F482573

General Info

Members Datasets Scaffolds Average Seq Length
828 310 1656 241

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0266365|Ga0501032_0266365_102_836
Length 234
Sequence VATEADRPAFYALAPGGTRDYLTLLHPPYTAWHLSYVAVGAALSSAFTWERFLPTLAAFFLAVGIGAHALDELSGRPLATRIPRPVLVALAAGSIAGAVDPWIAAFVAVGGFVVVAYNVELLGGRFHGDTWFALAWGAFPVATAYYAVAGRLDAVAAAGALYAFLLSRAQRQLSTPVRDVRRRVARVTGTIERKDGAVEPVTTELLLRGKERALLSLAGAAVAIGVGLVIMRVT

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
180 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
181 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
182 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
204 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
205 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
224 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
304 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 10.75
Rhizosphere 88.16
Stem 0
Stem Tuber 0
Unclassified 13.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0266365 3300049569 Bacteria 1110
2 JGI24751J29686_10000700 3300002459 Bacteria 8226
3 JGI25407J50210_10002835 3300003373 Unclassified 4124
4 Ga0070676_10149857 3300005328 Bacteria 1492
5 Ga0070683_100044810 3300005329 Bacteria 4081
6 Ga0070683_100100193 3300005329 Bacteria 2727
7 Ga0070690_100047913 3300005330 Bacteria 2720
8 Ga0070690_100109945 3300005330 Bacteria 1838
9 Ga0070670_100689956 3300005331 Bacteria 918
10 Ga0070677_10045842 3300005333 Unclassified 1746
11 Ga0068869_100095873 3300005334 Bacteria 2239
12 Ga0070680_100071905 3300005336 Bacteria 2843
13 Ga0070682_100064611 3300005337 Bacteria 2323
14 Ga0068868_100168965 3300005338 Unclassified 1810
15 Ga0070660_100404882 3300005339 Unclassified 1128
16 Ga0070689_100210873 3300005340 Unclassified 1590
17 Ga0070691_10011801 3300005341 Bacteria 3997
18 Ga0070687_100117925 3300005343 Bacteria 1513
19 Ga0070661_100013685 3300005344 Bacteria 5698
20 Ga0070661_100094597 3300005344 Bacteria 2215
21 Ga0070692_10032084 3300005345 Bacteria 2638
22 Ga0070692_10162161 3300005345 Bacteria 1282
23 Ga0070668_100055241 3300005347 Bacteria 3064
24 Ga0070668_100232903 3300005347 Bacteria 1523
25 Ga0070669_100048987 3300005353 Bacteria 3085
26 Ga0070675_100026048 3300005354 Bacteria 4690
27 Ga0070675_100770916 3300005354 Bacteria 878
28 Ga0070671_100064736 3300005355 Bacteria 3045
29 Ga0070673_100146019 3300005364 Bacteria 1999
30 Ga0070688_100006481 3300005365 Bacteria 6260
31 Ga0070659_100402659 3300005366 Unclassified 1155
32 Ga0070667_100174377 3300005367 Bacteria 1900
33 Ga0070703_10011929 3300005406 Bacteria 2459
34 Ga0070709_10109500 3300005434 Bacteria 1854
35 Ga0070714_100032783 3300005435 Unclassified 4338
36 Ga0070713_100092946 3300005436 Bacteria 2598
37 Ga0070710_10029427 3300005437 Bacteria 2947
38 Ga0070710_10059018 3300005437 Unclassified 2177
39 Ga0070710_10127993 3300005437 Bacteria 1545
40 Ga0070701_10011678 3300005438 Bacteria 3939
41 Ga0070701_10086611 3300005438 Unclassified 1707
42 Ga0070701_10285324 3300005438 Bacteria 1010
43 Ga0070711_100037538 3300005439 Bacteria 3251
44 Ga0070705_100015924 3300005440 Bacteria 3896
45 Ga0070705_100032998 3300005440 Bacteria 2882
46 Ga0070705_100082675 3300005440 Bacteria 1976
47 Ga0070700_100018370 3300005441 Bacteria 4019
48 Ga0070700_100020942 3300005441 Unclassified 3796
49 Ga0070700_100041153 3300005441 Bacteria 2832
50 Ga0070700_100216507 3300005441 Bacteria 1354
