F482573
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 828 | 310 | 1656 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0266365|Ga0501032_0266365_102_836 |
| Length | 234 |
| Sequence | VATEADRPAFYALAPGGTRDYLTLLHPPYTAWHLSYVAVGAALSSAFTWERFLPTLAAFFLAVGIGAHALDELSGRPLATRIPRPVLVALAAGSIAGAVDPWIAAFVAVGGFVVVAYNVELLGGRFHGDTWFALAWGAFPVATAYYAVAGRLDAVAAAGALYAFLLSRAQRQLSTPVRDVRRRVARVTGTIERKDGAVEPVTTELLLRGKERALLSLAGAAVAIGVGLVIMRVT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 180 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 182 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 204 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 205 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 257 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 258 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 259 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 260 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.72 |
| Nodule | 0 |
| Rhizoplane | 10.75 |
| Rhizosphere | 88.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0266365 | 3300049569 | Bacteria | 1110 |
| 2 | JGI24751J29686_10000700 | 3300002459 | Bacteria | 8226 |
| 3 | JGI25407J50210_10002835 | 3300003373 | Unclassified | 4124 |
| 4 | Ga0070676_10149857 | 3300005328 | Bacteria | 1492 |
| 5 | Ga0070683_100044810 | 3300005329 | Bacteria | 4081 |
| 6 | Ga0070683_100100193 | 3300005329 | Bacteria | 2727 |
| 7 | Ga0070690_100047913 | 3300005330 | Bacteria | 2720 |
| 8 | Ga0070690_100109945 | 3300005330 | Bacteria | 1838 |
| 9 | Ga0070670_100689956 | 3300005331 | Bacteria | 918 |
| 10 | Ga0070677_10045842 | 3300005333 | Unclassified | 1746 |
| 11 | Ga0068869_100095873 | 3300005334 | Bacteria | 2239 |
| 12 | Ga0070680_100071905 | 3300005336 | Bacteria | 2843 |
| 13 | Ga0070682_100064611 | 3300005337 | Bacteria | 2323 |
| 14 | Ga0068868_100168965 | 3300005338 | Unclassified | 1810 |
| 15 | Ga0070660_100404882 | 3300005339 | Unclassified | 1128 |
| 16 | Ga0070689_100210873 | 3300005340 | Unclassified | 1590 |
| 17 | Ga0070691_10011801 | 3300005341 | Bacteria | 3997 |
| 18 | Ga0070687_100117925 | 3300005343 | Bacteria | 1513 |
| 19 | Ga0070661_100013685 | 3300005344 | Bacteria | 5698 |
| 20 | Ga0070661_100094597 | 3300005344 | Bacteria | 2215 |
| 21 | Ga0070692_10032084 | 3300005345 | Bacteria | 2638 |
| 22 | Ga0070692_10162161 | 3300005345 | Bacteria | 1282 |
| 23 | Ga0070668_100055241 | 3300005347 | Bacteria | 3064 |
| 24 | Ga0070668_100232903 | 3300005347 | Bacteria | 1523 |
| 25 | Ga0070669_100048987 | 3300005353 | Bacteria | 3085 |
| 26 | Ga0070675_100026048 | 3300005354 | Bacteria | 4690 |
| 27 | Ga0070675_100770916 | 3300005354 | Bacteria | 878 |
| 28 | Ga0070671_100064736 | 3300005355 | Bacteria | 3045 |
| 29 | Ga0070673_100146019 | 3300005364 | Bacteria | 1999 |
| 30 | Ga0070688_100006481 | 3300005365 | Bacteria | 6260 |
| 31 | Ga0070659_100402659 | 3300005366 | Unclassified | 1155 |
| 32 | Ga0070667_100174377 | 3300005367 | Bacteria | 1900 |
| 33 | Ga0070703_10011929 | 3300005406 | Bacteria | 2459 |
| 34 | Ga0070709_10109500 | 3300005434 | Bacteria | 1854 |
| 35 | Ga0070714_100032783 | 3300005435 | Unclassified | 4338 |
| 36 | Ga0070713_100092946 | 3300005436 | Bacteria | 2598 |
| 37 | Ga0070710_10029427 | 3300005437 | Bacteria | 2947 |
| 38 | Ga0070710_10059018 | 3300005437 | Unclassified | 2177 |
| 39 | Ga0070710_10127993 | 3300005437 | Bacteria | 1545 |
| 40 | Ga0070701_10011678 | 3300005438 | Bacteria | 3939 |
| 41 | Ga0070701_10086611 | 3300005438 | Unclassified | 1707 |
| 42 | Ga0070701_10285324 | 3300005438 | Bacteria | 1010 |
| 43 | Ga0070711_100037538 | 3300005439 | Bacteria | 3251 |
| 44 | Ga0070705_100015924 | 3300005440 | Bacteria | 3896 |
| 45 | Ga0070705_100032998 | 3300005440 | Bacteria | 2882 |
| 46 | Ga0070705_100082675 | 3300005440 | Bacteria | 1976 |
| 47 | Ga0070700_100018370 | 3300005441 | Bacteria | 4019 |
| 48 | Ga0070700_100020942 | 3300005441 | Unclassified | 3796 |
| 49 | Ga0070700_100041153 | 3300005441 | Bacteria | 2832 |
| 50 | Ga0070700_100216507 | 3300005441 | Bacteria | 1354 |
| 51 | Ga0070694_100095759 | 3300005444 | Bacteria | 2091 |
| 52 | Ga0070694_100187991 | 3300005444 | Bacteria | 1532 |
| 53 | Ga0070694_100208461 | 3300005444 | Bacteria | 1460 |
| 54 | Ga0070694_100267670 | 3300005444 | Bacteria | 1298 |
| 55 | Ga0070708_100035691 | 3300005445 | Bacteria | 4333 |
| 56 | Ga0070708_100046365 | 3300005445 | Bacteria | 3835 |
| 57 | Ga0070708_100077637 | 3300005445 | Unclassified | 3001 |
| 58 | Ga0070708_100408808 | 3300005445 | Bacteria | 1280 |
| 59 | Ga0070663_100186509 | 3300005455 | Bacteria | 1612 |
| 60 | Ga0070663_100187611 | 3300005455 | Bacteria | 1607 |
| 61 | Ga0070663_100208962 | 3300005455 | Unclassified | 1527 |
| 62 | Ga0070663_100553567 | 3300005455 | Unclassified | 962 |
| 63 | Ga0070678_100020914 | 3300005456 | Bacteria | 4302 |
| 64 | Ga0070678_100038279 | 3300005456 | Bacteria | 3375 |
| 65 | Ga0070678_100235770 | 3300005456 | Bacteria | 1527 |
| 66 | Ga0070706_100069253 | 3300005467 | Unclassified | 3264 |
| 67 | Ga0070706_100080458 | 3300005467 | Bacteria | 3017 |
| 68 | Ga0070706_100143031 | 3300005467 | Bacteria | 2233 |
| 69 | Ga0070706_100177515 | 3300005467 | Bacteria | 1988 |
| 70 | Ga0070707_100001269 | 3300005468 | Bacteria | 24819 |
| 71 | Ga0070707_100005768 | 3300005468 | Bacteria | 11553 |
| 72 | Ga0070707_100063543 | 3300005468 | Bacteria | 3543 |
| 73 | Ga0070707_100548942 | 3300005468 | Bacteria | 1118 |
| 74 | Ga0070707_100549987 | 3300005468 | Bacteria | 1116 |
| 75 | Ga0070698_100013492 | 3300005471 | Bacteria | 8649 |
| 76 | Ga0070698_100015114 | 3300005471 | Bacteria | 8161 |
| 77 | Ga0070698_100050879 | 3300005471 | Bacteria | 4221 |
| 78 | Ga0070698_100149148 | 3300005471 | Unclassified | 2287 |
| 79 | Ga0070698_100237995 | 3300005471 | Unclassified | 1754 |
| 80 | Ga0070699_100008164 | 3300005518 | Bacteria | 9086 |
| 81 | Ga0070699_100017455 | 3300005518 | Bacteria | 6161 |
| 82 | Ga0070699_100062894 | 3300005518 | Bacteria | 3217 |
| 83 | Ga0070699_100113585 | 3300005518 | Bacteria | 2379 |
| 84 | Ga0070679_100002322 | 3300005530 | Bacteria | 17205 |
| 85 | Ga0070679_100357076 | 3300005530 | Bacteria | 1409 |
| 86 | Ga0070684_100001333 | 3300005535 | Bacteria | 17660 |
| 87 | Ga0070684_100023606 | 3300005535 | Bacteria | 5148 |
| 88 | Ga0070684_100238387 | 3300005535 | Bacteria | 1661 |
| 89 | Ga0070697_100335315 | 3300005536 | Unclassified | 1304 |
| 90 | Ga0068853_100186390 | 3300005539 | Bacteria | 1884 |
| 91 | Ga0070672_100073290 | 3300005543 | Bacteria | 2729 |
| 92 | Ga0070686_100023802 | 3300005544 | Bacteria | 3666 |
| 93 | Ga0070686_100058111 | 3300005544 | Bacteria | 2488 |
| 94 | Ga0070695_100247655 | 3300005545 | Bacteria | 1295 |
| 95 | Ga0070695_100286999 | 3300005545 | Unclassified | 1211 |
| 96 | Ga0070696_100016581 | 3300005546 | Bacteria | 4965 |
| 97 | Ga0070696_100129979 | 3300005546 | Unclassified | 1832 |
| 98 | Ga0070696_100130198 | 3300005546 | Unclassified | 1830 |
| 99 | Ga0070696_100377539 | 3300005546 | Unclassified | 1104 |
| 100 | Ga0070693_100000985 | 3300005547 | Bacteria | 12684 |
| 101 | Ga0070693_100049896 | 3300005547 | Bacteria | 2390 |
| 102 | Ga0070693_100109006 | 3300005547 | Bacteria | 1700 |
| 103 | Ga0070704_100403854 | 3300005549 | Bacteria | 1166 |
| 104 | Ga0068855_100037605 | 3300005563 | Bacteria | 5755 |
| 105 | Ga0068855_100545613 | 3300005563 | Unclassified | 1255 |
| 106 | Ga0068855_100755280 | 3300005563 | Bacteria | 1037 |
| 107 | Ga0070664_100040186 | 3300005564 | Bacteria | 3943 |
| 108 | Ga0070664_100291863 | 3300005564 | Bacteria | 1472 |
| 109 | Ga0070664_100414415 | 3300005564 | Bacteria | 1233 |
| 110 | Ga0068857_100008660 | 3300005577 | Bacteria | 8804 |
| 111 | Ga0068857_100106533 | 3300005577 | Bacteria | 2518 |
| 112 | Ga0068857_100163784 | 3300005577 | Unclassified | 2019 |
| 113 | Ga0068857_100401434 | 3300005577 | Unclassified | 1276 |
| 114 | Ga0068854_100176424 | 3300005578 | Unclassified | 1666 |
| 115 | Ga0068856_100049450 | 3300005614 | Bacteria | 4144 |
| 116 | Ga0068856_100077950 | 3300005614 | Unclassified | 3284 |
| 117 | Ga0068856_100125130 | 3300005614 | Bacteria | 2574 |
| 118 | Ga0068856_100129730 | 3300005614 | Bacteria | 2526 |
| 119 | Ga0070702_100017566 | 3300005615 | Bacteria | 3692 |
| 120 | Ga0070702_100038165 | 3300005615 | Bacteria | 2673 |
| 121 | Ga0070702_100243752 | 3300005615 | Bacteria | 1214 |
| 122 | Ga0070702_100527757 | 3300005615 | Unclassified | 872 |
| 123 | Ga0068852_100148632 | 3300005616 | Bacteria | 2176 |
| 124 | Ga0068852_100224010 | 3300005616 | Bacteria | 1790 |
| 125 | Ga0068859_100018378 | 3300005617 | Bacteria | 7028 |
| 126 | Ga0068864_100010882 | 3300005618 | Bacteria | 7520 |
| 127 | Ga0068864_100171340 | 3300005618 | Bacteria | 1979 |
| 128 | Ga0068864_100454207 | 3300005618 | Bacteria | 1226 |
| 129 | Ga0068866_10100334 | 3300005718 | Unclassified | 1596 |
| 130 | Ga0068866_10242894 | 3300005718 | Unclassified | 1098 |
| 131 | Ga0068861_100010653 | 3300005719 | Bacteria | 6385 |
| 132 | Ga0068861_100099612 | 3300005719 | Bacteria | 2309 |
| 133 | Ga0068851_10119004 | 3300005834 | Unclassified | 1418 |
| 134 | Ga0068870_10003709 | 3300005840 | Bacteria | 6490 |
| 135 | Ga0068863_100095332 | 3300005841 | Bacteria | 2824 |
| 136 | Ga0068858_100241069 | 3300005842 | Unclassified | 1716 |
| 137 | Ga0068860_100116180 | 3300005843 | Bacteria | 2560 |
| 138 | Ga0068860_100132309 | 3300005843 | Bacteria | 2394 |
| 139 | Ga0068862_100294877 | 3300005844 | Bacteria | 1490 |
| 140 | Ga0068862_100315427 | 3300005844 | Unclassified | 1442 |
| 141 | Ga0081455_10005485 | 3300005937 | Bacteria | 13907 |
| 142 | Ga0081455_10005503 | 3300005937 | Bacteria | 13877 |
| 143 | Ga0081455_10025164 | 3300005937 | Bacteria | 5498 |
| 144 | Ga0081455_10038422 | 3300005937 | Bacteria | 4240 |
| 145 | Ga0081455_10048335 | 3300005937 | Bacteria | 3677 |
| 146 | Ga0081538_10000089 | 3300005981 | Bacteria | 88801 |
| 147 | Ga0081538_10000245 | 3300005981 | Bacteria | 61398 |
| 148 | Ga0081538_10001308 | 3300005981 | Bacteria | 25746 |
