524 Bacteria 7014
522 Ga0495663_0028520 3300046525 Bacteria 1644
523 Ga0495666_0009465 3300046526 Bacteria 4869
524 Ga0495666_0012854 3300046526 Bacteria 4173
525 Ga0495654_0004411 3300046530 Bacteria 8358
526 Ga0495654_0014979 3300046530 Bacteria 4121
527 Ga0495654_0137897 3300046530 Bacteria 1089
528 Ga0495587_0000479 3300046536 Bacteria 27722
529 Ga0495609_0013875 3300046538 Bacteria 3798
530 Ga0495621_0005626 3300046539 Bacteria 3615
531 Ga0495621_0033574 3300046539 Bacteria 1769
532 Ga0495621_0034102 3300046539 Bacteria 1757
533 Ga0495597_0007304 3300046542 Bacteria 5628
534 Ga0495597_0050143 3300046542 Bacteria 1843
535 Ga0495645_0021607 3300046543 Bacteria 4651
536 Ga0495622_0024167 3300046557 Bacteria 2837
537 Ga0495622_0029261 3300046557 Bacteria 2574
538 Ga0495622_0042417 3300046557 Bacteria 2115
539 Ga0495633_0000091 3300046558 Bacteria 122383
540 Ga0495633_0000612 3300046558 Bacteria 33866
541 Ga0495668_0034669 3300046616 Bacteria 2830
542 Ga0495668_0103705 3300046616 Bacteria 1556
543 Ga0495634_0000025 3300046642 Bacteria 115964
544 Ga0495611_0030363 3300046648 Bacteria 2375
545 Ga0495625_0166652 3300046660 Bacteria 1472
546 Ga0495635_0000298 3300046663 Bacteria 31939
547 Ga0495635_0059902 3300046663 Bacteria 2618
548 Ga0495661_0044447 3300046665 Bacteria 2722
549 Ga0495661_0075987 3300046665 Bacteria 1950
550 Ga0495661_0082297 3300046665 Bacteria 1853
551 Ga0495588_0027877 3300046674 Bacteria 2824
552 Ga0495623_0004546 3300046679 Bacteria 9110
553 Ga0495646_0020344 3300046680 Bacteria 4198
554 Ga0495658_0021874 3300046683 Bacteria 3376
555 Ga0495658_0041874 3300046683 Bacteria 2555
556 Ga0495613_0009208 3300046689 Bacteria 7322
557 Ga0495613_0147989 3300046689 Bacteria 1676
558 Ga0495671_0000069 3300046692 Bacteria 98738
559 Ga0495649_0072655 3300046694 Bacteria 1844
560 Ga0495589_0017485 3300046794 Bacteria 3678
561 Ga0495589_0021028 3300046794 Bacteria 3335
562 Ga0495604_0012794 3300047317 Bacteria 6681
563 Ga0495604_0024673 3300047317 Bacteria 4797
564 Ga0495674_0003207 3300047319 Bacteria 15884
565 Ga0495674_0007659 3300047319 Bacteria 10314
566 Ga0495674_0047291 3300047319 Bacteria 3815
567 Ga0495674_0162958 3300047319 Bacteria 1865
568 Ga0495672_0009892 3300047320 Bacteria 6853
569 Ga0495672_0010898 3300047320 Bacteria 6449
570 Ga0495676_0201586 3300047321 Bacteria 1382
571 Ga0495680_0097134 3300047322 Bacteria 2199
572 Ga0495683_0000290 3300047323 Bacteria 43279
573 Ga0495683_0005559 3300047323 Bacteria 6988
574 Ga0495687_033169 3300047443 Bacteria 2346
575 Ga0495675_0013353 3300047444 Bacteria 5184
576 Ga0495679_002783 3300047446 Bacteria 8698
577 Ga0495673_0005428 3300047469 Bacteria 7705
578 Ga0495673_0012224 3300047469 Bacteria 4567
579 Ga0495673_0060841 3300047469 Bacteria 1618
580 Ga0495681_0004895 3300047470 Bacteria 9048
581 Ga0495681_0047572 3300047470 Bacteria 2039
582 Ga0495681_0073773 3300047470 Bacteria 1540
583 Ga0495681_0075825 3300047470 Bacteria 1512
584 Ga0495686_0000012 3300047472 Bacteria 508428
585 Ga0495686_0071363 3300047472 Bacteria 2138
586 Ga0495686_0100189 3300047472 Bacteria 1748
587 Ga0495593_0040256 3300047673 Bacteria 2516
588 Ga0495602_0056983 3300048088 Bacteria 3432
589 Ga0495614_0009428 3300048089 Bacteria 4316
590 Ga0495626_0001873 3300048091 Bacteria 15758
591 Ga0495626_0029522 3300048091 Bacteria 2654
592 Ga0496100_0042413 3300048903 Bacteria 2906
593 Ga0496101_0016397 3300048904 Bacteria 5004
594 Ga0496101_0049520 3300048904 Bacteria 3023
595 Ga0496102_0000038 3300048905 Bacteria 198844
596 Ga0496102_0078332 3300048905 Bacteria 3042
597 Ga0496102_0140832 3300048905 Bacteria 2261
598 Ga0496103_0000137 3300048906 Bacteria 76353
599 Ga0496104_0062960 3300048907 Bacteria 3517
600 Ga0496104_0070138 3300048907 Bacteria 3332
601 Ga0496104_0103395 3300048907 Bacteria 2729
602 Ga0496105_0015662 3300048908 Bacteria 6049
603 Ga0496105_0073508 3300048908 Bacteria 2824
604 Ga0496106_0066059 3300048909 Bacteria 2754
605 Ga0496107_0128726 3300048910 Bacteria 1868
606 Ga0496108_0085776 3300048911 Bacteria 2673
607 Ga0496109_0128065 3300048912 Bacteria 2368
608 Ga0496109_0134074 3300048912 Bacteria 2313
609 Ga0496112_0090145 3300048915 Bacteria 3035
610 Ga0496113_0193026 3300048916 Bacteria 1616
611 Ga0496114_0040436 3300048917 Bacteria 3861
612 Ga0496114_0073181 3300048917 Bacteria 2884
613 Ga0496116_0007511 3300048919 Bacteria 9649
614 Ga0496116_0015789 3300048919 Bacteria 5948
615 Ga0496116_0015902 3300048919 Bacteria 5919
616 Ga0496116_0022818 3300048919 Bacteria 4677
617 Ga0496116_0055289 3300048919 Bacteria 2608
618 Ga0496117_0003381 3300048920 Bacteria 18583
619 Ga0496117_0006162 3300048920 Bacteria 12255
620 Ga0496117_0006767 3300048920 Bacteria 11447
621 Ga0496117_0009563 3300048920 Bacteria 8989
622 Ga0496117_0014705 3300048920 Bacteria 6723
623 Ga0496117_0034713 3300048920 Bacteria 3796
624 Ga0496117_0044104 3300048920 Bacteria 3233
625 Ga0496117_0086822 3300048920 Bacteria 2031
626 Ga0496118_0007452 3300048921 Bacteria 11588
627 Ga0496118_0009975 3300048921 Bacteria 9483
628 Ga0496118_0011018 3300048921 Bacteria 8880
629 Ga0496118_0013975 3300048921 Bacteria 7544
630 Ga0496118_0014147 3300048921 Bacteria 7484
631 Ga0496118_0017416 3300048921 Bacteria 6541
632 Ga0496118_0067984 3300048921 Bacteria 2590
633 Ga0496118_0109577 3300048921 Bacteria 1837
634 Ga0496119_0076902 3300048922 Bacteria 1935
635 Ga0496119_0081901 3300048922 Bacteria 1857
636 Ga0496120_0070086 3300048923 Bacteria 1929
637 Ga0496121_0000137 3300048924 Bacteria 164043
638 Ga0496121_0000186 3300048924 Bacteria 138418
639 Ga0496121_0001220 3300048924 Bacteria 44787
640 Ga0496121_0013018 3300048924 Bacteria 8988
641 Ga0496121_0027666 3300048924 Bacteria 5300
642 Ga0496121_0044191 3300048924 Bacteria 3847
643 Ga0496121_0051703 3300048924 Bacteria 3458
644 Ga0496121_0055186 3300048924 Bacteria 3312
645 Ga0496121_0079138 3300048924 Bacteria 2610
646 Ga0496121_0085261 3300048924 Bacteria 2487
647 Ga0496121_0103589 3300048924 Bacteria 2188
648 Ga0496121_0163518 3300048924 Bacteria 1625
649 Ga0496122_0000102 3300048925 Bacteria 197296
650 Ga0496122_0000383 3300048925 Bacteria 94797
651 Ga0496122_0013251 3300048925 Bacteria 8085
652 Ga0496123_0000110 3300048926 Bacteria 165766
653 Ga0496123_0000249 3300048926 Bacteria 108969
654 Ga0496123_0011403 3300048926 Bacteria 7706
655 Ga0496123_0015207 3300048926 Bacteria 6328
656 Ga0496123_0020883 3300048926 Bacteria 5106
657 Ga0496123_0087819 3300048926 Bacteria 1859
658 Ga0496124_0000013 3300048927 Bacteria 484884
659 Ga0496124_0003855 3300048927 Bacteria 17946
660 Ga0496124_0111470 3300048927 Bacteria 2201
661 Ga0496125_0003063 3300048928 Bacteria 20872
662 Ga0496125_0007429 3300048928 Bacteria 11657
663 Ga0496125_0010419 3300048928 Bacteria 9406
664 Ga0496125_0028699 3300048928 Bacteria 5017
665 Ga0496125_0033809 3300048928 Bacteria 4517
666 Ga0496125_0081548 3300048928 Bacteria 2471
667 Ga0496125_0091310 3300048928 Bacteria 2282
668 Ga0496125_0110318 3300048928 Bacteria 1995
669 Ga0496126_0000328 3300048929 Bacteria 101511
670 Ga0496126_0000681 3300048929 Bacteria 62495
671 Ga0496126_0057773 3300048929 Bacteria 3500
672 Ga0496126_0093192 3300048929 Bacteria 2645
673 Ga0496126_0108265 3300048929 Bacteria 2423
674 Ga0496126_0109182 3300048929 Bacteria 2411
675 Ga0495678_028750 3300049459 Bacteria 2341
676 Ga0501033_0242784 3300049570 Bacteria 1278
677 Ga0501043_0000097 3300049579 Bacteria 79736
678 Ga0501046_0000047 3300049580 Bacteria 140344
679 Ga0501047_0000058 3300049581 Bacteria 139202
680 Ga0501047_0202045 3300049581 Bacteria 1848
681 Ga0501262_000753 3300049759 Bacteria 3735
682 Ga0501035_0017152 3300049822 Bacteria 6673
683 Ga0501035_0044595 3300049822 Bacteria 3993