51 Ga0070694_100095759 3300005444 Bacteria 2091
52 Ga0070694_100187991 3300005444 Bacteria 1532
53 Ga0070694_100208461 3300005444 Bacteria 1460
54 Ga0070694_100267670 3300005444 Bacteria 1298
55 Ga0070708_100035691 3300005445 Bacteria 4333
56 Ga0070708_100046365 3300005445 Bacteria 3835
57 Ga0070708_100077637 3300005445 Unclassified 3001
58 Ga0070708_100408808 3300005445 Bacteria 1280
59 Ga0070663_100186509 3300005455 Bacteria 1612
60 Ga0070663_100187611 3300005455 Bacteria 1607
61 Ga0070663_100208962 3300005455 Unclassified 1527
62 Ga0070663_100553567 3300005455 Unclassified 962
63 Ga0070678_100020914 3300005456 Bacteria 4302
64 Ga0070678_100038279 3300005456 Bacteria 3375
65 Ga0070678_100235770 3300005456 Bacteria 1527
66 Ga0070706_100069253 3300005467 Unclassified 3264
67 Ga0070706_100080458 3300005467 Bacteria 3017
68 Ga0070706_100143031 3300005467 Bacteria 2233
69 Ga0070706_100177515 3300005467 Bacteria 1988
70 Ga0070707_100001269 3300005468 Bacteria 24819
71 Ga0070707_100005768 3300005468 Bacteria 11553
72 Ga0070707_100063543 3300005468 Bacteria 3543
73 Ga0070707_100548942 3300005468 Bacteria 1118
74 Ga0070707_100549987 3300005468 Bacteria 1116
75 Ga0070698_100013492 3300005471 Bacteria 8649
76 Ga0070698_100015114 3300005471 Bacteria 8161
77 Ga0070698_100050879 3300005471 Bacteria 4221
78 Ga0070698_100149148 3300005471 Unclassified 2287
79 Ga0070698_100237995 3300005471 Unclassified 1754
80 Ga0070699_100008164 3300005518 Bacteria 9086
81 Ga0070699_100017455 3300005518 Bacteria 6161
82 Ga0070699_100062894 3300005518 Bacteria 3217
83 Ga0070699_100113585 3300005518 Bacteria 2379
84 Ga0070679_100002322 3300005530 Bacteria 17205
85 Ga0070679_100357076 3300005530 Bacteria 1409
86 Ga0070684_100001333 3300005535 Bacteria 17660
87 Ga0070684_100023606 3300005535 Bacteria 5148
88 Ga0070684_100238387 3300005535 Bacteria 1661
89 Ga0070697_100335315 3300005536 Unclassified 1304
90 Ga0068853_100186390 3300005539 Bacteria 1884
91 Ga0070672_100073290 3300005543 Bacteria 2729
92 Ga0070686_100023802 3300005544 Bacteria 3666
93 Ga0070686_100058111 3300005544 Bacteria 2488
94 Ga0070695_100247655 3300005545 Bacteria 1295
95 Ga0070695_100286999 3300005545 Unclassified 1211
96 Ga0070696_100016581 3300005546 Bacteria 4965
97 Ga0070696_100129979 3300005546 Unclassified 1832
98 Ga0070696_100130198 3300005546 Unclassified 1830
99 Ga0070696_100377539 3300005546 Unclassified 1104
100 Ga0070693_100000985 3300005547 Bacteria 12684
101 Ga0070693_100049896 3300005547 Bacteria 2390
102 Ga0070693_100109006 3300005547 Bacteria 1700
103 Ga0070704_100403854 3300005549 Bacteria 1166
104 Ga0068855_100037605 3300005563 Bacteria 5755
105 Ga0068855_100545613 3300005563 Unclassified 1255
106 Ga0068855_100755280 3300005563 Bacteria 1037
107 Ga0070664_100040186 3300005564 Bacteria 3943
108 Ga0070664_100291863 3300005564 Bacteria 1472
109 Ga0070664_100414415 3300005564 Bacteria 1233
110 Ga0068857_100008660 3300005577 Bacteria 8804
111 Ga0068857_100106533 3300005577 Bacteria 2518
112 Ga0068857_100163784 3300005577 Unclassified 2019
113 Ga0068857_100401434 3300005577 Unclassified 1276
114 Ga0068854_100176424 3300005578 Unclassified 1666
115 Ga0068856_100049450 3300005614 Bacteria 4144
116 Ga0068856_100077950 3300005614 Unclassified 3284
117 Ga0068856_100125130 3300005614 Bacteria 2574
118 Ga0068856_100129730 3300005614 Bacteria 2526
119 Ga0070702_100017566 3300005615 Bacteria 3692
120 Ga0070702_100038165 3300005615 Bacteria 2673