| 149 | Ga0081538_10001549 | 3300005981 | Bacteria | 23556 |
| 150 | Ga0081538_10001642 | 3300005981 | Bacteria | 22944 |
| 151 | Ga0081538_10014744 | 3300005981 | Bacteria | 6098 |
| 152 | Ga0081538_10016976 | 3300005981 | Bacteria | 5550 |
| 153 | Ga0081538_10019498 | 3300005981 | Bacteria | 5036 |
| 154 | Ga0081540_1004845 | 3300005983 | Bacteria | 10141 |
| 155 | Ga0081539_10002069 | 3300005985 | Bacteria | 30045 |
| 156 | Ga0081539_10003486 | 3300005985 | Bacteria | 19222 |
| 157 | Ga0081539_10102143 | 3300005985 | Bacteria | 1459 |
| 158 | Ga0070717_10112606 | 3300006028 | Bacteria | 2322 |
| 159 | Ga0075365_10155832 | 3300006038 | Unclassified | 1590 |
| 160 | Ga0075365_10193739 | 3300006038 | Bacteria | 1423 |
| 161 | Ga0075364_10420708 | 3300006051 | Bacteria | 912 |
| 162 | Ga0075432_10005739 | 3300006058 | Bacteria | 4224 |
| 163 | Ga0075432_10009868 | 3300006058 | Bacteria | 3246 |
| 164 | Ga0075432_10047443 | 3300006058 | Bacteria | 1510 |
| 165 | Ga0070715_10003344 | 3300006163 | Bacteria | 5082 |
| 166 | Ga0070715_10007785 | 3300006163 | Bacteria | 3702 |
| 167 | Ga0070715_10012797 | 3300006163 | Bacteria | 3066 |
| 168 | Ga0070715_10069632 | 3300006163 | Bacteria | 1568 |
| 169 | Ga0070716_100215355 | 3300006173 | Bacteria | 1286 |
| 170 | Ga0070716_100243238 | 3300006173 | Bacteria | 1221 |
| 171 | Ga0070712_100019297 | 3300006175 | Bacteria | 4445 |
| 172 | Ga0070712_100035361 | 3300006175 | Bacteria | 3391 |
| 173 | Ga0070712_100111525 | 3300006175 | Bacteria | 2042 |
| 174 | Ga0075366_10216130 | 3300006195 | Bacteria | 1167 |
| 175 | Ga0097621_100029812 | 3300006237 | Bacteria | 4312 |
| 176 | Ga0097621_100230231 | 3300006237 | Bacteria | 1618 |
| 177 | Ga0068871_100010689 | 3300006358 | Bacteria | 6711 |
| 178 | Ga0068871_100138003 | 3300006358 | Unclassified | 2072 |
| 179 | Ga0068871_100182216 | 3300006358 | Bacteria | 1805 |
| 180 | Ga0075428_100010997 | 3300006844 | Bacteria | 10065 |
| 181 | Ga0075428_100012866 | 3300006844 | Bacteria | 9311 |
| 182 | Ga0075428_100048126 | 3300006844 | Bacteria | 4681 |
| 183 | Ga0075428_100109056 | 3300006844 | Bacteria | 3017 |
| 184 | Ga0075428_100340594 | 3300006844 | Bacteria | 1610 |
| 185 | Ga0075428_100746647 | 3300006844 | Bacteria | 1041 |
| 186 | Ga0075430_100010666 | 3300006846 | Bacteria | 7786 |
| 187 | Ga0075430_100026886 | 3300006846 | Bacteria | 4893 |
| 188 | Ga0075430_100111993 | 3300006846 | Bacteria | 2275 |
| 189 | Ga0075431_100096903 | 3300006847 | Bacteria | 3045 |
| 190 | Ga0075431_100317481 | 3300006847 | Bacteria | 1572 |
| 191 | Ga0075433_10009272 | 3300006852 | Bacteria | 7869 |
| 192 | Ga0075433_10090658 | 3300006852 | Bacteria | 2702 |
| 193 | Ga0075433_10206948 | 3300006852 | Bacteria | 1744 |
| 194 | Ga0075433_10262686 | 3300006852 | Bacteria | 1530 |
| 195 | Ga0075433_10602252 | 3300006852 | Unclassified | 965 |
| 196 | Ga0075434_100019501 | 3300006871 | Bacteria | 6565 |
| 197 | Ga0075434_100158749 | 3300006871 | Bacteria | 2281 |
| 198 | Ga0075434_100169729 | 3300006871 | Bacteria | 2202 |
| 199 | Ga0075434_100238749 | 3300006871 | Bacteria | 1837 |
| 200 | Ga0075434_100325516 | 3300006871 | Unclassified | 1557 |
| 201 | Ga0075429_100031457 | 3300006880 | Bacteria | 4612 |
| 202 | Ga0068865_100008729 | 3300006881 | Bacteria | 6270 |
| 203 | Ga0075436_100009847 | 3300006914 | Bacteria | 6538 |
| 204 | Ga0075436_100011299 | 3300006914 | Bacteria | 6125 |
| 205 | Ga0075436_100178056 | 3300006914 | Bacteria | 1502 |
| 206 | Ga0097620_100018376 | 3300006931 | Bacteria | 7028 |
| 207 | Ga0075435_100002683 | 3300007076 | Bacteria | 11878 |
| 208 | Ga0075435_100021766 | 3300007076 | Bacteria | 4938 |
| 209 | Ga0075435_100049004 | 3300007076 | Bacteria | 3395 |
| 210 | Ga0075435_100238999 | 3300007076 | Bacteria | 1544 |
| 211 | Ga0075435_100257135 | 3300007076 | Bacteria | 1487 |
| 212 | Ga0111539_10000579 | 3300009094 | Bacteria | 47092 |
| 213 | Ga0111539_10007286 | 3300009094 | Bacteria | 14163 |
| 214 | Ga0111539_10017387 | 3300009094 | Bacteria | 8900 |
| 215 | Ga0111539_10027803 | 3300009094 | Bacteria | 6907 |
| 216 | Ga0111539_10046085 | 3300009094 | Bacteria | 5217 |
| 217 | Ga0111539_10176433 | 3300009094 | Bacteria | 2496 |
| 218 | Ga0111539_10190636 | 3300009094 | Bacteria | 2392 |
| 219 | Ga0111539_10756664 | 3300009094 | Bacteria | 1131 |
| 220 | Ga0105245_10004716 | 3300009098 | Bacteria | 12049 |
| 221 | Ga0105245_10008329 | 3300009098 | Bacteria | 9061 |
| 222 | Ga0105245_10034329 | 3300009098 | Bacteria | 4499 |
| 223 | Ga0105245_10054431 | 3300009098 | Bacteria | 3593 |
| 224 | Ga0105247_10014964 | 3300009101 | Bacteria | 4651 |
| 225 | Ga0114129_10028436 | 3300009147 | Bacteria | 7923 |
| 226 | Ga0114129_10069809 | 3300009147 | Bacteria | 4898 |
| 227 | Ga0114129_10077327 | 3300009147 | Bacteria | 4629 |
| 228 | Ga0114129_10111656 | 3300009147 | Bacteria | 3771 |
| 229 | Ga0114129_10148284 | 3300009147 | Bacteria | 3212 |
| 230 | Ga0114129_10154381 | 3300009147 | Unclassified | 3141 |
| 231 | Ga0114129_10233669 | 3300009147 | Bacteria | 2475 |
| 232 | Ga0114129_10236865 | 3300009147 | Bacteria | 2455 |
| 233 | Ga0114129_10454029 | 3300009147 | Unclassified | 1680 |
| 234 | Ga0114129_10686657 | 3300009147 | Bacteria | 1317 |
| 235 | Ga0105243_10005743 | 3300009148 | Bacteria | 9636 |
| 236 | Ga0105243_10021509 | 3300009148 | Bacteria | 4897 |
| 237 | Ga0105243_10096887 | 3300009148 | Bacteria | 2441 |
| 238 | Ga0105243_10304678 | 3300009148 | Bacteria | 1445 |
| 239 | Ga0105243_10383286 | 3300009148 | Bacteria | 1301 |
| 240 | Ga0105241_10077750 | 3300009174 | Bacteria | 2591 |
| 241 | Ga0105241_10555572 | 3300009174 | Bacteria | 1031 |
| 242 | Ga0105242_10094515 | 3300009176 | Bacteria | 2522 |
| 243 | Ga0105242_10241952 | 3300009176 | Unclassified | 1623 |
| 244 | Ga0105248_10319811 | 3300009177 | Bacteria | 1748 |
| 245 | Ga0105248_10924734 | 3300009177 | Bacteria | 985 |
| 246 | Ga0105237_10208181 | 3300009545 | Bacteria | 1956 |
| 247 | Ga0105238_10197271 | 3300009551 | Unclassified | 1988 |
| 248 | Ga0105249_10007425 | 3300009553 | Bacteria | 9561 |
| 249 | Ga0105249_10048598 | 3300009553 | Bacteria | 3867 |
| 250 | Ga0105249_10059391 | 3300009553 | Bacteria | 3507 |
| 251 | Ga0105249_10142593 | 3300009553 | Bacteria | 2299 |
| 252 | Ga0105249_10331421 | 3300009553 | Bacteria | 1536 |
| 253 | Ga0105239_10048807 | 3300010375 | Bacteria | 4641 |
| 254 | Ga0105239_10118367 | 3300010375 | Unclassified | 2940 |
| 255 | Ga0105239_10403580 | 3300010375 | Bacteria | 1547 |
| 256 | Ga0105239_10840767 | 3300010375 | Bacteria | 1052 |
| 257 | Ga0105246_10017021 | 3300011119 | Bacteria | 4617 |
| 258 | Ga0157371_10437959 | 3300013102 | Unclassified | 960 |
| 259 | Ga0157374_11183224 | 3300013296 | Bacteria | 786 |
| 260 | Ga0157378_10157307 | 3300013297 | Unclassified | 2122 |
| 261 | Ga0163162_10034504 | 3300013306 | Bacteria | 5035 |
| 262 | Ga0163162_10073465 | 3300013306 | Bacteria | 3476 |
| 263 | Ga0163162_10183446 | 3300013306 | Bacteria | 2219 |
| 264 | Ga0157375_10421355 | 3300013308 | Bacteria | 1501 |
| 265 | Ga0157375_10466578 | 3300013308 | Unclassified | 1428 |
| 266 | Ga0157375_10480204 | 3300013308 | Bacteria | 1408 |
| 267 | Ga0163163_10055234 | 3300014325 | Bacteria | 3925 |
| 268 | Ga0163163_10072190 | 3300014325 | Bacteria | 3441 |
| 269 | Ga0157380_10029265 | 3300014326 | Bacteria | 4209 |
| 270 | Ga0157377_10166470 | 3300014745 | Unclassified | 1375 |
| 271 | Ga0157377_10362634 | 3300014745 | Bacteria | 976 |
| 272 | Ga0157379_10014155 | 3300014968 | Bacteria | 6995 |
| 273 | Ga0157379_10208325 | 3300014968 | Bacteria | 1769 |
| 274 | Ga0157376_10015092 | 3300014969 | Bacteria | 5823 |
| 275 | Ga0157376_10106649 | 3300014969 | Bacteria | 2458 |
| 276 | Ga0163161_10496137 | 3300017792 | Bacteria | 993 |
| 277 | Ga0213876_10005772 | 3300021384 | Bacteria | 6779 |
| 278 | Ga0207656_10022769 | 3300025321 | Bacteria | 2517 |
| 279 | Ga0207653_10001281 | 3300025885 | Bacteria | 8189 |
| 280 | Ga0207653_10019655 | 3300025885 | Bacteria | 2131 |
| 281 | Ga0207692_10098042 | 3300025898 | Bacteria | 1603 |
| 282 | Ga0207692_10152619 | 3300025898 | Bacteria | 1324 |
| 283 | Ga0207642_10054406 | 3300025899 | Unclassified | 1826 |
| 284 | Ga0207642_10224017 | 3300025899 | Unclassified | 1052 |
| 285 | Ga0207688_10008143 | 3300025901 | Bacteria | 5698 |
| 286 | Ga0207688_10031063 | 3300025901 | Unclassified | 2947 |
| 287 | Ga0207688_10080712 | 3300025901 | Bacteria | 1857 |
| 288 | Ga0207699_10013847 | 3300025906 | Bacteria | 4139 |
| 289 | Ga0207699_10036367 | 3300025906 | Bacteria | 2806 |
| 290 | Ga0207699_10221283 | 3300025906 | Bacteria | 1292 |
| 291 | Ga0207645_10018387 | 3300025907 | Bacteria | 4597 |
| 292 | Ga0207645_10090842 | 3300025907 | Bacteria | 1964 |
| 293 | Ga0207643_10000527 | 3300025908 | Bacteria | 24547 |
| 294 | Ga0207684_10072851 | 3300025910 | Unclassified | 2917 |
| 295 | Ga0207684_10086646 | 3300025910 | Bacteria | 2668 |
| 296 | Ga0207684_10252637 | 3300025910 | Bacteria | 1521 |
| 297 | Ga0207684_10263273 | 3300025910 | Bacteria | 1488 |
| 298 | Ga0207654_10166275 | 3300025911 | Unclassified | 1429 |
| 299 | Ga0207693_10005408 | 3300025915 | Bacteria | 10668 |
| 300 | Ga0207693_10011813 | 3300025915 | Bacteria | 7057 |
| 301 | Ga0207693_10021966 | 3300025915 | Bacteria | 5073 |
| 302 | Ga0207693_10069084 | 3300025915 | Bacteria | 2765 |
| 303 | Ga0207693_10087993 | 3300025915 | Bacteria | 2434 |
| 304 | Ga0207693_10386072 | 3300025915 | Unclassified | 1095 |
| 305 | Ga0207663_10002883 | 3300025916 | Bacteria | 8306 |
| 306 | Ga0207663_10013680 | 3300025916 | Bacteria | 4417 |
| 307 | Ga0207663_10014107 | 3300025916 | Bacteria | 4365 |
| 308 | Ga0207663_10043586 | 3300025916 | Bacteria | 2748 |
| 309 | Ga0207663_10160951 | 3300025916 | Bacteria | 1584 |
| 310 | Ga0207660_10052549 | 3300025917 | Bacteria | 2901 |
| 311 | Ga0207662_10181687 | 3300025918 | Unclassified | 1354 |
| 312 | Ga0207657_10047961 | 3300025919 | Bacteria | 3731 |
| 313 | Ga0207649_10431994 | 3300025920 | Bacteria | 991 |
| 314 | Ga0207652_10135455 | 3300025921 | Bacteria | 2199 |
