F482602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 829 | 304 | 1658 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10156652|Ga0114129_101566523 |
| Length | 175 |
| Sequence | LNWWIDYSQFRNAITRLSNYPMQILARCPKCDAGLPVRAAEAPSAITCGRCGREIPLAISDEVRADRAVDRCPVCSGADFYIRKDFDPKLGLTVVIVGALISAAFYWFGRDLIAYGILAAAVMIDLVVYGRLKDVTVCYRCHTEFRGAYQRRAHAFDLHTADVLEVEYQRRVGRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 174 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 188 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 200 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 212 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 213 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 214 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 282 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 289 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 302 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 303 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 4.58 |
| Rhizosphere | 94.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10156652 | 3300009147 | Bacteria | 3114 |
| 2 | JGI24751J29686_10119432 | 3300002459 | Unclassified | 554 |
| 3 | JGI25406J46586_10066766 | 3300003203 | Unclassified | 1141 |
| 4 | Ga0065712_10080601 | 3300005290 | Bacteria | 3089 |
| 5 | Ga0065712_10085558 | 3300005290 | Bacteria | 2690 |
| 6 | Ga0065715_10004337 | 3300005293 | Bacteria | 4780 |
| 7 | Ga0065707_10719682 | 3300005295 | Bacteria | 631 |
| 8 | Ga0070676_10001366 | 3300005328 | Bacteria | 12293 |
| 9 | Ga0070676_10297136 | 3300005328 | Bacteria | 1093 |
| 10 | Ga0070683_100027315 | 3300005329 | Bacteria | 5146 |
| 11 | Ga0070683_100715514 | 3300005329 | Bacteria | 959 |
| 12 | Ga0070690_100091555 | 3300005330 | Bacteria | 2003 |
| 13 | Ga0070670_100278997 | 3300005331 | Unclassified | 1459 |
| 14 | Ga0070670_100330316 | 3300005331 | Bacteria | 1337 |
| 15 | Ga0070670_100492404 | 3300005331 | Bacteria | 1089 |
| 16 | Ga0070670_101140811 | 3300005331 | Unclassified | 711 |
| 17 | Ga0070670_101649569 | 3300005331 | Bacteria | 590 |
| 18 | Ga0070677_10090386 | 3300005333 | Bacteria | 1330 |
| 19 | Ga0068869_100093012 | 3300005334 | Unclassified | 2271 |
| 20 | Ga0068869_100608189 | 3300005334 | Unclassified | 924 |
| 21 | Ga0068869_100962682 | 3300005334 | Unclassified | 741 |
| 22 | Ga0070666_10125697 | 3300005335 | Unclassified | 1780 |
| 23 | Ga0070666_10361826 | 3300005335 | Bacteria | 1039 |
| 24 | Ga0070680_100469098 | 3300005336 | Bacteria | 1076 |
| 25 | Ga0070682_100582661 | 3300005337 | Unclassified | 880 |
| 26 | Ga0068868_100101430 | 3300005338 | Bacteria | 2329 |
| 27 | Ga0068868_100107428 | 3300005338 | Bacteria | 2265 |
| 28 | Ga0068868_100111675 | 3300005338 | Unclassified | 2221 |
| 29 | Ga0068868_100115424 | 3300005338 | Archaea | 2186 |
| 30 | Ga0068868_100252123 | 3300005338 | Bacteria | 1486 |
| 31 | Ga0068868_101705561 | 3300005338 | Unclassified | 594 |
| 32 | Ga0070660_100283566 | 3300005339 | Unclassified | 1356 |
| 33 | Ga0070660_101391044 | 3300005339 | Unclassified | 596 |
| 34 | Ga0070660_101679240 | 3300005339 | Unclassified | 541 |
| 35 | Ga0070689_100079981 | 3300005340 | Unclassified | 2565 |
| 36 | Ga0070689_100175558 | 3300005340 | Unclassified | 1738 |
| 37 | Ga0070689_100922111 | 3300005340 | Unclassified | 774 |
| 38 | Ga0070691_10055702 | 3300005341 | Bacteria | 1894 |
| 39 | Ga0070687_100178877 | 3300005343 | Bacteria | 1269 |
| 40 | Ga0070687_100368194 | 3300005343 | Bacteria | 932 |
| 41 | Ga0070661_100690040 | 3300005344 | Bacteria | 831 |
| 42 | Ga0070692_11040805 | 3300005345 | Bacteria | 575 |
| 43 | Ga0070668_100012918 | 3300005347 | Bacteria | 6220 |
| 44 | Ga0070668_100245130 | 3300005347 | Unclassified | 1486 |
| 45 | Ga0070669_100029378 | 3300005353 | Bacteria | 3962 |
| 46 | Ga0070669_100030711 | 3300005353 | Bacteria | 3878 |
| 47 | Ga0070669_100117442 | 3300005353 | Unclassified | 2025 |
| 48 | Ga0070669_100471046 | 3300005353 | Unclassified | 1038 |
| 49 | Ga0070675_100042892 | 3300005354 | Bacteria | 3696 |
| 50 | Ga0070675_100052041 | 3300005354 | Bacteria | 3366 |
| 51 | Ga0070675_100113918 | 3300005354 | Bacteria | 2291 |
| 52 | Ga0070671_100093982 | 3300005355 | Bacteria | 2513 |
| 53 | Ga0070671_100175613 | 3300005355 | Bacteria | 1812 |
| 54 | Ga0070671_100720367 | 3300005355 | Bacteria | 866 |
| 55 | Ga0070674_100015355 | 3300005356 | Bacteria | 4780 |
| 56 | Ga0070674_100063609 | 3300005356 | Bacteria | 2583 |
| 57 | Ga0070674_100288378 | 3300005356 | Unclassified | 1304 |
| 58 | Ga0070674_100596543 | 3300005356 | Bacteria | 933 |
| 59 | Ga0070673_101491223 | 3300005364 | Bacteria | 638 |
| 60 | Ga0070688_100012569 | 3300005365 | Bacteria | 4746 |
| 61 | Ga0070688_100043332 | 3300005365 | Bacteria | 2772 |
| 62 | Ga0070659_100150356 | 3300005366 | Unclassified | 1899 |
| 63 | Ga0070667_100036885 | 3300005367 | Bacteria | 4098 |
| 64 | Ga0070667_101148144 | 3300005367 | Unclassified | 727 |
| 65 | Ga0070710_10446136 | 3300005437 | Bacteria | 876 |
| 66 | Ga0070701_10005792 | 3300005438 | Bacteria | 5144 |
| 67 | Ga0070701_10218798 | 3300005438 | Bacteria | 1135 |
| 68 | Ga0070701_10321110 | 3300005438 | Unclassified | 958 |
| 69 | Ga0070701_10440643 | 3300005438 | Bacteria | 834 |
| 70 | Ga0070701_10511201 | 3300005438 | Unclassified | 782 |
| 71 | Ga0070711_100054973 | 3300005439 | Unclassified | 2749 |
| 72 | Ga0070711_100125730 | 3300005439 | Bacteria | 1903 |
| 73 | Ga0070705_100010712 | 3300005440 | Bacteria | 4599 |
| 74 | Ga0070705_100073222 | 3300005440 | Bacteria | 2078 |
| 75 | Ga0070705_100192297 | 3300005440 | Unclassified | 1392 |
| 76 | Ga0070705_100261969 | 3300005440 | Bacteria | 1220 |
| 77 | Ga0070700_100025011 | 3300005441 | Bacteria | 3513 |
| 78 | Ga0070700_100115138 | 3300005441 | Bacteria | 1794 |
| 79 | Ga0070700_100915304 | 3300005441 | Unclassified | 715 |
| 80 | Ga0070694_100022280 | 3300005444 | Bacteria | 4058 |
| 81 | Ga0070694_100032981 | 3300005444 | Bacteria | 3404 |
| 82 | Ga0070694_100040457 | 3300005444 | Bacteria | 3108 |
| 83 | Ga0070694_100201111 | 3300005444 | Bacteria | 1485 |
| 84 | Ga0070694_100334650 | 3300005444 | Bacteria | 1169 |
| 85 | Ga0070694_100612055 | 3300005444 | Bacteria | 878 |
| 86 | Ga0070708_100195540 | 3300005445 | Unclassified | 1892 |
| 87 | Ga0070708_100654014 | 3300005445 | Unclassified | 990 |
| 88 | Ga0070708_100944648 | 3300005445 | Bacteria | 809 |
| 89 | Ga0070663_101948614 | 3300005455 | Unclassified | 528 |
| 90 | Ga0070678_100097821 | 3300005456 | Bacteria | 2267 |
| 91 | Ga0070678_100332587 | 3300005456 | Unclassified | 1301 |
| 92 | Ga0070678_100617645 | 3300005456 | Bacteria | 969 |
| 93 | Ga0070678_101270789 | 3300005456 | Bacteria | 684 |
| 94 | Ga0070662_100090753 | 3300005457 | Bacteria | 2294 |
| 95 | Ga0070662_100237599 | 3300005457 | Bacteria | 1460 |
| 96 | Ga0070662_100708816 | 3300005457 | Bacteria | 852 |
| 97 | Ga0070681_10106845 | 3300005458 | Bacteria | 2740 |
| 98 | Ga0070681_11403161 | 3300005458 | Unclassified | 622 |
| 99 | Ga0068867_100002097 | 3300005459 | Bacteria | 13966 |
| 100 | Ga0068867_100018173 | 3300005459 | Bacteria | 4996 |
| 101 | Ga0068867_100020766 | 3300005459 | Bacteria | 4681 |
| 102 | Ga0068867_100280302 | 3300005459 | Bacteria | 1367 |
| 103 | Ga0068867_101108229 | 3300005459 | Unclassified | 723 |
| 104 | Ga0068867_101917884 | 3300005459 | Viruses | 559 |
| 105 | Ga0070685_10036929 | 3300005466 | Unclassified | 2764 |
| 106 | Ga0070685_10294910 | 3300005466 | Bacteria | 1091 |
| 107 | Ga0070706_100118543 | 3300005467 | Unclassified | 2466 |
| 108 | Ga0070706_100839023 | 3300005467 | Bacteria | 850 |
| 109 | Ga0070706_101108248 | 3300005467 | Bacteria | 729 |
| 110 | Ga0070707_100052416 | 3300005468 | Bacteria | 3912 |
| 111 | Ga0070707_100055342 | 3300005468 | Bacteria | 3804 |
| 112 | Ga0070707_100081015 | 3300005468 | Bacteria | 3134 |
| 113 | Ga0070698_100264789 | 3300005471 | Unclassified | 1651 |
| 114 | Ga0070698_100378182 | 3300005471 | Bacteria | 1349 |
| 115 | Ga0070698_100771027 | 3300005471 | Unclassified | 905 |
| 116 | Ga0070699_100003176 | 3300005518 | Bacteria | 14548 |
| 117 | Ga0070699_100071764 | 3300005518 | Bacteria | 3012 |
| 118 | Ga0070699_100441730 | 3300005518 | Unclassified | 1179 |
| 119 | Ga0070699_101008934 | 3300005518 | Unclassified | 763 |
| 120 | Ga0070679_100076744 | 3300005530 | Bacteria | 3330 |
| 121 | Ga0070679_100279722 | 3300005530 | Unclassified | 1621 |
| 122 | Ga0070684_100079683 | 3300005535 | Unclassified | 2896 |
| 123 | Ga0070684_100409608 | 3300005535 | Bacteria | 1251 |
| 124 | Ga0070684_102098993 | 3300005535 | Bacteria | 533 |
| 125 | Ga0070697_100085215 | 3300005536 | Bacteria | 2607 |
| 126 | Ga0070697_100347162 | 3300005536 | Bacteria | 1281 |
| 127 | Ga0070697_100794691 | 3300005536 | Bacteria | 837 |
| 128 | Ga0068853_100713753 | 3300005539 | Unclassified | 957 |
| 129 | Ga0070672_100063406 | 3300005543 | Bacteria | 2918 |
| 130 | Ga0070672_100152394 | 3300005543 | Bacteria | 1913 |
| 131 | Ga0070672_101481782 | 3300005543 | Unclassified | 608 |
| 132 | Ga0070686_100215022 | 3300005544 | Bacteria | 1386 |
| 133 | Ga0070695_100001441 | 3300005545 | Bacteria | 13201 |
| 134 | Ga0070695_100107225 | 3300005545 | Bacteria | 1890 |
| 135 | Ga0070695_100183413 | 3300005545 | Bacteria | 1484 |
| 136 | Ga0070695_100205869 | 3300005545 | Bacteria | 1409 |
| 137 | Ga0070695_101013941 | 3300005545 | Bacteria | 676 |
| 138 | Ga0070696_100067973 | 3300005546 | Bacteria | 2501 |
| 139 | Ga0070696_100082669 | 3300005546 | Bacteria | 2277 |
| 140 | Ga0070696_100106555 | 3300005546 | Bacteria | 2015 |
| 141 | Ga0070696_100260527 | 3300005546 | Bacteria | 1315 |
| 142 | Ga0070696_100450416 | 3300005546 | Bacteria | 1015 |
| 143 | Ga0070693_100363573 | 3300005547 | Bacteria | 994 |
| 144 | Ga0070665_100016860 | 3300005548 | Bacteria | 7325 |
| 145 | Ga0070665_100044841 | 3300005548 | Bacteria | 4439 |
| 146 | Ga0070665_100344449 | 3300005548 | Unclassified | 1495 |
| 147 | Ga0070665_101026335 | 3300005548 | Bacteria | 837 |
| 148 | Ga0070704_100003928 | 3300005549 | Bacteria | 8561 |
| 149 | Ga0070704_100023249 | 3300005549 | Bacteria | 4043 |
| 150 | Ga0070704_100053861 | 3300005549 | Bacteria | 2845 |