121 Ga0070702_100243752 3300005615 Bacteria 1214
122 Ga0070702_100527757 3300005615 Unclassified 872
123 Ga0068852_100148632 3300005616 Bacteria 2176
124 Ga0068852_100224010 3300005616 Bacteria 1790
125 Ga0068859_100018378 3300005617 Bacteria 7028
126 Ga0068864_100010882 3300005618 Bacteria 7520
127 Ga0068864_100171340 3300005618 Bacteria 1979
128 Ga0068864_100454207 3300005618 Bacteria 1226
129 Ga0068866_10100334 3300005718 Unclassified 1596
130 Ga0068866_10242894 3300005718 Unclassified 1098
131 Ga0068861_100010653 3300005719 Bacteria 6385
132 Ga0068861_100099612 3300005719 Bacteria 2309
133 Ga0068851_10119004 3300005834 Unclassified 1418
134 Ga0068870_10003709 3300005840 Bacteria 6490
135 Ga0068863_100095332 3300005841 Bacteria 2824
136 Ga0068858_100241069 3300005842 Unclassified 1716
137 Ga0068860_100116180 3300005843 Bacteria 2560
138 Ga0068860_100132309 3300005843 Bacteria 2394
139 Ga0068862_100294877 3300005844 Bacteria 1490
140 Ga0068862_100315427 3300005844 Unclassified 1442
141 Ga0081455_10005485 3300005937 Bacteria 13907
142 Ga0081455_10005503 3300005937 Bacteria 13877
143 Ga0081455_10025164 3300005937 Bacteria 5498
144 Ga0081455_10038422 3300005937 Bacteria 4240
145 Ga0081455_10048335 3300005937 Bacteria 3677
146 Ga0081538_10000089 3300005981 Bacteria 88801
147 Ga0081538_10000245 3300005981 Bacteria 61398
148 Ga0081538_10001308 3300005981 Bacteria 25746
149 Ga0081538_10001549 3300005981 Bacteria 23556
150 Ga0081538_10001642 3300005981 Bacteria 22944
151 Ga0081538_10014744 3300005981 Bacteria 6098
152 Ga0081538_10016976 3300005981 Bacteria 5550
153 Ga0081538_10019498 3300005981 Bacteria 5036
154 Ga0081540_1004845 3300005983 Bacteria 10141
155 Ga0081539_10002069 3300005985 Bacteria 30045
156 Ga0081539_10003486 3300005985 Bacteria 19222
157 Ga0081539_10102143 3300005985 Bacteria 1459
158 Ga0070717_10112606 3300006028 Bacteria 2322
159 Ga0075365_10155832 3300006038 Unclassified 1590
160 Ga0075365_10193739 3300006038 Bacteria 1423
161 Ga0075364_10420708 3300006051 Bacteria 912
162 Ga0075432_10005739 3300006058 Bacteria 4224
163 Ga0075432_10009868 3300006058 Bacteria 3246
164 Ga0075432_10047443 3300006058 Bacteria 1510
165 Ga0070715_10003344 3300006163 Bacteria 5082
166 Ga0070715_10007785 3300006163 Bacteria 3702
167 Ga0070715_10012797 3300006163 Bacteria 3066
168 Ga0070715_10069632 3300006163 Bacteria 1568
169 Ga0070716_100215355 3300006173 Bacteria 1286
170 Ga0070716_100243238 3300006173 Bacteria 1221
171 Ga0070712_100019297 3300006175 Bacteria 4445
172 Ga0070712_100035361 3300006175 Bacteria 3391
173 Ga0070712_100111525 3300006175 Bacteria 2042
174 Ga0075366_10216130 3300006195 Bacteria 1167
175 Ga0097621_100029812 3300006237 Bacteria 4312
176 Ga0097621_100230231 3300006237 Bacteria 1618
177 Ga0068871_100010689 3300006358 Bacteria 6711
178 Ga0068871_100138003 3300006358 Unclassified 2072
179 Ga0068871_100182216 3300006358 Bacteria 1805
180 Ga0075428_100010997 3300006844 Bacteria 10065
181 Ga0075428_100012866 3300006844 Bacteria 9311
182 Ga0075428_100048126 3300006844 Bacteria 4681
183 Ga0075428_100109056 3300006844 Bacteria 3017
184 Ga0075428_100340594 3300006844 Bacteria 1610
185 Ga0075428_100746647 3300006844 Bacteria 1041
186 Ga0075430_100010666 3300006846 Bacteria 7786
187 Ga0075430_100026886 3300006846 Bacteria 4893
188 Ga0075430_100111993 3300006846 Bacteria 2275
189 Ga0075431_100096903 3300006847 Bacteria 3045
190 Ga0075431_100317481 3300006847 Bacteria 1572
