F482602

General Info

Members Datasets Scaffolds Average Seq Length
829 304 1658 153

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10156652|Ga0114129_101566523
Length 175
Sequence LNWWIDYSQFRNAITRLSNYPMQILARCPKCDAGLPVRAAEAPSAITCGRCGREIPLAISDEVRADRAVDRCPVCSGADFYIRKDFDPKLGLTVVIVGALISAAFYWFGRDLIAYGILAAAVMIDLVVYGRLKDVTVCYRCHTEFRGAYQRRAHAFDLHTADVLEVEYQRRVGRR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
188 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
189 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
299 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
300 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
301 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
302 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
303 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
304 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 4.58
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 31.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10156652 3300009147 Bacteria 3114
2 JGI24751J29686_10119432 3300002459 Unclassified 554
3 JGI25406J46586_10066766 3300003203 Unclassified 1141
4 Ga0065712_10080601 3300005290 Bacteria 3089
5 Ga0065712_10085558 3300005290 Bacteria 2690
6 Ga0065715_10004337 3300005293 Bacteria 4780
7 Ga0065707_10719682 3300005295 Bacteria 631
8 Ga0070676_10001366 3300005328 Bacteria 12293
9 Ga0070676_10297136 3300005328 Bacteria 1093
10 Ga0070683_100027315 3300005329 Bacteria 5146
11 Ga0070683_100715514 3300005329 Bacteria 959
12 Ga0070690_100091555 3300005330 Bacteria 2003
13 Ga0070670_100278997 3300005331 Unclassified 1459
14 Ga0070670_100330316 3300005331 Bacteria 1337
15 Ga0070670_100492404 3300005331 Bacteria 1089
16 Ga0070670_101140811 3300005331 Unclassified 711
17 Ga0070670_101649569 3300005331 Bacteria 590
18 Ga0070677_10090386 3300005333 Bacteria 1330
19 Ga0068869_100093012 3300005334 Unclassified 2271
20 Ga0068869_100608189 3300005334 Unclassified 924
21 Ga0068869_100962682 3300005334 Unclassified 741
22 Ga0070666_10125697 3300005335 Unclassified 1780
23 Ga0070666_10361826 3300005335 Bacteria 1039
24 Ga0070680_100469098 3300005336 Bacteria 1076
25 Ga0070682_100582661 3300005337 Unclassified 880
26 Ga0068868_100101430 3300005338 Bacteria 2329
27 Ga0068868_100107428 3300005338 Bacteria 2265
28 Ga0068868_100111675 3300005338 Unclassified 2221
29 Ga0068868_100115424 3300005338 Archaea 2186
30 Ga0068868_100252123 3300005338 Bacteria 1486
31 Ga0068868_101705561 3300005338 Unclassified 594
32 Ga0070660_100283566 3300005339 Unclassified 1356
33 Ga0070660_101391044 3300005339 Unclassified 596
34 Ga0070660_101679240 3300005339 Unclassified 541
35 Ga0070689_100079981 3300005340 Unclassified 2565
36 Ga0070689_100175558 3300005340 Unclassified 1738
37 Ga0070689_100922111 3300005340 Unclassified 774
38 Ga0070691_10055702 3300005341 Bacteria 1894
39 Ga0070687_100178877 3300005343 Bacteria 1269
40 Ga0070687_100368194 3300005343 Bacteria 932
41 Ga0070661_100690040 3300005344 Bacteria 831
42 Ga0070692_11040805 3300005345 Bacteria 575
43 Ga0070668_100012918 3300005347 Bacteria 6220
44 Ga0070668_100245130 3300005347 Unclassified 1486
45 Ga0070669_100029378 3300005353 Bacteria 3962
46 Ga0070669_100030711 3300005353 Bacteria 3878
47 Ga0070669_100117442 3300005353 Unclassified 2025
48 Ga0070669_100471046 3300005353 Unclassified 1038
49 Ga0070675_100042892 3300005354 Bacteria 3696
50 Ga0070675_100052041 3300005354 Bacteria 3366
51 Ga0070675_100113918 3300005354 Bacteria 2291
52 Ga0070671_100093982 3300005355 Bacteria 2513
53 Ga0070671_100175613 3300005355 Bacteria 1812
54 Ga0070671_100720367 3300005355 Bacteria 866
55 Ga0070674_100015355 3300005356 Bacteria 4780
56 Ga0070674_100063609 3300005356 Bacteria 2583
57 Ga0070674_100288378 3300005356 Unclassified 1304
58 Ga0070674_100596543 3300005356 Bacteria 933
59 Ga0070673_101491223 3300005364 Bacteria 638
60 Ga0070688_100012569 3300005365 Bacteria 4746
61 Ga0070688_100043332 3300005365 Bacteria 2772
62 Ga0070659_100150356 3300005366 Unclassified 1899
63 Ga0070667_100036885 3300005367 Bacteria 4098
64 Ga0070667_101148144 3300005367 Unclassified 727
65 Ga0070710_10446136 3300005437 Bacteria 876
66 Ga0070701_10005792 3300005438 Bacteria 5144
67 Ga0070701_10218798 3300005438 Bacteria 1135
68 Ga0070701_10321110 3300005438 Unclassified 958
69 Ga0070701_10440643 3300005438 Bacteria 834
70 Ga0070701_10511201 3300005438 Unclassified 782
71 Ga0070711_100054973 3300005439 Unclassified 2749
72 Ga0070711_100125730 3300005439 Bacteria 1903
73 Ga0070705_100010712 3300005440 Bacteria 4599
74 Ga0070705_100073222 3300005440 Bacteria 2078
75 Ga0070705_100192297 3300005440 Unclassified 1392
76 Ga0070705_100261969 3300005440 Bacteria 1220
77 Ga0070700_100025011 3300005441 Bacteria 3513
78 Ga0070700_100115138 3300005441 Bacteria 1794
79 Ga0070700_100915304 3300005441 Unclassified 715
80 Ga0070694_100022280 3300005444 Bacteria 4058
81 Ga0070694_100032981 3300005444 Bacteria 3404
82 Ga0070694_100040457 3300005444 Bacteria 3108
83 Ga0070694_100201111 3300005444 Bacteria 1485
84 Ga0070694_100334650 3300005444 Bacteria 1169
85 Ga0070694_100612055 3300005444 Bacteria 878
86 Ga0070708_100195540 3300005445 Unclassified 1892
87 Ga0070708_100654014 3300005445 Unclassified 990
88 Ga0070708_100944648 3300005445 Bacteria 809
89 Ga0070663_101948614 3300005455 Unclassified 528
90 Ga0070678_100097821 3300005456 Bacteria 2267
91 Ga0070678_100332587 3300005456 Unclassified 1301
92 Ga0070678_100617645 3300005456 Bacteria 969
93 Ga0070678_101270789 3300005456 Bacteria 684
94 Ga0070662_100090753 3300005457 Bacteria 2294
95 Ga0070662_100237599 3300005457 Bacteria 1460
96 Ga0070662_100708816 3300005457 Bacteria 852
97 Ga0070681_10106845 3300005458 Bacteria 2740
98 Ga0070681_11403161 3300005458 Unclassified 622
99 Ga0068867_100002097 3300005459 Bacteria 13966
100 Ga0068867_100018173 3300005459 Bacteria 4996
101 Ga0068867_100020766 3300005459 Bacteria 4681
102 Ga0068867_100280302 3300005459 Bacteria 1367
103 Ga0068867_101108229 3300005459 Unclassified 723
104 Ga0068867_101917884 3300005459 Viruses 559
105 Ga0070685_10036929 3300005466 Unclassified 2764
106 Ga0070685_10294910 3300005466 Bacteria 1091
107 Ga0070706_100118543 3300005467 Unclassified 2466
108 Ga0070706_100839023 3300005467 Bacteria 850
109 Ga0070706_101108248 3300005467 Bacteria 729
110 Ga0070707_100052416 3300005468 Bacteria 3912
111 Ga0070707_100055342 3300005468 Bacteria 3804
112 Ga0070707_100081015 3300005468 Bacteria 3134
113 Ga0070698_100264789 3300005471 Unclassified 1651
114 Ga0070698_100378182 3300005471 Bacteria 1349
115 Ga0070698_100771027 3300005471 Unclassified 905
116 Ga0070699_100003176 3300005518 Bacteria 14548
117 Ga0070699_100071764 3300005518 Bacteria 3012
118 Ga0070699_100441730 3300005518 Unclassified 1179
119 Ga0070699_101008934 3300005518 Unclassified 763
120 Ga0070679_100076744 3300005530 Bacteria 3330
121 Ga0070679_100279722 3300005530 Unclassified 1621
122 Ga0070684_100079683 3300005535 Unclassified 2896
123 Ga0070684_100409608 3300005535 Bacteria 1251
124 Ga0070684_102098993 3300005535 Bacteria 533
125 Ga0070697_100085215 3300005536 Bacteria 2607
126 Ga0070697_100347162 3300005536 Bacteria 1281
127 Ga0070697_100794691 3300005536 Bacteria 837
128 Ga0068853_100713753 3300005539 Unclassified 957
129 Ga0070672_100063406 3300005543 Bacteria 2918
130 Ga0070672_100152394 3300005543 Bacteria 1913
131 Ga0070672_101481782 3300005543 Unclassified 608
132 Ga0070686_100215022 3300005544 Bacteria 1386
133 Ga0070695_100001441 3300005545 Bacteria 13201
134 Ga0070695_100107225 3300005545 Bacteria 1890
135 Ga0070695_100183413 3300005545 Bacteria 1484
136 Ga0070695_100205869 3300005545 Bacteria 1409
137 Ga0070695_101013941 3300005545 Bacteria 676
138 Ga0070696_100067973 3300005546 Bacteria 2501
139 Ga0070696_100082669 3300005546 Bacteria 2277
140 Ga0070696_100106555 3300005546 Bacteria 2015
141 Ga0070696_100260527 3300005546 Bacteria 1315