684 Ga0501035_0057558 3300049822 Bacteria 3466
685 Ga0501035_0074936 3300049822 Bacteria 2993
686 Ga0501044_0000022 3300049823 Bacteria 201689
687 Ga0501044_0295264 3300049823 Bacteria 1551
688 Ga0501045_0007269 3300049824 Bacteria 7691
689 nmdc:mga03683_1531_c1 3300050489 Bacteria 6890
690 nmdc:mga03683_44651_c1 3300050489 Bacteria 1832
691 nmdc:mga03683_5516_c1 3300050489 Bacteria 2314
692 nmdc:mga03n38_33802_c1 3300050490 Bacteria 2179
693 nmdc:mga03n38_81335_c1 3300050490 Bacteria 1523
694 nmdc:mga00v17_26459_c1 3300050491 Bacteria 3381
695 nmdc:mga00v17_28640_c1 3300050491 Bacteria 3264
696 nmdc:mga00v17_40362_c1 3300050491 Bacteria 2799
697 nmdc:mga00v17_6114_c1 3300050491 Bacteria 6375
698 nmdc:mga0yw44_77831_c1 3300050492 Bacteria 2073
699 nmdc:mga0yw44_77833_c1 3300050492 Bacteria 2073
700 nmdc:mga0k408_169_c1 3300050493 Bacteria 34402
701 nmdc:mga0k408_32408_c1 3300050493 Bacteria 2986
702 nmdc:mga0k408_7920_c1 3300050493 Bacteria 5690
703 nmdc:mga04h51_3736_c1 3300050495 Bacteria 3729
704 nmdc:mga07m45_36764_c1 3300050496 Bacteria 2729
705 nmdc:mga0sz30_4052_c1 3300050516 Bacteria 5276
706 nmdc:mga0sz30_46182_c1 3300050516 Bacteria 1838
707 nmdc:mga0sz30_7297_c1 3300050516 Bacteria 4141
708 Ga0500610_0000129 3300053079 Bacteria 22906
709 Ga0500610_0000353 3300053079 Bacteria 13908
710 Ga0495619_0053804 3300053085 Bacteria 2664
711 Ga0500578_0103777 3300053086 Bacteria 1797
712 Ga0500643_009332 3300053087 Bacteria 3755
713 Ga0500643_014841 3300053087 Bacteria 2690
714 Ga0500643_026819 3300053087 Bacteria 1798
715 Ga0500644_0021117 3300053088 Bacteria 1946
716 Ga0500651_0004536 3300053093 Bacteria 7790
717 Ga0500566_0000208 3300053094 Bacteria 31057
718 Ga0500554_021801 3300053102 Bacteria 1782
719 Ga0500556_0000003 3300053104 Bacteria 679379
720 Ga0500562_002197 3300053108 Bacteria 4879
721 Ga0500562_017120 3300053108 Bacteria 1866
722 Ga0500571_000069 3300053110 Bacteria 32297
723 Ga0500594_0006047 3300053118 Bacteria 2705
724 Ga0500607_002984 3300053121 Bacteria 12836
725 Ga0500652_003004 3300053131 Bacteria 5092
726 Ga0500655_007412 3300053133 Bacteria 1974
727 Ga0500658_0000431 3300053134 Bacteria 18048
728 Ga0500559_0000413 3300053136 Bacteria 30711
729 Ga0500559_0028652 3300053136 Bacteria 2380
730 Ga0500568_0000940 3300053139 Bacteria 20068
731 Ga0500568_0016093 3300053139 Bacteria 3332
732 Ga0500573_0055894 3300053140 Bacteria 2265
733 Ga0500586_000957 3300053145 Bacteria 5947
734 Ga0500590_002212 3300053148 Bacteria 8499
735 Ga0500590_027759 3300053148 Bacteria 2937
736 Ga0500604_0003122 3300053151 Bacteria 4452
737 Ga0500616_0000114 3300053153 Bacteria 148574
738 Ga0500622_0000073 3300053156 Bacteria 111045
739 Ga0500627_0022641 3300053158 Bacteria 2550
740 Ga0500634_0038196 3300053161 Bacteria 2611
741 Ga0500634_0085113 3300053161 Bacteria 1618
742 Ga0500636_0004440 3300053177 Bacteria 7934
743 Ga0500636_0016826 3300053177 Bacteria 4311

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0011381 Ga0453683_0011381_4808_5830 303
2 3300046453 Ga0495627_043010 Ga0495627_043010_45_1067 306
3 3300046530 Ga0495654_0137897 Ga0495654_0137897_15_1037 306
4 3300046665 Ga0495661_0075987 Ga0495661_0075987_914_1936 306
5 3300047469 Ga0495673_0060841 Ga0495673_0060841_48_1070 306
6 3300049570 Ga0501033_0242784 Ga0501033_0242784_30_1070 307
7 3300046519 Ga0495632_0080090 Ga0495632_0080090_471_1475 311
8 3300028794 Ga0307515_10000049 Ga0307515_10000049168 314
9 3300046694 Ga0495649_0072655 Ga0495649_0072655_86_1153 315
10 3300037471 Ga0395905_0047336 Ga0395905_0047336_2449_3660 316
11 3300048929 Ga0496126_0109182 Ga0496126_0109182_1356_2378 316
12 3300028794 Ga0307515_10000658 Ga0307515_1000065816 317
13 3300046519 Ga0495632_0126798 Ga0495632_0126798_147_1169 317
14 3300047470 Ga0495681_0047572 Ga0495681_0047572_997_2019 317
15 3300044683 Ga0466965_0175946 Ga0466965_0175946_24_1034 318
16 3300048916 Ga0496113_0193026 Ga0496113_0193026_16_1032 320
17 3300048924 Ga0496121_0051703 Ga0496121_0051703_843_2057 320
18 3300049822 Ga0501035_0044595 Ga0501035_0044595_259_1404 320
19 3300048091 Ga0495626_0001873 Ga0495626_0001873_14658_15725 322
20 3300005539 Ga0068853_100329346 Ga0068853_1003293461 325
21 3300046492 Ga0495585_0112495 Ga0495585_0112495_29_1108 325
22 3300053087 Ga0500643_014841 Ga0500643_014841_1593_2639 326
23 3300048924 Ga0496121_0163518 Ga0496121_0163518_16_1062 327
24 3300005328 Ga0070676_10087194 Ga0070676_100871942 329
25 3300005330 Ga0070690_100032788 Ga0070690_1000327882 329
26 3300005333 Ga0070677_10009009 Ga0070677_100090092 329
27 3300005334 Ga0068869_100019255 Ga0068869_1000192552 329
28 3300005335 Ga0070666_10001072 Ga0070666_100010727 329
29 3300005338 Ga0068868_100000885 Ga0068868_1000008853 329
30 3300005354 Ga0070675_100000052 Ga0070675_10000005254 329
31 3300005367 Ga0070667_100010800 Ga0070667_1000108003 329
32 3300005456 Ga0070678_100083782 Ga0070678_1000837822 329
33 3300005459 Ga0068867_100047218 Ga0068867_1000472183 329
34 3300005466 Ga0070685_10020978 Ga0070685_100209783 329
35 3300005544 Ga0070686_100029030 Ga0070686_1000290302 329
36 3300005616 Ga0068852_100027025 Ga0068852_1000270254 329
37 3300005617 Ga0068859_100003350 Ga0068859_1000033508 329
38 3300005618 Ga0068864_100001554 Ga0068864_1000015548 329
39 3300005841 Ga0068863_100002851 Ga0068863_10000285111 329
40 3300005842 Ga0068858_100000312 Ga0068858_10000031235 329
41 3300005843 Ga0068860_100236303 Ga0068860_1002363032 329
42 3300006237 Ga0097621_100009557 Ga0097621_1000095576 329
43 3300006358 Ga0068871_100004541 Ga0068871_10000454110 329
44 3300006931 Ga0097620_100003350 Ga0097620_1000033509 329
45 3300009177 Ga0105248_10003174 Ga0105248_1000317413 329
46 3300013297 Ga0157378_10154427 Ga0157378_101544272 329
47 3300013306 Ga0163162_10010534 Ga0163162_100105346 329
48 3300013308 Ga0157375_10009254 Ga0157375_100092542 329
49 3300014325 Ga0163163_10001116 Ga0163163_1000111611 329
50 3300014968 Ga0157379_10001049 Ga0157379_1000104910 329
51 3300017792 Ga0163161_10055885 Ga0163161_100558852 329
52 3300025893 Ga0207682_10036883 Ga0207682_100368832 329
53 3300025899 Ga0207642_10056071 Ga0207642_100560712 329
54 3300025933 Ga0207706_10063353 Ga0207706_100633532 329
55 3300025940 Ga0207691_10059490 Ga0207691_100594902 329
56 3300025941 Ga0207711_10001139 Ga0207711_1000113910 329
57 3300025960 Ga0207651_10001026 Ga0207651_100010263 329
58 3300025986 Ga0207658_10066451 Ga0207658_100664512 329
59 3300026023 Ga0207677_10022286 Ga0207677_100222863 329
60 3300026035 Ga0207703_10001421 Ga0207703_100014215 329
61 3300026067 Ga0207678_10295625 Ga0207678_102956252 329
62 3300026088 Ga0207641_10002352 Ga0207641_1000235211 329
63 3300026095 Ga0207676_10001317 Ga0207676_100013173 329
64 3300026121 Ga0207683_10002265 Ga0207683_100022652 329
65 3300026142 Ga0207698_10188848 Ga0207698_101888481 329
66 3300048911 Ga0496108_0085776 Ga0496108_0085776_614_1783 329
67 3300028800 Ga0265338_10002421 Ga0265338_1000242117 330
68 3300048912 Ga0496109_0128065 Ga0496109_0128065_810_1979 330
69 3300048919 Ga0496116_0007511 Ga0496116_0007511_512_1720 330
70 3300048924 Ga0496121_0000186 Ga0496121_0000186_56877_58082 330
71 3300048929 Ga0496126_0000681 Ga0496126_0000681_35180_36385 330
72 3300048909 Ga0496106_0066059 Ga0496106_0066059_369_1607 331
73 3300048927 Ga0496124_0003855 Ga0496124_0003855_12227_13384 331
74 3300005347 Ga0070668_100017566 Ga0070668_1000175664 332
75 3300009036 Ga0105244_10000640 Ga0105244_100006404 332
76 3300009148 Ga0105243_10000020 Ga0105243_1000002092 332
77 3300011119 Ga0105246_10000031 Ga0105246_1000003139 332
78 3300025728 Ga0207655_1000098 Ga0207655_100009856 332
79 3300025935 Ga0207709_10000004 Ga0207709_10000004459 332