| 315 | Ga0207646_10007257 | 3300025922 | Bacteria | 11300 |
| 316 | Ga0207646_10059733 | 3300025922 | Unclassified | 3405 |
| 317 | Ga0207650_10006885 | 3300025925 | Bacteria | 7751 |
| 318 | Ga0207650_10024317 | 3300025925 | Bacteria | 4305 |
| 319 | Ga0207659_10095510 | 3300025926 | Bacteria | 2229 |
| 320 | Ga0207659_10289286 | 3300025926 | Unclassified | 1342 |
| 321 | Ga0207687_10131962 | 3300025927 | Bacteria | 1884 |
| 322 | Ga0207687_10146722 | 3300025927 | Bacteria | 1796 |
| 323 | Ga0207687_10242239 | 3300025927 | Bacteria | 1430 |
| 324 | Ga0207700_10038736 | 3300025928 | Bacteria | 3463 |
| 325 | Ga0207700_10099906 | 3300025928 | Bacteria | 2311 |
| 326 | Ga0207700_10131655 | 3300025928 | Bacteria | 2043 |
| 327 | Ga0207664_10015497 | 3300025929 | Bacteria | 5535 |
| 328 | Ga0207664_10020772 | 3300025929 | Bacteria | 4873 |
| 329 | Ga0207664_10032523 | 3300025929 | Bacteria | 3999 |
| 330 | Ga0207690_10061927 | 3300025932 | Bacteria | 2545 |
| 331 | Ga0207706_10045210 | 3300025933 | Bacteria | 3901 |
| 332 | Ga0207706_10133067 | 3300025933 | Bacteria | 2187 |
| 333 | Ga0207709_10059908 | 3300025935 | Bacteria | 2371 |
| 334 | Ga0207709_10141361 | 3300025935 | Unclassified | 1655 |
| 335 | Ga0207709_10238285 | 3300025935 | Unclassified | 1322 |
| 336 | Ga0207670_10051476 | 3300025936 | Bacteria | 2765 |
| 337 | Ga0207704_10088469 | 3300025938 | Bacteria | 2026 |
| 338 | Ga0207665_10019918 | 3300025939 | Bacteria | 4409 |
| 339 | Ga0207665_10047351 | 3300025939 | Bacteria | 2883 |
| 340 | Ga0207665_10153970 | 3300025939 | Bacteria | 1649 |
| 341 | Ga0207691_10068532 | 3300025940 | Bacteria | 3205 |
| 342 | Ga0207711_10378447 | 3300025941 | Bacteria | 1313 |
| 343 | Ga0207689_10126335 | 3300025942 | Bacteria | 2104 |
| 344 | Ga0207689_10161033 | 3300025942 | Bacteria | 1849 |
| 345 | Ga0207661_10323747 | 3300025944 | Unclassified | 1386 |
| 346 | Ga0207679_10045086 | 3300025945 | Bacteria | 3187 |
| 347 | Ga0207667_10043411 | 3300025949 | Bacteria | 4771 |
| 348 | Ga0207651_10131712 | 3300025960 | Bacteria | 1915 |
| 349 | Ga0207712_10078488 | 3300025961 | Bacteria | 2396 |
| 350 | Ga0207712_10082165 | 3300025961 | Bacteria | 2348 |
| 351 | Ga0207712_10499441 | 3300025961 | Bacteria | 1040 |
| 352 | Ga0207668_10096569 | 3300025972 | Bacteria | 2185 |
| 353 | Ga0207668_10128671 | 3300025972 | Unclassified | 1930 |
| 354 | Ga0207668_10172902 | 3300025972 | Bacteria | 1696 |
| 355 | Ga0207640_10598187 | 3300025981 | Bacteria | 933 |
| 356 | Ga0207677_10067037 | 3300026023 | Bacteria | 2513 |
| 357 | Ga0207677_10157147 | 3300026023 | Bacteria | 1762 |
| 358 | Ga0207678_10073770 | 3300026067 | Bacteria | 2924 |
| 359 | Ga0207678_10094897 | 3300026067 | Bacteria | 2549 |
| 360 | Ga0207678_10308547 | 3300026067 | Unclassified | 1360 |
| 361 | Ga0207708_10001608 | 3300026075 | Bacteria | 16828 |
| 362 | Ga0207708_10006647 | 3300026075 | Bacteria | 8555 |
| 363 | Ga0207708_10055758 | 3300026075 | Bacteria | 3013 |
| 364 | Ga0207708_10087051 | 3300026075 | Bacteria | 2405 |
| 365 | Ga0207708_10239186 | 3300026075 | Bacteria | 1460 |
| 366 | Ga0207702_10023714 | 3300026078 | Bacteria | 5090 |
| 367 | Ga0207702_10090343 | 3300026078 | Bacteria | 2680 |
| 368 | Ga0207702_10169476 | 3300026078 | Bacteria | 2001 |
| 369 | Ga0207702_10170408 | 3300026078 | Bacteria | 1996 |
| 370 | Ga0207702_10175810 | 3300026078 | Bacteria | 1967 |
| 371 | Ga0207641_10009676 | 3300026088 | Bacteria | 7941 |
| 372 | Ga0207648_10002938 | 3300026089 | Bacteria | 18038 |
| 373 | Ga0207648_10022072 | 3300026089 | Bacteria | 5718 |
| 374 | Ga0207648_10078940 | 3300026089 | Bacteria | 2872 |
| 375 | Ga0207648_10294015 | 3300026089 | Unclassified | 1455 |
| 376 | Ga0207648_10484094 | 3300026089 | Bacteria | 1130 |
| 377 | Ga0207676_10121440 | 3300026095 | Bacteria | 2204 |
| 378 | Ga0207676_10506138 | 3300026095 | Bacteria | 1147 |
| 379 | Ga0207674_10002510 | 3300026116 | Bacteria | 23138 |
| 380 | Ga0207674_10002573 | 3300026116 | Bacteria | 22845 |
| 381 | Ga0207674_10024468 | 3300026116 | Bacteria | 6453 |
| 382 | Ga0207674_10061131 | 3300026116 | Bacteria | 3807 |
| 383 | Ga0207675_100001956 | 3300026118 | Bacteria | 20587 |
| 384 | Ga0207675_100005728 | 3300026118 | Bacteria | 11889 |
| 385 | Ga0207675_100075423 | 3300026118 | Bacteria | 3157 |
| 386 | Ga0207683_10006879 | 3300026121 | Bacteria | 9740 |
| 387 | Ga0207683_10007217 | 3300026121 | Bacteria | 9528 |
| 388 | Ga0207683_10045061 | 3300026121 | Bacteria | 3857 |
| 389 | Ga0207683_10184222 | 3300026121 | Unclassified | 1894 |
| 390 | Ga0207428_10000677 | 3300027907 | Bacteria | 39885 |
| 391 | Ga0207428_10001781 | 3300027907 | Bacteria | 22060 |
| 392 | Ga0207428_10003568 | 3300027907 | Bacteria | 15031 |
| 393 | Ga0207428_10039435 | 3300027907 | Bacteria | 3836 |
| 394 | Ga0207428_10046080 | 3300027907 | Bacteria | 3508 |
| 395 | Ga0268266_10334699 | 3300028379 | Bacteria | 1420 |
| 396 | Ga0268265_10106248 | 3300028380 | Bacteria | 2280 |
| 397 | Ga0268265_10205737 | 3300028380 | Bacteria | 1711 |
| 398 | Ga0268265_10832424 | 3300028380 | Bacteria | 902 |
| 399 | Ga0268264_10048357 | 3300028381 | Bacteria | 3538 |
| 400 | Ga0268264_10154737 | 3300028381 | Bacteria | 2059 |
| 401 | Ga0268264_10218176 | 3300028381 | Bacteria | 1754 |
| 402 | Ga0268264_10324821 | 3300028381 | Unclassified | 1456 |
| 403 | Ga0307405_10127801 | 3300031731 | Bacteria | 1751 |
| 404 | Ga0307405_10150169 | 3300031731 | Unclassified | 1637 |
| 405 | Ga0307413_10441711 | 3300031824 | Bacteria | 1030 |
| 406 | Ga0307416_100100906 | 3300032002 | Unclassified | 2512 |
| 407 | Ga0307415_100370090 | 3300032126 | Unclassified | 1213 |
| 408 | Ga0373948_0049470 | 3300034817 | Bacteria | 900 |
| 409 | Ga0373950_0002657 | 3300034818 | Bacteria | 2482 |
| 410 | Ga0373958_0002312 | 3300034819 | Bacteria | 2656 |
| 411 | Ga0373959_0034270 | 3300034820 | Bacteria | 1039 |
| 412 | Ga0373959_0055272 | 3300034820 | Bacteria | 867 |
| 413 | Ga0373938_0002500 | 3300034957 | Unclassified | 2969 |
| 414 | Ga0373928_0004080 | 3300035084 | Bacteria | 2785 |
| 415 | Ga0373928_0031857 | 3300035084 | Bacteria | 1173 |
| 416 | Ga0373949_0003358 | 3300035090 | Unclassified | 3839 |
| 417 | Ga0373949_0009384 | 3300035090 | Bacteria | 2144 |
| 418 | Ga0373932_0001826 | 3300035112 | Bacteria | 5718 |
| 419 | Ga0373941_0005767 | 3300035115 | Bacteria | 2939 |
| 420 | Ga0373941_0019618 | 3300035115 | Unclassified | 1885 |
| 421 | Ga0373941_0032241 | 3300035115 | Bacteria | 1567 |
| 422 | Ga0373941_0113788 | 3300035115 | Bacteria | 957 |
| 423 | Ga0373960_0005431 | 3300035121 | Bacteria | 2953 |
| 424 | Ga0373960_0016022 | 3300035121 | Bacteria | 1922 |
| 425 | Ga0373960_0017010 | 3300035121 | Bacteria | 1878 |
| 426 | Ga0373943_0008391 | 3300035170 | Bacteria | 4636 |
| 427 | Ga0373946_0018521 | 3300035171 | Bacteria | 2675 |
| 428 | Ga0373942_0037060 | 3300035207 | Bacteria | 1316 |
| 429 | Ga0373942_0052177 | 3300035207 | Bacteria | 1150 |
| 430 | Ga0373961_0005634 | 3300035241 | Unclassified | 3006 |
| 431 | Ga0373962_0013589 | 3300035242 | Unclassified | 2065 |
| 432 | Ga0373931_0014004 | 3300035691 | Unclassified | 3913 |
| 433 | Ga0373931_0112172 | 3300035691 | Unclassified | 1548 |
| 434 | Ga0373931_0113989 | 3300035691 | Bacteria | 1537 |
| 435 | Ga0373947_0002805 | 3300035725 | Bacteria | 10416 |
| 436 | Ga0373925_0016048 | 3300037068 | Bacteria | 5422 |
| 437 | Ga0373925_0022241 | 3300037068 | Bacteria | 4624 |
| 438 | Ga0373925_0235302 | 3300037068 | Bacteria | 1466 |
| 439 | Ga0373925_0311872 | 3300037068 | Unclassified | 1272 |
| 440 | Ga0395899_0003008 | 3300037312 | Bacteria | 13460 |
| 441 | Ga0395899_0027902 | 3300037312 | Bacteria | 4252 |
| 442 | Ga0395899_0035400 | 3300037312 | Unclassified | 3748 |
| 443 | Ga0395899_0036227 | 3300037312 | Bacteria | 3701 |
| 444 | Ga0395899_0138410 | 3300037312 | Bacteria | 1734 |
| 445 | Ga0395899_0272547 | 3300037312 | Bacteria | 1154 |
| 446 | Ga0395899_0308123 | 3300037312 | Bacteria | 1070 |
| 447 | Ga0395900_0002545 | 3300037418 | Bacteria | 19969 |
| 448 | Ga0395900_0004907 | 3300037418 | Bacteria | 14086 |
| 449 | Ga0395900_0016158 | 3300037418 | Bacteria | 7602 |
| 450 | Ga0395900_0016253 | 3300037418 | Bacteria | 7583 |
| 451 | Ga0395900_0053915 | 3300037418 | Bacteria | 4139 |
| 452 | Ga0395900_0107826 | 3300037418 | Bacteria | 2861 |
| 453 | Ga0395900_0179669 | 3300037418 | Bacteria | 2151 |
| 454 | Ga0395900_0315072 | 3300037418 | Bacteria | 1546 |
| 455 | Ga0395900_0377714 | 3300037418 | Bacteria | 1386 |
| 456 | Ga0395900_0414983 | 3300037418 | Bacteria | 1308 |
| 457 | Ga0395900_0489434 | 3300037418 | Bacteria | 1182 |
| 458 | Ga0395898_0002860 | 3300037466 | Bacteria | 19703 |
| 459 | Ga0395898_0004729 | 3300037466 | Bacteria | 14820 |
| 460 | Ga0395898_0008218 | 3300037466 | Bacteria | 11036 |
| 461 | Ga0395898_0013665 | 3300037466 | Bacteria | 8353 |
| 462 | Ga0395898_0131318 | 3300037466 | Bacteria | 2399 |
| 463 | Ga0395898_0596165 | 3300037466 | Bacteria | 1047 |
| 464 | Ga0395905_0003136 | 3300037471 | Bacteria | 17816 |
| 465 | Ga0395905_0004049 | 3300037471 | Bacteria | 15373 |
| 466 | Ga0395905_0033459 | 3300037471 | Bacteria | 4828 |
| 467 | Ga0395905_0049114 | 3300037471 | Unclassified | 3953 |
| 468 | Ga0395905_0102994 | 3300037471 | Bacteria | 2680 |
| 469 | Ga0395905_0395294 | 3300037471 | Bacteria | 1277 |
| 470 | Ga0395905_0536197 | 3300037471 | Bacteria | 1071 |
| 471 | Ga0395905_0550878 | 3300037471 | Bacteria | 1054 |
| 472 | Ga0395905_0697845 | 3300037471 | Unclassified | 917 |
| 473 | Ga0436364_0677119 | 3300037853 | Bacteria | 3871 |
| 474 | Ga0395901_0001407 | 3300038443 | Bacteria | 25117 |
| 475 | Ga0395901_0002611 | 3300038443 | Bacteria | 18245 |
| 476 | Ga0395901_0007150 | 3300038443 | Bacteria | 11268 |
| 477 | Ga0395901_0013743 | 3300038443 | Bacteria | 8229 |
| 478 | Ga0395901_0049334 | 3300038443 | Bacteria | 4373 |
| 479 | Ga0395901_0061347 | 3300038443 | Bacteria | 3912 |
| 480 | Ga0395901_0063344 | 3300038443 | Bacteria | 3848 |
| 481 | Ga0395901_0072010 | 3300038443 | Bacteria | 3602 |
| 482 | Ga0395901_0079798 | 3300038443 | Bacteria | 3416 |