142 Ga0070696_100450416 3300005546 Bacteria 1015
143 Ga0070693_100363573 3300005547 Bacteria 994
144 Ga0070665_100016860 3300005548 Bacteria 7325
145 Ga0070665_100044841 3300005548 Bacteria 4439
146 Ga0070665_100344449 3300005548 Unclassified 1495
147 Ga0070665_101026335 3300005548 Bacteria 837
148 Ga0070704_100003928 3300005549 Bacteria 8561
149 Ga0070704_100023249 3300005549 Bacteria 4043
150 Ga0070704_100053861 3300005549 Bacteria 2845
151 Ga0070704_100140774 3300005549 Bacteria 1883
152 Ga0070704_100935212 3300005549 Bacteria 781
153 Ga0070704_101007162 3300005549 Unclassified 754
154 Ga0070664_100195327 3300005564 Bacteria 1804
155 Ga0070664_100927353 3300005564 Unclassified 817
156 Ga0070664_101396302 3300005564 Unclassified 662
157 Ga0068857_100078036 3300005577 Bacteria 2956
158 Ga0068857_100782875 3300005577 Bacteria 910
159 Ga0068854_100021553 3300005578 Bacteria 4373
160 Ga0068856_100994547 3300005614 Bacteria 857
161 Ga0070702_100000624 3300005615 Bacteria 13045
162 Ga0068852_100124584 3300005616 Bacteria 2364
163 Ga0068859_100002294 3300005617 Bacteria 19421
164 Ga0068859_100104173 3300005617 Bacteria 2896
165 Ga0068859_100697724 3300005617 Unclassified 1106
166 Ga0068859_101546121 3300005617 Unclassified 732
167 Ga0068859_101839530 3300005617 Bacteria 669
168 Ga0068864_100002167 3300005618 Bacteria 16210
169 Ga0068864_100104072 3300005618 Archaea 2521
170 Ga0068864_100124050 3300005618 Bacteria 2312
171 Ga0068864_101080178 3300005618 Unclassified 798
172 Ga0068864_102112207 3300005618 Unclassified 570
173 Ga0068866_10062469 3300005718 Bacteria 1938
174 Ga0068866_10107149 3300005718 Bacteria 1552
175 Ga0068866_10121207 3300005718 Bacteria 1474
176 Ga0068866_10122337 3300005718 Unclassified 1468
177 Ga0068866_10366790 3300005718 Unclassified 920
178 Ga0068861_100011220 3300005719 Bacteria 6219
179 Ga0068861_100029368 3300005719 Bacteria 4022
180 Ga0068861_100150503 3300005719 Bacteria 1909
181 Ga0068861_100173726 3300005719 Bacteria 1788
182 Ga0068861_100208885 3300005719 Unclassified 1643
183 Ga0068861_100295915 3300005719 Unclassified 1400
184 Ga0068870_10090174 3300005840 Unclassified 1712
185 Ga0068863_100012476 3300005841 Bacteria 8203
186 Ga0068863_100169686 3300005841 Unclassified 2092
187 Ga0068863_100217099 3300005841 Unclassified 1842
188 Ga0068863_100479810 3300005841 Bacteria 1223
189 Ga0068863_100548302 3300005841 Unclassified 1141
190 Ga0068863_101079181 3300005841 Bacteria 807
191 Ga0068858_100029645 3300005842 Bacteria 5082
192 Ga0068858_100107941 3300005842 Unclassified 2599
193 Ga0068858_100220278 3300005842 Bacteria 1797
194 Ga0068858_100693580 3300005842 Bacteria 991
195 Ga0068858_100825770 3300005842 Bacteria 905
196 Ga0068858_101677175 3300005842 Unclassified 627
197 Ga0068860_100138091 3300005843 Bacteria 2341
198 Ga0068860_100343474 3300005843 Unclassified 1468
199 Ga0068860_100789380 3300005843 Unclassified 963
200 Ga0068860_101184683 3300005843 Bacteria 784
201 Ga0068860_101480252 3300005843 Bacteria 700
202 Ga0068860_101672483 3300005843 Unclassified 658
203 Ga0068860_102041262 3300005843 Bacteria 595
204 Ga0068862_100036864 3300005844 Bacteria 4144
205 Ga0068862_100104747 3300005844 Bacteria 2478
206 Ga0068862_100138157 3300005844 Unclassified 2161
207 Ga0068862_100172887 3300005844 Bacteria 1935
208 Ga0068862_100205244 3300005844 Bacteria 1778
209 Ga0068862_102089397 3300005844 Bacteria 577
210 Ga0081455_10036603 3300005937 Bacteria 4367
211 Ga0081539_10025788 3300005985 Bacteria 3770
212 Ga0070717_10346298 3300006028 Bacteria 1328
213 Ga0070715_10381363 3300006163 Unclassified 778
214 Ga0070715_10565184 3300006163 Unclassified 661
215 Ga0097621_100004485 3300006237 Bacteria 9731
216 Ga0097621_100015314 3300006237 Bacteria 5767
217 Ga0097621_100019423 3300006237 Archaea 5214
218 Ga0097621_100021970 3300006237 Bacteria 4945
219 Ga0097621_100026579 3300006237 Bacteria 4543
220 Ga0097621_100042241 3300006237 Bacteria 3672
221 Ga0097621_100236837 3300006237 Bacteria 1595
222 Ga0097621_100324277 3300006237 Bacteria 1365
223 Ga0097621_100476857 3300006237 Bacteria 1127
224 Ga0068871_100036235 3300006358 Bacteria 3927
225 Ga0068871_100062149 3300006358 Bacteria 3051
226 Ga0068871_100067701 3300006358 Bacteria 2930
227 Ga0068871_100068350 3300006358 Bacteria 2917
228 Ga0068871_100323441 3300006358 Unclassified 1359
229 Ga0068871_100529875 3300006358 Unclassified 1065
230 Ga0068871_100542493 3300006358 Bacteria 1052
231 Ga0068871_100885050 3300006358 Bacteria 827
232 Ga0075428_100000005 3300006844 Bacteria 326130
233 Ga0075428_101773168 3300006844 Unclassified 643
234 Ga0075430_100694078 3300006846 Bacteria 839
235 Ga0075431_100051743 3300006847 Bacteria 4235
236 Ga0075431_100065918 3300006847 Bacteria 3739
237 Ga0075431_100241004 3300006847 Unclassified 1840
238 Ga0075431_102075655 3300006847 Unclassified 523
239 Ga0075433_10057392 3300006852 Bacteria 3403
240 Ga0075433_10081222 3300006852 Bacteria 2858
241 Ga0075433_10090819 3300006852 Unclassified 2700
242 Ga0075433_10144685 3300006852 Unclassified 2113
243 Ga0075433_10254376 3300006852 Unclassified 1558
244 Ga0075433_10565386 3300006852 Bacteria 999
245 Ga0075433_10681660 3300006852 Unclassified 901
246 Ga0075433_10870544 3300006852 Unclassified 786
247 Ga0075434_100011109 3300006871 Bacteria 8473
248 Ga0075434_100015041 3300006871 Bacteria 7410
249 Ga0075434_100034937 3300006871 Bacteria 4968
250 Ga0075434_100083214 3300006871 Bacteria 3197
251 Ga0075434_100096589 3300006871 Bacteria 2960
252 Ga0075434_101267968 3300006871 Bacteria 748
253 Ga0075434_101806781 3300006871 Bacteria 618
254 Ga0075429_100981222 3300006880 Unclassified 739
255 Ga0068865_100025544 3300006881 Bacteria 3886
256 Ga0068865_100266053 3300006881 Bacteria 1359
257 Ga0075436_100008336 3300006914 Bacteria 7088
258 Ga0075436_100012160 3300006914 Bacteria 5897
259 Ga0075436_100035527 3300006914 Bacteria 3437
260 Ga0075436_100036146 3300006914 Bacteria 3408
261 Ga0075436_100119305 3300006914 Bacteria 1844
262 Ga0075436_100139293 3300006914 Bacteria 1704
263 Ga0075436_100264288 3300006914 Bacteria 1227
264 Ga0075436_100770572 3300006914 Bacteria 715
265 Ga0097620_100002294 3300006931 Bacteria 19421
266 Ga0097620_100104178 3300006931 Bacteria 2896
267 Ga0097620_100697808 3300006931 Unclassified 1106
268 Ga0097620_101546126 3300006931 Unclassified 732
269 Ga0097620_101839484 3300006931 Bacteria 669
270 Ga0075435_100001816 3300007076 Bacteria 13876
271 Ga0075435_100008469 3300007076 Bacteria 7380
272 Ga0075435_100017880 3300007076 Bacteria 5374
273 Ga0075435_100046046 3300007076 Bacteria 3497
274 Ga0075435_100148399 3300007076 Unclassified 1970
275 Ga0075435_100290970 3300007076 Unclassified 1396
276 Ga0075435_100300717 3300007076 Bacteria 1372
277 Ga0105240_10096194 3300009093 Bacteria 3610
278 Ga0105240_10184954 3300009093 Unclassified 2455
279 Ga0105240_10195029 3300009093 Unclassified 2379
280 Ga0105240_10577173 3300009093 Bacteria 1241
281 Ga0105240_10865196 3300009093 Bacteria 975
282 Ga0111539_10000008 3300009094 Bacteria 382609
283 Ga0111539_10005984 3300009094 Bacteria 15714
284 Ga0111539_10006975 3300009094 Bacteria 14498
285 Ga0111539_10385263 3300009094 Bacteria 1632
286 Ga0111539_10495993 3300009094 Bacteria 1422
287 Ga0111539_10570386 3300009094 Unclassified 1318
288 Ga0111539_11092779 3300009094 Bacteria 927
289 Ga0111539_11803404 3300009094 Bacteria 709
290 Ga0105245_10001762 3300009098 Bacteria 19728
291 Ga0105245_10490012 3300009098 Unclassified 1244
292 Ga0105245_10832131 3300009098 Unclassified 962
293 Ga0105245_10920229 3300009098 Unclassified 917
294 Ga0105245_11661326 3300009098 Unclassified 691
295 Ga0105245_11803152 3300009098 Unclassified 665
296 Ga0105247_10004214 3300009101 Bacteria 9223
297 Ga0105247_10312784 3300009101 Bacteria 1093
298 Ga0114129_10002454 3300009147 Bacteria 25742
299 Ga0114129_10002522 3300009147 Bacteria 25425
300 Ga0114129_10004744 3300009147 Bacteria 19206
301 Ga0114129_10023846 3300009147 Bacteria 8671