| 151 | Ga0070704_100140774 | 3300005549 | Bacteria | 1883 |
| 152 | Ga0070704_100935212 | 3300005549 | Bacteria | 781 |
| 153 | Ga0070704_101007162 | 3300005549 | Unclassified | 754 |
| 154 | Ga0070664_100195327 | 3300005564 | Bacteria | 1804 |
| 155 | Ga0070664_100927353 | 3300005564 | Unclassified | 817 |
| 156 | Ga0070664_101396302 | 3300005564 | Unclassified | 662 |
| 157 | Ga0068857_100078036 | 3300005577 | Bacteria | 2956 |
| 158 | Ga0068857_100782875 | 3300005577 | Bacteria | 910 |
| 159 | Ga0068854_100021553 | 3300005578 | Bacteria | 4373 |
| 160 | Ga0068856_100994547 | 3300005614 | Bacteria | 857 |
| 161 | Ga0070702_100000624 | 3300005615 | Bacteria | 13045 |
| 162 | Ga0068852_100124584 | 3300005616 | Bacteria | 2364 |
| 163 | Ga0068859_100002294 | 3300005617 | Bacteria | 19421 |
| 164 | Ga0068859_100104173 | 3300005617 | Bacteria | 2896 |
| 165 | Ga0068859_100697724 | 3300005617 | Unclassified | 1106 |
| 166 | Ga0068859_101546121 | 3300005617 | Unclassified | 732 |
| 167 | Ga0068859_101839530 | 3300005617 | Bacteria | 669 |
| 168 | Ga0068864_100002167 | 3300005618 | Bacteria | 16210 |
| 169 | Ga0068864_100104072 | 3300005618 | Archaea | 2521 |
| 170 | Ga0068864_100124050 | 3300005618 | Bacteria | 2312 |
| 171 | Ga0068864_101080178 | 3300005618 | Unclassified | 798 |
| 172 | Ga0068864_102112207 | 3300005618 | Unclassified | 570 |
| 173 | Ga0068866_10062469 | 3300005718 | Bacteria | 1938 |
| 174 | Ga0068866_10107149 | 3300005718 | Bacteria | 1552 |
| 175 | Ga0068866_10121207 | 3300005718 | Bacteria | 1474 |
| 176 | Ga0068866_10122337 | 3300005718 | Unclassified | 1468 |
| 177 | Ga0068866_10366790 | 3300005718 | Unclassified | 920 |
| 178 | Ga0068861_100011220 | 3300005719 | Bacteria | 6219 |
| 179 | Ga0068861_100029368 | 3300005719 | Bacteria | 4022 |
| 180 | Ga0068861_100150503 | 3300005719 | Bacteria | 1909 |
| 181 | Ga0068861_100173726 | 3300005719 | Bacteria | 1788 |
| 182 | Ga0068861_100208885 | 3300005719 | Unclassified | 1643 |
| 183 | Ga0068861_100295915 | 3300005719 | Unclassified | 1400 |
| 184 | Ga0068870_10090174 | 3300005840 | Unclassified | 1712 |
| 185 | Ga0068863_100012476 | 3300005841 | Bacteria | 8203 |
| 186 | Ga0068863_100169686 | 3300005841 | Unclassified | 2092 |
| 187 | Ga0068863_100217099 | 3300005841 | Unclassified | 1842 |
| 188 | Ga0068863_100479810 | 3300005841 | Bacteria | 1223 |
| 189 | Ga0068863_100548302 | 3300005841 | Unclassified | 1141 |
| 190 | Ga0068863_101079181 | 3300005841 | Bacteria | 807 |
| 191 | Ga0068858_100029645 | 3300005842 | Bacteria | 5082 |
| 192 | Ga0068858_100107941 | 3300005842 | Unclassified | 2599 |
| 193 | Ga0068858_100220278 | 3300005842 | Bacteria | 1797 |
| 194 | Ga0068858_100693580 | 3300005842 | Bacteria | 991 |
| 195 | Ga0068858_100825770 | 3300005842 | Bacteria | 905 |
| 196 | Ga0068858_101677175 | 3300005842 | Unclassified | 627 |
| 197 | Ga0068860_100138091 | 3300005843 | Bacteria | 2341 |
| 198 | Ga0068860_100343474 | 3300005843 | Unclassified | 1468 |
| 199 | Ga0068860_100789380 | 3300005843 | Unclassified | 963 |
| 200 | Ga0068860_101184683 | 3300005843 | Bacteria | 784 |
| 201 | Ga0068860_101480252 | 3300005843 | Bacteria | 700 |
| 202 | Ga0068860_101672483 | 3300005843 | Unclassified | 658 |
| 203 | Ga0068860_102041262 | 3300005843 | Bacteria | 595 |
| 204 | Ga0068862_100036864 | 3300005844 | Bacteria | 4144 |
| 205 | Ga0068862_100104747 | 3300005844 | Bacteria | 2478 |
| 206 | Ga0068862_100138157 | 3300005844 | Unclassified | 2161 |
| 207 | Ga0068862_100172887 | 3300005844 | Bacteria | 1935 |
| 208 | Ga0068862_100205244 | 3300005844 | Bacteria | 1778 |
| 209 | Ga0068862_102089397 | 3300005844 | Bacteria | 577 |
| 210 | Ga0081455_10036603 | 3300005937 | Bacteria | 4367 |
| 211 | Ga0081539_10025788 | 3300005985 | Bacteria | 3770 |
| 212 | Ga0070717_10346298 | 3300006028 | Bacteria | 1328 |
| 213 | Ga0070715_10381363 | 3300006163 | Unclassified | 778 |
| 214 | Ga0070715_10565184 | 3300006163 | Unclassified | 661 |
| 215 | Ga0097621_100004485 | 3300006237 | Bacteria | 9731 |
| 216 | Ga0097621_100015314 | 3300006237 | Bacteria | 5767 |
| 217 | Ga0097621_100019423 | 3300006237 | Archaea | 5214 |
| 218 | Ga0097621_100021970 | 3300006237 | Bacteria | 4945 |
| 219 | Ga0097621_100026579 | 3300006237 | Bacteria | 4543 |
| 220 | Ga0097621_100042241 | 3300006237 | Bacteria | 3672 |
| 221 | Ga0097621_100236837 | 3300006237 | Bacteria | 1595 |
| 222 | Ga0097621_100324277 | 3300006237 | Bacteria | 1365 |
| 223 | Ga0097621_100476857 | 3300006237 | Bacteria | 1127 |
| 224 | Ga0068871_100036235 | 3300006358 | Bacteria | 3927 |
| 225 | Ga0068871_100062149 | 3300006358 | Bacteria | 3051 |
| 226 | Ga0068871_100067701 | 3300006358 | Bacteria | 2930 |
| 227 | Ga0068871_100068350 | 3300006358 | Bacteria | 2917 |
| 228 | Ga0068871_100323441 | 3300006358 | Unclassified | 1359 |
| 229 | Ga0068871_100529875 | 3300006358 | Unclassified | 1065 |
| 230 | Ga0068871_100542493 | 3300006358 | Bacteria | 1052 |
| 231 | Ga0068871_100885050 | 3300006358 | Bacteria | 827 |
| 232 | Ga0075428_100000005 | 3300006844 | Bacteria | 326130 |
| 233 | Ga0075428_101773168 | 3300006844 | Unclassified | 643 |
| 234 | Ga0075430_100694078 | 3300006846 | Bacteria | 839 |
| 235 | Ga0075431_100051743 | 3300006847 | Bacteria | 4235 |
| 236 | Ga0075431_100065918 | 3300006847 | Bacteria | 3739 |
| 237 | Ga0075431_100241004 | 3300006847 | Unclassified | 1840 |
| 238 | Ga0075431_102075655 | 3300006847 | Unclassified | 523 |
| 239 | Ga0075433_10057392 | 3300006852 | Bacteria | 3403 |
| 240 | Ga0075433_10081222 | 3300006852 | Bacteria | 2858 |
| 241 | Ga0075433_10090819 | 3300006852 | Unclassified | 2700 |
| 242 | Ga0075433_10144685 | 3300006852 | Unclassified | 2113 |
| 243 | Ga0075433_10254376 | 3300006852 | Unclassified | 1558 |
| 244 | Ga0075433_10565386 | 3300006852 | Bacteria | 999 |
| 245 | Ga0075433_10681660 | 3300006852 | Unclassified | 901 |
| 246 | Ga0075433_10870544 | 3300006852 | Unclassified | 786 |
| 247 | Ga0075434_100011109 | 3300006871 | Bacteria | 8473 |
| 248 | Ga0075434_100015041 | 3300006871 | Bacteria | 7410 |
| 249 | Ga0075434_100034937 | 3300006871 | Bacteria | 4968 |
| 250 | Ga0075434_100083214 | 3300006871 | Bacteria | 3197 |
| 251 | Ga0075434_100096589 | 3300006871 | Bacteria | 2960 |
| 252 | Ga0075434_101267968 | 3300006871 | Bacteria | 748 |
| 253 | Ga0075434_101806781 | 3300006871 | Bacteria | 618 |
| 254 | Ga0075429_100981222 | 3300006880 | Unclassified | 739 |
| 255 | Ga0068865_100025544 | 3300006881 | Bacteria | 3886 |
| 256 | Ga0068865_100266053 | 3300006881 | Bacteria | 1359 |
| 257 | Ga0075436_100008336 | 3300006914 | Bacteria | 7088 |
| 258 | Ga0075436_100012160 | 3300006914 | Bacteria | 5897 |
| 259 | Ga0075436_100035527 | 3300006914 | Bacteria | 3437 |
| 260 | Ga0075436_100036146 | 3300006914 | Bacteria | 3408 |
| 261 | Ga0075436_100119305 | 3300006914 | Bacteria | 1844 |
| 262 | Ga0075436_100139293 | 3300006914 | Bacteria | 1704 |
| 263 | Ga0075436_100264288 | 3300006914 | Bacteria | 1227 |
| 264 | Ga0075436_100770572 | 3300006914 | Bacteria | 715 |
| 265 | Ga0097620_100002294 | 3300006931 | Bacteria | 19421 |
| 266 | Ga0097620_100104178 | 3300006931 | Bacteria | 2896 |
| 267 | Ga0097620_100697808 | 3300006931 | Unclassified | 1106 |
| 268 | Ga0097620_101546126 | 3300006931 | Unclassified | 732 |
| 269 | Ga0097620_101839484 | 3300006931 | Bacteria | 669 |
| 270 | Ga0075435_100001816 | 3300007076 | Bacteria | 13876 |
| 271 | Ga0075435_100008469 | 3300007076 | Bacteria | 7380 |
| 272 | Ga0075435_100017880 | 3300007076 | Bacteria | 5374 |
| 273 | Ga0075435_100046046 | 3300007076 | Bacteria | 3497 |
| 274 | Ga0075435_100148399 | 3300007076 | Unclassified | 1970 |
| 275 | Ga0075435_100290970 | 3300007076 | Unclassified | 1396 |
| 276 | Ga0075435_100300717 | 3300007076 | Bacteria | 1372 |
| 277 | Ga0105240_10096194 | 3300009093 | Bacteria | 3610 |
| 278 | Ga0105240_10184954 | 3300009093 | Unclassified | 2455 |
| 279 | Ga0105240_10195029 | 3300009093 | Unclassified | 2379 |
| 280 | Ga0105240_10577173 | 3300009093 | Bacteria | 1241 |
| 281 | Ga0105240_10865196 | 3300009093 | Bacteria | 975 |
| 282 | Ga0111539_10000008 | 3300009094 | Bacteria | 382609 |
| 283 | Ga0111539_10005984 | 3300009094 | Bacteria | 15714 |
| 284 | Ga0111539_10006975 | 3300009094 | Bacteria | 14498 |
| 285 | Ga0111539_10385263 | 3300009094 | Bacteria | 1632 |
| 286 | Ga0111539_10495993 | 3300009094 | Bacteria | 1422 |
| 287 | Ga0111539_10570386 | 3300009094 | Unclassified | 1318 |
| 288 | Ga0111539_11092779 | 3300009094 | Bacteria | 927 |
| 289 | Ga0111539_11803404 | 3300009094 | Bacteria | 709 |
| 290 | Ga0105245_10001762 | 3300009098 | Bacteria | 19728 |
| 291 | Ga0105245_10490012 | 3300009098 | Unclassified | 1244 |
| 292 | Ga0105245_10832131 | 3300009098 | Unclassified | 962 |
| 293 | Ga0105245_10920229 | 3300009098 | Unclassified | 917 |
| 294 | Ga0105245_11661326 | 3300009098 | Unclassified | 691 |
| 295 | Ga0105245_11803152 | 3300009098 | Unclassified | 665 |
| 296 | Ga0105247_10004214 | 3300009101 | Bacteria | 9223 |
| 297 | Ga0105247_10312784 | 3300009101 | Bacteria | 1093 |
| 298 | Ga0114129_10002454 | 3300009147 | Bacteria | 25742 |
| 299 | Ga0114129_10002522 | 3300009147 | Bacteria | 25425 |
| 300 | Ga0114129_10004744 | 3300009147 | Bacteria | 19206 |
| 301 | Ga0114129_10023846 | 3300009147 | Bacteria | 8671 |
| 302 | Ga0114129_10024935 | 3300009147 | Bacteria | 8479 |
| 303 | Ga0114129_10047223 | 3300009147 | Bacteria | 6051 |
| 304 | Ga0114129_10072618 | 3300009147 | Bacteria | 4796 |
| 305 | Ga0114129_10130146 | 3300009147 | Unclassified | 3458 |
| 306 | Ga0114129_10275915 | 3300009147 | Bacteria | 2247 |
| 307 | Ga0114129_10371477 | 3300009147 | Unclassified | 1890 |
| 308 | Ga0114129_10540555 | 3300009147 | Bacteria | 1517 |
| 309 | Ga0114129_10584291 | 3300009147 | Bacteria | 1449 |
| 310 | Ga0114129_10772010 | 3300009147 | Bacteria | 1228 |
| 311 | Ga0114129_10909681 | 3300009147 | Unclassified | 1114 |
| 312 | Ga0114129_11232683 | 3300009147 | Bacteria | 930 |
| 313 | Ga0114129_11305827 | 3300009147 | Bacteria | 899 |
| 314 | Ga0114129_13288703 | 3300009147 | Unclassified | 523 |
| 315 | Ga0105243_10114209 | 3300009148 | Bacteria | 2266 |
| 316 | Ga0105243_10125552 | 3300009148 | Bacteria | 2170 |