80 3300046557 Ga0495622_0029261 Ga0495622_0029261_681_1853 332
81 3300046558 Ga0495633_0000091 Ga0495633_0000091_47540_48712 332
82 3300005719 Ga0068861_100095333 Ga0068861_1000953333 333
83 3300005844 Ga0068862_100185416 Ga0068862_1001854162 333
84 3300009553 Ga0105249_10074259 Ga0105249_100742593 333
85 3300025940 Ga0207691_10088308 Ga0207691_100883082 333
86 3300026089 Ga0207648_10043439 Ga0207648_100434394 333
87 3300026118 Ga0207675_100129547 Ga0207675_1001295472 333
88 3300042115 Ga0450911_000549 Ga0450911_000549_2977_4134 333
89 3300048908 Ga0496105_0073508 Ga0496105_0073508_802_1974 334
90 3300009148 Ga0105243_10077502 Ga0105243_100775022 335
91 3300013306 Ga0163162_10030016 Ga0163162_100300165 335
92 3300017792 Ga0163161_10085888 Ga0163161_100858882 335
93 3300044901 Ga0466960_0147607 Ga0466960_0147607_120_1187 335
94 3300046683 Ga0495658_0041874 Ga0495658_0041874_462_1634 335
95 3300048917 Ga0496114_0073181 Ga0496114_0073181_1583_2752 335
96 3300006881 Ga0068865_100133914 Ga0068865_1001339142 336
97 3300009545 Ga0105237_10384795 Ga0105237_103847951 337
98 3300025931 Ga0207644_10338194 Ga0207644_103381941 337
99 3300031507 Ga0307509_10078280 Ga0307509_100782802 337
100 3300046517 Ga0495630_0079323 Ga0495630_0079323_1338_2462 338
101 3300033179 Ga0307507_10020829 Ga0307507_100208292 339
102 3300046683 Ga0495658_0021874 Ga0495658_0021874_799_1950 339
103 3300053086 Ga0500578_0103777 Ga0500578_0103777_345_1583 339
104 3300005466 Ga0070685_10209480 Ga0070685_102094802 340
105 3300009098 Ga0105245_10033391 Ga0105245_100333915 340
106 3300025927 Ga0207687_10073307 Ga0207687_100733072 340
107 3300026089 Ga0207648_10067585 Ga0207648_100675852 340
108 3300042122 Ga0450920_000742 Ga0450920_000742_175_1332 340
109 3300003758 Ga0055532_1000162 Ga0055532_100016231 342
110 3300003760 Ga0055527_1000110 Ga0055527_100011031 342
111 3300003761 Ga0055535_1000235 Ga0055535_100023531 342
112 3300003762 Ga0055542_1000894 Ga0055542_10008943 342
113 3300003763 Ga0055529_1002573 Ga0055529_10025733 342
114 3300025228 Ga0209672_100059 Ga0209672_100059157 342
115 3300025229 Ga0209147_100072 Ga0209147_100072157 342
116 3300025242 Ga0209258_100102 Ga0209258_100102157 342
117 3300025254 Ga0209148_1000404 Ga0209148_100040419 342
118 3300025272 Ga0209455_1000385 Ga0209455_100038511 342
119 3300031456 Ga0307513_10012028 Ga0307513_100120285 342
120 3300037471 Ga0395905_0000963 Ga0395905_0000963_31969_33183 342
121 3300048925 Ga0496122_0013251 Ga0496122_0013251_6815_7972 343
122 3300048926 Ga0496123_0011403 Ga0496123_0011403_114_1271 343
123 3300048928 Ga0496125_0007429 Ga0496125_0007429_3802_4959 343
124 3300044735 Ga0466968_0018100 Ga0466968_0018100_947_2161 344
125 3300006186 Ga0075369_10003695 Ga0075369_100036952 345
126 3300013296 Ga0157374_10063727 Ga0157374_100637274 345
127 3300050516 nmdc:mga0sz30_7297_c1 nmdc:mga0sz30_7297_c1_90_1247 345
128 3300046522 Ga0495643_0026180 Ga0495643_0026180_1662_2873 346
129 3300046616 Ga0495668_0103705 Ga0495668_0103705_282_1493 346
130 3300046642 Ga0495634_0000025 Ga0495634_0000025_81165_82322 346
131 3300046665 Ga0495661_0082297 Ga0495661_0082297_427_1638 346
132 3300046680 Ga0495646_0020344 Ga0495646_0020344_65_1222 346
133 3300049581 Ga0501047_0202045 Ga0501047_0202045_315_1493 346
134 3300028794 Ga0307515_10029059 Ga0307515_100290598 347
135 3300045051 Ga0451576_0250992 Ga0451576_0250992_261_1421 347
136 3300048928 Ga0496125_0110318 Ga0496125_0110318_19_1161 347
137 3300005459 Ga0068867_100213037 Ga0068867_1002130372 348
138 3300025940 Ga0207691_10027277 Ga0207691_100272772 348
139 3300026089 Ga0207648_10061792 Ga0207648_100617924 348
140 3300048912 Ga0496109_0134074 Ga0496109_0134074_16_1116 348
141 iso_pu_bacteria 2984568884 2984569345 348
142 3300003792 Ga0055540_1002909 Ga0055540_10029098 349
143 3300006177 Ga0075362_10004798 Ga0075362_100047982 349
144 3300013308 Ga0157375_10290384 Ga0157375_102903842 349
145 3300025303 Ga0209051_1001013 Ga0209051_100101313 349
146 3300028380 Ga0268265_10031470 Ga0268265_100314704 349
147 3300044712 Ga0453684_0017188 Ga0453684_0017188_2153_3325 349
148 3300045051 Ga0451576_0006640 Ga0451576_0006640_3545_4717 349
149 3300046501 Ga0495607_0000501 Ga0495607_0000501_34680_35837 349
150 3300046517 Ga0495630_0062548 Ga0495630_0062548_1617_2774 349
151 3300046536 Ga0495587_0000479 Ga0495587_0000479_5031_6188 349
152 3300046663 Ga0495635_0000298 Ga0495635_0000298_13051_14208 349
153 3300048088 Ga0495602_0056983 Ga0495602_0056983_1218_2375 349
154 3300048905 Ga0496102_0000038 Ga0496102_0000038_151719_152876 349
155 3300048906 Ga0496103_0000137 Ga0496103_0000137_8028_9185 349
156 3300048919 Ga0496116_0022818 Ga0496116_0022818_2303_3460 349
157 3300048920 Ga0496117_0006767 Ga0496117_0006767_2169_3326 349
158 3300048921 Ga0496118_0017416 Ga0496118_0017416_3863_5020 349
159 3300049822 Ga0501035_0057558 Ga0501035_0057558_721_1899 349
160 3300050489 nmdc:mga03683_1531_c1 nmdc:mga03683_1531_c1_1778_2935 349
161 3300006051 Ga0075364_10009415 Ga0075364_100094154 350
162 3300013102 Ga0157371_10087744 Ga0157371_100877442 350
163 3300013308 Ga0157375_10422314 Ga0157375_104223142 350
164 3300025918 Ga0207662_10048198 Ga0207662_100481982 350
165 3300031456 Ga0307513_10000034 Ga0307513_1000003457 350
166 3300031730 Ga0307516_10003466 Ga0307516_1000346619 350
167 3300042876 Ga0451577_0152810 Ga0451577_0152810_417_1619 350
168 3300045976 Ga0466967_0119783 Ga0466967_0119783_202_1401 350
169 3300046452 Ga0495617_013070 Ga0495617_013070_512_1669 350
170 3300046463 Ga0495653_0112344 Ga0495653_0112344_781_1938 350
171 3300046507 Ga0495606_0049368 Ga0495606_0049368_640_1797 350
172 3300046512 Ga0495610_0083231 Ga0495610_0083231_218_1375 350
173 3300046513 Ga0495616_0067432 Ga0495616_0067432_530_1687 350
174 3300046515 Ga0495620_0016498 Ga0495620_0016498_2240_3397 350
175 3300046520 Ga0495637_0048836 Ga0495637_0048836_155_1312 350
176 3300046523 Ga0495644_0002111 Ga0495644_0002111_1519_2676 350
177 3300046526 Ga0495666_0009465 Ga0495666_0009465_2361_3518 350
178 3300046530 Ga0495654_0004411 Ga0495654_0004411_5883_7040 350
179 3300046542 Ga0495597_0007304 Ga0495597_0007304_694_1851 350
180 3300046557 Ga0495622_0024167 Ga0495622_0024167_851_2008 350
181 3300046558 Ga0495633_0000612 Ga0495633_0000612_13289_14446 350
182 3300046660 Ga0495625_0166652 Ga0495625_0166652_156_1313 350
183 3300046665 Ga0495661_0044447 Ga0495661_0044447_677_1834 350
184 3300046679 Ga0495623_0004546 Ga0495623_0004546_1135_2292 350
185 3300046689 Ga0495613_0009208 Ga0495613_0009208_1333_2490 350
186 3300046692 Ga0495671_0000069 Ga0495671_0000069_16168_17325 350
187 3300047317 Ga0495604_0012794 Ga0495604_0012794_2253_3410 350
188 3300047319 Ga0495674_0047291 Ga0495674_0047291_882_2039 350
189 3300047322 Ga0495680_0097134 Ga0495680_0097134_646_1803 350
190 3300047323 Ga0495683_0005559 Ga0495683_0005559_5264_6421 350
191 3300047444 Ga0495675_0013353 Ga0495675_0013353_2870_4027 350
192 3300047446 Ga0495679_002783 Ga0495679_002783_5701_6858 350
193 3300047469 Ga0495673_0005428 Ga0495673_0005428_669_1826 350
194 3300047470 Ga0495681_0004895 Ga0495681_0004895_2608_3765 350
195 3300047470 Ga0495681_0075825 Ga0495681_0075825_277_1434 350
196 3300048924 Ga0496121_0044191 Ga0496121_0044191_1957_3114 350
197 iso_pu_bacteria 2551306352 2552746059 350
198 iso_pu_bacteria 2639762793 2640736965 350
199 iso_pu_bacteria 2675903507 2678229796 350
200 iso_pu_bacteria 2773857761 2774391468 350
201 iso_pu_bacteria 2773857770 2774439532 350
202 iso_pu_bacteria 2919182534 2919185575 350
203 3300049459 Ga0495678_028750 Ga0495678_028750_486_1643 351
204 3300042006 Ga0439432_047533 Ga0439432_047533_16_1194 352
205 3300047320 Ga0495672_0010898 Ga0495672_0010898_851_2059 352