| 483 | Ga0395901_0109293 | 3300038443 | Bacteria | 2903 |
| 484 | Ga0395901_0180697 | 3300038443 | Unclassified | 2213 |
| 485 | Ga0395901_0262999 | 3300038443 | Bacteria | 1795 |
| 486 | Ga0395901_0599276 | 3300038443 | Bacteria | 1111 |
| 487 | Ga0395901_0756359 | 3300038443 | Bacteria | 964 |
| 488 | Ga0242420_023834 | 3300038996 | Bacteria | 1106 |
| 489 | Ga0436365_1193809 | 3300039437 | Bacteria | 7696 |
| 490 | Ga0439450_057375 | 3300042008 | Bacteria | 935 |
| 491 | Ga0439456_022924 | 3300042013 | Bacteria | 1323 |
| 492 | Ga0439435_0072300 | 3300042436 | Bacteria | 1023 |
| 493 | Ga0466966_0210733 | 3300044684 | Unclassified | 1174 |
| 494 | Ga0466964_0041384 | 3300044706 | Bacteria | 1863 |
| 495 | Ga0466959_0015481 | 3300045049 | Bacteria | 5557 |
| 496 | Ga0466959_0189993 | 3300045049 | Bacteria | 1434 |
| 497 | Ga0451576_0017984 | 3300045051 | Bacteria | 7757 |
| 498 | Ga0451576_0120488 | 3300045051 | Bacteria | 2731 |
| 499 | Ga0451576_0594715 | 3300045051 | Bacteria | 1163 |
| 500 | Ga0466967_0021485 | 3300045976 | Bacteria | 5244 |
| 501 | Ga0495603_0003521 | 3300046455 | Bacteria | 9320 |
| 502 | Ga0495603_0246200 | 3300046455 | Unclassified | 1029 |
| 503 | Ga0495629_0001783 | 3300046459 | Bacteria | 16883 |
| 504 | Ga0495641_0001752 | 3300046461 | Bacteria | 18080 |
| 505 | Ga0495641_0066965 | 3300046461 | Bacteria | 1615 |
| 506 | Ga0495580_0024717 | 3300046472 | Bacteria | 4395 |
| 507 | Ga0495582_0000046 | 3300046473 | Bacteria | 62677 |
| 508 | Ga0495582_0023121 | 3300046473 | Bacteria | 3400 |
| 509 | Ga0495605_0150702 | 3300046474 | Unclassified | 1038 |
| 510 | Ga0495639_0010832 | 3300046475 | Bacteria | 3927 |
| 511 | Ga0495584_0019832 | 3300046491 | Bacteria | 3416 |
| 512 | Ga0495585_0251073 | 3300046492 | Unclassified | 883 |
| 513 | Ga0495594_0005092 | 3300046499 | Bacteria | 6765 |
| 514 | Ga0495596_0026310 | 3300046500 | Bacteria | 2346 |
| 515 | Ga0495607_0082757 | 3300046501 | Bacteria | 1760 |
| 516 | Ga0495607_0178103 | 3300046501 | Bacteria | 1068 |
| 517 | Ga0495630_0015682 | 3300046517 | Bacteria | 5537 |
| 518 | Ga0495630_0037841 | 3300046517 | Bacteria | 3608 |
| 519 | Ga0495631_0025017 | 3300046518 | Bacteria | 2752 |
| 520 | Ga0495637_0072285 | 3300046520 | Bacteria | 1389 |
| 521 | Ga0495637_0164808 | 3300046520 | Bacteria | 829 |
| 522 | Ga0495644_0033168 | 3300046523 | Bacteria | 1951 |
| 523 | Ga0495644_0102308 | 3300046523 | Bacteria | 1084 |
| 524 | Ga0495663_0009180 | 3300046525 | Unclassified | 2742 |
| 525 | Ga0495663_0036935 | 3300046525 | Bacteria | 1472 |
| 526 | Ga0495666_0098231 | 3300046526 | Unclassified | 1381 |
| 527 | Ga0495666_0152401 | 3300046526 | Bacteria | 1074 |
| 528 | Ga0495642_0027367 | 3300046528 | Bacteria | 2269 |
| 529 | Ga0495642_0139042 | 3300046528 | Bacteria | 1048 |
| 530 | Ga0495665_0088732 | 3300046531 | Bacteria | 1625 |
| 531 | Ga0495665_0089737 | 3300046531 | Bacteria | 1615 |
| 532 | Ga0495667_0066513 | 3300046559 | Bacteria | 2356 |
| 533 | Ga0495656_0017822 | 3300046615 | Bacteria | 2716 |
| 534 | Ga0495656_0263096 | 3300046615 | Unclassified | 874 |
| 535 | Ga0495656_0304640 | 3300046615 | Bacteria | 817 |
| 536 | Ga0495659_0068575 | 3300046664 | Bacteria | 1325 |
| 537 | Ga0495588_0001448 | 3300046674 | Bacteria | 10166 |
| 538 | Ga0495588_0116517 | 3300046674 | Unclassified | 1408 |
| 539 | Ga0495658_0000392 | 3300046683 | Bacteria | 24645 |
| 540 | Ga0495658_0020824 | 3300046683 | Bacteria | 3449 |
| 541 | Ga0495658_0256497 | 3300046683 | Bacteria | 1100 |
| 542 | Ga0495658_0413318 | 3300046683 | Bacteria | 860 |
| 543 | Ga0495613_0000466 | 3300046689 | Bacteria | 34644 |
| 544 | Ga0495613_0277176 | 3300046689 | Bacteria | 1165 |
| 545 | Ga0495670_0130212 | 3300046691 | Bacteria | 1311 |
| 546 | Ga0495589_0019725 | 3300046794 | Bacteria | 3451 |
| 547 | Ga0495589_0098219 | 3300046794 | Unclassified | 1418 |
| 548 | Ga0495581_0003492 | 3300047315 | Bacteria | 9025 |
| 549 | Ga0495672_0018007 | 3300047320 | Bacteria | 4705 |
| 550 | Ga0495676_0013741 | 3300047321 | Bacteria | 7263 |
| 551 | Ga0495676_0020917 | 3300047321 | Bacteria | 5729 |
| 552 | Ga0495676_0028913 | 3300047321 | Bacteria | 4726 |
| 553 | Ga0495676_0338886 | 3300047321 | Unclassified | 1007 |
| 554 | Ga0495685_075506 | 3300047447 | Unclassified | 1126 |
| 555 | Ga0495614_0008400 | 3300048089 | Bacteria | 4593 |
| 556 | Ga0495615_0046162 | 3300048090 | Unclassified | 1106 |
| 557 | Ga0496100_0009969 | 3300048903 | Bacteria | 5361 |
| 558 | Ga0496100_0038687 | 3300048903 | Bacteria | 3024 |
| 559 | Ga0496100_0102223 | 3300048903 | Unclassified | 1977 |
| 560 | Ga0496100_0133585 | 3300048903 | Unclassified | 1751 |
| 561 | Ga0496100_0242387 | 3300048903 | Bacteria | 1331 |
| 562 | Ga0496100_0484665 | 3300048903 | Bacteria | 951 |
| 563 | Ga0496101_0003207 | 3300048904 | Bacteria | 10145 |
| 564 | Ga0496101_0007809 | 3300048904 | Bacteria | 6955 |
| 565 | Ga0496101_0033934 | 3300048904 | Bacteria | 3603 |
| 566 | Ga0496101_0061592 | 3300048904 | Bacteria | 2726 |
| 567 | Ga0496101_0064839 | 3300048904 | Bacteria | 2662 |
| 568 | Ga0496101_0177446 | 3300048904 | Bacteria | 1639 |
| 569 | Ga0496101_0214939 | 3300048904 | Bacteria | 1491 |
| 570 | Ga0496101_0274906 | 3300048904 | Unclassified | 1315 |
| 571 | Ga0496102_0021593 | 3300048905 | Bacteria | 5694 |
| 572 | Ga0496102_0054480 | 3300048905 | Unclassified | 3647 |
| 573 | Ga0496102_0113109 | 3300048905 | Bacteria | 2532 |
| 574 | Ga0496102_0114292 | 3300048905 | Bacteria | 2518 |
| 575 | Ga0496102_0167333 | 3300048905 | Bacteria | 2069 |
| 576 | Ga0496102_0217841 | 3300048905 | Bacteria | 1799 |
| 577 | Ga0496103_0010233 | 3300048906 | Bacteria | 5548 |
| 578 | Ga0496103_0047946 | 3300048906 | Bacteria | 2640 |
| 579 | Ga0496104_0007945 | 3300048907 | Bacteria | 9407 |
| 580 | Ga0496104_0050672 | 3300048907 | Bacteria | 3917 |
| 581 | Ga0496104_0079265 | 3300048907 | Bacteria | 3130 |
| 582 | Ga0496104_0093148 | 3300048907 | Unclassified | 2881 |
| 583 | Ga0496105_0001914 | 3300048908 | Bacteria | 14954 |
| 584 | Ga0496105_0016257 | 3300048908 | Bacteria | 5938 |
| 585 | Ga0496105_0017456 | 3300048908 | Bacteria | 5756 |
| 586 | Ga0496105_0039033 | 3300048908 | Bacteria | 3912 |
| 587 | Ga0496106_0009322 | 3300048909 | Bacteria | 7256 |
| 588 | Ga0496106_0028534 | 3300048909 | Bacteria | 4157 |
| 589 | Ga0496106_0084186 | 3300048909 | Unclassified | 2447 |
| 590 | Ga0496107_0005857 | 3300048910 | Bacteria | 8414 |
| 591 | Ga0496107_0030422 | 3300048910 | Bacteria | 3848 |
| 592 | Ga0496107_0043111 | 3300048910 | Bacteria | 3241 |
| 593 | Ga0496107_0228138 | 3300048910 | Unclassified | 1385 |
| 594 | Ga0496107_0333178 | 3300048910 | Unclassified | 1129 |
| 595 | Ga0496108_0002151 | 3300048911 | Bacteria | 15780 |
| 596 | Ga0496108_0015849 | 3300048911 | Bacteria | 6144 |
| 597 | Ga0496108_0067015 | 3300048911 | Bacteria | 3028 |
| 598 | Ga0496109_0008507 | 3300048912 | Bacteria | 8725 |
| 599 | Ga0496109_0016026 | 3300048912 | Bacteria | 6550 |
| 600 | Ga0496109_0025127 | 3300048912 | Bacteria | 5305 |
| 601 | Ga0496109_0039594 | 3300048912 | Bacteria | 4267 |
| 602 | Ga0496109_0044581 | 3300048912 | Bacteria | 4023 |
| 603 | Ga0496109_0044829 | 3300048912 | Bacteria | 4012 |
| 604 | Ga0496109_0049293 | 3300048912 | Bacteria | 3833 |
| 605 | Ga0496109_0110512 | 3300048912 | Bacteria | 2555 |
| 606 | Ga0496109_0158195 | 3300048912 | Bacteria | 2122 |
| 607 | Ga0496109_0375837 | 3300048912 | Bacteria | 1342 |
| 608 | Ga0496109_0539739 | 3300048912 | Bacteria | 1100 |
| 609 | Ga0496110_0008459 | 3300048913 | Bacteria | 8282 |
| 610 | Ga0496110_0010897 | 3300048913 | Bacteria | 7412 |
| 611 | Ga0496110_0011941 | 3300048913 | Bacteria | 7135 |
| 612 | Ga0496110_0028852 | 3300048913 | Bacteria | 4769 |
| 613 | Ga0496110_0060301 | 3300048913 | Unclassified | 3345 |
| 614 | Ga0496110_0083846 | 3300048913 | Bacteria | 2844 |
| 615 | Ga0496110_0211487 | 3300048913 | Unclassified | 1763 |
| 616 | Ga0496110_0259534 | 3300048913 | Bacteria | 1581 |
| 617 | Ga0496110_0814370 | 3300048913 | Unclassified | 838 |
| 618 | Ga0496111_0000412 | 3300048914 | Bacteria | 21482 |
| 619 | Ga0496111_0002040 | 3300048914 | Bacteria | 12017 |
| 620 | Ga0496111_0003390 | 3300048914 | Bacteria | 9853 |
| 621 | Ga0496111_0006871 | 3300048914 | Bacteria | 7426 |
| 622 | Ga0496111_0050907 | 3300048914 | Bacteria | 2989 |
| 623 | Ga0496111_0153618 | 3300048914 | Bacteria | 1708 |
| 624 | Ga0496111_0179655 | 3300048914 | Unclassified | 1573 |
| 625 | Ga0496112_0017997 | 3300048915 | Bacteria | 6649 |
| 626 | Ga0496112_0027781 | 3300048915 | Bacteria | 5457 |
| 627 | Ga0496112_0038723 | 3300048915 | Bacteria | 4657 |
| 628 | Ga0496112_0044930 | 3300048915 | Bacteria | 4329 |
| 629 | Ga0496112_0294698 | 3300048915 | Bacteria | 1568 |
| 630 | Ga0496112_0390919 | 3300048915 | Bacteria | 1331 |
| 631 | Ga0496113_0003830 | 3300048916 | Bacteria | 9101 |
| 632 | Ga0496113_0011816 | 3300048916 | Bacteria | 5849 |
| 633 | Ga0496113_0015551 | 3300048916 | Bacteria | 5235 |
| 634 | Ga0496113_0018202 | 3300048916 | Bacteria | 4891 |
| 635 | Ga0496113_0284703 | 3300048916 | Bacteria | 1322 |
| 636 | Ga0496113_0389657 | 3300048916 | Bacteria | 1118 |
| 637 | Ga0496113_0392941 | 3300048916 | Unclassified | 1113 |
| 638 | Ga0496114_0032611 | 3300048917 | Bacteria | 4288 |
| 639 | Ga0496114_0032959 | 3300048917 | Bacteria | 4266 |
| 640 | Ga0496114_0220339 | 3300048917 | Unclassified | 1665 |
| 641 | Ga0496114_0231540 | 3300048917 | Bacteria | 1623 |
| 642 | Ga0496114_0295584 | 3300048917 | Bacteria | 1429 |
| 643 | Ga0496115_0015970 | 3300048918 | Bacteria | 5708 |
| 644 | Ga0496115_0025433 | 3300048918 | Bacteria | 4608 |
| 645 | Ga0496115_0071383 | 3300048918 | Bacteria | 2816 |
| 646 | Ga0501031_0000110 | 3300049568 | Bacteria | 43369 |
| 647 | Ga0501031_0002523 | 3300049568 | Bacteria | 11655 |
| 648 | Ga0501031_0241417 | 3300049568 | Bacteria | 1174 |
| 649 | Ga0501032_0002808 | 3300049569 | Bacteria | 13538 |
| 650 | Ga0501033_0012655 | 3300049570 | Bacteria | 6435 |
| 651 | Ga0501033_0051916 | 3300049570 | Bacteria | 3039 |