| 317 | Ga0105243_10636780 | 3300009148 | Bacteria | 1031 |
| 318 | Ga0105243_10705238 | 3300009148 | Bacteria | 984 |
| 319 | Ga0105243_10975912 | 3300009148 | Unclassified | 848 |
| 320 | Ga0105243_11971661 | 3300009148 | Bacteria | 618 |
| 321 | Ga0105243_12168049 | 3300009148 | Bacteria | 592 |
| 322 | Ga0105241_10426591 | 3300009174 | Bacteria | 1168 |
| 323 | Ga0105241_11862459 | 3300009174 | Unclassified | 589 |
| 324 | Ga0105242_10004556 | 3300009176 | Bacteria | 10755 |
| 325 | Ga0105242_10020139 | 3300009176 | Bacteria | 5229 |
| 326 | Ga0105242_10180717 | 3300009176 | Bacteria | 1861 |
| 327 | Ga0105242_10620726 | 3300009176 | Bacteria | 1047 |
| 328 | Ga0105242_10687238 | 3300009176 | Unclassified | 999 |
| 329 | Ga0105242_10893321 | 3300009176 | Bacteria | 888 |
| 330 | Ga0105248_10003660 | 3300009177 | Bacteria | 17052 |
| 331 | Ga0105248_10013961 | 3300009177 | Bacteria | 8838 |
| 332 | Ga0105248_10032263 | 3300009177 | Bacteria | 5855 |
| 333 | Ga0105248_10093625 | 3300009177 | Bacteria | 3384 |
| 334 | Ga0105248_10271381 | 3300009177 | Bacteria | 1910 |
| 335 | Ga0105248_10354140 | 3300009177 | Unclassified | 1653 |
| 336 | Ga0105248_10609398 | 3300009177 | Bacteria | 1232 |
| 337 | Ga0105248_10761816 | 3300009177 | Bacteria | 1092 |
| 338 | Ga0105248_10772266 | 3300009177 | Unclassified | 1084 |
| 339 | Ga0105248_11019394 | 3300009177 | Bacteria | 935 |
| 340 | Ga0105248_11155448 | 3300009177 | Bacteria | 875 |
| 341 | Ga0105248_11981664 | 3300009177 | Unclassified | 661 |
| 342 | Ga0105248_12390472 | 3300009177 | Bacteria | 602 |
| 343 | Ga0105237_10179635 | 3300009545 | Bacteria | 2117 |
| 344 | Ga0105237_10381088 | 3300009545 | Bacteria | 1415 |
| 345 | Ga0105238_10452037 | 3300009551 | Bacteria | 1282 |
| 346 | Ga0105238_11002864 | 3300009551 | Unclassified | 856 |
| 347 | Ga0105238_11551190 | 3300009551 | Unclassified | 692 |
| 348 | Ga0105249_10086774 | 3300009553 | Bacteria | 2919 |
| 349 | Ga0105249_10204042 | 3300009553 | Bacteria | 1936 |
| 350 | Ga0105249_10426319 | 3300009553 | Unclassified | 1361 |
| 351 | Ga0105249_10934912 | 3300009553 | Bacteria | 935 |
| 352 | Ga0105249_10982552 | 3300009553 | Bacteria | 913 |
| 353 | Ga0105249_11156046 | 3300009553 | Bacteria | 845 |
| 354 | Ga0105249_12552079 | 3300009553 | Bacteria | 583 |
| 355 | Ga0105239_10402639 | 3300010375 | Bacteria | 1549 |
| 356 | Ga0105246_10324919 | 3300011119 | Bacteria | 1252 |
| 357 | Ga0105246_10834380 | 3300011119 | Bacteria | 821 |
| 358 | Ga0157374_10069568 | 3300013296 | Unclassified | 3314 |
| 359 | Ga0157374_11305571 | 3300013296 | Bacteria | 748 |
| 360 | Ga0157378_10389158 | 3300013297 | Unclassified | 1371 |
| 361 | Ga0157378_10487422 | 3300013297 | Unclassified | 1229 |
| 362 | Ga0157378_10924029 | 3300013297 | Unclassified | 904 |
| 363 | Ga0163162_10101495 | 3300013306 | Unclassified | 2969 |
| 364 | Ga0163162_10437192 | 3300013306 | Bacteria | 1440 |
| 365 | Ga0163162_10747938 | 3300013306 | Bacteria | 1097 |
| 366 | Ga0163162_10876752 | 3300013306 | Unclassified | 1012 |
| 367 | Ga0157372_10989373 | 3300013307 | Bacteria | 974 |
| 368 | Ga0157375_10074074 | 3300013308 | Bacteria | 3425 |
| 369 | Ga0157375_10153304 | 3300013308 | Bacteria | 2441 |
| 370 | Ga0157375_10261060 | 3300013308 | Bacteria | 1894 |
| 371 | Ga0157375_10853739 | 3300013308 | Unclassified | 1057 |
| 372 | Ga0163163_10002970 | 3300014325 | Bacteria | 14346 |
| 373 | Ga0163163_10282799 | 3300014325 | Bacteria | 1710 |
| 374 | Ga0163163_10609288 | 3300014325 | Bacteria | 1155 |
| 375 | Ga0163163_10840811 | 3300014325 | Unclassified | 981 |
| 376 | Ga0163163_11513013 | 3300014325 | Bacteria | 732 |
| 377 | Ga0163163_12539303 | 3300014325 | Unclassified | 570 |
| 378 | Ga0157380_10021482 | 3300014326 | Bacteria | 4841 |
| 379 | Ga0157380_10239360 | 3300014326 | Bacteria | 1635 |
| 380 | Ga0157380_10707289 | 3300014326 | Bacteria | 1013 |
| 381 | Ga0157380_10729009 | 3300014326 | Bacteria | 1000 |
| 382 | Ga0157380_10778206 | 3300014326 | Bacteria | 971 |
| 383 | Ga0157380_11727852 | 3300014326 | Bacteria | 684 |
| 384 | Ga0157380_12124772 | 3300014326 | Unclassified | 625 |
| 385 | Ga0157377_10324658 | 3300014745 | Bacteria | 1024 |
| 386 | Ga0157379_10009368 | 3300014968 | Bacteria | 8533 |
| 387 | Ga0157379_10017186 | 3300014968 | Bacteria | 6372 |
| 388 | Ga0157379_10045873 | 3300014968 | Bacteria | 3901 |
| 389 | Ga0157379_10560859 | 3300014968 | Unclassified | 1063 |
| 390 | Ga0157379_10935488 | 3300014968 | Bacteria | 824 |
| 391 | Ga0157376_10007383 | 3300014969 | Bacteria | 7842 |
| 392 | Ga0157376_10023512 | 3300014969 | Bacteria | 4823 |
| 393 | Ga0157376_10026344 | 3300014969 | Bacteria | 4593 |
| 394 | Ga0157376_10397908 | 3300014969 | Unclassified | 1331 |
| 395 | Ga0157376_11420530 | 3300014969 | Unclassified | 726 |
| 396 | Ga0157376_11763356 | 3300014969 | Bacteria | 655 |
| 397 | Ga0163161_10385455 | 3300017792 | Bacteria | 1121 |
| 398 | Ga0163161_10780624 | 3300017792 | Bacteria | 801 |
| 399 | Ga0213876_10454800 | 3300021384 | Bacteria | 681 |
| 400 | Ga0207697_10167434 | 3300025315 | Bacteria | 960 |
| 401 | Ga0207642_10190676 | 3300025899 | Bacteria | 1124 |
| 402 | Ga0207642_10243649 | 3300025899 | Bacteria | 1016 |
| 403 | Ga0207680_10069645 | 3300025903 | Unclassified | 2174 |
| 404 | Ga0207680_10158042 | 3300025903 | Bacteria | 1517 |
| 405 | Ga0207685_10395022 | 3300025905 | Unclassified | 707 |
| 406 | Ga0207685_10395982 | 3300025905 | Bacteria | 707 |
| 407 | Ga0207699_10015778 | 3300025906 | Bacteria | 3934 |
| 408 | Ga0207645_10002091 | 3300025907 | Bacteria | 15970 |
| 409 | Ga0207645_10351971 | 3300025907 | Unclassified | 986 |
| 410 | Ga0207643_10730658 | 3300025908 | Unclassified | 640 |
| 411 | Ga0207684_10956167 | 3300025910 | Unclassified | 718 |
| 412 | Ga0207654_10527712 | 3300025911 | Bacteria | 836 |
| 413 | Ga0207707_10279452 | 3300025912 | Unclassified | 1446 |
| 414 | Ga0207707_10820702 | 3300025912 | Bacteria | 773 |
| 415 | Ga0207695_10170769 | 3300025913 | Bacteria | 2100 |
| 416 | Ga0207695_10191257 | 3300025913 | Bacteria | 1964 |
| 417 | Ga0207695_10634378 | 3300025913 | Bacteria | 949 |
| 418 | Ga0207695_10758946 | 3300025913 | Unclassified | 850 |
| 419 | Ga0207660_10138464 | 3300025917 | Bacteria | 1859 |
| 420 | Ga0207660_10906661 | 3300025917 | Unclassified | 719 |
| 421 | Ga0207662_10270528 | 3300025918 | Unclassified | 1121 |
| 422 | Ga0207662_10377975 | 3300025918 | Bacteria | 956 |
| 423 | Ga0207657_10257276 | 3300025919 | Unclassified | 1390 |
| 424 | Ga0207657_10969041 | 3300025919 | Unclassified | 653 |
| 425 | Ga0207649_10822657 | 3300025920 | Bacteria | 726 |
| 426 | Ga0207652_10547397 | 3300025921 | Unclassified | 1040 |
| 427 | Ga0207652_11504502 | 3300025921 | Unclassified | 577 |
| 428 | Ga0207646_10043289 | 3300025922 | Bacteria | 4044 |
| 429 | Ga0207646_10051452 | 3300025922 | Bacteria | 3686 |
| 430 | Ga0207646_10153206 | 3300025922 | Unclassified | 2079 |
| 431 | Ga0207646_10568852 | 3300025922 | Bacteria | 1018 |
| 432 | Ga0207646_10876785 | 3300025922 | Bacteria | 797 |
| 433 | Ga0207681_10043056 | 3300025923 | Bacteria | 3020 |
| 434 | Ga0207681_10082383 | 3300025923 | Bacteria | 2274 |
| 435 | Ga0207681_10130141 | 3300025923 | Bacteria | 1859 |
| 436 | Ga0207681_10472243 | 3300025923 | Unclassified | 1023 |
| 437 | Ga0207694_11030440 | 3300025924 | Unclassified | 696 |
| 438 | Ga0207650_10042085 | 3300025925 | Bacteria | 3351 |
| 439 | Ga0207650_10046439 | 3300025925 | Bacteria | 3198 |
| 440 | Ga0207650_10078551 | 3300025925 | Bacteria | 2497 |
| 441 | Ga0207650_10479189 | 3300025925 | Bacteria | 1038 |
| 442 | Ga0207650_10710911 | 3300025925 | Bacteria | 849 |
| 443 | Ga0207650_10967420 | 3300025925 | Unclassified | 724 |
| 444 | Ga0207659_10000452 | 3300025926 | Bacteria | 24737 |
| 445 | Ga0207659_10033882 | 3300025926 | Bacteria | 3518 |
| 446 | Ga0207659_10581749 | 3300025926 | Unclassified | 953 |
| 447 | Ga0207659_10678944 | 3300025926 | Unclassified | 881 |
| 448 | Ga0207659_10962004 | 3300025926 | Unclassified | 734 |
| 449 | Ga0207687_10299088 | 3300025927 | Bacteria | 1296 |
| 450 | Ga0207687_10467323 | 3300025927 | Unclassified | 1048 |
| 451 | Ga0207700_10055736 | 3300025928 | Bacteria | 2972 |
| 452 | Ga0207644_10087083 | 3300025931 | Bacteria | 2321 |
| 453 | Ga0207644_11253300 | 3300025931 | Bacteria | 623 |
| 454 | Ga0207690_11168266 | 3300025932 | Unclassified | 642 |
| 455 | Ga0207706_10159756 | 3300025933 | Bacteria | 1981 |
| 456 | Ga0207706_10189351 | 3300025933 | Bacteria | 1806 |
| 457 | Ga0207706_10220485 | 3300025933 | Unclassified | 1661 |
| 458 | Ga0207706_10244056 | 3300025933 | Bacteria | 1570 |
| 459 | Ga0207706_10396176 | 3300025933 | Bacteria | 1197 |
| 460 | Ga0207706_10991269 | 3300025933 | Unclassified | 706 |
| 461 | Ga0207686_10086937 | 3300025934 | Unclassified | 2055 |
| 462 | Ga0207686_10250266 | 3300025934 | Bacteria | 1294 |
| 463 | Ga0207686_10670262 | 3300025934 | Bacteria | 822 |
| 464 | Ga0207709_10105681 | 3300025935 | Bacteria | 1871 |
| 465 | Ga0207670_10153243 | 3300025936 | Unclassified | 1712 |
| 466 | Ga0207670_10356899 | 3300025936 | Unclassified | 1159 |
| 467 | Ga0207669_10024470 | 3300025937 | Bacteria | 3246 |
| 468 | Ga0207669_10469371 | 3300025937 | Bacteria | 1001 |
| 469 | Ga0207669_10931994 | 3300025937 | Unclassified | 727 |
| 470 | Ga0207704_10097737 | 3300025938 | Bacteria | 1948 |
| 471 | Ga0207704_10366677 | 3300025938 | Bacteria | 1126 |
| 472 | Ga0207704_10472621 | 3300025938 | Bacteria | 1005 |
| 473 | Ga0207665_10055349 | 3300025939 | Bacteria | 2676 |
| 474 | Ga0207691_10010298 | 3300025940 | Bacteria | 8969 |
| 475 | Ga0207691_10105363 | 3300025940 | Bacteria | 2512 |
| 476 | Ga0207691_10262209 | 3300025940 | Bacteria | 1490 |
| 477 | Ga0207711_10024485 | 3300025941 | Bacteria | 5059 |
| 478 | Ga0207711_10107549 | 3300025941 | Bacteria | 2476 |
| 479 | Ga0207711_10150743 | 3300025941 | Unclassified | 2098 |
| 480 | Ga0207711_10274636 | 3300025941 | Bacteria | 1551 |
| 481 | Ga0207711_10372624 | 3300025941 | Bacteria | 1324 |
| 482 | Ga0207711_10469466 | 3300025941 | Unclassified | 1172 |
| 483 | Ga0207711_10725475 | 3300025941 | Unclassified | 927 |
| 484 | Ga0207711_10885461 | 3300025941 | Unclassified | 830 |