206 3300049823 Ga0501044_0295264 Ga0501044_0295264_329_1534 352
207 3300005367 Ga0070667_100088929 Ga0070667_1000889292 353
208 3300009177 Ga0105248_10081641 Ga0105248_100816412 353
209 3300013306 Ga0163162_10000998 Ga0163162_100009989 353
210 3300013308 Ga0157375_10140549 Ga0157375_101405492 353
211 3300014325 Ga0163163_10260526 Ga0163163_102605261 353
212 3300025903 Ga0207680_10175460 Ga0207680_101754602 353
213 3300026089 Ga0207648_10100166 Ga0207648_101001662 353
214 3300030521 Ga0307511_10000485 Ga0307511_1000048512 353
215 3300046459 Ga0495629_0136179 Ga0495629_0136179_231_1400 353
216 3300046474 Ga0495605_0000848 Ga0495605_0000848_9341_10510 353
217 3300046492 Ga0495585_0051193 Ga0495585_0051193_569_1738 353
218 3300046500 Ga0495596_0038054 Ga0495596_0038054_429_1598 353
219 3300046542 Ga0495597_0050143 Ga0495597_0050143_255_1424 353
220 3300046794 Ga0495589_0017485 Ga0495589_0017485_1399_2568 353
221 3300047319 Ga0495674_0007659 Ga0495674_0007659_982_2151 353
222 3300047320 Ga0495672_0009892 Ga0495672_0009892_2858_4027 353
223 3300047469 Ga0495673_0012224 Ga0495673_0012224_708_1877 353
224 3300048091 Ga0495626_0029522 Ga0495626_0029522_512_1681 353
225 3300048903 Ga0496100_0042413 Ga0496100_0042413_1169_2338 353
226 3300048904 Ga0496101_0049520 Ga0496101_0049520_673_1842 353
227 3300048905 Ga0496102_0078332 Ga0496102_0078332_624_1793 353
228 3300048910 Ga0496107_0128726 Ga0496107_0128726_334_1503 353
229 3300048917 Ga0496114_0040436 Ga0496114_0040436_242_1411 353
230 3300048920 Ga0496117_0086822 Ga0496117_0086822_587_1756 353
231 3300003856 Ga0058692_1000027 Ga0058692_100002747 354
232 3300005272 Ga0065703_1000152 Ga0065703_100015211 354
233 3300005289 Ga0065704_10086279 Ga0065704_100862793 354
234 3300005289 Ga0065704_10106726 Ga0065704_101067262 354
235 3300005353 Ga0070669_100001876 Ga0070669_1000018769 354
236 3300005364 Ga0070673_100019238 Ga0070673_1000192385 354
237 3300005548 Ga0070665_100008004 Ga0070665_1000080048 354
238 3300009036 Ga0105244_10009231 Ga0105244_100092312 354
239 3300009093 Ga0105240_10022111 Ga0105240_100221117 354
240 3300009101 Ga0105247_10000221 Ga0105247_1000022136 354
241 3300009148 Ga0105243_10000343 Ga0105243_1000034320 354
242 3300013306 Ga0163162_10023284 Ga0163162_100232841 354
243 3300017792 Ga0163161_10044730 Ga0163161_100447302 354
244 3300025711 Ga0207696_1003494 Ga0207696_10034942 354
245 3300025711 Ga0207696_1008402 Ga0207696_10084025 354
246 3300025728 Ga0207655_1000755 Ga0207655_100075523 354
247 3300025728 Ga0207655_1010657 Ga0207655_10106572 354
248 3300025735 Ga0207713_1001757 Ga0207713_10017579 354
249 3300025735 Ga0207713_1030788 Ga0207713_10307882 354
250 3300025900 Ga0207710_10000057 Ga0207710_1000005747 354
251 3300025913 Ga0207695_10142170 Ga0207695_101421702 354
252 3300025923 Ga0207681_10000821 Ga0207681_100008216 354
253 3300027312 Ga0209371_1000074 Ga0209371_100007447 354
254 3300030500 Ga0268256_1000067 Ga0268256_100006747 354
255 3300046616 Ga0495668_0034669 Ga0495668_0034669_606_1793 354
256 3300046794 Ga0495589_0021028 Ga0495589_0021028_618_1793 354
257 3300047472 Ga0495686_0000012 Ga0495686_0000012_444456_445631 354
258 3300053148 Ga0500590_002212 Ga0500590_002212_7205_8365 354
259 iso_pu_bacteria 2515154123 2515687802 354
260 iso_pu_bacteria 8055301274 8055307956 354
261 3300005262 Ga0065165_1002663 Ga0065165_100266313 355
262 3300005338 Ga0068868_100004002 Ga0068868_1000040027 355
263 3300005355 Ga0070671_100011579 Ga0070671_1000115794 355
264 3300005440 Ga0070705_100034668 Ga0070705_1000346682 355
265 3300005457 Ga0070662_100033964 Ga0070662_1000339642 355
266 3300005459 Ga0068867_100061352 Ga0068867_1000613522 355
267 3300005467 Ga0070706_100114580 Ga0070706_1001145802 355
268 3300005471 Ga0070698_100164235 Ga0070698_1001642351 355
269 3300005618 Ga0068864_100023527 Ga0068864_1000235275 355
270 3300005718 Ga0068866_10013798 Ga0068866_100137982 355
271 3300005719 Ga0068861_100027008 Ga0068861_1000270084 355
272 3300006048 Ga0075363_100019723 Ga0075363_1000197234 355
273 3300006051 Ga0075364_10041760 Ga0075364_100417602 355
274 3300006058 Ga0075432_10005731 Ga0075432_100057313 355
275 3300006178 Ga0075367_10011041 Ga0075367_100110414 355
276 3300006186 Ga0075369_10000645 Ga0075369_100006455 355
277 3300006358 Ga0068871_100041352 Ga0068871_1000413522 355
278 3300009093 Ga0105240_10469942 Ga0105240_104699421 355
279 3300009098 Ga0105245_10064850 Ga0105245_100648503 355
280 3300009148 Ga0105243_10016686 Ga0105243_100166863 355
281 3300011119 Ga0105246_10011288 Ga0105246_100112883 355
282 3300017792 Ga0163161_10003777 Ga0163161_100037777 355
283 3300025273 Ga0209673_1003066 Ga0209673_100306610 355
284 3300025907 Ga0207645_10023668 Ga0207645_100236682 355
285 3300025910 Ga0207684_10005739 Ga0207684_100057393 355
286 3300025933 Ga0207706_10076233 Ga0207706_100762332 355
287 3300025942 Ga0207689_10023495 Ga0207689_100234953 355
288 3300026088 Ga0207641_10429515 Ga0207641_104295151 355
289 3300026089 Ga0207648_10024226 Ga0207648_100242263 355
290 3300026118 Ga0207675_100018840 Ga0207675_1000188404 355
291 3300037418 Ga0395900_0118912 Ga0395900_0118912_110_1231 355
292 3300048924 Ga0496121_0027666 Ga0496121_0027666_3439_4692 355
293 3300048925 Ga0496122_0000102 Ga0496122_0000102_73528_74781 355
294 3300048926 Ga0496123_0000110 Ga0496123_0000110_154365_155618 355
295 3300048928 Ga0496125_0028699 Ga0496125_0028699_1119_2372 355
296 3300049579 Ga0501043_0000097 Ga0501043_0000097_22611_23789 355
297 3300049580 Ga0501046_0000047 Ga0501046_0000047_116766_117944 355
298 3300049581 Ga0501047_0000058 Ga0501047_0000058_22803_23981 355
299 3300049824 Ga0501045_0007269 Ga0501045_0007269_4607_5785 355
300 3300050489 nmdc:mga03683_5516_c1 nmdc:mga03683_5516_c1_581_1765 355
301 3300050493 nmdc:mga0k408_169_c1 nmdc:mga0k408_169_c1_13866_15050 355
302 3300050516 nmdc:mga0sz30_4052_c1 nmdc:mga0sz30_4052_c1_750_1934 355
303 3300014497 Ga0182008_10000316 Ga0182008_1000031613 356
304 3300017792 Ga0163161_10096833 Ga0163161_100968332 356
305 3300031911 Ga0307412_10059873 Ga0307412_100598731 356
306 3300045836 Ga0466958_0157360 Ga0466958_0157360_281_1405 356
307 3300049822 Ga0501035_0017152 Ga0501035_0017152_4989_6155 356
308 3300049823 Ga0501044_0000022 Ga0501044_0000022_50969_52135 356
309 3300005616 Ga0068852_100328194 Ga0068852_1003281942 357
310 3300025901 Ga0207688_10086733 Ga0207688_100867331 357
311 3300031238 Ga0265332_10000027 Ga0265332_1000002720 357
312 3300041407 Ga0439447_011098 Ga0439447_011098_1165_2334 357
313 3300042138 Ga0450903_001624 Ga0450903_001624_51_1220 357
314 3300046519 Ga0495632_0036707 Ga0495632_0036707_639_1808 357
315 3300048907 Ga0496104_0070138 Ga0496104_0070138_1342_2547 357
316 3300048920 Ga0496117_0003381 Ga0496117_0003381_14671_15846 357
317 3300048929 Ga0496126_0000328 Ga0496126_0000328_24128_25303 357
318 3300006038 Ga0075365_10003966 Ga0075365_100039662 358
319 3300025960 Ga0207651_10196028 Ga0207651_101960282 358
320 3300026116 Ga0207674_10053254 Ga0207674_100532541 358
321 3300026121 Ga0207683_10033430 Ga0207683_100334303 358
322 3300028379 Ga0268266_10070330 Ga0268266_100703303 358
323 3300046522 Ga0495643_0051401 Ga0495643_0051401_873_2072 358
324 3300046538 Ga0495609_0013875 Ga0495609_0013875_1353_2552 358
325 3300046648 Ga0495611_0030363 Ga0495611_0030363_717_1916 358
326 3300005564 Ga0070664_100205423 Ga0070664_1002054232 359
327 3300053151 Ga0500604_0003122 Ga0500604_0003122_687_1847 359
328 iso_pu_bacteria 2501025502 2501079053 359
329 iso_pu_bacteria 2510917013 2511093053 359
330 3300005288 Ga0065714_10006453 Ga0065714_100064532 360
331 3300005328 Ga0070676_10005423 Ga0070676_100054232 360