302 Ga0114129_10024935 3300009147 Bacteria 8479
303 Ga0114129_10047223 3300009147 Bacteria 6051
304 Ga0114129_10072618 3300009147 Bacteria 4796
305 Ga0114129_10130146 3300009147 Unclassified 3458
306 Ga0114129_10275915 3300009147 Bacteria 2247
307 Ga0114129_10371477 3300009147 Unclassified 1890
308 Ga0114129_10540555 3300009147 Bacteria 1517
309 Ga0114129_10584291 3300009147 Bacteria 1449
310 Ga0114129_10772010 3300009147 Bacteria 1228
311 Ga0114129_10909681 3300009147 Unclassified 1114
312 Ga0114129_11232683 3300009147 Bacteria 930
313 Ga0114129_11305827 3300009147 Bacteria 899
314 Ga0114129_13288703 3300009147 Unclassified 523
315 Ga0105243_10114209 3300009148 Bacteria 2266
316 Ga0105243_10125552 3300009148 Bacteria 2170
317 Ga0105243_10636780 3300009148 Bacteria 1031
318 Ga0105243_10705238 3300009148 Bacteria 984
319 Ga0105243_10975912 3300009148 Unclassified 848
320 Ga0105243_11971661 3300009148 Bacteria 618
321 Ga0105243_12168049 3300009148 Bacteria 592
322 Ga0105241_10426591 3300009174 Bacteria 1168
323 Ga0105241_11862459 3300009174 Unclassified 589
324 Ga0105242_10004556 3300009176 Bacteria 10755
325 Ga0105242_10020139 3300009176 Bacteria 5229
326 Ga0105242_10180717 3300009176 Bacteria 1861
327 Ga0105242_10620726 3300009176 Bacteria 1047
328 Ga0105242_10687238 3300009176 Unclassified 999
329 Ga0105242_10893321 3300009176 Bacteria 888
330 Ga0105248_10003660 3300009177 Bacteria 17052
331 Ga0105248_10013961 3300009177 Bacteria 8838
332 Ga0105248_10032263 3300009177 Bacteria 5855
333 Ga0105248_10093625 3300009177 Bacteria 3384
334 Ga0105248_10271381 3300009177 Bacteria 1910
335 Ga0105248_10354140 3300009177 Unclassified 1653
336 Ga0105248_10609398 3300009177 Bacteria 1232
337 Ga0105248_10761816 3300009177 Bacteria 1092
338 Ga0105248_10772266 3300009177 Unclassified 1084
339 Ga0105248_11019394 3300009177 Bacteria 935
340 Ga0105248_11155448 3300009177 Bacteria 875
341 Ga0105248_11981664 3300009177 Unclassified 661
342 Ga0105248_12390472 3300009177 Bacteria 602
343 Ga0105237_10179635 3300009545 Bacteria 2117
344 Ga0105237_10381088 3300009545 Bacteria 1415
345 Ga0105238_10452037 3300009551 Bacteria 1282
346 Ga0105238_11002864 3300009551 Unclassified 856
347 Ga0105238_11551190 3300009551 Unclassified 692
348 Ga0105249_10086774 3300009553 Bacteria 2919
349 Ga0105249_10204042 3300009553 Bacteria 1936
350 Ga0105249_10426319 3300009553 Unclassified 1361
351 Ga0105249_10934912 3300009553 Bacteria 935
352 Ga0105249_10982552 3300009553 Bacteria 913
353 Ga0105249_11156046 3300009553 Bacteria 845
354 Ga0105249_12552079 3300009553 Bacteria 583
355 Ga0105239_10402639 3300010375 Bacteria 1549
356 Ga0105246_10324919 3300011119 Bacteria 1252
357 Ga0105246_10834380 3300011119 Bacteria 821
358 Ga0157374_10069568 3300013296 Unclassified 3314
359 Ga0157374_11305571 3300013296 Bacteria 748
360 Ga0157378_10389158 3300013297 Unclassified 1371
361 Ga0157378_10487422 3300013297 Unclassified 1229
362 Ga0157378_10924029 3300013297 Unclassified 904
363 Ga0163162_10101495 3300013306 Unclassified 2969
364 Ga0163162_10437192 3300013306 Bacteria 1440
365 Ga0163162_10747938 3300013306 Bacteria 1097
366 Ga0163162_10876752 3300013306 Unclassified 1012
367 Ga0157372_10989373 3300013307 Bacteria 974
368 Ga0157375_10074074 3300013308 Bacteria 3425
369 Ga0157375_10153304 3300013308 Bacteria 2441
370 Ga0157375_10261060 3300013308 Bacteria 1894
371 Ga0157375_10853739 3300013308 Unclassified 1057
372 Ga0163163_10002970 3300014325 Bacteria 14346
373 Ga0163163_10282799 3300014325 Bacteria 1710
374 Ga0163163_10609288 3300014325 Bacteria 1155
375 Ga0163163_10840811 3300014325 Unclassified 981
376 Ga0163163_11513013 3300014325 Bacteria 732
377 Ga0163163_12539303 3300014325 Unclassified 570
378 Ga0157380_10021482 3300014326 Bacteria 4841
379 Ga0157380_10239360 3300014326 Bacteria 1635
380 Ga0157380_10707289 3300014326 Bacteria 1013
381 Ga0157380_10729009 3300014326 Bacteria 1000
382 Ga0157380_10778206 3300014326 Bacteria 971
383 Ga0157380_11727852 3300014326 Bacteria 684
384 Ga0157380_12124772 3300014326 Unclassified 625
385 Ga0157377_10324658 3300014745 Bacteria 1024
386 Ga0157379_10009368 3300014968 Bacteria 8533
387 Ga0157379_10017186 3300014968 Bacteria 6372
388 Ga0157379_10045873 3300014968 Bacteria 3901
389 Ga0157379_10560859 3300014968 Unclassified 1063
390 Ga0157379_10935488 3300014968 Bacteria 824
391 Ga0157376_10007383 3300014969 Bacteria 7842
392 Ga0157376_10023512 3300014969 Bacteria 4823
393 Ga0157376_10026344 3300014969 Bacteria 4593
394 Ga0157376_10397908 3300014969 Unclassified 1331
395 Ga0157376_11420530 3300014969 Unclassified 726
396 Ga0157376_11763356 3300014969 Bacteria 655
397 Ga0163161_10385455 3300017792 Bacteria 1121
398 Ga0163161_10780624 3300017792 Bacteria 801
399 Ga0213876_10454800 3300021384 Bacteria 681
400 Ga0207697_10167434 3300025315 Bacteria 960
401 Ga0207642_10190676 3300025899 Bacteria 1124
402 Ga0207642_10243649 3300025899 Bacteria 1016
403 Ga0207680_10069645 3300025903 Unclassified 2174
404 Ga0207680_10158042 3300025903 Bacteria 1517
405 Ga0207685_10395022 3300025905 Unclassified 707
406 Ga0207685_10395982 3300025905 Bacteria 707
407 Ga0207699_10015778 3300025906 Bacteria 3934
408 Ga0207645_10002091 3300025907 Bacteria 15970
409 Ga0207645_10351971 3300025907 Unclassified 986
410 Ga0207643_10730658 3300025908 Unclassified 640
411 Ga0207684_10956167 3300025910 Unclassified 718
412 Ga0207654_10527712 3300025911 Bacteria 836
413 Ga0207707_10279452 3300025912 Unclassified 1446
414 Ga0207707_10820702 3300025912 Bacteria 773
415 Ga0207695_10170769 3300025913 Bacteria 2100
416 Ga0207695_10191257 3300025913 Bacteria 1964
417 Ga0207695_10634378 3300025913 Bacteria 949
418 Ga0207695_10758946 3300025913 Unclassified 850
419 Ga0207660_10138464 3300025917 Bacteria 1859
420 Ga0207660_10906661 3300025917 Unclassified 719
421 Ga0207662_10270528 3300025918 Unclassified 1121
422 Ga0207662_10377975 3300025918 Bacteria 956
423 Ga0207657_10257276 3300025919 Unclassified 1390
424 Ga0207657_10969041 3300025919 Unclassified 653
425 Ga0207649_10822657 3300025920 Bacteria 726
426 Ga0207652_10547397 3300025921 Unclassified 1040
427 Ga0207652_11504502 3300025921 Unclassified 577
428 Ga0207646_10043289 3300025922 Bacteria 4044
429 Ga0207646_10051452 3300025922 Bacteria 3686
430 Ga0207646_10153206 3300025922 Unclassified 2079
431 Ga0207646_10568852 3300025922 Bacteria 1018
432 Ga0207646_10876785 3300025922 Bacteria 797
433 Ga0207681_10043056 3300025923 Bacteria 3020
434 Ga0207681_10082383 3300025923 Bacteria 2274
435 Ga0207681_10130141 3300025923 Bacteria 1859
436 Ga0207681_10472243 3300025923 Unclassified 1023
437 Ga0207694_11030440 3300025924 Unclassified 696
438 Ga0207650_10042085 3300025925 Bacteria 3351
439 Ga0207650_10046439 3300025925 Bacteria 3198
440 Ga0207650_10078551 3300025925 Bacteria 2497
441 Ga0207650_10479189 3300025925 Bacteria 1038
442 Ga0207650_10710911 3300025925 Bacteria 849
443 Ga0207650_10967420 3300025925 Unclassified 724
444 Ga0207659_10000452 3300025926 Bacteria 24737
445 Ga0207659_10033882 3300025926 Bacteria 3518
446 Ga0207659_10581749 3300025926 Unclassified 953
447 Ga0207659_10678944 3300025926 Unclassified 881
448 Ga0207659_10962004 3300025926 Unclassified 734
449 Ga0207687_10299088 3300025927 Bacteria 1296
450 Ga0207687_10467323 3300025927 Unclassified 1048
451 Ga0207700_10055736 3300025928 Bacteria 2972
452 Ga0207644_10087083 3300025931 Bacteria 2321
453 Ga0207644_11253300 3300025931 Bacteria 623
454 Ga0207690_11168266 3300025932 Unclassified 642
455 Ga0207706_10159756 3300025933 Bacteria 1981
456 Ga0207706_10189351 3300025933 Bacteria 1806
457 Ga0207706_10220485 3300025933 Unclassified 1661
458 Ga0207706_10244056 3300025933 Bacteria 1570
459 Ga0207706_10396176 3300025933 Bacteria 1197
460 Ga0207706_10991269 3300025933 Unclassified 706
461 Ga0207686_10086937 3300025934 Unclassified 2055
462 Ga0207686_10250266 3300025934 Bacteria 1294
463 Ga0207686_10670262 3300025934 Bacteria 822