| 485 | Ga0207711_11766710 | 3300025941 | Unclassified | 562 |
| 486 | Ga0207689_10066268 | 3300025942 | Unclassified | 2970 |
| 487 | Ga0207689_10243431 | 3300025942 | Bacteria | 1487 |
| 488 | Ga0207689_10712667 | 3300025942 | Bacteria | 846 |
| 489 | Ga0207661_10893755 | 3300025944 | Bacteria | 818 |
| 490 | Ga0207679_10898551 | 3300025945 | Unclassified | 810 |
| 491 | Ga0207651_10059893 | 3300025960 | Bacteria | 2640 |
| 492 | Ga0207651_10146338 | 3300025960 | Bacteria | 1833 |
| 493 | Ga0207651_10202200 | 3300025960 | Bacteria | 1593 |
| 494 | Ga0207651_10987054 | 3300025960 | Unclassified | 752 |
| 495 | Ga0207651_11430528 | 3300025960 | Unclassified | 622 |
| 496 | Ga0207712_10184534 | 3300025961 | Bacteria | 1641 |
| 497 | Ga0207712_11569295 | 3300025961 | Unclassified | 590 |
| 498 | Ga0207668_10073037 | 3300025972 | Unclassified | 2457 |
| 499 | Ga0207668_10078354 | 3300025972 | Bacteria | 2386 |
| 500 | Ga0207668_10951756 | 3300025972 | Bacteria | 766 |
| 501 | Ga0207640_10013049 | 3300025981 | Bacteria | 4751 |
| 502 | Ga0207640_10522898 | 3300025981 | Bacteria | 992 |
| 503 | Ga0207640_11901567 | 3300025981 | Bacteria | 538 |
| 504 | Ga0207658_10024715 | 3300025986 | Bacteria | 4204 |
| 505 | Ga0207677_10023554 | 3300026023 | Unclassified | 3807 |
| 506 | Ga0207677_10729951 | 3300026023 | Unclassified | 881 |
| 507 | Ga0207703_10010553 | 3300026035 | Bacteria | 7223 |
| 508 | Ga0207703_10019535 | 3300026035 | Bacteria | 5295 |
| 509 | Ga0207703_10085620 | 3300026035 | Unclassified | 2638 |
| 510 | Ga0207703_10092312 | 3300026035 | Unclassified | 2548 |
| 511 | Ga0207703_10308848 | 3300026035 | Bacteria | 1445 |
| 512 | Ga0207703_10534291 | 3300026035 | Bacteria | 1104 |
| 513 | Ga0207703_10762856 | 3300026035 | Unclassified | 922 |
| 514 | Ga0207703_11034608 | 3300026035 | Unclassified | 788 |
| 515 | Ga0207639_10672373 | 3300026041 | Unclassified | 959 |
| 516 | Ga0207708_10007933 | 3300026075 | Bacteria | 7868 |
| 517 | Ga0207708_10040406 | 3300026075 | Bacteria | 3557 |
| 518 | Ga0207708_10060056 | 3300026075 | Bacteria | 2902 |
| 519 | Ga0207708_11002572 | 3300026075 | Bacteria | 726 |
| 520 | Ga0207641_10001556 | 3300026088 | Bacteria | 22467 |
| 521 | Ga0207641_10040115 | 3300026088 | Bacteria | 3918 |
| 522 | Ga0207641_10340522 | 3300026088 | Bacteria | 1427 |
| 523 | Ga0207641_10462193 | 3300026088 | Unclassified | 1228 |
| 524 | Ga0207648_10003842 | 3300026089 | Bacteria | 15693 |
| 525 | Ga0207648_10053331 | 3300026089 | Bacteria | 3534 |
| 526 | Ga0207648_10342720 | 3300026089 | Bacteria | 1346 |
| 527 | Ga0207676_10035030 | 3300026095 | Bacteria | 3805 |
| 528 | Ga0207676_10087713 | 3300026095 | Archaea | 2545 |
| 529 | Ga0207676_10259837 | 3300026095 | Bacteria | 1567 |
| 530 | Ga0207674_10065546 | 3300026116 | Bacteria | 3660 |
| 531 | Ga0207674_10198566 | 3300026116 | Bacteria | 1955 |
| 532 | Ga0207674_11063895 | 3300026116 | Unclassified | 778 |
| 533 | Ga0207675_100004284 | 3300026118 | Bacteria | 13796 |
| 534 | Ga0207675_100025632 | 3300026118 | Bacteria | 5487 |
| 535 | Ga0207675_100038973 | 3300026118 | Bacteria | 4435 |
| 536 | Ga0207675_100166723 | 3300026118 | Bacteria | 2104 |
| 537 | Ga0207675_100232631 | 3300026118 | Bacteria | 1778 |
| 538 | Ga0207675_102065467 | 3300026118 | Unclassified | 587 |
| 539 | Ga0207683_10127404 | 3300026121 | Unclassified | 2289 |
| 540 | Ga0207683_10152629 | 3300026121 | Unclassified | 2085 |
| 541 | Ga0207683_10195122 | 3300026121 | Bacteria | 1839 |
| 542 | Ga0207683_10949869 | 3300026121 | Bacteria | 798 |
| 543 | Ga0207683_11692932 | 3300026121 | Bacteria | 582 |
| 544 | Ga0207698_10541608 | 3300026142 | Bacteria | 1139 |
| 545 | Ga0207428_10000019 | 3300027907 | Bacteria | 276945 |
| 546 | Ga0207428_10032336 | 3300027907 | Bacteria | 4303 |
| 547 | Ga0207428_10115323 | 3300027907 | Unclassified | 2064 |
| 548 | Ga0268266_10027359 | 3300028379 | Bacteria | 4850 |
| 549 | Ga0268266_10075175 | 3300028379 | Bacteria | 2934 |
| 550 | Ga0268266_10128250 | 3300028379 | Bacteria | 2266 |
| 551 | Ga0268266_11837429 | 3300028379 | Unclassified | 580 |
| 552 | Ga0268265_10007747 | 3300028380 | Bacteria | 7249 |
| 553 | Ga0268265_10013365 | 3300028380 | Bacteria | 5578 |
| 554 | Ga0268265_10019194 | 3300028380 | Bacteria | 4747 |
| 555 | Ga0268264_10061651 | 3300028381 | Bacteria | 3147 |
| 556 | Ga0268264_10111140 | 3300028381 | Unclassified | 2400 |
| 557 | Ga0268264_10438819 | 3300028381 | Bacteria | 1263 |
| 558 | Ga0268264_10816406 | 3300028381 | Unclassified | 932 |
| 559 | Ga0268264_11073354 | 3300028381 | Unclassified | 813 |
| 560 | Ga0265336_10023671 | 3300028666 | Bacteria | 1946 |
| 561 | Ga0265332_10054475 | 3300031238 | Unclassified | 1716 |
| 562 | Ga0307408_100578861 | 3300031548 | Bacteria | 994 |
| 563 | Ga0307408_100588344 | 3300031548 | Unclassified | 987 |
| 564 | Ga0307405_10004523 | 3300031731 | Bacteria | 6583 |
| 565 | Ga0307413_10011495 | 3300031824 | Bacteria | 4359 |
| 566 | Ga0307413_10494734 | 3300031824 | Unclassified | 980 |
| 567 | Ga0307410_10024578 | 3300031852 | Bacteria | 3766 |
| 568 | Ga0307410_10026753 | 3300031852 | Bacteria | 3636 |
| 569 | Ga0307406_10007138 | 3300031901 | Bacteria | 6187 |
| 570 | Ga0307407_10005639 | 3300031903 | Bacteria | 5459 |
| 571 | Ga0307407_10074004 | 3300031903 | Bacteria | 2037 |
| 572 | Ga0307412_10042454 | 3300031911 | Bacteria | 2955 |
| 573 | Ga0307409_100002717 | 3300031995 | Bacteria | 9338 |
| 574 | Ga0307409_100033865 | 3300031995 | Bacteria | 3723 |
| 575 | Ga0307409_100727550 | 3300031995 | Bacteria | 994 |
| 576 | Ga0307416_100770534 | 3300032002 | Unclassified | 1056 |
| 577 | Ga0307414_10005333 | 3300032004 | Bacteria | 7073 |
| 578 | Ga0307414_10072664 | 3300032004 | Unclassified | 2486 |
| 579 | Ga0307411_10018419 | 3300032005 | Bacteria | 4004 |
| 580 | Ga0307411_10056903 | 3300032005 | Bacteria | 2580 |
| 581 | Ga0307411_10153677 | 3300032005 | Unclassified | 1714 |
| 582 | Ga0307415_100150420 | 3300032126 | Bacteria | 1791 |
| 583 | Ga0373948_0000509 | 3300034817 | Bacteria | 4866 |
| 584 | Ga0373958_0016317 | 3300034819 | Unclassified | 1322 |
| 585 | Ga0373959_0001115 | 3300034820 | Bacteria | 4371 |
| 586 | Ga0373938_0000914 | 3300034957 | Bacteria | 4724 |
| 587 | Ga0373928_0003690 | 3300035084 | Bacteria | 2920 |
| 588 | Ga0373929_0001665 | 3300035085 | Bacteria | 4199 |
| 589 | Ga0373940_0008914 | 3300035088 | Bacteria | 2317 |
| 590 | Ga0373940_0171412 | 3300035088 | Bacteria | 701 |
| 591 | Ga0373949_0000482 | 3300035090 | Bacteria | 13633 |
| 592 | Ga0373951_0000509 | 3300035091 | Bacteria | 11092 |
| 593 | Ga0373952_0000226 | 3300035092 | Bacteria | 9044 |
| 594 | Ga0373952_0275102 | 3300035092 | Bacteria | 517 |
| 595 | Ga0373923_0544803 | 3300035111 | Unclassified | 568 |
| 596 | Ga0373932_0002843 | 3300035112 | Bacteria | 4283 |
| 597 | Ga0373932_0269964 | 3300035112 | Bacteria | 626 |
| 598 | Ga0373939_0000720 | 3300035114 | Bacteria | 8195 |
| 599 | Ga0373939_0017908 | 3300035114 | Bacteria | 1889 |
| 600 | Ga0373941_0001206 | 3300035115 | Bacteria | 5410 |
| 601 | Ga0373945_0052675 | 3300035116 | Unclassified | 1500 |
| 602 | Ga0373953_0262848 | 3300035117 | Bacteria | 751 |
| 603 | Ga0373956_0124444 | 3300035119 | Bacteria | 1205 |
| 604 | Ga0373957_0178833 | 3300035120 | Bacteria | 879 |
| 605 | Ga0373957_0195768 | 3300035120 | Unclassified | 841 |
| 606 | Ga0373960_0002697 | 3300035121 | Bacteria | 4015 |
| 607 | Ga0373942_0001963 | 3300035207 | Bacteria | 5138 |
| 608 | Ga0373961_0001603 | 3300035241 | Bacteria | 6432 |
| 609 | Ga0373962_0004201 | 3300035242 | Bacteria | 3471 |
| 610 | Ga0373962_0007357 | 3300035242 | Bacteria | 2696 |
| 611 | Ga0373931_0000488 | 3300035691 | Bacteria | 16182 |
| 612 | Ga0373931_0096249 | 3300035691 | Unclassified | 1658 |
| 613 | Ga0373931_0214019 | 3300035691 | Bacteria | 1157 |
| 614 | Ga0373935_0976698 | 3300035692 | Unclassified | 629 |
| 615 | Ga0373927_0238985 | 3300035695 | Bacteria | 1194 |
| 616 | Ga0373927_0347378 | 3300035695 | Bacteria | 978 |
| 617 | Ga0373927_1044381 | 3300035695 | Bacteria | 539 |
| 618 | Ga0373933_0275446 | 3300035724 | Bacteria | 1087 |
| 619 | Ga0373947_0991536 | 3300035725 | Unclassified | 573 |
| 620 | Ga0373937_0241425 | 3300036401 | Bacteria | 1702 |
| 621 | Ga0373937_0293586 | 3300036401 | Unclassified | 1536 |
| 622 | Ga0373937_0483143 | 3300036401 | Unclassified | 1177 |
| 623 | Ga0373937_0533155 | 3300036401 | Unclassified | 1115 |
| 624 | Ga0373937_1527814 | 3300036401 | Bacteria | 615 |
| 625 | Ga0373925_0217272 | 3300037068 | Bacteria | 1525 |
| 626 | Ga0373925_0260971 | 3300037068 | Bacteria | 1392 |
| 627 | Ga0373925_1291666 | 3300037068 | Bacteria | 599 |
| 628 | Ga0436365_0147401 | 3300039437 | Bacteria | 1121 |
| 629 | Ga0436365_0783264 | 3300039437 | Unclassified | 940 |
| 630 | Ga0439461_0169737 | 3300041410 | Bacteria | 573 |
| 631 | Ga0466963_0034100 | 3300044694 | Bacteria | 3311 |
| 632 | Ga0451576_0035736 | 3300045051 | Bacteria | 5269 |
| 633 | Ga0451576_0471764 | 3300045051 | Unclassified | 1318 |
| 634 | Ga0451576_0574926 | 3300045051 | Bacteria | 1184 |
| 635 | Ga0466967_0114487 | 3300045976 | Bacteria | 2483 |
| 636 | Ga0495592_0039982 | 3300046454 | Bacteria | 3521 |
| 637 | Ga0495629_0728659 | 3300046459 | Unclassified | 657 |
| 638 | Ga0495629_0885322 | 3300046459 | Unclassified | 586 |
| 639 | Ga0495651_0307638 | 3300046462 | Unclassified | 1061 |
| 640 | Ga0495653_0743868 | 3300046463 | Unclassified | 593 |
| 641 | Ga0495580_0239561 | 3300046472 | Unclassified | 1244 |
| 642 | Ga0495580_0315459 | 3300046472 | Bacteria | 1063 |
| 643 | Ga0495580_0496614 | 3300046472 | Bacteria | 815 |
| 644 | Ga0495639_0658393 | 3300046475 | Unclassified | 540 |
| 645 | Ga0495662_0176579 | 3300046476 | Unclassified | 1053 |
| 646 | Ga0495608_0004888 | 3300046511 | Bacteria | 9591 |
| 647 | Ga0495618_0258946 | 3300046514 | Unclassified | 1090 |
| 648 | Ga0495628_0099882 | 3300046516 | Bacteria | 2240 |
| 649 | Ga0495628_0233517 | 3300046516 | Unclassified | 1378 |
| 650 | Ga0495628_0320848 | 3300046516 | Unclassified | 1143 |
| 651 | Ga0495630_0035961 | 3300046517 | Bacteria | 3702 |
| 652 | Ga0495630_0855087 | 3300046517 | Unclassified | 694 |