332 3300005330 Ga0070690_100116095 Ga0070690_1001160952 360
333 3300005331 Ga0070670_100018686 Ga0070670_1000186865 360
334 3300005334 Ga0068869_100001131 Ga0068869_1000011316 360
335 3300005338 Ga0068868_100160625 Ga0068868_1001606252 360
336 3300005353 Ga0070669_100004206 Ga0070669_10000420611 360
337 3300005354 Ga0070675_100225138 Ga0070675_1002251382 360
338 3300005356 Ga0070674_100002148 Ga0070674_1000021489 360
339 3300005364 Ga0070673_100107944 Ga0070673_1001079442 360
340 3300005365 Ga0070688_100194930 Ga0070688_1001949302 360
341 3300005367 Ga0070667_100109657 Ga0070667_1001096572 360
342 3300005441 Ga0070700_100153772 Ga0070700_1001537722 360
343 3300005456 Ga0070678_100085278 Ga0070678_1000852781 360
344 3300005457 Ga0070662_100096915 Ga0070662_1000969152 360
345 3300005543 Ga0070672_100000701 Ga0070672_10000070111 360
346 3300005616 Ga0068852_100031259 Ga0068852_1000312592 360
347 3300005617 Ga0068859_100031712 Ga0068859_1000317124 360
348 3300005618 Ga0068864_100009096 Ga0068864_1000090968 360
349 3300005718 Ga0068866_10001392 Ga0068866_1000139212 360
350 3300005719 Ga0068861_100001224 Ga0068861_10000122414 360
351 3300005841 Ga0068863_100001886 Ga0068863_1000018862 360
352 3300005842 Ga0068858_100001000 Ga0068858_10000100034 360
353 3300005843 Ga0068860_100001048 Ga0068860_1000010483 360
354 3300005844 Ga0068862_100028430 Ga0068862_1000284305 360
355 3300006195 Ga0075366_10051788 Ga0075366_100517882 360
356 3300006881 Ga0068865_100024466 Ga0068865_1000244663 360
357 3300006931 Ga0097620_100031712 Ga0097620_1000317123 360
358 3300009148 Ga0105243_10240189 Ga0105243_102401892 360
359 3300009177 Ga0105248_10175872 Ga0105248_101758722 360
360 3300009553 Ga0105249_10090429 Ga0105249_100904292 360
361 3300013306 Ga0163162_10017500 Ga0163162_100175002 360
362 3300013308 Ga0157375_10004479 Ga0157375_1000447910 360
363 3300013308 Ga0157375_10308863 Ga0157375_103088632 360
364 3300014325 Ga0163163_10113694 Ga0163163_101136942 360
365 3300014326 Ga0157380_10002558 Ga0157380_1000255811 360
366 3300014968 Ga0157379_10026574 Ga0157379_100265742 360
367 3300025298 Ga0209050_1001787 Ga0209050_10017872 360
368 3300025893 Ga0207682_10047107 Ga0207682_100471072 360
369 3300025907 Ga0207645_10017116 Ga0207645_100171164 360
370 3300025923 Ga0207681_10000308 Ga0207681_1000030834 360
371 3300025925 Ga0207650_10001370 Ga0207650_1000137013 360
372 3300025926 Ga0207659_10015718 Ga0207659_100157185 360
373 3300025933 Ga0207706_10062189 Ga0207706_100621892 360
374 3300025935 Ga0207709_10089856 Ga0207709_100898562 360
375 3300025936 Ga0207670_10237078 Ga0207670_102370782 360
376 3300025937 Ga0207669_10073142 Ga0207669_100731422 360
377 3300025938 Ga0207704_10005851 Ga0207704_100058512 360
378 3300025940 Ga0207691_10028559 Ga0207691_100285592 360
379 3300025941 Ga0207711_10030653 Ga0207711_100306532 360
380 3300025942 Ga0207689_10002245 Ga0207689_100022456 360
381 3300025960 Ga0207651_10018646 Ga0207651_100186464 360
382 3300025986 Ga0207658_10000495 Ga0207658_1000049534 360
383 3300026023 Ga0207677_10168164 Ga0207677_101681642 360
384 3300026035 Ga0207703_10000414 Ga0207703_100004142 360
385 3300026088 Ga0207641_10000615 Ga0207641_1000061514 360
386 3300026095 Ga0207676_10110171 Ga0207676_101101712 360
387 3300026118 Ga0207675_100005031 Ga0207675_10000503110 360
388 3300026121 Ga0207683_10049515 Ga0207683_100495152 360
389 3300028380 Ga0268265_10012608 Ga0268265_100126086 360
390 3300028381 Ga0268264_10000780 Ga0268264_1000078036 360
391 3300041411 Ga0439466_0013209 Ga0439466_0013209_1412_2569 360
392 3300050491 nmdc:mga00v17_40362_c1 nmdc:mga00v17_40362_c1_159_1373 360
393 3300005288 Ga0065714_10011224 Ga0065714_100112242 361
394 3300005335 Ga0070666_10088331 Ga0070666_100883312 361
395 3300005347 Ga0070668_100038500 Ga0070668_1000385002 361
396 3300005353 Ga0070669_100045554 Ga0070669_1000455542 361
397 3300005366 Ga0070659_100274328 Ga0070659_1002743281 361
398 3300005367 Ga0070667_100036506 Ga0070667_1000365062 361
399 3300005459 Ga0068867_100006169 Ga0068867_1000061694 361
400 3300005617 Ga0068859_100240371 Ga0068859_1002403712 361
401 3300005719 Ga0068861_100034174 Ga0068861_1000341744 361
402 3300005842 Ga0068858_100034439 Ga0068858_1000344395 361
403 3300005843 Ga0068860_100006491 Ga0068860_10000649112 361
404 3300005844 Ga0068862_100037636 Ga0068862_1000376364 361
405 3300006881 Ga0068865_100002084 Ga0068865_1000020849 361
406 3300006931 Ga0097620_100240368 Ga0097620_1002403682 361
407 3300009553 Ga0105249_10009083 Ga0105249_100090835 361
408 3300013297 Ga0157378_10008090 Ga0157378_100080905 361
409 3300013306 Ga0163162_10003327 Ga0163162_100033272 361
410 3300013308 Ga0157375_10030818 Ga0157375_100308182 361
411 3300014326 Ga0157380_10032362 Ga0157380_100323622 361
412 3300025893 Ga0207682_10002802 Ga0207682_100028022 361
413 3300025907 Ga0207645_10130883 Ga0207645_101308832 361
414 3300025932 Ga0207690_10092910 Ga0207690_100929102 361
415 3300025934 Ga0207686_10093888 Ga0207686_100938882 361
416 3300025940 Ga0207691_10135734 Ga0207691_101357341 361
417 3300025972 Ga0207668_10079683 Ga0207668_100796832 361
418 3300026035 Ga0207703_10052657 Ga0207703_100526572 361
419 3300026067 Ga0207678_10101396 Ga0207678_101013962 361
420 3300026067 Ga0207678_10217122 Ga0207678_102171222 361
421 3300026089 Ga0207648_10005514 Ga0207648_100055142 361
422 3300026089 Ga0207648_10273811 Ga0207648_102738112 361
423 3300026118 Ga0207675_100003069 Ga0207675_10000306913 361
424 3300026121 Ga0207683_10014063 Ga0207683_100140635 361
425 3300028380 Ga0268265_10100728 Ga0268265_101007282 361
426 3300028381 Ga0268264_10001577 Ga0268264_100015778 361
427 3300035172 Ga0373955_0052098 Ga0373955_0052098_994_2133 361
428 3300036401 Ga0373937_0057331 Ga0373937_0057331_23_1162 361
429 3300046459 Ga0495629_0079421 Ga0495629_0079421_457_1596 361
430 3300046516 Ga0495628_0003869 Ga0495628_0003869_8090_9265 361
431 3300046539 Ga0495621_0034102 Ga0495621_0034102_247_1386 361
432 3300046543 Ga0495645_0021607 Ga0495645_0021607_821_1960 361
433 3300046663 Ga0495635_0059902 Ga0495635_0059902_629_1768 361
434 3300046689 Ga0495613_0147989 Ga0495613_0147989_137_1276 361
435 3300047319 Ga0495674_0162958 Ga0495674_0162958_319_1458 361
436 3300047323 Ga0495683_0000290 Ga0495683_0000290_13602_14759 361
437 3300048924 Ga0496121_0000137 Ga0496121_0000137_80535_81764 361
438 3300050490 nmdc:mga03n38_81335_c1 nmdc:mga03n38_81335_c1_269_1453 361
439 3300053085 Ga0495619_0053804 Ga0495619_0053804_1177_2316 361
440 3300025253 Ga0209677_100180 Ga0209677_10018023 362
441 3300025728 Ga0207655_1000687 Ga0207655_100068712 362
442 3300025935 Ga0207709_10000057 Ga0207709_10000057156 362
443 3300048920 Ga0496117_0009563 Ga0496117_0009563_5651_6826 362
444 3300048921 Ga0496118_0067984 Ga0496118_0067984_906_2111 362
445 3300048924 Ga0496121_0055186 Ga0496121_0055186_1274_2470 362
446 3300048924 Ga0496121_0079138 Ga0496121_0079138_211_1416 362
447 3300048927 Ga0496124_0000013 Ga0496124_0000013_336287_337483 362
448 3300003792 Ga0055540_1004067 Ga0055540_10040672 363
449 3300003794 Ga0055531_10001837 Ga0055531_100018374 363
450 3300025303 Ga0209051_1000369 Ga0209051_100036937 363
451 3300025304 Ga0209257_1000317 Ga0209257_100031766 363
452 3300037471 Ga0395905_0223151 Ga0395905_0223151_65_1210 363
453 3300045049 Ga0466959_0001542 Ga0466959_0001542_9094_10263 363
454 3300003316 rootH1_10035044 rootH1_100350442 364
455 3300003758 Ga0055532_1002676 Ga0055532_10026763 364
456 3300006042 Ga0075368_10011398 Ga0075368_100113983 364
457 3300025229 Ga0209147_100534 Ga0209147_1005345 364
458 3300027866 Ga0209813_10012910 Ga0209813_100129102 364
459 3300031911 Ga0307412_10000129 Ga0307412_1000012919 364