464 Ga0207709_10105681 3300025935 Bacteria 1871
465 Ga0207670_10153243 3300025936 Unclassified 1712
466 Ga0207670_10356899 3300025936 Unclassified 1159
467 Ga0207669_10024470 3300025937 Bacteria 3246
468 Ga0207669_10469371 3300025937 Bacteria 1001
469 Ga0207669_10931994 3300025937 Unclassified 727
470 Ga0207704_10097737 3300025938 Bacteria 1948
471 Ga0207704_10366677 3300025938 Bacteria 1126
472 Ga0207704_10472621 3300025938 Bacteria 1005
473 Ga0207665_10055349 3300025939 Bacteria 2676
474 Ga0207691_10010298 3300025940 Bacteria 8969
475 Ga0207691_10105363 3300025940 Bacteria 2512
476 Ga0207691_10262209 3300025940 Bacteria 1490
477 Ga0207711_10024485 3300025941 Bacteria 5059
478 Ga0207711_10107549 3300025941 Bacteria 2476
479 Ga0207711_10150743 3300025941 Unclassified 2098
480 Ga0207711_10274636 3300025941 Bacteria 1551
481 Ga0207711_10372624 3300025941 Bacteria 1324
482 Ga0207711_10469466 3300025941 Unclassified 1172
483 Ga0207711_10725475 3300025941 Unclassified 927
484 Ga0207711_10885461 3300025941 Unclassified 830
485 Ga0207711_11766710 3300025941 Unclassified 562
486 Ga0207689_10066268 3300025942 Unclassified 2970
487 Ga0207689_10243431 3300025942 Bacteria 1487
488 Ga0207689_10712667 3300025942 Bacteria 846
489 Ga0207661_10893755 3300025944 Bacteria 818
490 Ga0207679_10898551 3300025945 Unclassified 810
491 Ga0207651_10059893 3300025960 Bacteria 2640
492 Ga0207651_10146338 3300025960 Bacteria 1833
493 Ga0207651_10202200 3300025960 Bacteria 1593
494 Ga0207651_10987054 3300025960 Unclassified 752
495 Ga0207651_11430528 3300025960 Unclassified 622
496 Ga0207712_10184534 3300025961 Bacteria 1641
497 Ga0207712_11569295 3300025961 Unclassified 590
498 Ga0207668_10073037 3300025972 Unclassified 2457
499 Ga0207668_10078354 3300025972 Bacteria 2386
500 Ga0207668_10951756 3300025972 Bacteria 766
501 Ga0207640_10013049 3300025981 Bacteria 4751
502 Ga0207640_10522898 3300025981 Bacteria 992
503 Ga0207640_11901567 3300025981 Bacteria 538
504 Ga0207658_10024715 3300025986 Bacteria 4204
505 Ga0207677_10023554 3300026023 Unclassified 3807
506 Ga0207677_10729951 3300026023 Unclassified 881
507 Ga0207703_10010553 3300026035 Bacteria 7223
508 Ga0207703_10019535 3300026035 Bacteria 5295
509 Ga0207703_10085620 3300026035 Unclassified 2638
510 Ga0207703_10092312 3300026035 Unclassified 2548
511 Ga0207703_10308848 3300026035 Bacteria 1445
512 Ga0207703_10534291 3300026035 Bacteria 1104
513 Ga0207703_10762856 3300026035 Unclassified 922
514 Ga0207703_11034608 3300026035 Unclassified 788
515 Ga0207639_10672373 3300026041 Unclassified 959
516 Ga0207708_10007933 3300026075 Bacteria 7868
517 Ga0207708_10040406 3300026075 Bacteria 3557
518 Ga0207708_10060056 3300026075 Bacteria 2902
519 Ga0207708_11002572 3300026075 Bacteria 726
520 Ga0207641_10001556 3300026088 Bacteria 22467
521 Ga0207641_10040115 3300026088 Bacteria 3918
522 Ga0207641_10340522 3300026088 Bacteria 1427
523 Ga0207641_10462193 3300026088 Unclassified 1228
524 Ga0207648_10003842 3300026089 Bacteria 15693
525 Ga0207648_10053331 3300026089 Bacteria 3534
526 Ga0207648_10342720 3300026089 Bacteria 1346
527 Ga0207676_10035030 3300026095 Bacteria 3805
528 Ga0207676_10087713 3300026095 Archaea 2545
529 Ga0207676_10259837 3300026095 Bacteria 1567
530 Ga0207674_10065546 3300026116 Bacteria 3660
531 Ga0207674_10198566 3300026116 Bacteria 1955
532 Ga0207674_11063895 3300026116 Unclassified 778
533 Ga0207675_100004284 3300026118 Bacteria 13796
534 Ga0207675_100025632 3300026118 Bacteria 5487
535 Ga0207675_100038973 3300026118 Bacteria 4435
536 Ga0207675_100166723 3300026118 Bacteria 2104
537 Ga0207675_100232631 3300026118 Bacteria 1778
538 Ga0207675_102065467 3300026118 Unclassified 587
539 Ga0207683_10127404 3300026121 Unclassified 2289
540 Ga0207683_10152629 3300026121 Unclassified 2085
541 Ga0207683_10195122 3300026121 Bacteria 1839
542 Ga0207683_10949869 3300026121 Bacteria 798
543 Ga0207683_11692932 3300026121 Bacteria 582
544 Ga0207698_10541608 3300026142 Bacteria 1139
545 Ga0207428_10000019 3300027907 Bacteria 276945
546 Ga0207428_10032336 3300027907 Bacteria 4303
547 Ga0207428_10115323 3300027907 Unclassified 2064
548 Ga0268266_10027359 3300028379 Bacteria 4850
549 Ga0268266_10075175 3300028379 Bacteria 2934
550 Ga0268266_10128250 3300028379 Bacteria 2266
551 Ga0268266_11837429 3300028379 Unclassified 580
552 Ga0268265_10007747 3300028380 Bacteria 7249
553 Ga0268265_10013365 3300028380 Bacteria 5578
554 Ga0268265_10019194 3300028380 Bacteria 4747
555 Ga0268264_10061651 3300028381 Bacteria 3147
556 Ga0268264_10111140 3300028381 Unclassified 2400
557 Ga0268264_10438819 3300028381 Bacteria 1263
558 Ga0268264_10816406 3300028381 Unclassified 932
559 Ga0268264_11073354 3300028381 Unclassified 813
560 Ga0265336_10023671 3300028666 Bacteria 1946
561 Ga0265332_10054475 3300031238 Unclassified 1716
562 Ga0307408_100578861 3300031548 Bacteria 994
563 Ga0307408_100588344 3300031548 Unclassified 987
564 Ga0307405_10004523 3300031731 Bacteria 6583
565 Ga0307413_10011495 3300031824 Bacteria 4359
566 Ga0307413_10494734 3300031824 Unclassified 980
567 Ga0307410_10024578 3300031852 Bacteria 3766
568 Ga0307410_10026753 3300031852 Bacteria 3636
569 Ga0307406_10007138 3300031901 Bacteria 6187
570 Ga0307407_10005639 3300031903 Bacteria 5459
571 Ga0307407_10074004 3300031903 Bacteria 2037
572 Ga0307412_10042454 3300031911 Bacteria 2955
573 Ga0307409_100002717 3300031995 Bacteria 9338
574 Ga0307409_100033865 3300031995 Bacteria 3723
575 Ga0307409_100727550 3300031995 Bacteria 994
576 Ga0307416_100770534 3300032002 Unclassified 1056
577 Ga0307414_10005333 3300032004 Bacteria 7073
578 Ga0307414_10072664 3300032004 Unclassified 2486
579 Ga0307411_10018419 3300032005 Bacteria 4004
580 Ga0307411_10056903 3300032005 Bacteria 2580
581 Ga0307411_10153677 3300032005 Unclassified 1714
582 Ga0307415_100150420 3300032126 Bacteria 1791
583 Ga0373948_0000509 3300034817 Bacteria 4866
584 Ga0373958_0016317 3300034819 Unclassified 1322
585 Ga0373959_0001115 3300034820 Bacteria 4371
586 Ga0373938_0000914 3300034957 Bacteria 4724
587 Ga0373928_0003690 3300035084 Bacteria 2920
588 Ga0373929_0001665 3300035085 Bacteria 4199
589 Ga0373940_0008914 3300035088 Bacteria 2317
590 Ga0373940_0171412 3300035088 Bacteria 701
591 Ga0373949_0000482 3300035090 Bacteria 13633
592 Ga0373951_0000509 3300035091 Bacteria 11092
593 Ga0373952_0000226 3300035092 Bacteria 9044
594 Ga0373952_0275102 3300035092 Bacteria 517
595 Ga0373923_0544803 3300035111 Unclassified 568
596 Ga0373932_0002843 3300035112 Bacteria 4283
597 Ga0373932_0269964 3300035112 Bacteria 626
598 Ga0373939_0000720 3300035114 Bacteria 8195
599 Ga0373939_0017908 3300035114 Bacteria 1889
600 Ga0373941_0001206 3300035115 Bacteria 5410
601 Ga0373945_0052675 3300035116 Unclassified 1500
602 Ga0373953_0262848 3300035117 Bacteria 751
603 Ga0373956_0124444 3300035119 Bacteria 1205
604 Ga0373957_0178833 3300035120 Bacteria 879
605 Ga0373957_0195768 3300035120 Unclassified 841
606 Ga0373960_0002697 3300035121 Bacteria 4015
607 Ga0373942_0001963 3300035207 Bacteria 5138
608 Ga0373961_0001603 3300035241 Bacteria 6432
609 Ga0373962_0004201 3300035242 Bacteria 3471
610 Ga0373962_0007357 3300035242 Bacteria 2696
611 Ga0373931_0000488 3300035691 Bacteria 16182
612 Ga0373931_0096249 3300035691 Unclassified 1658
613 Ga0373931_0214019 3300035691 Bacteria 1157
614 Ga0373935_0976698 3300035692 Unclassified 629
615 Ga0373927_0238985 3300035695 Bacteria 1194
616 Ga0373927_0347378 3300035695 Bacteria 978
617 Ga0373927_1044381 3300035695 Bacteria 539
618 Ga0373933_0275446 3300035724 Bacteria 1087
619 Ga0373947_0991536 3300035725 Unclassified 573
620 Ga0373937_0241425 3300036401 Bacteria 1702
621 Ga0373937_0293586 3300036401 Unclassified 1536
622 Ga0373937_0483143 3300036401 Unclassified 1177
623 Ga0373937_0533155 3300036401 Unclassified 1115
624 Ga0373937_1527814 3300036401 Bacteria 615
625 Ga0373925_0217272 3300037068 Bacteria 1525