| 653 | Ga0495652_0062779 | 3300046529 | Bacteria | 3131 |
| 654 | Ga0495640_0430106 | 3300046533 | Bacteria | 808 |
| 655 | Ga0495586_0055765 | 3300046535 | Unclassified | 2142 |
| 656 | Ga0495586_0241916 | 3300046535 | Unclassified | 1029 |
| 657 | Ga0495586_0460655 | 3300046535 | Unclassified | 733 |
| 658 | Ga0495645_0090377 | 3300046543 | Archaea | 2188 |
| 659 | Ga0495645_0100298 | 3300046543 | Bacteria | 2059 |
| 660 | Ga0495656_0151136 | 3300046615 | Bacteria | 1122 |
| 661 | Ga0495668_0290656 | 3300046616 | Bacteria | 896 |
| 662 | Ga0495634_0078175 | 3300046642 | Archaea | 2168 |
| 663 | Ga0495634_0574656 | 3300046642 | Bacteria | 656 |
| 664 | Ga0495634_0792723 | 3300046642 | Unclassified | 541 |
| 665 | Ga0495635_0099729 | 3300046663 | Bacteria | 1985 |
| 666 | Ga0495658_0017387 | 3300046683 | Unclassified | 3714 |
| 667 | Ga0495658_0040106 | 3300046683 | Archaea | 2602 |
| 668 | Ga0495658_0087771 | 3300046683 | Bacteria | 1837 |
| 669 | Ga0495658_0360637 | 3300046683 | Unclassified | 924 |
| 670 | Ga0495658_0402427 | 3300046683 | Unclassified | 873 |
| 671 | Ga0495658_0735918 | 3300046683 | Bacteria | 632 |
| 672 | Ga0495613_0000270 | 3300046689 | Bacteria | 48533 |
| 673 | Ga0495613_0906875 | 3300046689 | Unclassified | 570 |
| 674 | Ga0495670_0567414 | 3300046691 | Bacteria | 618 |
| 675 | Ga0495600_0017848 | 3300046809 | Bacteria | 4516 |
| 676 | Ga0495600_0537039 | 3300046809 | Unclassified | 716 |
| 677 | Ga0495581_0408664 | 3300047315 | Unclassified | 791 |
| 678 | Ga0495581_0554214 | 3300047315 | Unclassified | 667 |
| 679 | Ga0495581_0826992 | 3300047315 | Unclassified | 531 |
| 680 | Ga0495604_0006670 | 3300047317 | Bacteria | 9150 |
| 681 | Ga0495604_0673273 | 3300047317 | Unclassified | 659 |
| 682 | Ga0495674_0363478 | 3300047319 | Bacteria | 1173 |
| 683 | Ga0495680_0330919 | 3300047322 | Bacteria | 1064 |
| 684 | Ga0495675_0331792 | 3300047444 | Unclassified | 898 |
| 685 | Ga0495684_0000011 | 3300047471 | Bacteria | 195144 |
| 686 | Ga0495684_0259806 | 3300047471 | Bacteria | 1260 |
| 687 | Ga0496100_0001767 | 3300048903 | Bacteria | 10786 |
| 688 | Ga0496100_1253419 | 3300048903 | Unclassified | 585 |
| 689 | Ga0496101_0003536 | 3300048904 | Bacteria | 9748 |
| 690 | Ga0496101_0752257 | 3300048904 | Bacteria | 769 |
| 691 | Ga0496102_0142358 | 3300048905 | Bacteria | 2249 |
| 692 | Ga0496102_0904677 | 3300048905 | Unclassified | 804 |
| 693 | Ga0496102_1441450 | 3300048905 | Bacteria | 607 |
| 694 | Ga0496104_0011243 | 3300048907 | Bacteria | 8010 |
| 695 | Ga0496104_0308976 | 3300048907 | Bacteria | 1494 |
| 696 | Ga0496104_0316675 | 3300048907 | Unclassified | 1473 |
| 697 | Ga0496104_0698494 | 3300048907 | Bacteria | 922 |
| 698 | Ga0496105_0041581 | 3300048908 | Bacteria | 3789 |
| 699 | Ga0496105_0393068 | 3300048908 | Bacteria | 1102 |
| 700 | Ga0496105_0421467 | 3300048908 | Bacteria | 1057 |
| 701 | Ga0496106_0271180 | 3300048909 | Bacteria | 1359 |
| 702 | Ga0496106_0563783 | 3300048909 | Unclassified | 913 |
| 703 | Ga0496107_0257617 | 3300048910 | Unclassified | 1298 |
| 704 | Ga0496108_0007470 | 3300048911 | Bacteria | 8860 |
| 705 | Ga0496108_0849015 | 3300048911 | Unclassified | 786 |
| 706 | Ga0496109_0072409 | 3300048912 | Bacteria | 3166 |
| 707 | Ga0496109_1145045 | 3300048912 | Bacteria | 715 |
| 708 | Ga0496110_0282573 | 3300048913 | Bacteria | 1511 |
| 709 | Ga0496110_0951555 | 3300048913 | Bacteria | 766 |
| 710 | Ga0496112_0015032 | 3300048915 | Bacteria | 7206 |
| 711 | Ga0496112_0155795 | 3300048915 | Bacteria | 2251 |
| 712 | Ga0496112_0392061 | 3300048915 | Bacteria | 1329 |
| 713 | Ga0496112_0710904 | 3300048915 | Unclassified | 932 |
| 714 | Ga0496112_0998843 | 3300048915 | Unclassified | 757 |
| 715 | Ga0496113_0050182 | 3300048916 | Bacteria | 3110 |
| 716 | Ga0496113_0251822 | 3300048916 | Bacteria | 1410 |
| 717 | Ga0496113_0820804 | 3300048916 | Bacteria | 738 |
| 718 | Ga0496114_0002246 | 3300048917 | Bacteria | 14722 |
| 719 | Ga0496114_0134932 | 3300048917 | Bacteria | 2134 |
| 720 | Ga0496114_0148242 | 3300048917 | Bacteria | 2035 |
| 721 | Ga0496114_0343772 | 3300048917 | Bacteria | 1319 |
| 722 | Ga0496114_0544204 | 3300048917 | Unclassified | 1026 |
| 723 | Ga0496115_0048392 | 3300048918 | Bacteria | 3401 |
| 724 | Ga0496115_0258333 | 3300048918 | Unclassified | 1433 |
| 725 | Ga0501031_0562897 | 3300049568 | Bacteria | 734 |
| 726 | Ga0501033_0026014 | 3300049570 | Unclassified | 4404 |
| 727 | Ga0501036_0016899 | 3300049572 | Bacteria | 6095 |
| 728 | Ga0501036_0170785 | 3300049572 | Bacteria | 1832 |
| 729 | Ga0501036_0718552 | 3300049572 | Bacteria | 825 |
| 730 | Ga0501038_0084400 | 3300049574 | Unclassified | 2672 |
| 731 | Ga0501039_0132881 | 3300049575 | Bacteria | 1953 |
| 732 | Ga0501040_0002560 | 3300049576 | Bacteria | 11734 |
| 733 | Ga0501040_0216812 | 3300049576 | Bacteria | 1361 |
| 734 | Ga0501041_0004195 | 3300049577 | Bacteria | 8338 |
| 735 | Ga0501041_0217098 | 3300049577 | Bacteria | 1200 |
| 736 | Ga0501042_0044934 | 3300049578 | Unclassified | 3147 |
| 737 | Ga0501046_0187931 | 3300049580 | Bacteria | 1542 |
| 738 | Ga0501048_0082513 | 3300049582 | Unclassified | 2268 |
| 739 | Ga0501048_0165996 | 3300049582 | Bacteria | 1563 |
| 740 | Ga0501068_0383365 | 3300049584 | Unclassified | 905 |
| 741 | Ga0501071_0342249 | 3300049587 | Bacteria | 1137 |
| 742 | Ga0501072_0082534 | 3300049588 | Unclassified | 2548 |
| 743 | Ga0501072_0362322 | 3300049588 | Bacteria | 1151 |
| 744 | Ga0501074_0365259 | 3300049590 | Bacteria | 1024 |
| 745 | Ga0501075_0078260 | 3300049591 | Bacteria | 2503 |
| 746 | Ga0501075_0140304 | 3300049591 | Bacteria | 1841 |
| 747 | Ga0501075_0258869 | 3300049591 | Unclassified | 1326 |
| 748 | Ga0501075_1085085 | 3300049591 | Unclassified | 608 |
| 749 | Ga0501076_0020154 | 3300049592 | Bacteria | 5102 |
| 750 | Ga0501077_0028491 | 3300049593 | Unclassified | 3549 |
| 751 | Ga0501249_160885 | 3300049679 | Unclassified | 570 |
| 752 | Ga0501079_0128664 | 3300049741 | Bacteria | 1970 |
| 753 | Ga0501080_0016251 | 3300049742 | Bacteria | 6872 |
| 754 | Ga0501080_1161423 | 3300049742 | Bacteria | 665 |
| 755 | Ga0501081_0002355 | 3300049743 | Bacteria | 11897 |
| 756 | Ga0501081_0021287 | 3300049743 | Bacteria | 4327 |
| 757 | Ga0501081_0320255 | 3300049743 | Bacteria | 1140 |
| 758 | Ga0501081_0703344 | 3300049743 | Unclassified | 759 |
| 759 | Ga0501081_0921142 | 3300049743 | Unclassified | 659 |
| 760 | Ga0501083_0299985 | 3300049744 | Unclassified | 1045 |
| 761 | Ga0501035_0657129 | 3300049822 | Bacteria | 849 |
| 762 | Ga0501045_0018351 | 3300049824 | Unclassified | 4976 |
| 763 | nmdc:mga07m45_62441_c1 | 3300050496 | Unclassified | 2111 |
| 764 | nmdc:mga05p37_146673_c1 | 3300050507 | Unclassified | 2889 |
| 765 | nmdc:mga05p37_18651_c1 | 3300050507 | Bacteria | 8385 |
| 766 | nmdc:mga05p37_213361_c1 | 3300050507 | Unclassified | 2332 |
| 767 | nmdc:mga05p37_255682_c1 | 3300050507 | Bacteria | 2099 |
| 768 | nmdc:mga05p37_266676_c1 | 3300050507 | Unclassified | 2047 |
| 769 | nmdc:mga05p37_28334_c1 | 3300050507 | Bacteria | 6830 |
| 770 | nmdc:mga05p37_317751_c1 | 3300050507 | Unclassified | 1844 |
| 771 | nmdc:mga05p37_4712_c1 | 3300050507 | Bacteria | 15933 |
| 772 | nmdc:mga05p37_484360_c1 | 3300050507 | Bacteria | 1424 |
| 773 | nmdc:mga05p37_485232_c1 | 3300050507 | Bacteria | 1422 |
| 774 | nmdc:mga05p37_58211_c1 | 3300050507 | Bacteria | 4759 |
| 775 | nmdc:mga05p37_629149_c1 | 3300050507 | Bacteria | 1206 |
| 776 | nmdc:mga05p37_876468_c1 | 3300050507 | Bacteria | 971 |
| 777 | nmdc:mga09592_1202268_c1 | 3300050508 | Unclassified | 626 |
| 778 | nmdc:mga09592_843732_c1 | 3300050508 | Unclassified | 773 |
| 779 | nmdc:mga06r32_1862087_c1 | 3300050510 | Unclassified | 536 |
| 780 | nmdc:mga06r32_307623_c1 | 3300050510 | Unclassified | 1570 |
| 781 | nmdc:mga06r32_990058_c1 | 3300050510 | Unclassified | 794 |
| 782 | nmdc:mga08y16_1112876_c1 | 3300050511 | Unclassified | 764 |
| 783 | nmdc:mga08y16_12059_c1 | 3300050511 | Bacteria | 9082 |
| 784 | nmdc:mga08y16_147882_c1 | 3300050511 | Unclassified | 2442 |
| 785 | nmdc:mga08y16_17_c1 | 3300050511 | Bacteria | 382598 |
| 786 | nmdc:mga08y16_9786_c1 | 3300050511 | Bacteria | 10061 |
| 787 | nmdc:mga0n895_111406_c1 | 3300050512 | Bacteria | 2451 |
| 788 | nmdc:mga0n895_158_c1 | 3300050512 | Bacteria | 41550 |
| 789 | nmdc:mga0n895_179707_c1 | 3300050512 | Bacteria | 2147 |
| 790 | nmdc:mga0n895_385788_c1 | 3300050512 | Unclassified | 1417 |
| 791 | nmdc:mga0n895_76694_c1 | 3300050512 | Bacteria | 3324 |
| 792 | nmdc:mga0rr50_2705_c1 | 3300050513 | Bacteria | 10059 |
| 793 | nmdc:mga0rr50_41605_c1 | 3300050513 | Bacteria | 3350 |
| 794 | nmdc:mga0rr50_41681_c1 | 3300050513 | Bacteria | 3347 |
| 795 | nmdc:mga0rr50_426345_c1 | 3300050513 | Bacteria | 1123 |
| 796 | nmdc:mga0rr50_6_c1 | 3300050513 | Bacteria | 310626 |
| 797 | nmdc:mga0rr50_84307_c1 | 3300050513 | Bacteria | 2460 |
| 798 | nmdc:mga08x19_198760_c1 | 3300050514 | Bacteria | 1374 |
| 799 | nmdc:mga08x19_21726_c1 | 3300050514 | Bacteria | 3966 |
| 800 | nmdc:mga08x19_251_c1 | 3300050514 | Bacteria | 40759 |
| 801 | nmdc:mga08x19_278381_c1 | 3300050514 | Bacteria | 1159 |
| 802 | nmdc:mga08x19_29141_c1 | 3300050514 | Bacteria | 3461 |
| 803 | nmdc:mga08x19_354423_c1 | 3300050514 | Bacteria | 1025 |
| 804 | nmdc:mga08x19_55985_c1 | 3300050514 | Bacteria | 2544 |
| 805 | nmdc:mga08x19_69754_c1 | 3300050514 | Unclassified | 2289 |
| 806 | nmdc:mga08x19_810829_c1 | 3300050514 | Bacteria | 665 |
| 807 | nmdc:mga0a205_23249_c1 | 3300050515 | Bacteria | 5878 |
| 808 | nmdc:mga0a205_272664_c1 | 3300050515 | Unclassified | 1569 |
| 809 | nmdc:mga0a205_6014_c1 | 3300050515 | Bacteria | 10945 |
| 810 | nmdc:mga0a205_67044_c1 | 3300050515 | Bacteria | 3467 |
| 811 | nmdc:mga0a205_80285_c1 | 3300050515 | Unclassified | 3152 |
| 812 | Ga0495601_0007844 | 3300053077 | Bacteria | 6282 |
| 813 | Ga0495601_0116945 | 3300053077 | Bacteria | 1730 |
| 814 | Ga0495595_0012854 | 3300053084 | Bacteria | 3530 |
| 815 | Ga0495595_0017737 | 3300053084 | Bacteria | 3066 |
| 816 | Ga0495595_0180684 | 3300053084 | Unclassified | 1046 |
| 817 | Ga0495619_0003599 | 3300053085 | Bacteria | 9981 |
| 818 | Ga0495619_0017075 | 3300053085 | Bacteria | 4601 |