460 3300050489 nmdc:mga03683_44651_c1 nmdc:mga03683_44651_c1_492_1652 364
461 3300050490 nmdc:mga03n38_33802_c1 nmdc:mga03n38_33802_c1_174_1334 364
462 3300050491 nmdc:mga00v17_28640_c1 nmdc:mga00v17_28640_c1_1858_3018 364
463 3300050491 nmdc:mga00v17_6114_c1 nmdc:mga00v17_6114_c1_47_1207 364
464 3300050492 nmdc:mga0yw44_77831_c1 nmdc:mga0yw44_77831_c1_866_2026 364
465 3300050492 nmdc:mga0yw44_77833_c1 nmdc:mga0yw44_77833_c1_866_2026 364
466 3300050493 nmdc:mga0k408_32408_c1 nmdc:mga0k408_32408_c1_99_1259 364
467 3300050495 nmdc:mga04h51_3736_c1 nmdc:mga04h51_3736_c1_492_1652 364
468 3300050516 nmdc:mga0sz30_46182_c1 nmdc:mga0sz30_46182_c1_267_1427 364
469 iso_pu_bacteria 2515154123 2515691095 364
470 iso_pu_bacteria 2939631187 2939634478 364
471 3300031731 Ga0307405_10161809 Ga0307405_101618092 365
472 3300037312 Ga0395899_0035639 Ga0395899_0035639_302_1498 365
473 3300037418 Ga0395900_0012763 Ga0395900_0012763_3507_4703 365
474 3300037466 Ga0395898_0031026 Ga0395898_0031026_3852_5048 365
475 3300038443 Ga0395901_0027834 Ga0395901_0027834_3342_4538 365
476 3300045049 Ga0466959_0115238 Ga0466959_0115238_95_1291 365
477 3300046674 Ga0495588_0027877 Ga0495588_0027877_554_1717 365
478 iso_pu_bacteria 2721755763 2723879888 365
479 3300025228 Ga0209672_101446 Ga0209672_1014466 366
480 3300025242 Ga0209258_106361 Ga0209258_1063612 366
481 3300025272 Ga0209455_1000398 Ga0209455_100039828 366
482 3300025728 Ga0207655_1031674 Ga0207655_10316742 366
483 3300047443 Ga0495687_033169 Ga0495687_033169_1122_2333 366
484 3300049822 Ga0501035_0074936 Ga0501035_0074936_859_2025 366
485 iso_pu_bacteria 2548876994 2550695725 366
486 iso_pu_bacteria 2855730933 2855732013 366
487 iso_pu_bacteria 2855767633 2855768720 366
488 iso_pu_bacteria 2881412998 2881415338 366
489 3300005539 Ga0068853_100040352 Ga0068853_1000403523 367
490 3300005563 Ga0068855_100289032 Ga0068855_1002890322 367
491 3300025935 Ga0207709_10000768 Ga0207709_1000076823 367
492 3300026041 Ga0207639_10003076 Ga0207639_100030767 367
493 3300028794 Ga0307515_10001006 Ga0307515_1000100651 367
494 3300037418 Ga0395900_0083050 Ga0395900_0083050_583_1758 367
495 3300038443 Ga0395901_0005950 Ga0395901_0005950_9855_11039 368
496 3300053136 Ga0500559_0000413 Ga0500559_0000413_11188_12399 368
497 3300030731 Ga0316177_1038652 Ga0316177_10386525 369
498 3300030732 Ga0316176_1212641 Ga0316176_12126412 369
499 3300030733 Ga0314311_1250941 Ga0314311_12509415 369
500 3300030735 Ga0316178_1183912 Ga0316178_11839126 369
501 3300030736 Ga0316180_1159745 Ga0316180_11597452 369
502 3300030742 Ga0316183_1085212 Ga0316183_10852122 369
503 3300030744 Ga0316181_1093548 Ga0316181_10935482 369
504 3300031911 Ga0307412_10005492 Ga0307412_100054923 369
505 3300049759 Ga0501262_000753 Ga0501262_000753_1922_3148 369
506 3300053108 Ga0500562_017120 Ga0500562_017120_507_1718 369
507 3300053145 Ga0500586_000957 Ga0500586_000957_1542_2753 369
508 3300053156 Ga0500622_0000073 Ga0500622_0000073_14962_16173 369
509 3300053177 Ga0500636_0004440 Ga0500636_0004440_4923_6122 369
510 iso_pu_bacteria 2599185240 2599745996 369
511 iso_pu_bacteria 2599185292 2599905388 369
512 iso_pu_bacteria 2599185355 2600207745 369
513 iso_pu_bacteria 2643221569 2643858853 369
514 iso_pu_bacteria 2643221594 2643981982 369
515 iso_pu_bacteria 2643221621 2644122699 369
516 iso_pu_bacteria 2675903129 2676744058 369
517 iso_pu_bacteria 2808606395 2809034085 369
518 iso_pu_bacteria 2857537821 2857539906 369
519 iso_pu_bacteria 2858950400 2858955022 369
520 iso_pu_bacteria 2870068957 2870073521 369
521 iso_pu_bacteria 2881927736 2881929993 369
522 iso_pu_bacteria 2941479691 2941479874 369
523 iso_pu_bacteria 641736154 642414993 369
524 iso_pu_bacteria 8020945358 8020945915 369
525 3300003187 JGI25151J46595_10000493 JGI25151J46595_1000049325 370
526 3300025261 Ga0209233_1004721 Ga0209233_10047212 370
527 3300025294 Ga0209025_1000018 Ga0209025_100001811 370
528 3300046472 Ga0495580_0035293 Ga0495580_0035293_1922_3139 370
529 3300046524 Ga0495648_0010582 Ga0495648_0010582_3857_5074 370
530 3300046557 Ga0495622_0042417 Ga0495622_0042417_767_1978 370
531 3300053094 Ga0500566_0000208 Ga0500566_0000208_22214_23425 370
532 3300053102 Ga0500554_021801 Ga0500554_021801_375_1586 370
533 3300053148 Ga0500590_027759 Ga0500590_027759_38_1249 370
534 3300053177 Ga0500636_0016826 Ga0500636_0016826_640_1851 370
535 iso_pu_bacteria 2857542790 2857543258 370
536 iso_pu_bacteria 2904615490 2904623138 370
537 iso_pu_bacteria 2928115317 2928119057 370
538 3300031731 Ga0307405_10163598 Ga0307405_101635982 371
539 iso_pu_bacteria 2513237151 2513958335 371
540 iso_pu_bacteria 2515154122 2515681573 371
541 iso_pu_bacteria 2515154189 2516019860 371
542 iso_pu_bacteria 2551306416 2553003427 371
543 iso_pu_bacteria 2599185239 2599735341 371
544 iso_pu_bacteria 2857524615 2857529749 371
545 iso_pu_bacteria 2893066018 2893066168 371
546 iso_pu_bacteria 2902682994 2902685745 371
547 iso_pu_bacteria 2919046199 2919046835 371
548 iso_pu_bacteria 2919073203 2919075124 371
549 iso_pu_bacteria 8018845410 8018851679 371
550 iso_pu_bacteria 8039098773 8039099617 371
551 iso_pu_bacteria 8055225921 8055228534 371
552 3300003781 Ga0055536_1002068 Ga0055536_100206810 372
553 3300025292 Ga0209676_1000595 Ga0209676_100059515 372
554 3300025303 Ga0209051_1000787 Ga0209051_100078723 372
555 3300025304 Ga0209257_1006472 Ga0209257_10064724 372
556 3300031548 Ga0307408_100016284 Ga0307408_1000162845 372
557 3300031901 Ga0307406_10000822 Ga0307406_1000082212 372
558 3300031911 Ga0307412_10135580 Ga0307412_101355801 372
559 3300037466 Ga0395898_0119398 Ga0395898_0119398_316_1551 372
560 3300042532 Ga0450893_0005595 Ga0450893_0005595_672_1880 372
561 3300046460 Ga0495638_0000537 Ga0495638_0000537_30221_31432 372
562 3300046472 Ga0495580_0131156 Ga0495580_0131156_261_1466 372
563 3300046526 Ga0495666_0012854 Ga0495666_0012854_2668_3873 372
564 3300047317 Ga0495604_0024673 Ga0495604_0024673_2159_3364 372
565 3300047319 Ga0495674_0003207 Ga0495674_0003207_8647_9843 372
566 3300048921 Ga0496118_0109577 Ga0496118_0109577_314_1525 372
567 3300053131 Ga0500652_003004 Ga0500652_003004_2976_4187 372
568 3300053139 Ga0500568_0000940 Ga0500568_0000940_10429_11640 372
569 iso_pu_bacteria 2856287931 2856289707 372
570 iso_pu_bacteria 2857357740 2857364439 372
571 3300003758 Ga0055532_1002682 Ga0055532_10026823 373
572 3300003760 Ga0055527_1000469 Ga0055527_10004694 373
573 3300003761 Ga0055535_1001165 Ga0055535_10011654 373
574 3300005563 Ga0068855_100223997 Ga0068855_1002239972 373
575 3300009093 Ga0105240_10000553 Ga0105240_100005533 373
576 3300025228 Ga0209672_100023 Ga0209672_100023327 373
577 3300025229 Ga0209147_100094 Ga0209147_10009415 373
578 3300025242 Ga0209258_100142 Ga0209258_1001424 373
579 3300025254 Ga0209148_1001094 Ga0209148_100109410 373
580 3300025256 Ga0209759_1001212 Ga0209759_100121216 373
581 3300025272 Ga0209455_1000634 Ga0209455_10006349 373
582 3300025913 Ga0207695_10000912 Ga0207695_1000091216 373
583 3300025949 Ga0207667_10037909 Ga0207667_100379091 373
584 3300048919 Ga0496116_0015789 Ga0496116_0015789_2890_4098 373
585 3300048921 Ga0496118_0011018 Ga0496118_0011018_2050_3258 373
586 iso_pu_bacteria 2923510766 2923511555 373
587 3300005262 Ga0065165_1018420 Ga0065165_10184202 374
588 3300005543 Ga0070672_100226888 Ga0070672_1002268881 374
589 3300006051 Ga0075364_10175781 Ga0075364_101757811 374
590 3300025295 Ga0209564_1000500 Ga0209564_100050040 374
591 3300046512 Ga0495610_0036035 Ga0495610_0036035_1267_2478 374
592 3300046539 Ga0495621_0033574 Ga0495621_0033574_82_1293 374
593 3300047472 Ga0495686_0071363 Ga0495686_0071363_267_1478 374
594 3300048905 Ga0496102_0140832 Ga0496102_0140832_335_1546 374