626 Ga0373925_0260971 3300037068 Bacteria 1392
627 Ga0373925_1291666 3300037068 Bacteria 599
628 Ga0436365_0147401 3300039437 Bacteria 1121
629 Ga0436365_0783264 3300039437 Unclassified 940
630 Ga0439461_0169737 3300041410 Bacteria 573
631 Ga0466963_0034100 3300044694 Bacteria 3311
632 Ga0451576_0035736 3300045051 Bacteria 5269
633 Ga0451576_0471764 3300045051 Unclassified 1318
634 Ga0451576_0574926 3300045051 Bacteria 1184
635 Ga0466967_0114487 3300045976 Bacteria 2483
636 Ga0495592_0039982 3300046454 Bacteria 3521
637 Ga0495629_0728659 3300046459 Unclassified 657
638 Ga0495629_0885322 3300046459 Unclassified 586
639 Ga0495651_0307638 3300046462 Unclassified 1061
640 Ga0495653_0743868 3300046463 Unclassified 593
641 Ga0495580_0239561 3300046472 Unclassified 1244
642 Ga0495580_0315459 3300046472 Bacteria 1063
643 Ga0495580_0496614 3300046472 Bacteria 815
644 Ga0495639_0658393 3300046475 Unclassified 540
645 Ga0495662_0176579 3300046476 Unclassified 1053
646 Ga0495608_0004888 3300046511 Bacteria 9591
647 Ga0495618_0258946 3300046514 Unclassified 1090
648 Ga0495628_0099882 3300046516 Bacteria 2240
649 Ga0495628_0233517 3300046516 Unclassified 1378
650 Ga0495628_0320848 3300046516 Unclassified 1143
651 Ga0495630_0035961 3300046517 Bacteria 3702
652 Ga0495630_0855087 3300046517 Unclassified 694
653 Ga0495652_0062779 3300046529 Bacteria 3131
654 Ga0495640_0430106 3300046533 Bacteria 808
655 Ga0495586_0055765 3300046535 Unclassified 2142
656 Ga0495586_0241916 3300046535 Unclassified 1029
657 Ga0495586_0460655 3300046535 Unclassified 733
658 Ga0495645_0090377 3300046543 Archaea 2188
659 Ga0495645_0100298 3300046543 Bacteria 2059
660 Ga0495656_0151136 3300046615 Bacteria 1122
661 Ga0495668_0290656 3300046616 Bacteria 896
662 Ga0495634_0078175 3300046642 Archaea 2168
663 Ga0495634_0574656 3300046642 Bacteria 656
664 Ga0495634_0792723 3300046642 Unclassified 541
665 Ga0495635_0099729 3300046663 Bacteria 1985
666 Ga0495658_0017387 3300046683 Unclassified 3714
667 Ga0495658_0040106 3300046683 Archaea 2602
668 Ga0495658_0087771 3300046683 Bacteria 1837
669 Ga0495658_0360637 3300046683 Unclassified 924
670 Ga0495658_0402427 3300046683 Unclassified 873
671 Ga0495658_0735918 3300046683 Bacteria 632
672 Ga0495613_0000270 3300046689 Bacteria 48533
673 Ga0495613_0906875 3300046689 Unclassified 570
674 Ga0495670_0567414 3300046691 Bacteria 618
675 Ga0495600_0017848 3300046809 Bacteria 4516
676 Ga0495600_0537039 3300046809 Unclassified 716
677 Ga0495581_0408664 3300047315 Unclassified 791
678 Ga0495581_0554214 3300047315 Unclassified 667
679 Ga0495581_0826992 3300047315 Unclassified 531
680 Ga0495604_0006670 3300047317 Bacteria 9150
681 Ga0495604_0673273 3300047317 Unclassified 659
682 Ga0495674_0363478 3300047319 Bacteria 1173
683 Ga0495680_0330919 3300047322 Bacteria 1064
684 Ga0495675_0331792 3300047444 Unclassified 898
685 Ga0495684_0000011 3300047471 Bacteria 195144
686 Ga0495684_0259806 3300047471 Bacteria 1260
687 Ga0496100_0001767 3300048903 Bacteria 10786
688 Ga0496100_1253419 3300048903 Unclassified 585
689 Ga0496101_0003536 3300048904 Bacteria 9748
690 Ga0496101_0752257 3300048904 Bacteria 769
691 Ga0496102_0142358 3300048905 Bacteria 2249
692 Ga0496102_0904677 3300048905 Unclassified 804
693 Ga0496102_1441450 3300048905 Bacteria 607
694 Ga0496104_0011243 3300048907 Bacteria 8010
695 Ga0496104_0308976 3300048907 Bacteria 1494
696 Ga0496104_0316675 3300048907 Unclassified 1473
697 Ga0496104_0698494 3300048907 Bacteria 922
698 Ga0496105_0041581 3300048908 Bacteria 3789
699 Ga0496105_0393068 3300048908 Bacteria 1102
700 Ga0496105_0421467 3300048908 Bacteria 1057
701 Ga0496106_0271180 3300048909 Bacteria 1359
702 Ga0496106_0563783 3300048909 Unclassified 913
703 Ga0496107_0257617 3300048910 Unclassified 1298
704 Ga0496108_0007470 3300048911 Bacteria 8860
705 Ga0496108_0849015 3300048911 Unclassified 786
706 Ga0496109_0072409 3300048912 Bacteria 3166
707 Ga0496109_1145045 3300048912 Bacteria 715
708 Ga0496110_0282573 3300048913 Bacteria 1511
709 Ga0496110_0951555 3300048913 Bacteria 766
710 Ga0496112_0015032 3300048915 Bacteria 7206
711 Ga0496112_0155795 3300048915 Bacteria 2251
712 Ga0496112_0392061 3300048915 Bacteria 1329
713 Ga0496112_0710904 3300048915 Unclassified 932
714 Ga0496112_0998843 3300048915 Unclassified 757
715 Ga0496113_0050182 3300048916 Bacteria 3110
716 Ga0496113_0251822 3300048916 Bacteria 1410
717 Ga0496113_0820804 3300048916 Bacteria 738
718 Ga0496114_0002246 3300048917 Bacteria 14722
719 Ga0496114_0134932 3300048917 Bacteria 2134
720 Ga0496114_0148242 3300048917 Bacteria 2035
721 Ga0496114_0343772 3300048917 Bacteria 1319
722 Ga0496114_0544204 3300048917 Unclassified 1026
723 Ga0496115_0048392 3300048918 Bacteria 3401
724 Ga0496115_0258333 3300048918 Unclassified 1433
725 Ga0501031_0562897 3300049568 Bacteria 734
726 Ga0501033_0026014 3300049570 Unclassified 4404
727 Ga0501036_0016899 3300049572 Bacteria 6095
728 Ga0501036_0170785 3300049572 Bacteria 1832
729 Ga0501036_0718552 3300049572 Bacteria 825
730 Ga0501038_0084400 3300049574 Unclassified 2672
731 Ga0501039_0132881 3300049575 Bacteria 1953
732 Ga0501040_0002560 3300049576 Bacteria 11734
733 Ga0501040_0216812 3300049576 Bacteria 1361
734 Ga0501041_0004195 3300049577 Bacteria 8338
735 Ga0501041_0217098 3300049577 Bacteria 1200
736 Ga0501042_0044934 3300049578 Unclassified 3147
737 Ga0501046_0187931 3300049580 Bacteria 1542
738 Ga0501048_0082513 3300049582 Unclassified 2268
739 Ga0501048_0165996 3300049582 Bacteria 1563
740 Ga0501068_0383365 3300049584 Unclassified 905
741 Ga0501071_0342249 3300049587 Bacteria 1137
742 Ga0501072_0082534 3300049588 Unclassified 2548
743 Ga0501072_0362322 3300049588 Bacteria 1151
744 Ga0501074_0365259 3300049590 Bacteria 1024
745 Ga0501075_0078260 3300049591 Bacteria 2503
746 Ga0501075_0140304 3300049591 Bacteria 1841
747 Ga0501075_0258869 3300049591 Unclassified 1326
748 Ga0501075_1085085 3300049591 Unclassified 608
749 Ga0501076_0020154 3300049592 Bacteria 5102
750 Ga0501077_0028491 3300049593 Unclassified 3549
751 Ga0501249_160885 3300049679 Unclassified 570
752 Ga0501079_0128664 3300049741 Bacteria 1970
753 Ga0501080_0016251 3300049742 Bacteria 6872
754 Ga0501080_1161423 3300049742 Bacteria 665
755 Ga0501081_0002355 3300049743 Bacteria 11897
756 Ga0501081_0021287 3300049743 Bacteria 4327
757 Ga0501081_0320255 3300049743 Bacteria 1140
758 Ga0501081_0703344 3300049743 Unclassified 759
759 Ga0501081_0921142 3300049743 Unclassified 659
760 Ga0501083_0299985 3300049744 Unclassified 1045
761 Ga0501035_0657129 3300049822 Bacteria 849
762 Ga0501045_0018351 3300049824 Unclassified 4976
763 nmdc:mga07m45_62441_c1 3300050496 Unclassified 2111
764 nmdc:mga05p37_146673_c1 3300050507 Unclassified 2889
765 nmdc:mga05p37_18651_c1 3300050507 Bacteria 8385
766 nmdc:mga05p37_213361_c1 3300050507 Unclassified 2332
767 nmdc:mga05p37_255682_c1 3300050507 Bacteria 2099
768 nmdc:mga05p37_266676_c1 3300050507 Unclassified 2047
769 nmdc:mga05p37_28334_c1 3300050507 Bacteria 6830
770 nmdc:mga05p37_317751_c1 3300050507 Unclassified 1844
771 nmdc:mga05p37_4712_c1 3300050507 Bacteria 15933
772 nmdc:mga05p37_484360_c1 3300050507 Bacteria 1424
773 nmdc:mga05p37_485232_c1 3300050507 Bacteria 1422
774 nmdc:mga05p37_58211_c1 3300050507 Bacteria 4759
775 nmdc:mga05p37_629149_c1 3300050507 Bacteria 1206
776 nmdc:mga05p37_876468_c1 3300050507 Bacteria 971
777 nmdc:mga09592_1202268_c1 3300050508 Unclassified 626
778 nmdc:mga09592_843732_c1 3300050508 Unclassified 773
779 nmdc:mga06r32_1862087_c1 3300050510 Unclassified 536
780 nmdc:mga06r32_307623_c1 3300050510 Unclassified 1570
781 nmdc:mga06r32_990058_c1 3300050510 Unclassified 794
782 nmdc:mga08y16_1112876_c1 3300050511 Unclassified 764
783 nmdc:mga08y16_12059_c1 3300050511 Bacteria 9082
784 nmdc:mga08y16_147882_c1 3300050511 Unclassified 2442
785 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
786 nmdc:mga08y16_9786_c1 3300050511 Bacteria 10061