| 652 | Ga0501034_0014796 | 3300049571 | Bacteria | 8028 |
| 653 | Ga0501034_0039823 | 3300049571 | Bacteria | 4759 |
| 654 | Ga0501036_0000848 | 3300049572 | Bacteria | 22769 |
| 655 | Ga0501036_0059348 | 3300049572 | Bacteria | 3241 |
| 656 | Ga0501037_0001347 | 3300049573 | Bacteria | 18047 |
| 657 | Ga0501037_0002198 | 3300049573 | Bacteria | 14096 |
| 658 | Ga0501037_0023626 | 3300049573 | Bacteria | 4545 |
| 659 | Ga0501037_0115338 | 3300049573 | Bacteria | 1933 |
| 660 | Ga0501038_0000237 | 3300049574 | Bacteria | 46387 |
| 661 | Ga0501038_0003056 | 3300049574 | Bacteria | 15605 |
| 662 | Ga0501038_0040534 | 3300049574 | Bacteria | 4066 |
| 663 | Ga0501038_0175405 | 3300049574 | Bacteria | 1732 |
| 664 | Ga0501039_0000285 | 3300049575 | Bacteria | 36222 |
| 665 | Ga0501039_0020218 | 3300049575 | Bacteria | 5104 |
| 666 | Ga0501039_0034948 | 3300049575 | Bacteria | 3879 |
| 667 | Ga0501040_0000576 | 3300049576 | Bacteria | 22338 |
| 668 | Ga0501040_0002203 | 3300049576 | Bacteria | 12542 |
| 669 | Ga0501040_0037258 | 3300049576 | Bacteria | 3303 |
| 670 | Ga0501040_0065544 | 3300049576 | Bacteria | 2501 |
| 671 | Ga0501040_0104439 | 3300049576 | Bacteria | 1979 |
| 672 | Ga0501040_0251674 | 3300049576 | Bacteria | 1260 |
| 673 | Ga0501041_0001246 | 3300049577 | Bacteria | 13952 |
| 674 | Ga0501041_0007464 | 3300049577 | Bacteria | 6417 |
| 675 | Ga0501041_0084237 | 3300049577 | Bacteria | 1959 |
| 676 | Ga0501042_0000013 | 3300049578 | Bacteria | 53996 |
| 677 | Ga0501042_0015921 | 3300049578 | Bacteria | 5156 |
| 678 | Ga0501042_0113119 | 3300049578 | Bacteria | 1954 |
| 679 | Ga0501042_0274373 | 3300049578 | Unclassified | 1217 |
| 680 | Ga0501043_0001144 | 3300049579 | Bacteria | 23348 |
| 681 | Ga0501043_0020340 | 3300049579 | Bacteria | 5206 |
| 682 | Ga0501043_0038719 | 3300049579 | Bacteria | 3749 |
| 683 | Ga0501043_0044465 | 3300049579 | Bacteria | 3492 |
| 684 | Ga0501046_0001149 | 3300049580 | Bacteria | 25728 |
| 685 | Ga0501046_0007119 | 3300049580 | Bacteria | 9841 |
| 686 | Ga0501046_0032829 | 3300049580 | Bacteria | 4199 |
| 687 | Ga0501046_0068158 | 3300049580 | Bacteria | 2769 |
| 688 | Ga0501046_0329069 | 3300049580 | Bacteria | 1112 |
| 689 | Ga0501047_0000927 | 3300049581 | Bacteria | 29952 |
| 690 | Ga0501048_0000042 | 3300049582 | Bacteria | 62023 |
| 691 | Ga0501048_0006175 | 3300049582 | Bacteria | 9118 |
| 692 | Ga0501048_0072605 | 3300049582 | Bacteria | 2429 |
| 693 | Ga0501048_0201043 | 3300049582 | Bacteria | 1412 |
| 694 | Ga0501067_0003510 | 3300049583 | Bacteria | 8622 |
| 695 | Ga0501067_0023275 | 3300049583 | Bacteria | 3433 |
| 696 | Ga0501068_0000199 | 3300049584 | Bacteria | 28546 |
| 697 | Ga0501068_0034378 | 3300049584 | Bacteria | 3022 |
| 698 | Ga0501068_0041296 | 3300049584 | Bacteria | 2771 |
| 699 | Ga0501068_0042859 | 3300049584 | Bacteria | 2721 |
| 700 | Ga0501069_0001814 | 3300049585 | Bacteria | 10677 |
| 701 | Ga0501069_0095963 | 3300049585 | Bacteria | 1679 |
| 702 | Ga0501070_0005526 | 3300049586 | Bacteria | 10780 |
| 703 | Ga0501070_0009629 | 3300049586 | Bacteria | 8165 |
| 704 | Ga0501071_0000384 | 3300049587 | Bacteria | 21781 |
| 705 | Ga0501071_0111562 | 3300049587 | Unclassified | 2021 |
| 706 | Ga0501071_0203756 | 3300049587 | Bacteria | 1486 |
| 707 | Ga0501071_0527894 | 3300049587 | Unclassified | 906 |
| 708 | Ga0501072_0002936 | 3300049588 | Bacteria | 12825 |
| 709 | Ga0501072_0017435 | 3300049588 | Bacteria | 5516 |
| 710 | Ga0501072_0030419 | 3300049588 | Bacteria | 4222 |
| 711 | Ga0501072_0110375 | 3300049588 | Unclassified | 2189 |
| 712 | Ga0501072_0206107 | 3300049588 | Bacteria | 1568 |
| 713 | Ga0501073_0001106 | 3300049589 | Bacteria | 19561 |
| 714 | Ga0501073_0025007 | 3300049589 | Bacteria | 4285 |
| 715 | Ga0501073_0166853 | 3300049589 | Bacteria | 1524 |
| 716 | Ga0501074_0008119 | 3300049590 | Bacteria | 7606 |
| 717 | Ga0501074_0080429 | 3300049590 | Bacteria | 2338 |
| 718 | Ga0501074_0196311 | 3300049590 | Bacteria | 1438 |
| 719 | Ga0501074_0216240 | 3300049590 | Bacteria | 1365 |
| 720 | Ga0501075_0000032 | 3300049591 | Bacteria | 56088 |
| 721 | Ga0501075_0026946 | 3300049591 | Bacteria | 4233 |
| 722 | Ga0501075_0027117 | 3300049591 | Bacteria | 4220 |
| 723 | Ga0501075_0064142 | 3300049591 | Bacteria | 2770 |
| 724 | Ga0501076_0001224 | 3300049592 | Bacteria | 17055 |
| 725 | Ga0501076_0058833 | 3300049592 | Unclassified | 3055 |
| 726 | Ga0501076_0093765 | 3300049592 | Bacteria | 2416 |
| 727 | Ga0501077_0002257 | 3300049593 | Bacteria | 11624 |
| 728 | Ga0501077_0006095 | 3300049593 | Bacteria | 7359 |
| 729 | Ga0501077_0021209 | 3300049593 | Bacteria | 4111 |
| 730 | Ga0501077_0038619 | 3300049593 | Bacteria | 3041 |
| 731 | Ga0501077_0149880 | 3300049593 | Bacteria | 1480 |
| 732 | Ga0501077_0155745 | 3300049593 | Bacteria | 1450 |
| 733 | Ga0501077_0202952 | 3300049593 | Bacteria | 1259 |
| 734 | Ga0501249_065184 | 3300049679 | Bacteria | 847 |
| 735 | Ga0501079_0000096 | 3300049741 | Bacteria | 43720 |
| 736 | Ga0501079_0001183 | 3300049741 | Bacteria | 18298 |
| 737 | Ga0501079_0014139 | 3300049741 | Bacteria | 6083 |
| 738 | Ga0501079_0137930 | 3300049741 | Bacteria | 1899 |
| 739 | Ga0501079_0641460 | 3300049741 | Bacteria | 836 |
| 740 | Ga0501080_0000105 | 3300049742 | Bacteria | 57665 |
| 741 | Ga0501080_0035887 | 3300049742 | Bacteria | 4628 |
| 742 | Ga0501080_0345802 | 3300049742 | Bacteria | 1343 |
| 743 | Ga0501080_0663494 | 3300049742 | Unclassified | 922 |
| 744 | Ga0501081_0000180 | 3300049743 | Bacteria | 30061 |
| 745 | Ga0501081_0010256 | 3300049743 | Bacteria | 6116 |
| 746 | Ga0501081_0019424 | 3300049743 | Bacteria | 4525 |
| 747 | Ga0501081_0025883 | 3300049743 | Bacteria | 3951 |
| 748 | Ga0501081_0036374 | 3300049743 | Bacteria | 3357 |
| 749 | Ga0501081_0163996 | 3300049743 | Bacteria | 1602 |
| 750 | Ga0501081_0343629 | 3300049743 | Bacteria | 1099 |
| 751 | Ga0501081_0434632 | 3300049743 | Bacteria | 974 |
| 752 | Ga0501083_0000081 | 3300049744 | Bacteria | 64501 |
| 753 | Ga0501083_0006567 | 3300049744 | Bacteria | 8253 |
| 754 | Ga0501035_0001604 | 3300049822 | Bacteria | 22883 |
| 755 | Ga0501035_0005200 | 3300049822 | Bacteria | 12314 |
| 756 | Ga0501035_0212790 | 3300049822 | Bacteria | 1653 |
| 757 | Ga0501044_0025046 | 3300049823 | Bacteria | 6327 |
| 758 | Ga0501044_0050811 | 3300049823 | Bacteria | 4277 |
| 759 | Ga0501044_0190642 | 3300049823 | Bacteria | 2013 |
| 760 | Ga0501045_0000194 | 3300049824 | Bacteria | 34373 |
| 761 | Ga0501045_0014884 | 3300049824 | Bacteria | 5517 |
| 762 | Ga0501045_0056197 | 3300049824 | Bacteria | 2878 |
| 763 | Ga0501045_0057695 | 3300049824 | Bacteria | 2841 |
| 764 | Ga0501045_0075235 | 3300049824 | Bacteria | 2487 |
| 765 | nmdc:mga00v17_46279_c1 | 3300050491 | Bacteria | 2632 |
| 766 | nmdc:mga0yw44_202250_c1 | 3300050492 | Bacteria | 1312 |
| 767 | nmdc:mga05p37_23774_c1 | 3300050507 | Bacteria | 3660 |
| 768 | nmdc:mga05p37_248416_c1 | 3300050507 | Bacteria | 2135 |
| 769 | nmdc:mga05p37_516917_c1 | 3300050507 | Bacteria | 1367 |
| 770 | nmdc:mga05p37_782_c1 | 3300050507 | Bacteria | 35364 |
| 771 | nmdc:mga05p37_8278_c1 | 3300050507 | Bacteria | 12297 |
| 772 | nmdc:mga05p37_91832_c1 | 3300050507 | Bacteria | 3741 |
| 773 | nmdc:mga09592_3984_c1 | 3300050508 | Bacteria | 11899 |
| 774 | nmdc:mga09592_93624_c1 | 3300050508 | Bacteria | 2570 |
| 775 | nmdc:mga0qj67_113371_c1 | 3300050509 | Bacteria | 2189 |
| 776 | nmdc:mga0qj67_128029_c1 | 3300050509 | Bacteria | 2055 |
| 777 | nmdc:mga0qj67_241436_c1 | 3300050509 | Bacteria | 1466 |
| 778 | nmdc:mga0qj67_25424_c1 | 3300050509 | Bacteria | 4575 |
| 779 | nmdc:mga0qj67_36354_c1 | 3300050509 | Bacteria | 3852 |
| 780 | nmdc:mga0qj67_75828_c1 | 3300050509 | Bacteria | 2689 |
| 781 | nmdc:mga06r32_101759_c1 | 3300050510 | Bacteria | 2820 |
| 782 | nmdc:mga06r32_285921_c1 | 3300050510 | Bacteria | 1636 |
| 783 | nmdc:mga06r32_6240_c1 | 3300050510 | Bacteria | 10700 |
| 784 | nmdc:mga06r32_701346_c1 | 3300050510 | Bacteria | 978 |
| 785 | nmdc:mga08y16_46277_c1 | 3300050511 | Bacteria | 4555 |
| 786 | nmdc:mga08y16_470585_c1 | 3300050511 | Bacteria | 1280 |
| 787 | nmdc:mga08y16_54942_c1 | 3300050511 | Bacteria | 4162 |
| 788 | nmdc:mga08y16_6329_c1 | 3300050511 | Bacteria | 12416 |
| 789 | nmdc:mga08y16_736813_c1 | 3300050511 | Bacteria | 983 |
| 790 | nmdc:mga0n895_148945_c1 | 3300050512 | Bacteria | 2370 |
| 791 | nmdc:mga0n895_298364_c1 | 3300050512 | Bacteria | 1634 |
| 792 | nmdc:mga0n895_359870_c1 | 3300050512 | Bacteria | 1474 |
| 793 | nmdc:mga0n895_51598_c1 | 3300050512 | Bacteria | 4035 |
| 794 | nmdc:mga0n895_54468_c1 | 3300050512 | Unclassified | 3935 |
| 795 | nmdc:mga0n895_5857_c1 | 3300050512 | Bacteria | 10333 |
| 796 | nmdc:mga0rr50_130036_c1 | 3300050513 | Bacteria | 2015 |
| 797 | nmdc:mga0rr50_15083_c1 | 3300050513 | Bacteria | 5093 |
| 798 | nmdc:mga0rr50_22100_c1 | 3300050513 | Bacteria | 4359 |
| 799 | nmdc:mga0rr50_233129_c1 | 3300050513 | Bacteria | 1524 |
| 800 | nmdc:mga0rr50_43734_c1 | 3300050513 | Bacteria | 3281 |
| 801 | nmdc:mga08x19_14698_c1 | 3300050514 | Bacteria | 4754 |
| 802 | nmdc:mga08x19_16604_c2 | 3300050514 | Bacteria | 1813 |
| 803 | nmdc:mga08x19_345218_c1 | 3300050514 | Bacteria | 1039 |
| 804 | nmdc:mga08x19_6908_c1 | 3300050514 | Bacteria | 6741 |
| 805 | nmdc:mga0a205_113418_c1 | 3300050515 | Bacteria | 2610 |
| 806 | nmdc:mga0a205_12986_c1 | 3300050515 | Bacteria | 7732 |
| 807 | nmdc:mga0a205_82931_c1 | 3300050515 | Bacteria | 3097 |
| 808 | Ga0495601_0073853 | 3300053077 | Bacteria | 2181 |
| 809 | Ga0495655_0070373 | 3300053083 | Unclassified | 977 |
| 810 | Ga0495595_0197559 | 3300053084 | Bacteria | 1001 |
| 811 | Ga0501084_0000642 | 3300054114 | Bacteria | 26592 |
| 812 | Ga0501084_0004452 | 3300054114 | Bacteria | 11438 |
| 813 | Ga0501084_0032360 | 3300054114 | Bacteria | 4374 |
| 814 | Ga0501084_0157177 | 3300054114 | Bacteria | 1918 |
| 815 | Ga0501082_0001914 | 3300060353 | Bacteria | 18294 |
| 816 | Ga0501082_0002192 | 3300060353 | Bacteria | 17101 |
| 817 | Ga0501082_0062260 | 3300060353 | Bacteria | 3211 |