| 819 | Ga0495619_0072399 | 3300053085 | Bacteria | 2308 |
| 820 | Ga0495619_0803409 | 3300053085 | Bacteria | 636 |
| 821 | Ga0501084_0045423 | 3300054114 | Bacteria | 3677 |
| 822 | Ga0501084_0115664 | 3300054114 | Bacteria | 2254 |
| 823 | Ga0501084_0775157 | 3300054114 | Unclassified | 808 |
| 824 | Ga0590071_002132 | 3300059421 | Bacteria | 5041 |
| 825 | Ga0590075_001175 | 3300059424 | Bacteria | 6634 |
| 826 | Ga0501082_0005914 | 3300060353 | Bacteria | 10610 |
| 827 | Ga0501082_0233872 | 3300060353 | Bacteria | 1599 |
| 828 | Ga0530510_0058389 | 3300061734 | Bacteria | 2790 |
| 829 | Ga0530510_0447422 | 3300061734 | Bacteria | 976 |
| 830 | Ga0114129_10156652 | |||
| 831 | JGI24751J29686_10119432 | |||
| 832 | JGI25406J46586_10066766 | |||
| 833 | Ga0065712_10080601 | |||
| 834 | Ga0065712_10085558 | |||
| 835 | Ga0065715_10004337 | |||
| 836 | Ga0065707_10719682 | |||
| 837 | Ga0070676_10001366 | |||
| 838 | Ga0070676_10297136 | |||
| 839 | Ga0070683_100027315 | |||
| 840 | Ga0070683_100715514 | |||
| 841 | Ga0070690_100091555 | |||
| 842 | Ga0070670_100278997 | |||
| 843 | Ga0070670_100330316 | |||
| 844 | Ga0070670_100492404 | |||
| 845 | Ga0070670_101140811 | |||
| 846 | Ga0070670_101649569 | |||
| 847 | Ga0070677_10090386 | |||
| 848 | Ga0068869_100093012 | |||
| 849 | Ga0068869_100608189 | |||
| 850 | Ga0068869_100962682 | |||
| 851 | Ga0070666_10125697 | |||
| 852 | Ga0070666_10361826 | |||
| 853 | Ga0070680_100469098 | |||
| 854 | Ga0070682_100582661 | |||
| 855 | Ga0068868_100101430 | |||
| 856 | Ga0068868_100107428 | |||
| 857 | Ga0068868_100111675 | |||
| 858 | Ga0068868_100115424 | |||
| 859 | Ga0068868_100252123 | |||
| 860 | Ga0068868_101705561 | |||
| 861 | Ga0070660_100283566 | |||
| 862 | Ga0070660_101391044 | |||
| 863 | Ga0070660_101679240 | |||
| 864 | Ga0070689_100079981 | |||
| 865 | Ga0070689_100175558 | |||
| 866 | Ga0070689_100922111 | |||
| 867 | Ga0070691_10055702 | |||
| 868 | Ga0070687_100178877 | |||
| 869 | Ga0070687_100368194 | |||
| 870 | Ga0070661_100690040 | |||
| 871 | Ga0070692_11040805 | |||
| 872 | Ga0070668_100012918 | |||
| 873 | Ga0070668_100245130 | |||
| 874 | Ga0070669_100029378 | |||
| 875 | Ga0070669_100030711 | |||
| 876 | Ga0070669_100117442 | |||
| 877 | Ga0070669_100471046 | |||
| 878 | Ga0070675_100042892 | |||
| 879 | Ga0070675_100052041 | |||
| 880 | Ga0070675_100113918 | |||
| 881 | Ga0070671_100093982 | |||
| 882 | Ga0070671_100175613 | |||
| 883 | Ga0070671_100720367 | |||
| 884 | Ga0070674_100015355 | |||
| 885 | Ga0070674_100063609 | |||
| 886 | Ga0070674_100288378 | |||
| 887 | Ga0070674_100596543 | |||
| 888 | Ga0070673_101491223 | |||
| 889 | Ga0070688_100012569 | |||
| 890 | Ga0070688_100043332 | |||
| 891 | Ga0070659_100150356 | |||
| 892 | Ga0070667_100036885 | |||
| 893 | Ga0070667_101148144 | |||
| 894 | Ga0070710_10446136 | |||
| 895 | Ga0070701_10005792 | |||
| 896 | Ga0070701_10218798 | |||
| 897 | Ga0070701_10321110 | |||
| 898 | Ga0070701_10440643 | |||
| 899 | Ga0070701_10511201 | |||
| 900 | Ga0070711_100054973 | |||
| 901 | Ga0070711_100125730 | |||
| 902 | Ga0070705_100010712 | |||
| 903 | Ga0070705_100073222 | |||
| 904 | Ga0070705_100192297 | |||
| 905 | Ga0070705_100261969 | |||
| 906 | Ga0070700_100025011 | |||
| 907 | Ga0070700_100115138 | |||
| 908 | Ga0070700_100915304 | |||
| 909 | Ga0070694_100022280 | |||
| 910 | Ga0070694_100032981 | |||
| 911 | Ga0070694_100040457 | |||
| 912 | Ga0070694_100201111 | |||
| 913 | Ga0070694_100334650 | |||
| 914 | Ga0070694_100612055 | |||
| 915 | Ga0070708_100195540 | |||
| 916 | Ga0070708_100654014 | |||
| 917 | Ga0070708_100944648 | |||
| 918 | Ga0070663_101948614 | |||
| 919 | Ga0070678_100097821 | |||
| 920 | Ga0070678_100332587 | |||
| 921 | Ga0070678_100617645 | |||
| 922 | Ga0070678_101270789 | |||
| 923 | Ga0070662_100090753 | |||
| 924 | Ga0070662_100237599 | |||
| 925 | Ga0070662_100708816 | |||
| 926 | Ga0070681_10106845 | |||
| 927 | Ga0070681_11403161 | |||
| 928 | Ga0068867_100002097 | |||
| 929 | Ga0068867_100018173 | |||
| 930 | Ga0068867_100020766 | |||
| 931 | Ga0068867_100280302 | |||
| 932 | Ga0068867_101108229 | |||
| 933 | Ga0068867_101917884 | |||
| 934 | Ga0070685_10036929 | |||
| 935 | Ga0070685_10294910 | |||
| 936 | Ga0070706_100118543 | |||
| 937 | Ga0070706_100839023 | |||
| 938 | Ga0070706_101108248 | |||
| 939 | Ga0070707_100052416 | |||
| 940 | Ga0070707_100055342 | |||
| 941 | Ga0070707_100081015 | |||
| 942 | Ga0070698_100264789 | |||
| 943 | Ga0070698_100378182 | |||
| 944 | Ga0070698_100771027 | |||
| 945 | Ga0070699_100003176 | |||
| 946 | Ga0070699_100071764 | |||
| 947 | Ga0070699_100441730 | |||
| 948 | Ga0070699_101008934 | |||
| 949 | Ga0070679_100076744 | |||
| 950 | Ga0070679_100279722 | |||
| 951 | Ga0070684_100079683 | |||
| 952 | Ga0070684_100409608 | |||
| 953 | Ga0070684_102098993 | |||
| 954 | Ga0070697_100085215 | |||
| 955 | Ga0070697_100347162 | |||
| 956 | Ga0070697_100794691 | |||
| 957 | Ga0068853_100713753 | |||
| 958 | Ga0070672_100063406 | |||
| 959 | Ga0070672_100152394 | |||
| 960 | Ga0070672_101481782 | |||
| 961 | Ga0070686_100215022 | |||
| 962 | Ga0070695_100001441 | |||
| 963 | Ga0070695_100107225 | |||
| 964 | Ga0070695_100183413 | |||
| 965 | Ga0070695_100205869 | |||
| 966 | Ga0070695_101013941 | |||
| 967 | Ga0070696_100067973 | |||
| 968 | Ga0070696_100082669 | |||
| 969 | Ga0070696_100106555 | |||
| 970 | Ga0070696_100260527 | |||
| 971 | Ga0070696_100450416 | |||
| 972 | Ga0070693_100363573 | |||
| 973 | Ga0070665_100016860 | |||
| 974 | Ga0070665_100044841 | |||
| 975 | Ga0070665_100344449 | |||
| 976 | Ga0070665_101026335 | |||
| 977 | Ga0070704_100003928 | |||
| 978 | Ga0070704_100023249 | |||
| 979 | Ga0070704_100053861 | |||
| 980 | Ga0070704_100140774 | |||
| 981 | Ga0070704_100935212 | |||
| 982 | Ga0070704_101007162 | |||
| 983 | Ga0070664_100195327 | |||
| 984 | Ga0070664_100927353 | |||
| 985 | Ga0070664_101396302 | |||
| 986 | Ga0068857_100078036 | |||
| 987 | Ga0068857_100782875 | |||
| 988 | Ga0068854_100021553 | |||
| 989 | Ga0068856_100994547 | |||
| 990 | Ga0070702_100000624 | |||
| 991 | Ga0068852_100124584 | |||
| 992 | Ga0068859_100002294 | |||
| 993 | Ga0068859_100104173 | |||
| 994 | Ga0068859_100697724 | |||
| 995 | Ga0068859_101546121 | |||
| 996 | Ga0068859_101839530 | |||
| 997 | Ga0068864_100002167 | |||
| 998 | Ga0068864_100104072 | |||
| 999 | Ga0068864_100124050 | |||
| 1000 | Ga0068864_101080178 | |||
| 1001 | Ga0068864_102112207 | |||
| 1002 | Ga0068866_10062469 | |||
| 1003 | Ga0068866_10107149 | |||
| 1004 | Ga0068866_10121207 | |||
| 1005 | Ga0068866_10122337 | |||
| 1006 | Ga0068866_10366790 | |||
| 1007 | Ga0068861_100011220 | |||
| 1008 | Ga0068861_100029368 | |||
| 1009 | Ga0068861_100150503 | |||
| 1010 | Ga0068861_100173726 | |||
| 1011 | Ga0068861_100208885 | |||
| 1012 | Ga0068861_100295915 | |||
| 1013 | Ga0068870_10090174 | |||
| 1014 | Ga0068863_100012476 | |||
| 1015 | Ga0068863_100169686 | |||
| 1016 | Ga0068863_100217099 | |||
| 1017 | Ga0068863_100479810 | |||
| 1018 | Ga0068863_100548302 | |||
| 1019 | Ga0068863_101079181 | |||
| 1020 | Ga0068858_100029645 | |||
| 1021 | Ga0068858_100107941 | |||
| 1022 | Ga0068858_100220278 | |||
| 1023 | Ga0068858_100693580 | |||
| 1024 | Ga0068858_100825770 | |||
| 1025 | Ga0068858_101677175 | |||
| 1026 | Ga0068860_100138091 | |||
| 1027 | Ga0068860_100343474 | |||
| 1028 | Ga0068860_100789380 | |||
| 1029 | Ga0068860_101184683 | |||
| 1030 | Ga0068860_101480252 | |||
| 1031 | Ga0068860_101672483 | |||
| 1032 | Ga0068860_102041262 | |||
| 1033 | Ga0068862_100036864 | |||
| 1034 | Ga0068862_100104747 | |||
| 1035 | Ga0068862_100138157 | |||
| 1036 | Ga0068862_100172887 | |||
| 1037 | Ga0068862_100205244 | |||
| 1038 | Ga0068862_102089397 | |||
| 1039 | Ga0081455_10036603 | |||
| 1040 | Ga0081539_10025788 | |||
| 1041 | Ga0070717_10346298 | |||
| 1042 | Ga0070715_10381363 | |||
| 1043 | Ga0070715_10565184 | |||
| 1044 | Ga0097621_100004485 | |||
| 1045 | Ga0097621_100015314 | |||
| 1046 | Ga0097621_100019423 | |||
| 1047 | Ga0097621_100021970 | |||
| 1048 | Ga0097621_100026579 | |||
| 1049 | Ga0097621_100042241 | |||
| 1050 | Ga0097621_100236837 | |||
| 1051 | Ga0097621_100324277 | |||
| 1052 | Ga0097621_100476857 | |||
| 1053 | Ga0068871_100036235 | |||
| 1054 | Ga0068871_100062149 | |||
| 1055 | Ga0068871_100067701 | |||
| 1056 | Ga0068871_100068350 | |||
| 1057 | Ga0068871_100323441 | |||
| 1058 | Ga0068871_100529875 | |||
| 1059 | Ga0068871_100542493 | |||
| 1060 | Ga0068871_100885050 | |||
| 1061 | Ga0075428_100000005 | |||
| 1062 | Ga0075428_101773168 | |||
| 1063 | Ga0075430_100694078 | |||
| 1064 | Ga0075431_100051743 | |||
| 1065 | Ga0075431_100065918 | |||
| 1066 | Ga0075431_100241004 | |||
| 1067 | Ga0075431_102075655 | |||
| 1068 | Ga0075433_10057392 | |||
| 1069 | Ga0075433_10081222 | |||
| 1070 | Ga0075433_10090819 | |||
| 1071 | Ga0075433_10144685 | |||
| 1072 | Ga0075433_10254376 | |||
| 1073 | Ga0075433_10565386 | |||
| 1074 | Ga0075433_10681660 | |||
| 1075 | Ga0075433_10870544 | |||
| 1076 | Ga0075434_100011109 | |||
| 1077 | Ga0075434_100015041 | |||
| 1078 | Ga0075434_100034937 | |||
| 1079 | Ga0075434_100083214 | |||
| 1080 | Ga0075434_100096589 | |||
| 1081 | Ga0075434_101267968 | |||
| 1082 | Ga0075434_101806781 | |||
| 1083 | Ga0075429_100981222 | |||
| 1084 | Ga0068865_100025544 | |||
| 1085 | Ga0068865_100266053 | |||
| 1086 | Ga0075436_100008336 | |||
| 1087 | Ga0075436_100012160 | |||
| 1088 | Ga0075436_100035527 | |||
| 1089 | Ga0075436_100036146 | |||
| 1090 | Ga0075436_100119305 | |||
| 1091 | Ga0075436_100139293 | |||
| 1092 | Ga0075436_100264288 | |||
| 1093 | Ga0075436_100770572 | |||
| 1094 | Ga0097620_100002294 | |||
| 1095 | Ga0097620_100104178 | |||
| 1096 | Ga0097620_100697808 | |||
| 1097 | Ga0097620_101546126 | |||
| 1098 | Ga0097620_101839484 | |||
| 1099 | Ga0075435_100001816 | |||
| 1100 | Ga0075435_100008469 | |||
| 1101 | Ga0075435_100017880 | |||
| 1102 | Ga0075435_100046046 | |||
| 1103 | Ga0075435_100148399 | |||
| 1104 | Ga0075435_100290970 | |||
| 1105 | Ga0075435_100300717 | |||
| 1106 | Ga0105240_10096194 | |||
| 1107 | Ga0105240_10184954 | |||
| 1108 | Ga0105240_10195029 | |||
| 1109 | Ga0105240_10577173 | |||