787 nmdc:mga0n895_111406_c1 3300050512 Bacteria 2451
788 nmdc:mga0n895_158_c1 3300050512 Bacteria 41550
789 nmdc:mga0n895_179707_c1 3300050512 Bacteria 2147
790 nmdc:mga0n895_385788_c1 3300050512 Unclassified 1417
791 nmdc:mga0n895_76694_c1 3300050512 Bacteria 3324
792 nmdc:mga0rr50_2705_c1 3300050513 Bacteria 10059
793 nmdc:mga0rr50_41605_c1 3300050513 Bacteria 3350
794 nmdc:mga0rr50_41681_c1 3300050513 Bacteria 3347
795 nmdc:mga0rr50_426345_c1 3300050513 Bacteria 1123
796 nmdc:mga0rr50_6_c1 3300050513 Bacteria 310626
797 nmdc:mga0rr50_84307_c1 3300050513 Bacteria 2460
798 nmdc:mga08x19_198760_c1 3300050514 Bacteria 1374
799 nmdc:mga08x19_21726_c1 3300050514 Bacteria 3966
800 nmdc:mga08x19_251_c1 3300050514 Bacteria 40759
801 nmdc:mga08x19_278381_c1 3300050514 Bacteria 1159
802 nmdc:mga08x19_29141_c1 3300050514 Bacteria 3461
803 nmdc:mga08x19_354423_c1 3300050514 Bacteria 1025
804 nmdc:mga08x19_55985_c1 3300050514 Bacteria 2544
805 nmdc:mga08x19_69754_c1 3300050514 Unclassified 2289
806 nmdc:mga08x19_810829_c1 3300050514 Bacteria 665
807 nmdc:mga0a205_23249_c1 3300050515 Bacteria 5878
808 nmdc:mga0a205_272664_c1 3300050515 Unclassified 1569
809 nmdc:mga0a205_6014_c1 3300050515 Bacteria 10945
810 nmdc:mga0a205_67044_c1 3300050515 Bacteria 3467
811 nmdc:mga0a205_80285_c1 3300050515 Unclassified 3152
812 Ga0495601_0007844 3300053077 Bacteria 6282
813 Ga0495601_0116945 3300053077 Bacteria 1730
814 Ga0495595_0012854 3300053084 Bacteria 3530
815 Ga0495595_0017737 3300053084 Bacteria 3066
816 Ga0495595_0180684 3300053084 Unclassified 1046
817 Ga0495619_0003599 3300053085 Bacteria 9981
818 Ga0495619_0017075 3300053085 Bacteria 4601
819 Ga0495619_0072399 3300053085 Bacteria 2308
820 Ga0495619_0803409 3300053085 Bacteria 636
821 Ga0501084_0045423 3300054114 Bacteria 3677
822 Ga0501084_0115664 3300054114 Bacteria 2254
823 Ga0501084_0775157 3300054114 Unclassified 808
824 Ga0590071_002132 3300059421 Bacteria 5041
825 Ga0590075_001175 3300059424 Bacteria 6634
826 Ga0501082_0005914 3300060353 Bacteria 10610
827 Ga0501082_0233872 3300060353 Bacteria 1599
828 Ga0530510_0058389 3300061734 Bacteria 2790
829 Ga0530510_0447422 3300061734 Bacteria 976
830 Ga0114129_10156652
831 JGI24751J29686_10119432
832 JGI25406J46586_10066766
833 Ga0065712_10080601
834 Ga0065712_10085558
835 Ga0065715_10004337
836 Ga0065707_10719682
837 Ga0070676_10001366
838 Ga0070676_10297136
839 Ga0070683_100027315
840 Ga0070683_100715514
841 Ga0070690_100091555
842 Ga0070670_100278997
843 Ga0070670_100330316
844 Ga0070670_100492404
845 Ga0070670_101140811
846 Ga0070670_101649569
847 Ga0070677_10090386
848 Ga0068869_100093012
849 Ga0068869_100608189
850 Ga0068869_100962682
851 Ga0070666_10125697
852 Ga0070666_10361826
853 Ga0070680_100469098
854 Ga0070682_100582661
855 Ga0068868_100101430
856 Ga0068868_100107428
857 Ga0068868_100111675
858 Ga0068868_100115424
859 Ga0068868_100252123
860 Ga0068868_101705561
861 Ga0070660_100283566
862 Ga0070660_101391044
863 Ga0070660_101679240
864 Ga0070689_100079981
865 Ga0070689_100175558
866 Ga0070689_100922111
867 Ga0070691_10055702
868 Ga0070687_100178877
869 Ga0070687_100368194
870 Ga0070661_100690040
871 Ga0070692_11040805
872 Ga0070668_100012918
873 Ga0070668_100245130
874 Ga0070669_100029378
875 Ga0070669_100030711
876 Ga0070669_100117442
877 Ga0070669_100471046
878 Ga0070675_100042892
879 Ga0070675_100052041
880 Ga0070675_100113918
881 Ga0070671_100093982
882 Ga0070671_100175613
883 Ga0070671_100720367
884 Ga0070674_100015355
885 Ga0070674_100063609
886 Ga0070674_100288378
887 Ga0070674_100596543
888 Ga0070673_101491223
889 Ga0070688_100012569
890 Ga0070688_100043332
891 Ga0070659_100150356
892 Ga0070667_100036885
893 Ga0070667_101148144
894 Ga0070710_10446136
895 Ga0070701_10005792
896 Ga0070701_10218798
897 Ga0070701_10321110
898 Ga0070701_10440643
899 Ga0070701_10511201
900 Ga0070711_100054973
901 Ga0070711_100125730
902 Ga0070705_100010712
903 Ga0070705_100073222
904 Ga0070705_100192297
905 Ga0070705_100261969
906 Ga0070700_100025011
907 Ga0070700_100115138
908 Ga0070700_100915304
909 Ga0070694_100022280
910 Ga0070694_100032981
911 Ga0070694_100040457
912 Ga0070694_100201111
913 Ga0070694_100334650
914 Ga0070694_100612055
915 Ga0070708_100195540
916 Ga0070708_100654014
917 Ga0070708_100944648
918 Ga0070663_101948614
919 Ga0070678_100097821
920 Ga0070678_100332587
921 Ga0070678_100617645
922 Ga0070678_101270789
923 Ga0070662_100090753
924 Ga0070662_100237599
925 Ga0070662_100708816
926 Ga0070681_10106845
927 Ga0070681_11403161
928 Ga0068867_100002097
929 Ga0068867_100018173
930 Ga0068867_100020766
931 Ga0068867_100280302
932 Ga0068867_101108229
933 Ga0068867_101917884
934 Ga0070685_10036929
935 Ga0070685_10294910
936 Ga0070706_100118543
937 Ga0070706_100839023
938 Ga0070706_101108248
939 Ga0070707_100052416
940 Ga0070707_100055342
941 Ga0070707_100081015
942 Ga0070698_100264789
943 Ga0070698_100378182
944 Ga0070698_100771027
945 Ga0070699_100003176
946 Ga0070699_100071764
947 Ga0070699_100441730
948 Ga0070699_101008934
949 Ga0070679_100076744
950 Ga0070679_100279722
951 Ga0070684_100079683
952 Ga0070684_100409608
953 Ga0070684_102098993
954 Ga0070697_100085215
955 Ga0070697_100347162
956 Ga0070697_100794691
957 Ga0068853_100713753
958 Ga0070672_100063406
959 Ga0070672_100152394
960 Ga0070672_101481782
961 Ga0070686_100215022
962 Ga0070695_100001441
963 Ga0070695_100107225
964 Ga0070695_100183413
965 Ga0070695_100205869
966 Ga0070695_101013941
967 Ga0070696_100067973
968 Ga0070696_100082669
969 Ga0070696_100106555
970 Ga0070696_100260527
971 Ga0070696_100450416
972 Ga0070693_100363573
973 Ga0070665_100016860
974 Ga0070665_100044841
975 Ga0070665_100344449
976 Ga0070665_101026335
977 Ga0070704_100003928
978 Ga0070704_100023249
979 Ga0070704_100053861
980 Ga0070704_100140774
981 Ga0070704_100935212
982 Ga0070704_101007162
983 Ga0070664_100195327
984 Ga0070664_100927353
985 Ga0070664_101396302
986 Ga0068857_100078036
987 Ga0068857_100782875
988 Ga0068854_100021553
989 Ga0068856_100994547
990 Ga0070702_100000624
991 Ga0068852_100124584
992 Ga0068859_100002294
993 Ga0068859_100104173
994 Ga0068859_100697724
995 Ga0068859_101546121
996 Ga0068859_101839530
997 Ga0068864_100002167
998 Ga0068864_100104072
999 Ga0068864_100124050
1000 Ga0068864_101080178
1001 Ga0068864_102112207
1002 Ga0068866_10062469
1003 Ga0068866_10107149
1004 Ga0068866_10121207
1005 Ga0068866_10122337
1006 Ga0068866_10366790
1007 Ga0068861_100011220
1008 Ga0068861_100029368
1009 Ga0068861_100150503
1010 Ga0068861_100173726
1011 Ga0068861_100208885
1012 Ga0068861_100295915
1013 Ga0068870_10090174
1014 Ga0068863_100012476
1015 Ga0068863_100169686
1016 Ga0068863_100217099
1017 Ga0068863_100479810
1018 Ga0068863_100548302
1019 Ga0068863_101079181
1020 Ga0068858_100029645
1021 Ga0068858_100107941
1022 Ga0068858_100220278
1023 Ga0068858_100693580
1024 Ga0068858_100825770
1025 Ga0068858_101677175
1026 Ga0068860_100138091
1027 Ga0068860_100343474
1028 Ga0068860_100789380
1029 Ga0068860_101184683
1030 Ga0068860_101480252
1031 Ga0068860_101672483
1032 Ga0068860_102041262
1033 Ga0068862_100036864
1034 Ga0068862_100104747
1035 Ga0068862_100138157
1036 Ga0068862_100172887
1037 Ga0068862_100205244
1038 Ga0068862_102089397
1039 Ga0081455_10036603
1040 Ga0081539_10025788
1041 Ga0070717_10346298
1042 Ga0070715_10381363
1043 Ga0070715_10565184
1044 Ga0097621_100004485
1045 Ga0097621_100015314
1046 Ga0097621_100019423
1047 Ga0097621_100021970
1048 Ga0097621_100026579
1049 Ga0097621_100042241
1050 Ga0097621_100236837
1051 Ga0097621_100324277
1052 Ga0097621_100476857
1053 Ga0068871_100036235
1054 Ga0068871_100062149
1055 Ga0068871_100067701
1056 Ga0068871_100068350
1057 Ga0068871_100323441
1058 Ga0068871_100529875
1059 Ga0068871_100542493
1060 Ga0068871_100885050
1061 Ga0075428_100000005
1062 Ga0075428_101773168
1063 Ga0075430_100694078
1064 Ga0075431_100051743
1065 Ga0075431_100065918
1066 Ga0075431_100241004
1067 Ga0075431_102075655