| 818 | Ga0501082_0091118 | 3300060353 | Bacteria | 2632 |
| 819 | Ga0501082_0100973 | 3300060353 | Bacteria | 2495 |
| 820 | Ga0501082_0101986 | 3300060353 | Bacteria | 2483 |
| 821 | Ga0501082_0204282 | 3300060353 | Unclassified | 1719 |
| 822 | Ga0501082_0232802 | 3300060353 | Bacteria | 1603 |
| 823 | Ga0530510_0001349 | 3300061734 | Bacteria | 16423 |
| 824 | Ga0530510_0003318 | 3300061734 | Bacteria | 11072 |
| 825 | Ga0530510_0009789 | 3300061734 | Bacteria | 6726 |
| 826 | Ga0530510_0031808 | 3300061734 | Bacteria | 3794 |
| 827 | Ga0530510_0072226 | 3300061734 | Bacteria | 2504 |
| 828 | Ga0530510_0072382 | 3300061734 | Bacteria | 2501 |
| 829 | Ga0501032_0266365 | |||
| 830 | JGI24751J29686_10000700 | |||
| 831 | JGI25407J50210_10002835 | |||
| 832 | Ga0070676_10149857 | |||
| 833 | Ga0070683_100044810 | |||
| 834 | Ga0070683_100100193 | |||
| 835 | Ga0070690_100047913 | |||
| 836 | Ga0070690_100109945 | |||
| 837 | Ga0070670_100689956 | |||
| 838 | Ga0070677_10045842 | |||
| 839 | Ga0068869_100095873 | |||
| 840 | Ga0070680_100071905 | |||
| 841 | Ga0070682_100064611 | |||
| 842 | Ga0068868_100168965 | |||
| 843 | Ga0070660_100404882 | |||
| 844 | Ga0070689_100210873 | |||
| 845 | Ga0070691_10011801 | |||
| 846 | Ga0070687_100117925 | |||
| 847 | Ga0070661_100013685 | |||
| 848 | Ga0070661_100094597 | |||
| 849 | Ga0070692_10032084 | |||
| 850 | Ga0070692_10162161 | |||
| 851 | Ga0070668_100055241 | |||
| 852 | Ga0070668_100232903 | |||
| 853 | Ga0070669_100048987 | |||
| 854 | Ga0070675_100026048 | |||
| 855 | Ga0070675_100770916 | |||
| 856 | Ga0070671_100064736 | |||
| 857 | Ga0070673_100146019 | |||
| 858 | Ga0070688_100006481 | |||
| 859 | Ga0070659_100402659 | |||
| 860 | Ga0070667_100174377 | |||
| 861 | Ga0070703_10011929 | |||
| 862 | Ga0070709_10109500 | |||
| 863 | Ga0070714_100032783 | |||
| 864 | Ga0070713_100092946 | |||
| 865 | Ga0070710_10029427 | |||
| 866 | Ga0070710_10059018 | |||
| 867 | Ga0070710_10127993 | |||
| 868 | Ga0070701_10011678 | |||
| 869 | Ga0070701_10086611 | |||
| 870 | Ga0070701_10285324 | |||
| 871 | Ga0070711_100037538 | |||
| 872 | Ga0070705_100015924 | |||
| 873 | Ga0070705_100032998 | |||
| 874 | Ga0070705_100082675 | |||
| 875 | Ga0070700_100018370 | |||
| 876 | Ga0070700_100020942 | |||
| 877 | Ga0070700_100041153 | |||
| 878 | Ga0070700_100216507 | |||
| 879 | Ga0070694_100095759 | |||
| 880 | Ga0070694_100187991 | |||
| 881 | Ga0070694_100208461 | |||
| 882 | Ga0070694_100267670 | |||
| 883 | Ga0070708_100035691 | |||
| 884 | Ga0070708_100046365 | |||
| 885 | Ga0070708_100077637 | |||
| 886 | Ga0070708_100408808 | |||
| 887 | Ga0070663_100186509 | |||
| 888 | Ga0070663_100187611 | |||
| 889 | Ga0070663_100208962 | |||
| 890 | Ga0070663_100553567 | |||
| 891 | Ga0070678_100020914 | |||
| 892 | Ga0070678_100038279 | |||
| 893 | Ga0070678_100235770 | |||
| 894 | Ga0070706_100069253 | |||
| 895 | Ga0070706_100080458 | |||
| 896 | Ga0070706_100143031 | |||
| 897 | Ga0070706_100177515 | |||
| 898 | Ga0070707_100001269 | |||
| 899 | Ga0070707_100005768 | |||
| 900 | Ga0070707_100063543 | |||
| 901 | Ga0070707_100548942 | |||
| 902 | Ga0070707_100549987 | |||
| 903 | Ga0070698_100013492 | |||
| 904 | Ga0070698_100015114 | |||
| 905 | Ga0070698_100050879 | |||
| 906 | Ga0070698_100149148 | |||
| 907 | Ga0070698_100237995 | |||
| 908 | Ga0070699_100008164 | |||
| 909 | Ga0070699_100017455 | |||
| 910 | Ga0070699_100062894 | |||
| 911 | Ga0070699_100113585 | |||
| 912 | Ga0070679_100002322 | |||
| 913 | Ga0070679_100357076 | |||
| 914 | Ga0070684_100001333 | |||
| 915 | Ga0070684_100023606 | |||
| 916 | Ga0070684_100238387 | |||
| 917 | Ga0070697_100335315 | |||
| 918 | Ga0068853_100186390 | |||
| 919 | Ga0070672_100073290 | |||
| 920 | Ga0070686_100023802 | |||
| 921 | Ga0070686_100058111 | |||
| 922 | Ga0070695_100247655 | |||
| 923 | Ga0070695_100286999 | |||
| 924 | Ga0070696_100016581 | |||
| 925 | Ga0070696_100129979 | |||
| 926 | Ga0070696_100130198 | |||
| 927 | Ga0070696_100377539 | |||
| 928 | Ga0070693_100000985 | |||
| 929 | Ga0070693_100049896 | |||
| 930 | Ga0070693_100109006 | |||
| 931 | Ga0070704_100403854 | |||
| 932 | Ga0068855_100037605 | |||
| 933 | Ga0068855_100545613 | |||
| 934 | Ga0068855_100755280 | |||
| 935 | Ga0070664_100040186 | |||
| 936 | Ga0070664_100291863 | |||
| 937 | Ga0070664_100414415 | |||
| 938 | Ga0068857_100008660 | |||
| 939 | Ga0068857_100106533 | |||
| 940 | Ga0068857_100163784 | |||
| 941 | Ga0068857_100401434 | |||
| 942 | Ga0068854_100176424 | |||
| 943 | Ga0068856_100049450 | |||
| 944 | Ga0068856_100077950 | |||
| 945 | Ga0068856_100125130 | |||
| 946 | Ga0068856_100129730 | |||
| 947 | Ga0070702_100017566 | |||
| 948 | Ga0070702_100038165 | |||
| 949 | Ga0070702_100243752 | |||
| 950 | Ga0070702_100527757 | |||
| 951 | Ga0068852_100148632 | |||
| 952 | Ga0068852_100224010 | |||
| 953 | Ga0068859_100018378 | |||
| 954 | Ga0068864_100010882 | |||
| 955 | Ga0068864_100171340 | |||
| 956 | Ga0068864_100454207 | |||
| 957 | Ga0068866_10100334 | |||
| 958 | Ga0068866_10242894 | |||
| 959 | Ga0068861_100010653 | |||
| 960 | Ga0068861_100099612 | |||
| 961 | Ga0068851_10119004 | |||
| 962 | Ga0068870_10003709 | |||
| 963 | Ga0068863_100095332 | |||
| 964 | Ga0068858_100241069 | |||
| 965 | Ga0068860_100116180 | |||
| 966 | Ga0068860_100132309 | |||
| 967 | Ga0068862_100294877 | |||
| 968 | Ga0068862_100315427 | |||
| 969 | Ga0081455_10005485 | |||
| 970 | Ga0081455_10005503 | |||
| 971 | Ga0081455_10025164 | |||
| 972 | Ga0081455_10038422 | |||
| 973 | Ga0081455_10048335 | |||
| 974 | Ga0081538_10000089 | |||
| 975 | Ga0081538_10000245 | |||
| 976 | Ga0081538_10001308 | |||
| 977 | Ga0081538_10001549 | |||
| 978 | Ga0081538_10001642 | |||
| 979 | Ga0081538_10014744 | |||
| 980 | Ga0081538_10016976 | |||
| 981 | Ga0081538_10019498 | |||
| 982 | Ga0081540_1004845 | |||
| 983 | Ga0081539_10002069 | |||
| 984 | Ga0081539_10003486 | |||
| 985 | Ga0081539_10102143 | |||
| 986 | Ga0070717_10112606 | |||
| 987 | Ga0075365_10155832 | |||
| 988 | Ga0075365_10193739 | |||
| 989 | Ga0075364_10420708 | |||
| 990 | Ga0075432_10005739 | |||
| 991 | Ga0075432_10009868 | |||
| 992 | Ga0075432_10047443 | |||
| 993 | Ga0070715_10003344 | |||
| 994 | Ga0070715_10007785 | |||
| 995 | Ga0070715_10012797 | |||
| 996 | Ga0070715_10069632 | |||
| 997 | Ga0070716_100215355 | |||
| 998 | Ga0070716_100243238 | |||
| 999 | Ga0070712_100019297 | |||
| 1000 | Ga0070712_100035361 | |||
| 1001 | Ga0070712_100111525 | |||
| 1002 | Ga0075366_10216130 | |||
| 1003 | Ga0097621_100029812 | |||
| 1004 | Ga0097621_100230231 | |||
| 1005 | Ga0068871_100010689 | |||
| 1006 | Ga0068871_100138003 | |||
| 1007 | Ga0068871_100182216 | |||
| 1008 | Ga0075428_100010997 | |||
| 1009 | Ga0075428_100012866 | |||
| 1010 | Ga0075428_100048126 | |||
| 1011 | Ga0075428_100109056 | |||
| 1012 | Ga0075428_100340594 | |||
| 1013 | Ga0075428_100746647 | |||
| 1014 | Ga0075430_100010666 | |||
| 1015 | Ga0075430_100026886 | |||
| 1016 | Ga0075430_100111993 | |||
| 1017 | Ga0075431_100096903 | |||
| 1018 | Ga0075431_100317481 | |||
| 1019 | Ga0075433_10009272 | |||
| 1020 | Ga0075433_10090658 | |||
| 1021 | Ga0075433_10206948 | |||
| 1022 | Ga0075433_10262686 | |||
| 1023 | Ga0075433_10602252 | |||
| 1024 | Ga0075434_100019501 | |||
| 1025 | Ga0075434_100158749 | |||
| 1026 | Ga0075434_100169729 | |||
| 1027 | Ga0075434_100238749 | |||
| 1028 | Ga0075434_100325516 | |||
| 1029 | Ga0075429_100031457 | |||
| 1030 | Ga0068865_100008729 | |||
| 1031 | Ga0075436_100009847 | |||
| 1032 | Ga0075436_100011299 | |||
| 1033 | Ga0075436_100178056 | |||
| 1034 | Ga0097620_100018376 | |||
| 1035 | Ga0075435_100002683 | |||
| 1036 | Ga0075435_100021766 | |||
| 1037 | Ga0075435_100049004 | |||
| 1038 | Ga0075435_100238999 | |||
| 1039 | Ga0075435_100257135 | |||
| 1040 | Ga0111539_10000579 | |||
| 1041 | Ga0111539_10007286 | |||
| 1042 | Ga0111539_10017387 | |||
| 1043 | Ga0111539_10027803 | |||
| 1044 | Ga0111539_10046085 | |||
| 1045 | Ga0111539_10176433 | |||
| 1046 | Ga0111539_10190636 | |||
| 1047 | Ga0111539_10756664 | |||
| 1048 | Ga0105245_10004716 | |||
| 1049 | Ga0105245_10008329 | |||
| 1050 | Ga0105245_10034329 | |||
| 1051 | Ga0105245_10054431 | |||
| 1052 | Ga0105247_10014964 | |||
| 1053 | Ga0114129_10028436 | |||
| 1054 | Ga0114129_10069809 | |||
| 1055 | Ga0114129_10077327 | |||
| 1056 | Ga0114129_10111656 | |||
| 1057 | Ga0114129_10148284 | |||
| 1058 | Ga0114129_10154381 | |||
| 1059 | Ga0114129_10233669 | |||
| 1060 | Ga0114129_10236865 | |||
| 1061 | Ga0114129_10454029 | |||
| 1062 | Ga0114129_10686657 | |||
| 1063 | Ga0105243_10005743 | |||
| 1064 | Ga0105243_10021509 | |||
| 1065 | Ga0105243_10096887 | |||
| 1066 | Ga0105243_10304678 | |||
| 1067 | Ga0105243_10383286 | |||
| 1068 | Ga0105241_10077750 | |||
| 1069 | Ga0105241_10555572 | |||
| 1070 | Ga0105242_10094515 | |||
| 1071 | Ga0105242_10241952 | |||
| 1072 | Ga0105248_10319811 | |||
| 1073 | Ga0105248_10924734 | |||
| 1074 | Ga0105237_10208181 | |||
| 1075 | Ga0105238_10197271 | |||
| 1076 | Ga0105249_10007425 | |||
| 1077 | Ga0105249_10048598 | |||
| 1078 | Ga0105249_10059391 | |||
| 1079 | Ga0105249_10142593 | |||
| 1080 | Ga0105249_10331421 | |||
| 1081 | Ga0105239_10048807 | |||
| 1082 | Ga0105239_10118367 | |||
| 1083 | Ga0105239_10403580 | |||
| 1084 | Ga0105239_10840767 | |||
| 1085 | Ga0105246_10017021 | |||
| 1086 | Ga0157371_10437959 | |||
| 1087 | Ga0157374_11183224 | |||
| 1088 | Ga0157378_10157307 | |||
| 1089 | Ga0163162_10034504 | |||
| 1090 | Ga0163162_10073465 | |||
| 1091 | Ga0163162_10183446 | |||
| 1092 | Ga0157375_10421355 | |||
| 1093 | Ga0157375_10466578 | |||
| 1094 | Ga0157375_10480204 | |||
| 1095 | Ga0163163_10055234 | |||
| 1096 | Ga0163163_10072190 | |||
| 1097 | Ga0157380_10029265 | |||
| 1098 | Ga0157377_10166470 | |||
| 1099 | Ga0157377_10362634 | |||
| 1100 | Ga0157379_10014155 | |||
| 1101 | Ga0157379_10208325 | |||
| 1102 | Ga0157376_10015092 | |||
| 1103 | Ga0157376_10106649 | |||
| 1104 | Ga0163161_10496137 | |||
| 1105 | Ga0213876_10005772 | |||
| 1106 | Ga0207656_10022769 | |||