| 1110 | Ga0105240_10865196 | |||
| 1111 | Ga0111539_10000008 | |||
| 1112 | Ga0111539_10005984 | |||
| 1113 | Ga0111539_10006975 | |||
| 1114 | Ga0111539_10385263 | |||
| 1115 | Ga0111539_10495993 | |||
| 1116 | Ga0111539_10570386 | |||
| 1117 | Ga0111539_11092779 | |||
| 1118 | Ga0111539_11803404 | |||
| 1119 | Ga0105245_10001762 | |||
| 1120 | Ga0105245_10490012 | |||
| 1121 | Ga0105245_10832131 | |||
| 1122 | Ga0105245_10920229 | |||
| 1123 | Ga0105245_11661326 | |||
| 1124 | Ga0105245_11803152 | |||
| 1125 | Ga0105247_10004214 | |||
| 1126 | Ga0105247_10312784 | |||
| 1127 | Ga0114129_10002454 | |||
| 1128 | Ga0114129_10002522 | |||
| 1129 | Ga0114129_10004744 | |||
| 1130 | Ga0114129_10023846 | |||
| 1131 | Ga0114129_10024935 | |||
| 1132 | Ga0114129_10047223 | |||
| 1133 | Ga0114129_10072618 | |||
| 1134 | Ga0114129_10130146 | |||
| 1135 | Ga0114129_10275915 | |||
| 1136 | Ga0114129_10371477 | |||
| 1137 | Ga0114129_10540555 | |||
| 1138 | Ga0114129_10584291 | |||
| 1139 | Ga0114129_10772010 | |||
| 1140 | Ga0114129_10909681 | |||
| 1141 | Ga0114129_11232683 | |||
| 1142 | Ga0114129_11305827 | |||
| 1143 | Ga0114129_13288703 | |||
| 1144 | Ga0105243_10114209 | |||
| 1145 | Ga0105243_10125552 | |||
| 1146 | Ga0105243_10636780 | |||
| 1147 | Ga0105243_10705238 | |||
| 1148 | Ga0105243_10975912 | |||
| 1149 | Ga0105243_11971661 | |||
| 1150 | Ga0105243_12168049 | |||
| 1151 | Ga0105241_10426591 | |||
| 1152 | Ga0105241_11862459 | |||
| 1153 | Ga0105242_10004556 | |||
| 1154 | Ga0105242_10020139 | |||
| 1155 | Ga0105242_10180717 | |||
| 1156 | Ga0105242_10620726 | |||
| 1157 | Ga0105242_10687238 | |||
| 1158 | Ga0105242_10893321 | |||
| 1159 | Ga0105248_10003660 | |||
| 1160 | Ga0105248_10013961 | |||
| 1161 | Ga0105248_10032263 | |||
| 1162 | Ga0105248_10093625 | |||
| 1163 | Ga0105248_10271381 | |||
| 1164 | Ga0105248_10354140 | |||
| 1165 | Ga0105248_10609398 | |||
| 1166 | Ga0105248_10761816 | |||
| 1167 | Ga0105248_10772266 | |||
| 1168 | Ga0105248_11019394 | |||
| 1169 | Ga0105248_11155448 | |||
| 1170 | Ga0105248_11981664 | |||
| 1171 | Ga0105248_12390472 | |||
| 1172 | Ga0105237_10179635 | |||
| 1173 | Ga0105237_10381088 | |||
| 1174 | Ga0105238_10452037 | |||
| 1175 | Ga0105238_11002864 | |||
| 1176 | Ga0105238_11551190 | |||
| 1177 | Ga0105249_10086774 | |||
| 1178 | Ga0105249_10204042 | |||
| 1179 | Ga0105249_10426319 | |||
| 1180 | Ga0105249_10934912 | |||
| 1181 | Ga0105249_10982552 | |||
| 1182 | Ga0105249_11156046 | |||
| 1183 | Ga0105249_12552079 | |||
| 1184 | Ga0105239_10402639 | |||
| 1185 | Ga0105246_10324919 | |||
| 1186 | Ga0105246_10834380 | |||
| 1187 | Ga0157374_10069568 | |||
| 1188 | Ga0157374_11305571 | |||
| 1189 | Ga0157378_10389158 | |||
| 1190 | Ga0157378_10487422 | |||
| 1191 | Ga0157378_10924029 | |||
| 1192 | Ga0163162_10101495 | |||
| 1193 | Ga0163162_10437192 | |||
| 1194 | Ga0163162_10747938 | |||
| 1195 | Ga0163162_10876752 | |||
| 1196 | Ga0157372_10989373 | |||
| 1197 | Ga0157375_10074074 | |||
| 1198 | Ga0157375_10153304 | |||
| 1199 | Ga0157375_10261060 | |||
| 1200 | Ga0157375_10853739 | |||
| 1201 | Ga0163163_10002970 | |||
| 1202 | Ga0163163_10282799 | |||
| 1203 | Ga0163163_10609288 | |||
| 1204 | Ga0163163_10840811 | |||
| 1205 | Ga0163163_11513013 | |||
| 1206 | Ga0163163_12539303 | |||
| 1207 | Ga0157380_10021482 | |||
| 1208 | Ga0157380_10239360 | |||
| 1209 | Ga0157380_10707289 | |||
| 1210 | Ga0157380_10729009 | |||
| 1211 | Ga0157380_10778206 | |||
| 1212 | Ga0157380_11727852 | |||
| 1213 | Ga0157380_12124772 | |||
| 1214 | Ga0157377_10324658 | |||
| 1215 | Ga0157379_10009368 | |||
| 1216 | Ga0157379_10017186 | |||
| 1217 | Ga0157379_10045873 | |||
| 1218 | Ga0157379_10560859 | |||
| 1219 | Ga0157379_10935488 | |||
| 1220 | Ga0157376_10007383 | |||
| 1221 | Ga0157376_10023512 | |||
| 1222 | Ga0157376_10026344 | |||
| 1223 | Ga0157376_10397908 | |||
| 1224 | Ga0157376_11420530 | |||
| 1225 | Ga0157376_11763356 | |||
| 1226 | Ga0163161_10385455 | |||
| 1227 | Ga0163161_10780624 | |||
| 1228 | Ga0213876_10454800 | |||
| 1229 | Ga0207697_10167434 | |||
| 1230 | Ga0207642_10190676 | |||
| 1231 | Ga0207642_10243649 | |||
| 1232 | Ga0207680_10069645 | |||
| 1233 | Ga0207680_10158042 | |||
| 1234 | Ga0207685_10395022 | |||
| 1235 | Ga0207685_10395982 | |||
| 1236 | Ga0207699_10015778 | |||
| 1237 | Ga0207645_10002091 | |||
| 1238 | Ga0207645_10351971 | |||
| 1239 | Ga0207643_10730658 | |||
| 1240 | Ga0207684_10956167 | |||
| 1241 | Ga0207654_10527712 | |||
| 1242 | Ga0207707_10279452 | |||
| 1243 | Ga0207707_10820702 | |||
| 1244 | Ga0207695_10170769 | |||
| 1245 | Ga0207695_10191257 | |||
| 1246 | Ga0207695_10634378 | |||
| 1247 | Ga0207695_10758946 | |||
| 1248 | Ga0207660_10138464 | |||
| 1249 | Ga0207660_10906661 | |||
| 1250 | Ga0207662_10270528 | |||
| 1251 | Ga0207662_10377975 | |||
| 1252 | Ga0207657_10257276 | |||
| 1253 | Ga0207657_10969041 | |||
| 1254 | Ga0207649_10822657 | |||
| 1255 | Ga0207652_10547397 | |||
| 1256 | Ga0207652_11504502 | |||
| 1257 | Ga0207646_10043289 | |||
| 1258 | Ga0207646_10051452 | |||
| 1259 | Ga0207646_10153206 | |||
| 1260 | Ga0207646_10568852 | |||
| 1261 | Ga0207646_10876785 | |||
| 1262 | Ga0207681_10043056 | |||
| 1263 | Ga0207681_10082383 | |||
| 1264 | Ga0207681_10130141 | |||
| 1265 | Ga0207681_10472243 | |||
| 1266 | Ga0207694_11030440 | |||
| 1267 | Ga0207650_10042085 | |||
| 1268 | Ga0207650_10046439 | |||
| 1269 | Ga0207650_10078551 | |||
| 1270 | Ga0207650_10479189 | |||
| 1271 | Ga0207650_10710911 | |||
| 1272 | Ga0207650_10967420 | |||
| 1273 | Ga0207659_10000452 | |||
| 1274 | Ga0207659_10033882 | |||
| 1275 | Ga0207659_10581749 | |||
| 1276 | Ga0207659_10678944 | |||
| 1277 | Ga0207659_10962004 | |||
| 1278 | Ga0207687_10299088 | |||
| 1279 | Ga0207687_10467323 | |||
| 1280 | Ga0207700_10055736 | |||
| 1281 | Ga0207644_10087083 | |||
| 1282 | Ga0207644_11253300 | |||
| 1283 | Ga0207690_11168266 | |||
| 1284 | Ga0207706_10159756 | |||
| 1285 | Ga0207706_10189351 | |||
| 1286 | Ga0207706_10220485 | |||
| 1287 | Ga0207706_10244056 | |||
| 1288 | Ga0207706_10396176 | |||
| 1289 | Ga0207706_10991269 | |||
| 1290 | Ga0207686_10086937 | |||
| 1291 | Ga0207686_10250266 | |||
| 1292 | Ga0207686_10670262 | |||
| 1293 | Ga0207709_10105681 | |||
| 1294 | Ga0207670_10153243 | |||
| 1295 | Ga0207670_10356899 | |||
| 1296 | Ga0207669_10024470 | |||
| 1297 | Ga0207669_10469371 | |||
| 1298 | Ga0207669_10931994 | |||
| 1299 | Ga0207704_10097737 | |||
| 1300 | Ga0207704_10366677 | |||
| 1301 | Ga0207704_10472621 | |||
| 1302 | Ga0207665_10055349 | |||
| 1303 | Ga0207691_10010298 | |||
| 1304 | Ga0207691_10105363 | |||
| 1305 | Ga0207691_10262209 | |||
| 1306 | Ga0207711_10024485 | |||
| 1307 | Ga0207711_10107549 | |||
| 1308 | Ga0207711_10150743 | |||
| 1309 | Ga0207711_10274636 | |||
| 1310 | Ga0207711_10372624 | |||
| 1311 | Ga0207711_10469466 | |||
| 1312 | Ga0207711_10725475 | |||
| 1313 | Ga0207711_10885461 | |||
| 1314 | Ga0207711_11766710 | |||
| 1315 | Ga0207689_10066268 | |||
| 1316 | Ga0207689_10243431 | |||
| 1317 | Ga0207689_10712667 | |||
| 1318 | Ga0207661_10893755 | |||
| 1319 | Ga0207679_10898551 | |||
| 1320 | Ga0207651_10059893 | |||
| 1321 | Ga0207651_10146338 | |||
| 1322 | Ga0207651_10202200 | |||
| 1323 | Ga0207651_10987054 | |||
| 1324 | Ga0207651_11430528 | |||
| 1325 | Ga0207712_10184534 | |||
| 1326 | Ga0207712_11569295 | |||
| 1327 | Ga0207668_10073037 | |||
| 1328 | Ga0207668_10078354 | |||
| 1329 | Ga0207668_10951756 | |||
| 1330 | Ga0207640_10013049 | |||
| 1331 | Ga0207640_10522898 | |||
| 1332 | Ga0207640_11901567 | |||
| 1333 | Ga0207658_10024715 | |||
| 1334 | Ga0207677_10023554 | |||
| 1335 | Ga0207677_10729951 | |||
| 1336 | Ga0207703_10010553 | |||
| 1337 | Ga0207703_10019535 | |||
| 1338 | Ga0207703_10085620 | |||
| 1339 | Ga0207703_10092312 | |||
| 1340 | Ga0207703_10308848 | |||
| 1341 | Ga0207703_10534291 | |||
| 1342 | Ga0207703_10762856 | |||
| 1343 | Ga0207703_11034608 | |||
| 1344 | Ga0207639_10672373 | |||
| 1345 | Ga0207708_10007933 | |||
| 1346 | Ga0207708_10040406 | |||
| 1347 | Ga0207708_10060056 | |||
| 1348 | Ga0207708_11002572 | |||
| 1349 | Ga0207641_10001556 | |||
| 1350 | Ga0207641_10040115 | |||
| 1351 | Ga0207641_10340522 | |||
| 1352 | Ga0207641_10462193 | |||
| 1353 | Ga0207648_10003842 | |||
| 1354 | Ga0207648_10053331 | |||
| 1355 | Ga0207648_10342720 | |||
| 1356 | Ga0207676_10035030 | |||
| 1357 | Ga0207676_10087713 | |||
| 1358 | Ga0207676_10259837 | |||
| 1359 | Ga0207674_10065546 | |||
| 1360 | Ga0207674_10198566 | |||
| 1361 | Ga0207674_11063895 | |||
| 1362 | Ga0207675_100004284 | |||
| 1363 | Ga0207675_100025632 | |||
| 1364 | Ga0207675_100038973 | |||
| 1365 | Ga0207675_100166723 | |||
| 1366 | Ga0207675_100232631 | |||
| 1367 | Ga0207675_102065467 | |||
| 1368 | Ga0207683_10127404 | |||
| 1369 | Ga0207683_10152629 | |||
| 1370 | Ga0207683_10195122 | |||
| 1371 | Ga0207683_10949869 | |||
| 1372 | Ga0207683_11692932 | |||
| 1373 | Ga0207698_10541608 | |||
| 1374 | Ga0207428_10000019 | |||
| 1375 | Ga0207428_10032336 | |||
| 1376 | Ga0207428_10115323 | |||
| 1377 | Ga0268266_10027359 | |||
| 1378 | Ga0268266_10075175 | |||
| 1379 | Ga0268266_10128250 | |||
| 1380 | Ga0268266_11837429 | |||
| 1381 | Ga0268265_10007747 | |||
| 1382 | Ga0268265_10013365 | |||
| 1383 | Ga0268265_10019194 | |||
| 1384 | Ga0268264_10061651 | |||
| 1385 | Ga0268264_10111140 | |||
| 1386 | Ga0268264_10438819 | |||
| 1387 | Ga0268264_10816406 | |||
| 1388 | Ga0268264_11073354 | |||
| 1389 | Ga0265336_10023671 | |||
| 1390 | Ga0265332_10054475 | |||
| 1391 | Ga0307408_100578861 | |||
| 1392 | Ga0307408_100588344 | |||
| 1393 | Ga0307405_10004523 | |||
| 1394 | Ga0307413_10011495 | |||
| 1395 | Ga0307413_10494734 | |||
| 1396 | Ga0307410_10024578 | |||
| 1397 | Ga0307410_10026753 | |||
| 1398 | Ga0307406_10007138 | |||
| 1399 | Ga0307407_10005639 | |||
| 1400 | Ga0307407_10074004 | |||
| 1401 | Ga0307412_10042454 | |||
| 1402 | Ga0307409_100002717 | |||
| 1403 | Ga0307409_100033865 | |||
| 1404 | Ga0307409_100727550 | |||
| 1405 | Ga0307416_100770534 | |||
| 1406 | Ga0307414_10005333 | |||
| 1407 | Ga0307414_10072664 | |||
| 1408 | Ga0307411_10018419 | |||
| 1409 | Ga0307411_10056903 | |||
| 1410 | Ga0307411_10153677 | |||