1068 Ga0075433_10057392
1069 Ga0075433_10081222
1070 Ga0075433_10090819
1071 Ga0075433_10144685
1072 Ga0075433_10254376
1073 Ga0075433_10565386
1074 Ga0075433_10681660
1075 Ga0075433_10870544
1076 Ga0075434_100011109
1077 Ga0075434_100015041
1078 Ga0075434_100034937
1079 Ga0075434_100083214
1080 Ga0075434_100096589
1081 Ga0075434_101267968
1082 Ga0075434_101806781
1083 Ga0075429_100981222
1084 Ga0068865_100025544
1085 Ga0068865_100266053
1086 Ga0075436_100008336
1087 Ga0075436_100012160
1088 Ga0075436_100035527
1089 Ga0075436_100036146
1090 Ga0075436_100119305
1091 Ga0075436_100139293
1092 Ga0075436_100264288
1093 Ga0075436_100770572
1094 Ga0097620_100002294
1095 Ga0097620_100104178
1096 Ga0097620_100697808
1097 Ga0097620_101546126
1098 Ga0097620_101839484
1099 Ga0075435_100001816
1100 Ga0075435_100008469
1101 Ga0075435_100017880
1102 Ga0075435_100046046
1103 Ga0075435_100148399
1104 Ga0075435_100290970
1105 Ga0075435_100300717
1106 Ga0105240_10096194
1107 Ga0105240_10184954
1108 Ga0105240_10195029
1109 Ga0105240_10577173
1110 Ga0105240_10865196
1111 Ga0111539_10000008
1112 Ga0111539_10005984
1113 Ga0111539_10006975
1114 Ga0111539_10385263
1115 Ga0111539_10495993
1116 Ga0111539_10570386
1117 Ga0111539_11092779
1118 Ga0111539_11803404
1119 Ga0105245_10001762
1120 Ga0105245_10490012
1121 Ga0105245_10832131
1122 Ga0105245_10920229
1123 Ga0105245_11661326
1124 Ga0105245_11803152
1125 Ga0105247_10004214
1126 Ga0105247_10312784
1127 Ga0114129_10002454
1128 Ga0114129_10002522
1129 Ga0114129_10004744
1130 Ga0114129_10023846
1131 Ga0114129_10024935
1132 Ga0114129_10047223
1133 Ga0114129_10072618
1134 Ga0114129_10130146
1135 Ga0114129_10275915
1136 Ga0114129_10371477
1137 Ga0114129_10540555
1138 Ga0114129_10584291
1139 Ga0114129_10772010
1140 Ga0114129_10909681
1141 Ga0114129_11232683
1142 Ga0114129_11305827
1143 Ga0114129_13288703
1144 Ga0105243_10114209
1145 Ga0105243_10125552
1146 Ga0105243_10636780
1147 Ga0105243_10705238
1148 Ga0105243_10975912
1149 Ga0105243_11971661
1150 Ga0105243_12168049
1151 Ga0105241_10426591
1152 Ga0105241_11862459
1153 Ga0105242_10004556
1154 Ga0105242_10020139
1155 Ga0105242_10180717
1156 Ga0105242_10620726
1157 Ga0105242_10687238
1158 Ga0105242_10893321
1159 Ga0105248_10003660
1160 Ga0105248_10013961
1161 Ga0105248_10032263
1162 Ga0105248_10093625
1163 Ga0105248_10271381
1164 Ga0105248_10354140
1165 Ga0105248_10609398
1166 Ga0105248_10761816
1167 Ga0105248_10772266
1168 Ga0105248_11019394
1169 Ga0105248_11155448
1170 Ga0105248_11981664
1171 Ga0105248_12390472
1172 Ga0105237_10179635
1173 Ga0105237_10381088
1174 Ga0105238_10452037
1175 Ga0105238_11002864
1176 Ga0105238_11551190
1177 Ga0105249_10086774
1178 Ga0105249_10204042
1179 Ga0105249_10426319
1180 Ga0105249_10934912
1181 Ga0105249_10982552
1182 Ga0105249_11156046
1183 Ga0105249_12552079
1184 Ga0105239_10402639
1185 Ga0105246_10324919
1186 Ga0105246_10834380
1187 Ga0157374_10069568
1188 Ga0157374_11305571
1189 Ga0157378_10389158
1190 Ga0157378_10487422
1191 Ga0157378_10924029
1192 Ga0163162_10101495
1193 Ga0163162_10437192
1194 Ga0163162_10747938
1195 Ga0163162_10876752
1196 Ga0157372_10989373
1197 Ga0157375_10074074
1198 Ga0157375_10153304
1199 Ga0157375_10261060
1200 Ga0157375_10853739
1201 Ga0163163_10002970
1202 Ga0163163_10282799
1203 Ga0163163_10609288
1204 Ga0163163_10840811
1205 Ga0163163_11513013
1206 Ga0163163_12539303
1207 Ga0157380_10021482
1208 Ga0157380_10239360
1209 Ga0157380_10707289
1210 Ga0157380_10729009
1211 Ga0157380_10778206
1212 Ga0157380_11727852
1213 Ga0157380_12124772
1214 Ga0157377_10324658
1215 Ga0157379_10009368
1216 Ga0157379_10017186
1217 Ga0157379_10045873
1218 Ga0157379_10560859
1219 Ga0157379_10935488
1220 Ga0157376_10007383
1221 Ga0157376_10023512
1222 Ga0157376_10026344
1223 Ga0157376_10397908
1224 Ga0157376_11420530
1225 Ga0157376_11763356
1226 Ga0163161_10385455
1227 Ga0163161_10780624
1228 Ga0213876_10454800
1229 Ga0207697_10167434
1230 Ga0207642_10190676
1231 Ga0207642_10243649
1232 Ga0207680_10069645
1233 Ga0207680_10158042
1234 Ga0207685_10395022
1235 Ga0207685_10395982
1236 Ga0207699_10015778
1237 Ga0207645_10002091
1238 Ga0207645_10351971
1239 Ga0207643_10730658
1240 Ga0207684_10956167
1241 Ga0207654_10527712
1242 Ga0207707_10279452
1243 Ga0207707_10820702
1244 Ga0207695_10170769
1245 Ga0207695_10191257
1246 Ga0207695_10634378
1247 Ga0207695_10758946
1248 Ga0207660_10138464
1249 Ga0207660_10906661
1250 Ga0207662_10270528
1251 Ga0207662_10377975
1252 Ga0207657_10257276
1253 Ga0207657_10969041
1254 Ga0207649_10822657
1255 Ga0207652_10547397
1256 Ga0207652_11504502
1257 Ga0207646_10043289
1258 Ga0207646_10051452
1259 Ga0207646_10153206
1260 Ga0207646_10568852
1261 Ga0207646_10876785
1262 Ga0207681_10043056
1263 Ga0207681_10082383
1264 Ga0207681_10130141
1265 Ga0207681_10472243
1266 Ga0207694_11030440
1267 Ga0207650_10042085
1268 Ga0207650_10046439
1269 Ga0207650_10078551
1270 Ga0207650_10479189
1271 Ga0207650_10710911
1272 Ga0207650_10967420
1273 Ga0207659_10000452
1274 Ga0207659_10033882
1275 Ga0207659_10581749
1276 Ga0207659_10678944
1277 Ga0207659_10962004
1278 Ga0207687_10299088
1279 Ga0207687_10467323
1280 Ga0207700_10055736
1281 Ga0207644_10087083
1282 Ga0207644_11253300
1283 Ga0207690_11168266
1284 Ga0207706_10159756
1285 Ga0207706_10189351
1286 Ga0207706_10220485
1287 Ga0207706_10244056
1288 Ga0207706_10396176
1289 Ga0207706_10991269
1290 Ga0207686_10086937
1291 Ga0207686_10250266
1292 Ga0207686_10670262
1293 Ga0207709_10105681
1294 Ga0207670_10153243
1295 Ga0207670_10356899
1296 Ga0207669_10024470
1297 Ga0207669_10469371
1298 Ga0207669_10931994
1299 Ga0207704_10097737
1300 Ga0207704_10366677
1301 Ga0207704_10472621
1302 Ga0207665_10055349
1303 Ga0207691_10010298
1304 Ga0207691_10105363
1305 Ga0207691_10262209
1306 Ga0207711_10024485
1307 Ga0207711_10107549
1308 Ga0207711_10150743
1309 Ga0207711_10274636
1310 Ga0207711_10372624
1311 Ga0207711_10469466
1312 Ga0207711_10725475
1313 Ga0207711_10885461
1314 Ga0207711_11766710
1315 Ga0207689_10066268
1316 Ga0207689_10243431
1317 Ga0207689_10712667
1318 Ga0207661_10893755
1319 Ga0207679_10898551
1320 Ga0207651_10059893
1321 Ga0207651_10146338
1322 Ga0207651_10202200
1323 Ga0207651_10987054
1324 Ga0207651_11430528
1325 Ga0207712_10184534
1326 Ga0207712_11569295
1327 Ga0207668_10073037
1328 Ga0207668_10078354
1329 Ga0207668_10951756
1330 Ga0207640_10013049
1331 Ga0207640_10522898
1332 Ga0207640_11901567
1333 Ga0207658_10024715
1334 Ga0207677_10023554
1335 Ga0207677_10729951
1336 Ga0207703_10010553
1337 Ga0207703_10019535
1338 Ga0207703_10085620
1339 Ga0207703_10092312
1340 Ga0207703_10308848
1341 Ga0207703_10534291
1342 Ga0207703_10762856
1343 Ga0207703_11034608
1344 Ga0207639_10672373
1345 Ga0207708_10007933
1346 Ga0207708_10040406
1347 Ga0207708_10060056
1348 Ga0207708_11002572
1349 Ga0207641_10001556
1350 Ga0207641_10040115
1351 Ga0207641_10340522
1352 Ga0207641_10462193
1353 Ga0207648_10003842
1354 Ga0207648_10053331
1355 Ga0207648_10342720
1356 Ga0207676_10035030
1357 Ga0207676_10087713
1358 Ga0207676_10259837
1359 Ga0207674_10065546
1360 Ga0207674_10198566
1361 Ga0207674_11063895
1362 Ga0207675_100004284
1363 Ga0207675_100025632
1364 Ga0207675_100038973
1365 Ga0207675_100166723
1366 Ga0207675_100232631
1367 Ga0207675_102065467
1368 Ga0207683_10127404
1369 Ga0207683_10152629
1370 Ga0207683_10195122
1371 Ga0207683_10949869
1372 Ga0207683_11692932
1373 Ga0207698_10541608
1374 Ga0207428_10000019
1375 Ga0207428_10032336
1376 Ga0207428_10115323
1377 Ga0268266_10027359
1378 Ga0268266_10075175
1379 Ga0268266_10128250
1380 Ga0268266_11837429
1381 Ga0268265_10007747
1382 Ga0268265_10013365
1383 Ga0268265_10019194
1384 Ga0268264_10061651
1385 Ga0268264_10111140
1386 Ga0268264_10438819
1387 Ga0268264_10816406
1388 Ga0268264_11073354
1389 Ga0265336_10023671
1390 Ga0265332_10054475
1391 Ga0307408_100578861
1392 Ga0307408_100588344
1393 Ga0307405_10004523
1394 Ga0307413_10011495
1395 Ga0307413_10494734