| 1107 | Ga0207653_10001281 | |||
| 1108 | Ga0207653_10019655 | |||
| 1109 | Ga0207692_10098042 | |||
| 1110 | Ga0207692_10152619 | |||
| 1111 | Ga0207642_10054406 | |||
| 1112 | Ga0207642_10224017 | |||
| 1113 | Ga0207688_10008143 | |||
| 1114 | Ga0207688_10031063 | |||
| 1115 | Ga0207688_10080712 | |||
| 1116 | Ga0207699_10013847 | |||
| 1117 | Ga0207699_10036367 | |||
| 1118 | Ga0207699_10221283 | |||
| 1119 | Ga0207645_10018387 | |||
| 1120 | Ga0207645_10090842 | |||
| 1121 | Ga0207643_10000527 | |||
| 1122 | Ga0207684_10072851 | |||
| 1123 | Ga0207684_10086646 | |||
| 1124 | Ga0207684_10252637 | |||
| 1125 | Ga0207684_10263273 | |||
| 1126 | Ga0207654_10166275 | |||
| 1127 | Ga0207693_10005408 | |||
| 1128 | Ga0207693_10011813 | |||
| 1129 | Ga0207693_10021966 | |||
| 1130 | Ga0207693_10069084 | |||
| 1131 | Ga0207693_10087993 | |||
| 1132 | Ga0207693_10386072 | |||
| 1133 | Ga0207663_10002883 | |||
| 1134 | Ga0207663_10013680 | |||
| 1135 | Ga0207663_10014107 | |||
| 1136 | Ga0207663_10043586 | |||
| 1137 | Ga0207663_10160951 | |||
| 1138 | Ga0207660_10052549 | |||
| 1139 | Ga0207662_10181687 | |||
| 1140 | Ga0207657_10047961 | |||
| 1141 | Ga0207649_10431994 | |||
| 1142 | Ga0207652_10135455 | |||
| 1143 | Ga0207646_10007257 | |||
| 1144 | Ga0207646_10059733 | |||
| 1145 | Ga0207650_10006885 | |||
| 1146 | Ga0207650_10024317 | |||
| 1147 | Ga0207659_10095510 | |||
| 1148 | Ga0207659_10289286 | |||
| 1149 | Ga0207687_10131962 | |||
| 1150 | Ga0207687_10146722 | |||
| 1151 | Ga0207687_10242239 | |||
| 1152 | Ga0207700_10038736 | |||
| 1153 | Ga0207700_10099906 | |||
| 1154 | Ga0207700_10131655 | |||
| 1155 | Ga0207664_10015497 | |||
| 1156 | Ga0207664_10020772 | |||
| 1157 | Ga0207664_10032523 | |||
| 1158 | Ga0207690_10061927 | |||
| 1159 | Ga0207706_10045210 | |||
| 1160 | Ga0207706_10133067 | |||
| 1161 | Ga0207709_10059908 | |||
| 1162 | Ga0207709_10141361 | |||
| 1163 | Ga0207709_10238285 | |||
| 1164 | Ga0207670_10051476 | |||
| 1165 | Ga0207704_10088469 | |||
| 1166 | Ga0207665_10019918 | |||
| 1167 | Ga0207665_10047351 | |||
| 1168 | Ga0207665_10153970 | |||
| 1169 | Ga0207691_10068532 | |||
| 1170 | Ga0207711_10378447 | |||
| 1171 | Ga0207689_10126335 | |||
| 1172 | Ga0207689_10161033 | |||
| 1173 | Ga0207661_10323747 | |||
| 1174 | Ga0207679_10045086 | |||
| 1175 | Ga0207667_10043411 | |||
| 1176 | Ga0207651_10131712 | |||
| 1177 | Ga0207712_10078488 | |||
| 1178 | Ga0207712_10082165 | |||
| 1179 | Ga0207712_10499441 | |||
| 1180 | Ga0207668_10096569 | |||
| 1181 | Ga0207668_10128671 | |||
| 1182 | Ga0207668_10172902 | |||
| 1183 | Ga0207640_10598187 | |||
| 1184 | Ga0207677_10067037 | |||
| 1185 | Ga0207677_10157147 | |||
| 1186 | Ga0207678_10073770 | |||
| 1187 | Ga0207678_10094897 | |||
| 1188 | Ga0207678_10308547 | |||
| 1189 | Ga0207708_10001608 | |||
| 1190 | Ga0207708_10006647 | |||
| 1191 | Ga0207708_10055758 | |||
| 1192 | Ga0207708_10087051 | |||
| 1193 | Ga0207708_10239186 | |||
| 1194 | Ga0207702_10023714 | |||
| 1195 | Ga0207702_10090343 | |||
| 1196 | Ga0207702_10169476 | |||
| 1197 | Ga0207702_10170408 | |||
| 1198 | Ga0207702_10175810 | |||
| 1199 | Ga0207641_10009676 | |||
| 1200 | Ga0207648_10002938 | |||
| 1201 | Ga0207648_10022072 | |||
| 1202 | Ga0207648_10078940 | |||
| 1203 | Ga0207648_10294015 | |||
| 1204 | Ga0207648_10484094 | |||
| 1205 | Ga0207676_10121440 | |||
| 1206 | Ga0207676_10506138 | |||
| 1207 | Ga0207674_10002510 | |||
| 1208 | Ga0207674_10002573 | |||
| 1209 | Ga0207674_10024468 | |||
| 1210 | Ga0207674_10061131 | |||
| 1211 | Ga0207675_100001956 | |||
| 1212 | Ga0207675_100005728 | |||
| 1213 | Ga0207675_100075423 | |||
| 1214 | Ga0207683_10006879 | |||
| 1215 | Ga0207683_10007217 | |||
| 1216 | Ga0207683_10045061 | |||
| 1217 | Ga0207683_10184222 | |||
| 1218 | Ga0207428_10000677 | |||
| 1219 | Ga0207428_10001781 | |||
| 1220 | Ga0207428_10003568 | |||
| 1221 | Ga0207428_10039435 | |||
| 1222 | Ga0207428_10046080 | |||
| 1223 | Ga0268266_10334699 | |||
| 1224 | Ga0268265_10106248 | |||
| 1225 | Ga0268265_10205737 | |||
| 1226 | Ga0268265_10832424 | |||
| 1227 | Ga0268264_10048357 | |||
| 1228 | Ga0268264_10154737 | |||
| 1229 | Ga0268264_10218176 | |||
| 1230 | Ga0268264_10324821 | |||
| 1231 | Ga0307405_10127801 | |||
| 1232 | Ga0307405_10150169 | |||
| 1233 | Ga0307413_10441711 | |||
| 1234 | Ga0307416_100100906 | |||
| 1235 | Ga0307415_100370090 | |||
| 1236 | Ga0373948_0049470 | |||
| 1237 | Ga0373950_0002657 | |||
| 1238 | Ga0373958_0002312 | |||
| 1239 | Ga0373959_0034270 | |||
| 1240 | Ga0373959_0055272 | |||
| 1241 | Ga0373938_0002500 | |||
| 1242 | Ga0373928_0004080 | |||
| 1243 | Ga0373928_0031857 | |||
| 1244 | Ga0373949_0003358 | |||
| 1245 | Ga0373949_0009384 | |||
| 1246 | Ga0373932_0001826 | |||
| 1247 | Ga0373941_0005767 | |||
| 1248 | Ga0373941_0019618 | |||
| 1249 | Ga0373941_0032241 | |||
| 1250 | Ga0373941_0113788 | |||
| 1251 | Ga0373960_0005431 | |||
| 1252 | Ga0373960_0016022 | |||
| 1253 | Ga0373960_0017010 | |||
| 1254 | Ga0373943_0008391 | |||
| 1255 | Ga0373946_0018521 | |||
| 1256 | Ga0373942_0037060 | |||
| 1257 | Ga0373942_0052177 | |||
| 1258 | Ga0373961_0005634 | |||
| 1259 | Ga0373962_0013589 | |||
| 1260 | Ga0373931_0014004 | |||
| 1261 | Ga0373931_0112172 | |||
| 1262 | Ga0373931_0113989 | |||
| 1263 | Ga0373947_0002805 | |||
| 1264 | Ga0373925_0016048 | |||
| 1265 | Ga0373925_0022241 | |||
| 1266 | Ga0373925_0235302 | |||
| 1267 | Ga0373925_0311872 | |||
| 1268 | Ga0395899_0003008 | |||
| 1269 | Ga0395899_0027902 | |||
| 1270 | Ga0395899_0035400 | |||
| 1271 | Ga0395899_0036227 | |||
| 1272 | Ga0395899_0138410 | |||
| 1273 | Ga0395899_0272547 | |||
| 1274 | Ga0395899_0308123 | |||
| 1275 | Ga0395900_0002545 | |||
| 1276 | Ga0395900_0004907 | |||
| 1277 | Ga0395900_0016158 | |||
| 1278 | Ga0395900_0016253 | |||
| 1279 | Ga0395900_0053915 | |||
| 1280 | Ga0395900_0107826 | |||
| 1281 | Ga0395900_0179669 | |||
| 1282 | Ga0395900_0315072 | |||
| 1283 | Ga0395900_0377714 | |||
| 1284 | Ga0395900_0414983 | |||
| 1285 | Ga0395900_0489434 | |||
| 1286 | Ga0395898_0002860 | |||
| 1287 | Ga0395898_0004729 | |||
| 1288 | Ga0395898_0008218 | |||
| 1289 | Ga0395898_0013665 | |||
| 1290 | Ga0395898_0131318 | |||
| 1291 | Ga0395898_0596165 | |||
| 1292 | Ga0395905_0003136 | |||
| 1293 | Ga0395905_0004049 | |||
| 1294 | Ga0395905_0033459 | |||
| 1295 | Ga0395905_0049114 | |||
| 1296 | Ga0395905_0102994 | |||
| 1297 | Ga0395905_0395294 | |||
| 1298 | Ga0395905_0536197 | |||
| 1299 | Ga0395905_0550878 | |||
| 1300 | Ga0395905_0697845 | |||
| 1301 | Ga0436364_0677119 | |||
| 1302 | Ga0395901_0001407 | |||
| 1303 | Ga0395901_0002611 | |||
| 1304 | Ga0395901_0007150 | |||
| 1305 | Ga0395901_0013743 | |||
| 1306 | Ga0395901_0049334 | |||
| 1307 | Ga0395901_0061347 | |||
| 1308 | Ga0395901_0063344 | |||
| 1309 | Ga0395901_0072010 | |||
| 1310 | Ga0395901_0079798 | |||
| 1311 | Ga0395901_0109293 | |||
| 1312 | Ga0395901_0180697 | |||
| 1313 | Ga0395901_0262999 | |||
| 1314 | Ga0395901_0599276 | |||
| 1315 | Ga0395901_0756359 | |||
| 1316 | Ga0242420_023834 | |||
| 1317 | Ga0436365_1193809 | |||
| 1318 | Ga0439450_057375 | |||
| 1319 | Ga0439456_022924 | |||
| 1320 | Ga0439435_0072300 | |||
| 1321 | Ga0466966_0210733 | |||
| 1322 | Ga0466964_0041384 | |||
| 1323 | Ga0466959_0015481 | |||
| 1324 | Ga0466959_0189993 | |||
| 1325 | Ga0451576_0017984 | |||
| 1326 | Ga0451576_0120488 | |||
| 1327 | Ga0451576_0594715 | |||
| 1328 | Ga0466967_0021485 | |||
| 1329 | Ga0495603_0003521 | |||
| 1330 | Ga0495603_0246200 | |||
| 1331 | Ga0495629_0001783 | |||
| 1332 | Ga0495641_0001752 | |||
| 1333 | Ga0495641_0066965 | |||
| 1334 | Ga0495580_0024717 | |||
| 1335 | Ga0495582_0000046 | |||
| 1336 | Ga0495582_0023121 | |||
| 1337 | Ga0495605_0150702 | |||
| 1338 | Ga0495639_0010832 | |||
| 1339 | Ga0495584_0019832 | |||
| 1340 | Ga0495585_0251073 | |||
| 1341 | Ga0495594_0005092 | |||
| 1342 | Ga0495596_0026310 | |||
| 1343 | Ga0495607_0082757 | |||
| 1344 | Ga0495607_0178103 | |||
| 1345 | Ga0495630_0015682 | |||
| 1346 | Ga0495630_0037841 | |||
| 1347 | Ga0495631_0025017 | |||
| 1348 | Ga0495637_0072285 | |||
| 1349 | Ga0495637_0164808 | |||
| 1350 | Ga0495644_0033168 | |||
| 1351 | Ga0495644_0102308 | |||
| 1352 | Ga0495663_0009180 | |||
| 1353 | Ga0495663_0036935 | |||
| 1354 | Ga0495666_0098231 | |||
| 1355 | Ga0495666_0152401 | |||
| 1356 | Ga0495642_0027367 | |||
| 1357 | Ga0495642_0139042 | |||
| 1358 | Ga0495665_0088732 | |||
| 1359 | Ga0495665_0089737 | |||
| 1360 | Ga0495667_0066513 | |||
| 1361 | Ga0495656_0017822 | |||
| 1362 | Ga0495656_0263096 | |||
| 1363 | Ga0495656_0304640 | |||
| 1364 | Ga0495659_0068575 | |||
| 1365 | Ga0495588_0001448 | |||
| 1366 | Ga0495588_0116517 | |||
| 1367 | Ga0495658_0000392 | |||
| 1368 | Ga0495658_0020824 | |||
| 1369 | Ga0495658_0256497 | |||
| 1370 | Ga0495658_0413318 | |||
| 1371 | Ga0495613_0000466 | |||
| 1372 | Ga0495613_0277176 | |||
| 1373 | Ga0495670_0130212 | |||
| 1374 | Ga0495589_0019725 | |||
| 1375 | Ga0495589_0098219 | |||
| 1376 | Ga0495581_0003492 | |||
| 1377 | Ga0495672_0018007 | |||
| 1378 | Ga0495676_0013741 | |||
| 1379 | Ga0495676_0020917 | |||
| 1380 | Ga0495676_0028913 | |||
| 1381 | Ga0495676_0338886 | |||
| 1382 | Ga0495685_075506 | |||
| 1383 | Ga0495614_0008400 | |||
| 1384 | Ga0495615_0046162 | |||
| 1385 | Ga0496100_0009969 | |||
| 1386 | Ga0496100_0038687 | |||
| 1387 | Ga0496100_0102223 | |||
| 1388 | Ga0496100_0133585 | |||
| 1389 | Ga0496100_0242387 | |||
| 1390 | Ga0496100_0484665 | |||
| 1391 | Ga0496101_0003207 | |||
| 1392 | Ga0496101_0007809 | |||
| 1393 | Ga0496101_0033934 | |||
| 1394 | Ga0496101_0061592 | |||
| 1395 | Ga0496101_0064839 | |||
| 1396 | Ga0496101_0177446 | |||
| 1397 | Ga0496101_0214939 | |||
| 1398 | Ga0496101_0274906 | |||
| 1399 | Ga0496102_0021593 | |||
| 1400 | Ga0496102_0054480 | |||
| 1401 | Ga0496102_0113109 | |||
| 1402 | Ga0496102_0114292 | |||
| 1403 | Ga0496102_0167333 | |||
| 1404 | Ga0496102_0217841 | |||
| 1405 | Ga0496103_0010233 | |||
| 1406 | Ga0496103_0047946 | |||
| 1407 | Ga0496104_0007945 | |||
| 1408 | Ga0496104_0050672 | |||