| 1411 | Ga0307415_100150420 | |||
| 1412 | Ga0373948_0000509 | |||
| 1413 | Ga0373958_0016317 | |||
| 1414 | Ga0373959_0001115 | |||
| 1415 | Ga0373938_0000914 | |||
| 1416 | Ga0373928_0003690 | |||
| 1417 | Ga0373929_0001665 | |||
| 1418 | Ga0373940_0008914 | |||
| 1419 | Ga0373940_0171412 | |||
| 1420 | Ga0373949_0000482 | |||
| 1421 | Ga0373951_0000509 | |||
| 1422 | Ga0373952_0000226 | |||
| 1423 | Ga0373952_0275102 | |||
| 1424 | Ga0373923_0544803 | |||
| 1425 | Ga0373932_0002843 | |||
| 1426 | Ga0373932_0269964 | |||
| 1427 | Ga0373939_0000720 | |||
| 1428 | Ga0373939_0017908 | |||
| 1429 | Ga0373941_0001206 | |||
| 1430 | Ga0373945_0052675 | |||
| 1431 | Ga0373953_0262848 | |||
| 1432 | Ga0373956_0124444 | |||
| 1433 | Ga0373957_0178833 | |||
| 1434 | Ga0373957_0195768 | |||
| 1435 | Ga0373960_0002697 | |||
| 1436 | Ga0373942_0001963 | |||
| 1437 | Ga0373961_0001603 | |||
| 1438 | Ga0373962_0004201 | |||
| 1439 | Ga0373962_0007357 | |||
| 1440 | Ga0373931_0000488 | |||
| 1441 | Ga0373931_0096249 | |||
| 1442 | Ga0373931_0214019 | |||
| 1443 | Ga0373935_0976698 | |||
| 1444 | Ga0373927_0238985 | |||
| 1445 | Ga0373927_0347378 | |||
| 1446 | Ga0373927_1044381 | |||
| 1447 | Ga0373933_0275446 | |||
| 1448 | Ga0373947_0991536 | |||
| 1449 | Ga0373937_0241425 | |||
| 1450 | Ga0373937_0293586 | |||
| 1451 | Ga0373937_0483143 | |||
| 1452 | Ga0373937_0533155 | |||
| 1453 | Ga0373937_1527814 | |||
| 1454 | Ga0373925_0217272 | |||
| 1455 | Ga0373925_0260971 | |||
| 1456 | Ga0373925_1291666 | |||
| 1457 | Ga0436365_0147401 | |||
| 1458 | Ga0436365_0783264 | |||
| 1459 | Ga0439461_0169737 | |||
| 1460 | Ga0466963_0034100 | |||
| 1461 | Ga0451576_0035736 | |||
| 1462 | Ga0451576_0471764 | |||
| 1463 | Ga0451576_0574926 | |||
| 1464 | Ga0466967_0114487 | |||
| 1465 | Ga0495592_0039982 | |||
| 1466 | Ga0495629_0728659 | |||
| 1467 | Ga0495629_0885322 | |||
| 1468 | Ga0495651_0307638 | |||
| 1469 | Ga0495653_0743868 | |||
| 1470 | Ga0495580_0239561 | |||
| 1471 | Ga0495580_0315459 | |||
| 1472 | Ga0495580_0496614 | |||
| 1473 | Ga0495639_0658393 | |||
| 1474 | Ga0495662_0176579 | |||
| 1475 | Ga0495608_0004888 | |||
| 1476 | Ga0495618_0258946 | |||
| 1477 | Ga0495628_0099882 | |||
| 1478 | Ga0495628_0233517 | |||
| 1479 | Ga0495628_0320848 | |||
| 1480 | Ga0495630_0035961 | |||
| 1481 | Ga0495630_0855087 | |||
| 1482 | Ga0495652_0062779 | |||
| 1483 | Ga0495640_0430106 | |||
| 1484 | Ga0495586_0055765 | |||
| 1485 | Ga0495586_0241916 | |||
| 1486 | Ga0495586_0460655 | |||
| 1487 | Ga0495645_0090377 | |||
| 1488 | Ga0495645_0100298 | |||
| 1489 | Ga0495656_0151136 | |||
| 1490 | Ga0495668_0290656 | |||
| 1491 | Ga0495634_0078175 | |||
| 1492 | Ga0495634_0574656 | |||
| 1493 | Ga0495634_0792723 | |||
| 1494 | Ga0495635_0099729 | |||
| 1495 | Ga0495658_0017387 | |||
| 1496 | Ga0495658_0040106 | |||
| 1497 | Ga0495658_0087771 | |||
| 1498 | Ga0495658_0360637 | |||
| 1499 | Ga0495658_0402427 | |||
| 1500 | Ga0495658_0735918 | |||
| 1501 | Ga0495613_0000270 | |||
| 1502 | Ga0495613_0906875 | |||
| 1503 | Ga0495670_0567414 | |||
| 1504 | Ga0495600_0017848 | |||
| 1505 | Ga0495600_0537039 | |||
| 1506 | Ga0495581_0408664 | |||
| 1507 | Ga0495581_0554214 | |||
| 1508 | Ga0495581_0826992 | |||
| 1509 | Ga0495604_0006670 | |||
| 1510 | Ga0495604_0673273 | |||
| 1511 | Ga0495674_0363478 | |||
| 1512 | Ga0495680_0330919 | |||
| 1513 | Ga0495675_0331792 | |||
| 1514 | Ga0495684_0000011 | |||
| 1515 | Ga0495684_0259806 | |||
| 1516 | Ga0496100_0001767 | |||
| 1517 | Ga0496100_1253419 | |||
| 1518 | Ga0496101_0003536 | |||
| 1519 | Ga0496101_0752257 | |||
| 1520 | Ga0496102_0142358 | |||
| 1521 | Ga0496102_0904677 | |||
| 1522 | Ga0496102_1441450 | |||
| 1523 | Ga0496104_0011243 | |||
| 1524 | Ga0496104_0308976 | |||
| 1525 | Ga0496104_0316675 | |||
| 1526 | Ga0496104_0698494 | |||
| 1527 | Ga0496105_0041581 | |||
| 1528 | Ga0496105_0393068 | |||
| 1529 | Ga0496105_0421467 | |||
| 1530 | Ga0496106_0271180 | |||
| 1531 | Ga0496106_0563783 | |||
| 1532 | Ga0496107_0257617 | |||
| 1533 | Ga0496108_0007470 | |||
| 1534 | Ga0496108_0849015 | |||
| 1535 | Ga0496109_0072409 | |||
| 1536 | Ga0496109_1145045 | |||
| 1537 | Ga0496110_0282573 | |||
| 1538 | Ga0496110_0951555 | |||
| 1539 | Ga0496112_0015032 | |||
| 1540 | Ga0496112_0155795 | |||
| 1541 | Ga0496112_0392061 | |||
| 1542 | Ga0496112_0710904 | |||
| 1543 | Ga0496112_0998843 | |||
| 1544 | Ga0496113_0050182 | |||
| 1545 | Ga0496113_0251822 | |||
| 1546 | Ga0496113_0820804 | |||
| 1547 | Ga0496114_0002246 | |||
| 1548 | Ga0496114_0134932 | |||
| 1549 | Ga0496114_0148242 | |||
| 1550 | Ga0496114_0343772 | |||
| 1551 | Ga0496114_0544204 | |||
| 1552 | Ga0496115_0048392 | |||
| 1553 | Ga0496115_0258333 | |||
| 1554 | Ga0501031_0562897 | |||
| 1555 | Ga0501033_0026014 | |||
| 1556 | Ga0501036_0016899 | |||
| 1557 | Ga0501036_0170785 | |||
| 1558 | Ga0501036_0718552 | |||
| 1559 | Ga0501038_0084400 | |||
| 1560 | Ga0501039_0132881 | |||
| 1561 | Ga0501040_0002560 | |||
| 1562 | Ga0501040_0216812 | |||
| 1563 | Ga0501041_0004195 | |||
| 1564 | Ga0501041_0217098 | |||
| 1565 | Ga0501042_0044934 | |||
| 1566 | Ga0501046_0187931 | |||
| 1567 | Ga0501048_0082513 | |||
| 1568 | Ga0501048_0165996 | |||
| 1569 | Ga0501068_0383365 | |||
| 1570 | Ga0501071_0342249 | |||
| 1571 | Ga0501072_0082534 | |||
| 1572 | Ga0501072_0362322 | |||
| 1573 | Ga0501074_0365259 | |||
| 1574 | Ga0501075_0078260 | |||
| 1575 | Ga0501075_0140304 | |||
| 1576 | Ga0501075_0258869 | |||
| 1577 | Ga0501075_1085085 | |||
| 1578 | Ga0501076_0020154 | |||
| 1579 | Ga0501077_0028491 | |||
| 1580 | Ga0501249_160885 | |||
| 1581 | Ga0501079_0128664 | |||
| 1582 | Ga0501080_0016251 | |||
| 1583 | Ga0501080_1161423 | |||
| 1584 | Ga0501081_0002355 | |||
| 1585 | Ga0501081_0021287 | |||
| 1586 | Ga0501081_0320255 | |||
| 1587 | Ga0501081_0703344 | |||
| 1588 | Ga0501081_0921142 | |||
| 1589 | Ga0501083_0299985 | |||
| 1590 | Ga0501035_0657129 | |||
| 1591 | Ga0501045_0018351 | |||
| 1592 | nmdc:mga07m45_62441_c1 | |||
| 1593 | nmdc:mga05p37_146673_c1 | |||
| 1594 | nmdc:mga05p37_18651_c1 | |||
| 1595 | nmdc:mga05p37_213361_c1 | |||
| 1596 | nmdc:mga05p37_255682_c1 | |||
| 1597 | nmdc:mga05p37_266676_c1 | |||
| 1598 | nmdc:mga05p37_28334_c1 | |||
| 1599 | nmdc:mga05p37_317751_c1 | |||
| 1600 | nmdc:mga05p37_4712_c1 | |||
| 1601 | nmdc:mga05p37_484360_c1 | |||
| 1602 | nmdc:mga05p37_485232_c1 | |||
| 1603 | nmdc:mga05p37_58211_c1 | |||
| 1604 | nmdc:mga05p37_629149_c1 | |||
| 1605 | nmdc:mga05p37_876468_c1 | |||
| 1606 | nmdc:mga09592_1202268_c1 | |||
| 1607 | nmdc:mga09592_843732_c1 | |||
| 1608 | nmdc:mga06r32_1862087_c1 | |||
| 1609 | nmdc:mga06r32_307623_c1 | |||
| 1610 | nmdc:mga06r32_990058_c1 | |||
| 1611 | nmdc:mga08y16_1112876_c1 | |||
| 1612 | nmdc:mga08y16_12059_c1 | |||
| 1613 | nmdc:mga08y16_147882_c1 | |||
| 1614 | nmdc:mga08y16_17_c1 | |||
| 1615 | nmdc:mga08y16_9786_c1 | |||
| 1616 | nmdc:mga0n895_111406_c1 | |||
| 1617 | nmdc:mga0n895_158_c1 | |||
| 1618 | nmdc:mga0n895_179707_c1 | |||
| 1619 | nmdc:mga0n895_385788_c1 | |||
| 1620 | nmdc:mga0n895_76694_c1 | |||
| 1621 | nmdc:mga0rr50_2705_c1 | |||
| 1622 | nmdc:mga0rr50_41605_c1 | |||
| 1623 | nmdc:mga0rr50_41681_c1 | |||
| 1624 | nmdc:mga0rr50_426345_c1 | |||
| 1625 | nmdc:mga0rr50_6_c1 | |||
| 1626 | nmdc:mga0rr50_84307_c1 | |||
| 1627 | nmdc:mga08x19_198760_c1 | |||
| 1628 | nmdc:mga08x19_21726_c1 | |||
| 1629 | nmdc:mga08x19_251_c1 | |||
| 1630 | nmdc:mga08x19_278381_c1 | |||
| 1631 | nmdc:mga08x19_29141_c1 | |||
| 1632 | nmdc:mga08x19_354423_c1 | |||
| 1633 | nmdc:mga08x19_55985_c1 | |||
| 1634 | nmdc:mga08x19_69754_c1 | |||
| 1635 | nmdc:mga08x19_810829_c1 | |||
| 1636 | nmdc:mga0a205_23249_c1 | |||
| 1637 | nmdc:mga0a205_272664_c1 | |||
| 1638 | nmdc:mga0a205_6014_c1 | |||
| 1639 | nmdc:mga0a205_67044_c1 | |||
| 1640 | nmdc:mga0a205_80285_c1 | |||
| 1641 | Ga0495601_0007844 | |||
| 1642 | Ga0495601_0116945 | |||
| 1643 | Ga0495595_0012854 | |||
| 1644 | Ga0495595_0017737 | |||
| 1645 | Ga0495595_0180684 | |||
| 1646 | Ga0495619_0003599 | |||
| 1647 | Ga0495619_0017075 | |||
| 1648 | Ga0495619_0072399 | |||
| 1649 | Ga0495619_0803409 | |||
| 1650 | Ga0501084_0045423 | |||
| 1651 | Ga0501084_0115664 | |||
| 1652 | Ga0501084_0775157 | |||
| 1653 | Ga0590071_002132 | |||
| 1654 | Ga0590075_001175 | |||
| 1655 | Ga0501082_0005914 | |||
| 1656 | Ga0501082_0233872 | |||
| 1657 | Ga0530510_0058389 | |||
| 1658 | Ga0530510_0447422 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5eio-assembly1.cif.gz_C-2 | crystal structure of lysy from thermus thermophilus complexed with nadp+ and lysw-gamma-aminoadipic semialdehyde | 0.8355 | 4 | 36 |
| 5ein-assembly1.cif.gz_C | crystal structure of c148a mutant of lysy from thermus thermophilus in complex with nadp+ and lysw-gamma-aminoadipic acid | 0.8321 | 4 | 36 |
| 3wwn-assembly1.cif.gz_B-2 | crystal structure of lysz from thermus thermophilus complex with lysw | 0.8084 | 4 | 36 |
| 6tps-assembly1.cif.gz_I | early intermediate rna polymerase i pre-initiation complex - eipic | 0.6782 | 4 | 35 |
| 5lmx-assembly1.cif.gz_I | monomeric rna polymerase i at 4.9 a resolution | 0.6582 | 4 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1M6I0_390_487_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9456 | 75 | 104 | 1.25.40.10 |
| af_Q9M907_475_614_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9327 | 75 | 104 | 1.25.40.10 |
| af_Q4DPE2_262_423_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8997 | 68 | 107 | 1.10.1760.20 |
| af_Q4DUB6_274_435_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.8737 | 68 | 103 | 1.10.1760.20 |
| 5eioC00 | Mainly Beta;Single Sheet;Rubrerythrin, domain 2; | 0.8355 | 4 | 36 | 2.20.28.160 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8EJB5-F1-model_v4 | Uncharacterized protein | 0.9913 | 1 | 154 |
GO:0016020
|
| AF-A0A3D4FWX9-F1-model_v4 | DUF983 domain-containing protein | 0.9825 | 24 | 154 |
GO:0016020
|
| AF-A0A2V8MLZ5-F1-model_v4 | DUF4395 domain-containing protein | 0.9541 | 46 | 143 |
GO:0016020
|
| AF-A0A2E4KMT9-F1-model_v4 | Uncharacterized protein | 0.936 | 53 | 153 |
GO:0016020
|
| AF-A0A3D4FWX9-F1-model_v4 | DUF983 domain-containing protein | 0.9334 | 24 | 154 |
GO:0016020
|