1396 Ga0307410_10024578
1397 Ga0307410_10026753
1398 Ga0307406_10007138
1399 Ga0307407_10005639
1400 Ga0307407_10074004
1401 Ga0307412_10042454
1402 Ga0307409_100002717
1403 Ga0307409_100033865
1404 Ga0307409_100727550
1405 Ga0307416_100770534
1406 Ga0307414_10005333
1407 Ga0307414_10072664
1408 Ga0307411_10018419
1409 Ga0307411_10056903
1410 Ga0307411_10153677
1411 Ga0307415_100150420
1412 Ga0373948_0000509
1413 Ga0373958_0016317
1414 Ga0373959_0001115
1415 Ga0373938_0000914
1416 Ga0373928_0003690
1417 Ga0373929_0001665
1418 Ga0373940_0008914
1419 Ga0373940_0171412
1420 Ga0373949_0000482
1421 Ga0373951_0000509
1422 Ga0373952_0000226
1423 Ga0373952_0275102
1424 Ga0373923_0544803
1425 Ga0373932_0002843
1426 Ga0373932_0269964
1427 Ga0373939_0000720
1428 Ga0373939_0017908
1429 Ga0373941_0001206
1430 Ga0373945_0052675
1431 Ga0373953_0262848
1432 Ga0373956_0124444
1433 Ga0373957_0178833
1434 Ga0373957_0195768
1435 Ga0373960_0002697
1436 Ga0373942_0001963
1437 Ga0373961_0001603
1438 Ga0373962_0004201
1439 Ga0373962_0007357
1440 Ga0373931_0000488
1441 Ga0373931_0096249
1442 Ga0373931_0214019
1443 Ga0373935_0976698
1444 Ga0373927_0238985
1445 Ga0373927_0347378
1446 Ga0373927_1044381
1447 Ga0373933_0275446
1448 Ga0373947_0991536
1449 Ga0373937_0241425
1450 Ga0373937_0293586
1451 Ga0373937_0483143
1452 Ga0373937_0533155
1453 Ga0373937_1527814
1454 Ga0373925_0217272
1455 Ga0373925_0260971
1456 Ga0373925_1291666
1457 Ga0436365_0147401
1458 Ga0436365_0783264
1459 Ga0439461_0169737
1460 Ga0466963_0034100
1461 Ga0451576_0035736
1462 Ga0451576_0471764
1463 Ga0451576_0574926
1464 Ga0466967_0114487
1465 Ga0495592_0039982
1466 Ga0495629_0728659
1467 Ga0495629_0885322
1468 Ga0495651_0307638
1469 Ga0495653_0743868
1470 Ga0495580_0239561
1471 Ga0495580_0315459
1472 Ga0495580_0496614
1473 Ga0495639_0658393
1474 Ga0495662_0176579
1475 Ga0495608_0004888
1476 Ga0495618_0258946
1477 Ga0495628_0099882
1478 Ga0495628_0233517
1479 Ga0495628_0320848
1480 Ga0495630_0035961
1481 Ga0495630_0855087
1482 Ga0495652_0062779
1483 Ga0495640_0430106
1484 Ga0495586_0055765
1485 Ga0495586_0241916
1486 Ga0495586_0460655
1487 Ga0495645_0090377
1488 Ga0495645_0100298
1489 Ga0495656_0151136
1490 Ga0495668_0290656
1491 Ga0495634_0078175
1492 Ga0495634_0574656
1493 Ga0495634_0792723
1494 Ga0495635_0099729
1495 Ga0495658_0017387
1496 Ga0495658_0040106
1497 Ga0495658_0087771
1498 Ga0495658_0360637
1499 Ga0495658_0402427
1500 Ga0495658_0735918
1501 Ga0495613_0000270
1502 Ga0495613_0906875
1503 Ga0495670_0567414
1504 Ga0495600_0017848
1505 Ga0495600_0537039
1506 Ga0495581_0408664
1507 Ga0495581_0554214
1508 Ga0495581_0826992
1509 Ga0495604_0006670
1510 Ga0495604_0673273
1511 Ga0495674_0363478
1512 Ga0495680_0330919
1513 Ga0495675_0331792
1514 Ga0495684_0000011
1515 Ga0495684_0259806
1516 Ga0496100_0001767
1517 Ga0496100_1253419
1518 Ga0496101_0003536
1519 Ga0496101_0752257
1520 Ga0496102_0142358
1521 Ga0496102_0904677
1522 Ga0496102_1441450
1523 Ga0496104_0011243
1524 Ga0496104_0308976
1525 Ga0496104_0316675
1526 Ga0496104_0698494
1527 Ga0496105_0041581
1528 Ga0496105_0393068
1529 Ga0496105_0421467
1530 Ga0496106_0271180
1531 Ga0496106_0563783
1532 Ga0496107_0257617
1533 Ga0496108_0007470
1534 Ga0496108_0849015
1535 Ga0496109_0072409
1536 Ga0496109_1145045
1537 Ga0496110_0282573
1538 Ga0496110_0951555
1539 Ga0496112_0015032
1540 Ga0496112_0155795
1541 Ga0496112_0392061
1542 Ga0496112_0710904
1543 Ga0496112_0998843
1544 Ga0496113_0050182
1545 Ga0496113_0251822
1546 Ga0496113_0820804
1547 Ga0496114_0002246
1548 Ga0496114_0134932
1549 Ga0496114_0148242
1550 Ga0496114_0343772
1551 Ga0496114_0544204
1552 Ga0496115_0048392
1553 Ga0496115_0258333
1554 Ga0501031_0562897
1555 Ga0501033_0026014
1556 Ga0501036_0016899
1557 Ga0501036_0170785
1558 Ga0501036_0718552
1559 Ga0501038_0084400
1560 Ga0501039_0132881
1561 Ga0501040_0002560
1562 Ga0501040_0216812
1563 Ga0501041_0004195
1564 Ga0501041_0217098
1565 Ga0501042_0044934
1566 Ga0501046_0187931
1567 Ga0501048_0082513
1568 Ga0501048_0165996
1569 Ga0501068_0383365
1570 Ga0501071_0342249
1571 Ga0501072_0082534
1572 Ga0501072_0362322
1573 Ga0501074_0365259
1574 Ga0501075_0078260
1575 Ga0501075_0140304
1576 Ga0501075_0258869
1577 Ga0501075_1085085
1578 Ga0501076_0020154
1579 Ga0501077_0028491
1580 Ga0501249_160885
1581 Ga0501079_0128664
1582 Ga0501080_0016251
1583 Ga0501080_1161423
1584 Ga0501081_0002355
1585 Ga0501081_0021287
1586 Ga0501081_0320255
1587 Ga0501081_0703344
1588 Ga0501081_0921142
1589 Ga0501083_0299985
1590 Ga0501035_0657129
1591 Ga0501045_0018351
1592 nmdc:mga07m45_62441_c1
1593 nmdc:mga05p37_146673_c1
1594 nmdc:mga05p37_18651_c1
1595 nmdc:mga05p37_213361_c1
1596 nmdc:mga05p37_255682_c1
1597 nmdc:mga05p37_266676_c1
1598 nmdc:mga05p37_28334_c1
1599 nmdc:mga05p37_317751_c1
1600 nmdc:mga05p37_4712_c1
1601 nmdc:mga05p37_484360_c1
1602 nmdc:mga05p37_485232_c1
1603 nmdc:mga05p37_58211_c1
1604 nmdc:mga05p37_629149_c1
1605 nmdc:mga05p37_876468_c1
1606 nmdc:mga09592_1202268_c1
1607 nmdc:mga09592_843732_c1
1608 nmdc:mga06r32_1862087_c1
1609 nmdc:mga06r32_307623_c1
1610 nmdc:mga06r32_990058_c1
1611 nmdc:mga08y16_1112876_c1
1612 nmdc:mga08y16_12059_c1
1613 nmdc:mga08y16_147882_c1
1614 nmdc:mga08y16_17_c1
1615 nmdc:mga08y16_9786_c1
1616 nmdc:mga0n895_111406_c1
1617 nmdc:mga0n895_158_c1
1618 nmdc:mga0n895_179707_c1
1619 nmdc:mga0n895_385788_c1
1620 nmdc:mga0n895_76694_c1
1621 nmdc:mga0rr50_2705_c1
1622 nmdc:mga0rr50_41605_c1
1623 nmdc:mga0rr50_41681_c1
1624 nmdc:mga0rr50_426345_c1
1625 nmdc:mga0rr50_6_c1
1626 nmdc:mga0rr50_84307_c1
1627 nmdc:mga08x19_198760_c1
1628 nmdc:mga08x19_21726_c1
1629 nmdc:mga08x19_251_c1
1630 nmdc:mga08x19_278381_c1
1631 nmdc:mga08x19_29141_c1
1632 nmdc:mga08x19_354423_c1
1633 nmdc:mga08x19_55985_c1
1634 nmdc:mga08x19_69754_c1
1635 nmdc:mga08x19_810829_c1
1636 nmdc:mga0a205_23249_c1
1637 nmdc:mga0a205_272664_c1
1638 nmdc:mga0a205_6014_c1
1639 nmdc:mga0a205_67044_c1
1640 nmdc:mga0a205_80285_c1
1641 Ga0495601_0007844
1642 Ga0495601_0116945
1643 Ga0495595_0012854
1644 Ga0495595_0017737
1645 Ga0495595_0180684
1646 Ga0495619_0003599
1647 Ga0495619_0017075
1648 Ga0495619_0072399
1649 Ga0495619_0803409
1650 Ga0501084_0045423
1651 Ga0501084_0115664
1652 Ga0501084_0775157
1653 Ga0590071_002132
1654 Ga0590075_001175
1655 Ga0501082_0005914
1656 Ga0501082_0233872
1657 Ga0530510_0058389
1658 Ga0530510_0447422

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eio-assembly1.cif.gz_C-2 crystal structure of lysy from thermus thermophilus complexed with nadp+ and lysw-gamma-aminoadipic semialdehyde 0.8355 4 36
5ein-assembly1.cif.gz_C crystal structure of c148a mutant of lysy from thermus thermophilus in complex with nadp+ and lysw-gamma-aminoadipic acid 0.8321 4 36
3wwn-assembly1.cif.gz_B-2 crystal structure of lysz from thermus thermophilus complex with lysw 0.8084 4 36
6tps-assembly1.cif.gz_I early intermediate rna polymerase i pre-initiation complex - eipic 0.6782 4 35
5lmx-assembly1.cif.gz_I monomeric rna polymerase i at 4.9 a resolution 0.6582 4 37
ID Description Score Start End Superfamily
af_I1M6I0_390_487_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9456 75 104 1.25.40.10
af_Q9M907_475_614_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9327 75 104 1.25.40.10
af_Q4DPE2_262_423_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8997 68 107 1.10.1760.20
af_Q4DUB6_274_435_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8737 68 103 1.10.1760.20
5eioC00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.8355 4 36 2.20.28.160
ID Description Score Start End GO Terms
AF-A0A2V8EJB5-F1-model_v4 Uncharacterized protein 0.9913 1 154 GO:0016020
AF-A0A3D4FWX9-F1-model_v4 DUF983 domain-containing protein 0.9825 24 154 GO:0016020
AF-A0A2V8MLZ5-F1-model_v4 DUF4395 domain-containing protein 0.9541 46 143 GO:0016020
AF-A0A2E4KMT9-F1-model_v4 Uncharacterized protein 0.936 53 153 GO:0016020
AF-A0A3D4FWX9-F1-model_v4 DUF983 domain-containing protein 0.9334 24 154 GO:0016020

Map