595 3300048907 Ga0496104_0103395 Ga0496104_0103395_1485_2696 374
596 3300048920 Ga0496117_0014705 Ga0496117_0014705_4770_6008 374
597 3300048921 Ga0496118_0014147 Ga0496118_0014147_746_1984 374
598 3300048929 Ga0496126_0093192 Ga0496126_0093192_240_1439 374
599 3300050496 nmdc:mga07m45_36764_c1 nmdc:mga07m45_36764_c1_276_1505 374
600 3300053088 Ga0500644_0021117 Ga0500644_0021117_634_1845 374
601 3300053104 Ga0500556_0000003 Ga0500556_0000003_441668_442879 374
602 3300053108 Ga0500562_002197 Ga0500562_002197_1295_2506 374
603 3300053153 Ga0500616_0000114 Ga0500616_0000114_34993_36204 374
604 iso_pu_bacteria 2791355137 2792835128 374
605 3300005339 Ga0070660_100000588 Ga0070660_10000058814 375
606 3300005344 Ga0070661_100060140 Ga0070661_1000601401 375
607 3300005353 Ga0070669_100027787 Ga0070669_1000277872 375
608 3300005366 Ga0070659_100000038 Ga0070659_10000003813 375
609 3300005455 Ga0070663_100002734 Ga0070663_1000027342 375
610 3300005563 Ga0068855_100067985 Ga0068855_1000679853 375
611 3300005616 Ga0068852_100011891 Ga0068852_1000118914 375
612 3300009092 Ga0105250_10001390 Ga0105250_100013904 375
613 3300009093 Ga0105240_10028605 Ga0105240_100286053 375
614 3300009545 Ga0105237_10006553 Ga0105237_100065532 375
615 3300009551 Ga0105238_10009733 Ga0105238_100097335 375
616 3300010375 Ga0105239_10022668 Ga0105239_100226684 375
617 3300013105 Ga0157369_10028090 Ga0157369_100280904 375
618 3300017792 Ga0163161_10048349 Ga0163161_100483492 375
619 3300025913 Ga0207695_10029742 Ga0207695_100297424 375
620 3300025914 Ga0207671_10045264 Ga0207671_100452642 375
621 3300025919 Ga0207657_10000063 Ga0207657_1000006315 375
622 3300025924 Ga0207694_10017805 Ga0207694_100178053 375
623 3300025932 Ga0207690_10000025 Ga0207690_10000025154 375
624 3300025949 Ga0207667_10002610 Ga0207667_1000261012 375
625 3300026067 Ga0207678_10003127 Ga0207678_100031276 375
626 3300026142 Ga0207698_10008619 Ga0207698_100086194 375
627 3300044765 Ga0466970_0006300 Ga0466970_0006300_657_1871 375
628 3300047470 Ga0495681_0073773 Ga0495681_0073773_152_1363 375
629 3300047472 Ga0495686_0100189 Ga0495686_0100189_150_1364 375
630 3300048907 Ga0496104_0062960 Ga0496104_0062960_1135_2349 375
631 3300048908 Ga0496105_0015662 Ga0496105_0015662_2888_4102 375
632 3300048915 Ga0496112_0090145 Ga0496112_0090145_1793_3007 375
633 3300048920 Ga0496117_0006162 Ga0496117_0006162_7325_8536 375
634 3300048920 Ga0496117_0034713 Ga0496117_0034713_701_1915 375
635 3300048921 Ga0496118_0007452 Ga0496118_0007452_8332_9543 375
636 3300048921 Ga0496118_0013975 Ga0496118_0013975_4070_5284 375
637 3300048922 Ga0496119_0076902 Ga0496119_0076902_458_1672 375
638 3300048923 Ga0496120_0070086 Ga0496120_0070086_323_1537 375
639 3300048924 Ga0496121_0001220 Ga0496121_0001220_6512_7723 375
640 3300048924 Ga0496121_0013018 Ga0496121_0013018_3784_4998 375
641 3300048926 Ga0496123_0015207 Ga0496123_0015207_3189_4403 375
642 3300048926 Ga0496123_0020883 Ga0496123_0020883_2812_4023 375
643 3300048927 Ga0496124_0111470 Ga0496124_0111470_246_1460 375
644 3300048928 Ga0496125_0003063 Ga0496125_0003063_3056_4267 375
645 3300048928 Ga0496125_0010419 Ga0496125_0010419_7775_8986 375
646 3300048928 Ga0496125_0033809 Ga0496125_0033809_3033_4247 375
647 3300048929 Ga0496126_0057773 Ga0496126_0057773_2261_3472 375
648 3300048929 Ga0496126_0108265 Ga0496126_0108265_29_1240 375
649 3300003578 Ga0006562J51391_1181768 Ga0006562J51391_11817683 376
650 3300005457 Ga0070662_100069141 Ga0070662_1000691413 376
651 3300005844 Ga0068862_100290944 Ga0068862_1002909442 376
652 3300028380 Ga0268265_10269005 Ga0268265_102690052 376
653 3300048925 Ga0496122_0000383 Ga0496122_0000383_47060_48286 376
654 3300048926 Ga0496123_0000249 Ga0496123_0000249_46426_47652 376
655 iso_pu_bacteria 2842733646 2842736557 376
656 3300005335 Ga0070666_10156126 Ga0070666_101561261 377
657 3300006353 Ga0075370_10060462 Ga0075370_100604622 378
658 3300048904 Ga0496101_0016397 Ga0496101_0016397_392_1627 378
659 3300053136 Ga0500559_0028652 Ga0500559_0028652_493_1728 379
660 3300017792 Ga0163161_10000112 Ga0163161_1000011230 380
661 iso_pu_bacteria 2842747753 2842751811 381
662 iso_pu_bacteria 2842677519 2842680011 382
663 iso_pu_bacteria 2904449895 2904455369 382
664 iso_pu_bacteria 2904456579 2904460537 382
665 iso_pu_bacteria 2919462493 2919464321 382
666 iso_pu_bacteria 2929520902 2929524745 382
667 iso_pu_bacteria 2945945610 2945947140 382
668 iso_pu_bacteria 2643221683 2644468757 383
669 iso_pu_bacteria 2928084124 2928085098 383
670 iso_pu_bacteria 2904541872 2904548518 384
671 iso_pu_bacteria 2929160207 2929163916 384
672 iso_pu_bacteria 2945909444 2945912618 384
673 iso_pu_bacteria 2945984333 2945985095 384
674 3300053140 Ga0500573_0055894 Ga0500573_0055894_489_1715 385
675 iso_pu_bacteria 2513020051 2513229919 385
676 iso_pu_bacteria 2599185214 2599624668 385
677 iso_pu_bacteria 2599185226 2599672470 385
678 iso_pu_bacteria 2599185227 2599683470 385
679 iso_pu_bacteria 2599185229 2599694079 385
680 iso_pu_bacteria 2643221672 2644398491 385
681 iso_pu_bacteria 2738541277 2738720063 385
682 iso_pu_bacteria 2738543019 2739279262 385
683 iso_pu_bacteria 2885198086 2885201403 385
684 iso_pu_bacteria 2885211737 2885215017 385
685 iso_pu_bacteria 2928070936 2928070941 385
686 3300006038 Ga0075365_10035205 Ga0075365_100352052 386
687 3300006048 Ga0075363_100031238 Ga0075363_1000312382 386
688 3300006051 Ga0075364_10000869 Ga0075364_100008698 386
689 3300006177 Ga0075362_10026108 Ga0075362_100261082 386
690 3300006195 Ga0075366_10001544 Ga0075366_100015447 386
691 3300014497 Ga0182008_10074379 Ga0182008_100743791 386
692 3300048922 Ga0496119_0081901 Ga0496119_0081901_16_1281 386
693 3300050491 nmdc:mga00v17_26459_c1 nmdc:mga00v17_26459_c1_849_2075 386
694 3300050493 nmdc:mga0k408_7920_c1 nmdc:mga0k408_7920_c1_4226_5452 386
695 iso_pu_bacteria 2818991446 2819596056 386
696 iso_pu_bacteria 2831265667 2831270626 386
697 iso_pu_bacteria 2838054893 2838056850 386
698 iso_pu_bacteria 2899924645 2899925406 386
699 iso_pu_bacteria 2928037797 2928038472 386
700 iso_pu_bacteria 2928044640 2928045923 386
701 iso_pu_bacteria 2928051484 2928053598 386
702 iso_pu_bacteria 2928064002 2928067145 386
703 3300003187 JGI25151J46595_10002663 JGI25151J46595_100026634 387
704 3300017792 Ga0163161_10017588 Ga0163161_100175882 387
705 3300025258 Ga0209129_1000953 Ga0209129_100095316 387
706 3300025294 Ga0209025_1000157 Ga0209025_1000157137 387
707 3300028794 Ga0307515_10089463 Ga0307515_100894632 387
708 3300046459 Ga0495629_0127673 Ga0495629_0127673_109_1338 387
709 3300046460 Ga0495638_0130496 Ga0495638_0130496_129_1358 387
710 3300046513 Ga0495616_0056455 Ga0495616_0056455_477_1706 387
711 3300046518 Ga0495631_0001035 Ga0495631_0001035_11452_12681 387
712 3300046525 Ga0495663_0028520 Ga0495663_0028520_396_1625 387
713 3300046530 Ga0495654_0014979 Ga0495654_0014979_2326_3555 387
714 3300046539 Ga0495621_0005626 Ga0495621_0005626_1869_3098 387
715 3300047321 Ga0495676_0201586 Ga0495676_0201586_42_1271 387
716 3300047673 Ga0495593_0040256 Ga0495593_0040256_238_1467 387
717 3300048089 Ga0495614_0009428 Ga0495614_0009428_1278_2507 387
718 3300048924 Ga0496121_0103589 Ga0496121_0103589_62_1291 387
719 3300048926 Ga0496123_0087819 Ga0496123_0087819_387_1616 387
720 3300048928 Ga0496125_0081548 Ga0496125_0081548_821_2050 387
721 3300053087 Ga0500643_009332 Ga0500643_009332_572_1801 387
722 3300053087 Ga0500643_026819 Ga0500643_026819_77_1306 387
723 3300053093 Ga0500651_0004536 Ga0500651_0004536_3166_4395 387
724 3300053110 Ga0500571_000069 Ga0500571_000069_10661_11890 387
725 3300053118 Ga0500594_0006047 Ga0500594_0006047_865_2094 387
726 3300053133 Ga0500655_007412 Ga0500655_007412_286_1515 387