| 1409 | Ga0496104_0079265 | |||
| 1410 | Ga0496104_0093148 | |||
| 1411 | Ga0496105_0001914 | |||
| 1412 | Ga0496105_0016257 | |||
| 1413 | Ga0496105_0017456 | |||
| 1414 | Ga0496105_0039033 | |||
| 1415 | Ga0496106_0009322 | |||
| 1416 | Ga0496106_0028534 | |||
| 1417 | Ga0496106_0084186 | |||
| 1418 | Ga0496107_0005857 | |||
| 1419 | Ga0496107_0030422 | |||
| 1420 | Ga0496107_0043111 | |||
| 1421 | Ga0496107_0228138 | |||
| 1422 | Ga0496107_0333178 | |||
| 1423 | Ga0496108_0002151 | |||
| 1424 | Ga0496108_0015849 | |||
| 1425 | Ga0496108_0067015 | |||
| 1426 | Ga0496109_0008507 | |||
| 1427 | Ga0496109_0016026 | |||
| 1428 | Ga0496109_0025127 | |||
| 1429 | Ga0496109_0039594 | |||
| 1430 | Ga0496109_0044581 | |||
| 1431 | Ga0496109_0044829 | |||
| 1432 | Ga0496109_0049293 | |||
| 1433 | Ga0496109_0110512 | |||
| 1434 | Ga0496109_0158195 | |||
| 1435 | Ga0496109_0375837 | |||
| 1436 | Ga0496109_0539739 | |||
| 1437 | Ga0496110_0008459 | |||
| 1438 | Ga0496110_0010897 | |||
| 1439 | Ga0496110_0011941 | |||
| 1440 | Ga0496110_0028852 | |||
| 1441 | Ga0496110_0060301 | |||
| 1442 | Ga0496110_0083846 | |||
| 1443 | Ga0496110_0211487 | |||
| 1444 | Ga0496110_0259534 | |||
| 1445 | Ga0496110_0814370 | |||
| 1446 | Ga0496111_0000412 | |||
| 1447 | Ga0496111_0002040 | |||
| 1448 | Ga0496111_0003390 | |||
| 1449 | Ga0496111_0006871 | |||
| 1450 | Ga0496111_0050907 | |||
| 1451 | Ga0496111_0153618 | |||
| 1452 | Ga0496111_0179655 | |||
| 1453 | Ga0496112_0017997 | |||
| 1454 | Ga0496112_0027781 | |||
| 1455 | Ga0496112_0038723 | |||
| 1456 | Ga0496112_0044930 | |||
| 1457 | Ga0496112_0294698 | |||
| 1458 | Ga0496112_0390919 | |||
| 1459 | Ga0496113_0003830 | |||
| 1460 | Ga0496113_0011816 | |||
| 1461 | Ga0496113_0015551 | |||
| 1462 | Ga0496113_0018202 | |||
| 1463 | Ga0496113_0284703 | |||
| 1464 | Ga0496113_0389657 | |||
| 1465 | Ga0496113_0392941 | |||
| 1466 | Ga0496114_0032611 | |||
| 1467 | Ga0496114_0032959 | |||
| 1468 | Ga0496114_0220339 | |||
| 1469 | Ga0496114_0231540 | |||
| 1470 | Ga0496114_0295584 | |||
| 1471 | Ga0496115_0015970 | |||
| 1472 | Ga0496115_0025433 | |||
| 1473 | Ga0496115_0071383 | |||
| 1474 | Ga0501031_0000110 | |||
| 1475 | Ga0501031_0002523 | |||
| 1476 | Ga0501031_0241417 | |||
| 1477 | Ga0501032_0002808 | |||
| 1478 | Ga0501033_0012655 | |||
| 1479 | Ga0501033_0051916 | |||
| 1480 | Ga0501034_0014796 | |||
| 1481 | Ga0501034_0039823 | |||
| 1482 | Ga0501036_0000848 | |||
| 1483 | Ga0501036_0059348 | |||
| 1484 | Ga0501037_0001347 | |||
| 1485 | Ga0501037_0002198 | |||
| 1486 | Ga0501037_0023626 | |||
| 1487 | Ga0501037_0115338 | |||
| 1488 | Ga0501038_0000237 | |||
| 1489 | Ga0501038_0003056 | |||
| 1490 | Ga0501038_0040534 | |||
| 1491 | Ga0501038_0175405 | |||
| 1492 | Ga0501039_0000285 | |||
| 1493 | Ga0501039_0020218 | |||
| 1494 | Ga0501039_0034948 | |||
| 1495 | Ga0501040_0000576 | |||
| 1496 | Ga0501040_0002203 | |||
| 1497 | Ga0501040_0037258 | |||
| 1498 | Ga0501040_0065544 | |||
| 1499 | Ga0501040_0104439 | |||
| 1500 | Ga0501040_0251674 | |||
| 1501 | Ga0501041_0001246 | |||
| 1502 | Ga0501041_0007464 | |||
| 1503 | Ga0501041_0084237 | |||
| 1504 | Ga0501042_0000013 | |||
| 1505 | Ga0501042_0015921 | |||
| 1506 | Ga0501042_0113119 | |||
| 1507 | Ga0501042_0274373 | |||
| 1508 | Ga0501043_0001144 | |||
| 1509 | Ga0501043_0020340 | |||
| 1510 | Ga0501043_0038719 | |||
| 1511 | Ga0501043_0044465 | |||
| 1512 | Ga0501046_0001149 | |||
| 1513 | Ga0501046_0007119 | |||
| 1514 | Ga0501046_0032829 | |||
| 1515 | Ga0501046_0068158 | |||
| 1516 | Ga0501046_0329069 | |||
| 1517 | Ga0501047_0000927 | |||
| 1518 | Ga0501048_0000042 | |||
| 1519 | Ga0501048_0006175 | |||
| 1520 | Ga0501048_0072605 | |||
| 1521 | Ga0501048_0201043 | |||
| 1522 | Ga0501067_0003510 | |||
| 1523 | Ga0501067_0023275 | |||
| 1524 | Ga0501068_0000199 | |||
| 1525 | Ga0501068_0034378 | |||
| 1526 | Ga0501068_0041296 | |||
| 1527 | Ga0501068_0042859 | |||
| 1528 | Ga0501069_0001814 | |||
| 1529 | Ga0501069_0095963 | |||
| 1530 | Ga0501070_0005526 | |||
| 1531 | Ga0501070_0009629 | |||
| 1532 | Ga0501071_0000384 | |||
| 1533 | Ga0501071_0111562 | |||
| 1534 | Ga0501071_0203756 | |||
| 1535 | Ga0501071_0527894 | |||
| 1536 | Ga0501072_0002936 | |||
| 1537 | Ga0501072_0017435 | |||
| 1538 | Ga0501072_0030419 | |||
| 1539 | Ga0501072_0110375 | |||
| 1540 | Ga0501072_0206107 | |||
| 1541 | Ga0501073_0001106 | |||
| 1542 | Ga0501073_0025007 | |||
| 1543 | Ga0501073_0166853 | |||
| 1544 | Ga0501074_0008119 | |||
| 1545 | Ga0501074_0080429 | |||
| 1546 | Ga0501074_0196311 | |||
| 1547 | Ga0501074_0216240 | |||
| 1548 | Ga0501075_0000032 | |||
| 1549 | Ga0501075_0026946 | |||
| 1550 | Ga0501075_0027117 | |||
| 1551 | Ga0501075_0064142 | |||
| 1552 | Ga0501076_0001224 | |||
| 1553 | Ga0501076_0058833 | |||
| 1554 | Ga0501076_0093765 | |||
| 1555 | Ga0501077_0002257 | |||
| 1556 | Ga0501077_0006095 | |||
| 1557 | Ga0501077_0021209 | |||
| 1558 | Ga0501077_0038619 | |||
| 1559 | Ga0501077_0149880 | |||
| 1560 | Ga0501077_0155745 | |||
| 1561 | Ga0501077_0202952 | |||
| 1562 | Ga0501249_065184 | |||
| 1563 | Ga0501079_0000096 | |||
| 1564 | Ga0501079_0001183 | |||
| 1565 | Ga0501079_0014139 | |||
| 1566 | Ga0501079_0137930 | |||
| 1567 | Ga0501079_0641460 | |||
| 1568 | Ga0501080_0000105 | |||
| 1569 | Ga0501080_0035887 | |||
| 1570 | Ga0501080_0345802 | |||
| 1571 | Ga0501080_0663494 | |||
| 1572 | Ga0501081_0000180 | |||
| 1573 | Ga0501081_0010256 | |||
| 1574 | Ga0501081_0019424 | |||
| 1575 | Ga0501081_0025883 | |||
| 1576 | Ga0501081_0036374 | |||
| 1577 | Ga0501081_0163996 | |||
| 1578 | Ga0501081_0343629 | |||
| 1579 | Ga0501081_0434632 | |||
| 1580 | Ga0501083_0000081 | |||
| 1581 | Ga0501083_0006567 | |||
| 1582 | Ga0501035_0001604 | |||
| 1583 | Ga0501035_0005200 | |||
| 1584 | Ga0501035_0212790 | |||
| 1585 | Ga0501044_0025046 | |||
| 1586 | Ga0501044_0050811 | |||
| 1587 | Ga0501044_0190642 | |||
| 1588 | Ga0501045_0000194 | |||
| 1589 | Ga0501045_0014884 | |||
| 1590 | Ga0501045_0056197 | |||
| 1591 | Ga0501045_0057695 | |||
| 1592 | Ga0501045_0075235 | |||
| 1593 | nmdc:mga00v17_46279_c1 | |||
| 1594 | nmdc:mga0yw44_202250_c1 | |||
| 1595 | nmdc:mga05p37_23774_c1 | |||
| 1596 | nmdc:mga05p37_248416_c1 | |||
| 1597 | nmdc:mga05p37_516917_c1 | |||
| 1598 | nmdc:mga05p37_782_c1 | |||
| 1599 | nmdc:mga05p37_8278_c1 | |||
| 1600 | nmdc:mga05p37_91832_c1 | |||
| 1601 | nmdc:mga09592_3984_c1 | |||
| 1602 | nmdc:mga09592_93624_c1 | |||
| 1603 | nmdc:mga0qj67_113371_c1 | |||
| 1604 | nmdc:mga0qj67_128029_c1 | |||
| 1605 | nmdc:mga0qj67_241436_c1 | |||
| 1606 | nmdc:mga0qj67_25424_c1 | |||
| 1607 | nmdc:mga0qj67_36354_c1 | |||
| 1608 | nmdc:mga0qj67_75828_c1 | |||
| 1609 | nmdc:mga06r32_101759_c1 | |||
| 1610 | nmdc:mga06r32_285921_c1 | |||
| 1611 | nmdc:mga06r32_6240_c1 | |||
| 1612 | nmdc:mga06r32_701346_c1 | |||
| 1613 | nmdc:mga08y16_46277_c1 | |||
| 1614 | nmdc:mga08y16_470585_c1 | |||
| 1615 | nmdc:mga08y16_54942_c1 | |||
| 1616 | nmdc:mga08y16_6329_c1 | |||
| 1617 | nmdc:mga08y16_736813_c1 | |||
| 1618 | nmdc:mga0n895_148945_c1 | |||
| 1619 | nmdc:mga0n895_298364_c1 | |||
| 1620 | nmdc:mga0n895_359870_c1 | |||
| 1621 | nmdc:mga0n895_51598_c1 | |||
| 1622 | nmdc:mga0n895_54468_c1 | |||
| 1623 | nmdc:mga0n895_5857_c1 | |||
| 1624 | nmdc:mga0rr50_130036_c1 | |||
| 1625 | nmdc:mga0rr50_15083_c1 | |||
| 1626 | nmdc:mga0rr50_22100_c1 | |||
| 1627 | nmdc:mga0rr50_233129_c1 | |||
| 1628 | nmdc:mga0rr50_43734_c1 | |||
| 1629 | nmdc:mga08x19_14698_c1 | |||
| 1630 | nmdc:mga08x19_16604_c2 | |||
| 1631 | nmdc:mga08x19_345218_c1 | |||
| 1632 | nmdc:mga08x19_6908_c1 | |||
| 1633 | nmdc:mga0a205_113418_c1 | |||
| 1634 | nmdc:mga0a205_12986_c1 | |||
| 1635 | nmdc:mga0a205_82931_c1 | |||
| 1636 | Ga0495601_0073853 | |||
| 1637 | Ga0495655_0070373 | |||
| 1638 | Ga0495595_0197559 | |||
| 1639 | Ga0501084_0000642 | |||
| 1640 | Ga0501084_0004452 | |||
| 1641 | Ga0501084_0032360 | |||
| 1642 | Ga0501084_0157177 | |||
| 1643 | Ga0501082_0001914 | |||
| 1644 | Ga0501082_0002192 | |||
| 1645 | Ga0501082_0062260 | |||
| 1646 | Ga0501082_0091118 | |||
| 1647 | Ga0501082_0100973 | |||
| 1648 | Ga0501082_0101986 | |||
| 1649 | Ga0501082_0204282 | |||
| 1650 | Ga0501082_0232802 | |||
| 1651 | Ga0530510_0001349 | |||
| 1652 | Ga0530510_0003318 | |||
| 1653 | Ga0530510_0009789 | |||
| 1654 | Ga0530510_0031808 | |||
| 1655 | Ga0530510_0072226 | |||
| 1656 | Ga0530510_0072382 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8djm-assembly1.cif.gz_B | hmgcr-ubiad1 complex state 1 | 0.7342 | 17 | 190 |
| 3aqc-assembly2.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6455 | 20 | 187 |
| 4tq6-assembly2.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.6065 | 20 | 242 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.6001 | 19 | 190 |
| 5zlf-assembly2.cif.gz_D | crystal structure of octaprenyl pyrophosphate synthase from escherichia coli with ligand bph-629 | 0.5966 | 34 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZM0_17_182_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8711 | 25 | 164 | 1.10.357.140 |
| af_Q12887_160_330_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8067 | 30 | 177 | 1.10.357.140 |
| af_F1LVF4_158_307_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.8037 | 30 | 164 | 1.10.357.140 |
| af_A0A0R0IQ72_105_369_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.7602 | 34 | 190 | 1.20.1070.10 |
| af_Q57727_14_160_1.10.357.140 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase | 0.7599 | 25 | 158 | 1.10.357.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N0L117-F1-model_v4 | Uncharacterized protein | 0.9916 | 4 | 242 |
GO:0016020
|
| AF-A0A160VBF6-F1-model_v4 | Prepilin type IV endopeptidase peptidase domain-containing protein | 0.9912 | 40 | 242 |
GO:0016020
|
| AF-A0A1Q6XDR5-F1-model_v4 | Prenyltransferase | 0.991 | 7 | 243 |
GO:0016020
|
| AF-A0A1Q7DBQ0-F1-model_v4 | Methyltransferase domain-containing protein | 0.9897 | 24 | 242 |
GO:0008168
GO:0016020 GO:0032259 |
| AF-A0A7V1XP36-F1-model_v4 | Uncharacterized protein | 0.9896 | 5 | 243 |
GO:0016020
|