727 3300053134 Ga0500658_0000431 Ga0500658_0000431_12191_13420 387
728 3300053139 Ga0500568_0016093 Ga0500568_0016093_442_1671 387
729 3300053161 Ga0500634_0085113 Ga0500634_0085113_135_1364 387
730 3300003187 JGI25151J46595_10011420 JGI25151J46595_100114202 388
731 3300025294 Ga0209025_1002440 Ga0209025_10024403 388
732 3300025298 Ga0209050_1006373 Ga0209050_10063732 388
733 3300031731 Ga0307405_10017652 Ga0307405_100176522 388
734 3300048919 Ga0496116_0055289 Ga0496116_0055289_396_1625 388
735 3300048920 Ga0496117_0044104 Ga0496117_0044104_303_1532 388
736 3300048924 Ga0496121_0085261 Ga0496121_0085261_861_2090 388
737 3300003761 Ga0055535_1000666 Ga0055535_100066610 389
738 3300003762 Ga0055542_1000004 Ga0055542_1000004263 389
739 3300003781 Ga0055536_1014613 Ga0055536_10146132 389
740 3300003792 Ga0055540_1001549 Ga0055540_10015492 389
741 3300003794 Ga0055531_10002149 Ga0055531_100021492 389
742 3300005457 Ga0070662_100048896 Ga0070662_1000488962 389
743 3300005564 Ga0070664_100027548 Ga0070664_1000275485 389
744 3300009036 Ga0105244_10043425 Ga0105244_100434252 389
745 3300009148 Ga0105243_10006509 Ga0105243_100065092 389
746 3300011119 Ga0105246_10011450 Ga0105246_100114503 389
747 3300014497 Ga0182008_10008507 Ga0182008_100085073 389
748 3300015261 Ga0182006_1012334 Ga0182006_10123343 389
749 3300015262 Ga0182007_10001268 Ga0182007_1000126810 389
750 3300025229 Ga0209147_102086 Ga0209147_1020862 389
751 3300025242 Ga0209258_100022 Ga0209258_100022263 389
752 3300025254 Ga0209148_1000034 Ga0209148_1000034263 389
753 3300025292 Ga0209676_1001458 Ga0209676_10014587 389
754 3300025298 Ga0209050_1004848 Ga0209050_10048484 389
755 3300025303 Ga0209051_1000490 Ga0209051_100049018 389
756 3300025304 Ga0209257_1000508 Ga0209257_100050828 389
757 3300025728 Ga0207655_1015186 Ga0207655_10151863 389
758 3300025933 Ga0207706_10011277 Ga0207706_100112772 389
759 3300025935 Ga0207709_10001944 Ga0207709_1000194413 389
760 3300025945 Ga0207679_10145666 Ga0207679_101456662 389
761 3300026041 Ga0207639_10031709 Ga0207639_100317093 389
762 3300032005 Ga0307411_10065567 Ga0307411_100655672 389
763 3300048919 Ga0496116_0015902 Ga0496116_0015902_1746_2978 389
764 3300048921 Ga0496118_0009975 Ga0496118_0009975_1245_2477 389
765 3300048928 Ga0496125_0091310 Ga0496125_0091310_829_2061 389
766 3300053079 Ga0500610_0000129 Ga0500610_0000129_19536_20771 389
767 3300053079 Ga0500610_0000353 Ga0500610_0000353_2136_3371 389
768 3300053121 Ga0500607_002984 Ga0500607_002984_473_1708 389
769 3300053158 Ga0500627_0022641 Ga0500627_0022641_841_2076 389
770 3300053161 Ga0500634_0038196 Ga0500634_0038196_675_1910 389
771 3300002773 JGI25152J39213_1003716 JGI25152J39213_10037164 390
772 3300002774 JGI25150J39212_1000516 JGI25150J39212_10005167 390
773 3300003187 JGI25151J46595_10004960 JGI25151J46595_100049605 390
774 3300003187 JGI25151J46595_10008047 JGI25151J46595_100080474 390
775 3300003215 JGI25153J46596_10008011 JGI25153J46596_100080114 390
776 3300003354 JGI25160J50197_1007467 JGI25160J50197_10074672 390
777 3300003374 JGI25161J50226_1002008 JGI25161J50226_10020084 390
778 3300003771 Ga0055526_1002492 Ga0055526_10024925 390
779 3300003771 Ga0055526_1004332 Ga0055526_10043322 390
780 3300003773 Ga0055537_1003180 Ga0055537_10031804 390
781 3300003773 Ga0055537_1004038 Ga0055537_10040384 390
782 3300003775 Ga0055524_1001657 Ga0055524_10016579 390
783 3300003775 Ga0055524_1002900 Ga0055524_10029002 390
784 3300003781 Ga0055536_1001228 Ga0055536_10012287 390
785 3300003784 Ga0055534_1002803 Ga0055534_10028031 390
786 3300003784 Ga0055534_1003292 Ga0055534_10032922 390
787 3300003790 Ga0055528_1003080 Ga0055528_10030808 390
788 3300003790 Ga0055528_1008705 Ga0055528_10087054 390
789 3300003791 Ga0055530_10002436 Ga0055530_1000243610 390
790 3300003792 Ga0055540_1002782 Ga0055540_10027825 390
791 3300003792 Ga0055540_1007507 Ga0055540_10075073 390
792 3300003794 Ga0055531_10002174 Ga0055531_100021749 390
793 3300003794 Ga0055531_10011070 Ga0055531_100110702 390
794 3300004625 Ga0055543_1005580 Ga0055543_10055802 390
795 3300005262 Ga0065165_1007823 Ga0065165_10078233 390
796 3300005262 Ga0065165_1008247 Ga0065165_10082472 390
797 3300006353 Ga0075370_10111819 Ga0075370_101118192 390
798 3300025208 Ga0209436_102418 Ga0209436_1024185 390
799 3300025245 Ga0207425_1000138 Ga0207425_100013839 390
800 3300025258 Ga0209129_1000023 Ga0209129_1000023344 390
801 3300025258 Ga0209129_1000558 Ga0209129_100055824 390
802 3300025258 Ga0209129_1010257 Ga0209129_10102572 390
803 3300025263 Ga0209565_1000403 Ga0209565_100040323 390
804 3300025263 Ga0209565_1001326 Ga0209565_10013269 390
805 3300025273 Ga0209673_1000673 Ga0209673_100067324 390
806 3300025273 Ga0209673_1000928 Ga0209673_100092815 390
807 3300025273 Ga0209673_1001532 Ga0209673_10015329 390
808 3300025284 Ga0209130_1000222 Ga0209130_100022224 390
809 3300025284 Ga0209130_1000763 Ga0209130_100076322 390
810 3300025291 Ga0209675_1000600 Ga0209675_100060018 390
811 3300025291 Ga0209675_1001514 Ga0209675_10015149 390
812 3300025292 Ga0209676_1000005 Ga0209676_1000005456 390
813 3300025292 Ga0209676_1001885 Ga0209676_10018855 390
814 3300025294 Ga0209025_1000476 Ga0209025_100047652 390
815 3300025294 Ga0209025_1014572 Ga0209025_10145722 390
816 3300025295 Ga0209564_1000400 Ga0209564_100040049 390
817 3300025295 Ga0209564_1000898 Ga0209564_100089816 390
818 3300025297 Ga0209758_1000064 Ga0209758_1000064245 390
819 3300025297 Ga0209758_1027615 Ga0209758_10276152 390
820 3300025298 Ga0209050_1000007 Ga0209050_1000007641 390
821 3300025299 Ga0209256_1000038 Ga0209256_1000038321 390
822 3300025299 Ga0209256_1000115 Ga0209256_100011552 390
823 3300025302 Ga0207426_1000001 Ga0207426_10000011251 390
824 3300025302 Ga0207426_1000785 Ga0207426_100078510 390
825 3300025303 Ga0209051_1000009 Ga0209051_1000009456 390
826 3300025303 Ga0209051_1009860 Ga0209051_10098605 390
827 3300025303 Ga0209051_1036657 Ga0209051_10366571 390
828 3300025304 Ga0209257_1000011 Ga0209257_1000011430 390
829 3300025304 Ga0209257_1004648 Ga0209257_10046482 390

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mhx-assembly1.cif.gz_B structure of human trpv3 in the presence of 2-apb in c2 symmetry (2) 0.5992 233 359
7xj0-assembly1.cif.gz_A structure of human trpv3 in complex with trpvicin 0.5959 234 357
7xj0-assembly1.cif.gz_C structure of human trpv3 in complex with trpvicin 0.5959 234 357
7xj1-assembly1.cif.gz_C structure of human trpv3_g573s in complex with trpvicin in c2 symmetry 0.5958 234 357
8slx-assembly1.cif.gz_A rat trpv2 bound with 1 cbd ligand in nanodiscs 0.5904 233 357
ID Description Score Start End Superfamily
af_Q2FVM4_1_215_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.5657 195 364 1.20.950.20
af_Q4DRV6_12_200_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.5568 202 354 1.20.1420.10
af_Q3TQR0_18_241_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5438 199 375 1.20.1070.10
af_Q8MSU3_391_577_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5419 233 357 1.20.120.1770
af_K7LCP6_14_173_1.20.85.10 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.5252 206 325 1.20.85.10
ID Description Score Start End GO Terms
AF-A0A847J9X4-F1-model_v4 Tricarballylate utilization protein TcuB 0.9418 176 390 GO:0016020
AF-A0A7G2M127-F1-model_v4 4Fe-4S ferredoxin 0.9411 269 365 GO:0016020
AF-A0A238IZX3-F1-model_v4 Uncharacterized protein 0.9301 236 381 GO:0016020
AF-A0A6N6X985-F1-model_v4 deleted 0.9266 266 380
AF-A0A4U6MF78-F1-model_v4 Tricarballylate utilization protein TcuB 0.9233 273 371 GO:0016020

Feature Viewer

pLDDT pTM Quality
74.04 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map