191 Ga0075433_10009272 3300006852 Bacteria 7869
192 Ga0075433_10090658 3300006852 Bacteria 2702
193 Ga0075433_10206948 3300006852 Bacteria 1744
194 Ga0075433_10262686 3300006852 Bacteria 1530
195 Ga0075433_10602252 3300006852 Unclassified 965
196 Ga0075434_100019501 3300006871 Bacteria 6565
197 Ga0075434_100158749 3300006871 Bacteria 2281
198 Ga0075434_100169729 3300006871 Bacteria 2202
199 Ga0075434_100238749 3300006871 Bacteria 1837
200 Ga0075434_100325516 3300006871 Unclassified 1557
201 Ga0075429_100031457 3300006880 Bacteria 4612
202 Ga0068865_100008729 3300006881 Bacteria 6270
203 Ga0075436_100009847 3300006914 Bacteria 6538
204 Ga0075436_100011299 3300006914 Bacteria 6125
205 Ga0075436_100178056 3300006914 Bacteria 1502
206 Ga0097620_100018376 3300006931 Bacteria 7028
207 Ga0075435_100002683 3300007076 Bacteria 11878
208 Ga0075435_100021766 3300007076 Bacteria 4938
209 Ga0075435_100049004 3300007076 Bacteria 3395
210 Ga0075435_100238999 3300007076 Bacteria 1544
211 Ga0075435_100257135 3300007076 Bacteria 1487
212 Ga0111539_10000579 3300009094 Bacteria 47092
213 Ga0111539_10007286 3300009094 Bacteria 14163
214 Ga0111539_10017387 3300009094 Bacteria 8900
215 Ga0111539_10027803 3300009094 Bacteria 6907
216 Ga0111539_10046085 3300009094 Bacteria 5217
217 Ga0111539_10176433 3300009094 Bacteria 2496
218 Ga0111539_10190636 3300009094 Bacteria 2392
219 Ga0111539_10756664 3300009094 Bacteria 1131
220 Ga0105245_10004716 3300009098 Bacteria 12049
221 Ga0105245_10008329 3300009098 Bacteria 9061
222 Ga0105245_10034329 3300009098 Bacteria 4499
223 Ga0105245_10054431 3300009098 Bacteria 3593
224 Ga0105247_10014964 3300009101 Bacteria 4651
225 Ga0114129_10028436 3300009147 Bacteria 7923
226 Ga0114129_10069809 3300009147 Bacteria 4898
227 Ga0114129_10077327 3300009147 Bacteria 4629
228 Ga0114129_10111656 3300009147 Bacteria 3771
229 Ga0114129_10148284 3300009147 Bacteria 3212
230 Ga0114129_10154381 3300009147 Unclassified 3141
231 Ga0114129_10233669 3300009147 Bacteria 2475
232 Ga0114129_10236865 3300009147 Bacteria 2455
233 Ga0114129_10454029 3300009147 Unclassified 1680
234 Ga0114129_10686657 3300009147 Bacteria 1317
235 Ga0105243_10005743 3300009148 Bacteria 9636
236 Ga0105243_10021509 3300009148 Bacteria 4897
237 Ga0105243_10096887 3300009148 Bacteria 2441
238 Ga0105243_10304678 3300009148 Bacteria 1445
239 Ga0105243_10383286 3300009148 Bacteria 1301
240 Ga0105241_10077750 3300009174 Bacteria 2591
241 Ga0105241_10555572 3300009174 Bacteria 1031
242 Ga0105242_10094515 3300009176 Bacteria 2522
243 Ga0105242_10241952 3300009176 Unclassified 1623
244 Ga0105248_10319811 3300009177 Bacteria 1748
245 Ga0105248_10924734 3300009177 Bacteria 985
246 Ga0105237_10208181 3300009545 Bacteria 1956
247 Ga0105238_10197271 3300009551 Unclassified 1988
248 Ga0105249_10007425 3300009553 Bacteria 9561
249 Ga0105249_10048598 3300009553 Bacteria 3867
250 Ga0105249_10059391 3300009553 Bacteria 3507
251 Ga0105249_10142593 3300009553 Bacteria 2299
252 Ga0105249_10331421 3300009553 Bacteria 1536
253 Ga0105239_10048807 3300010375 Bacteria 4641
254 Ga0105239_10118367 3300010375 Unclassified 2940
255 Ga0105239_10403580 3300010375 Bacteria 1547
256 Ga0105239_10840767 3300010375 Bacteria 1052
257 Ga0105246_10017021 3300011119 Bacteria 4617
258 Ga0157371_10437959 3300013102 Unclassified 960
259 Ga0157374_11183224 3300013296 Bacteria 786
260 Ga0157378_10157307 3300013297 Unclassified 2122
261 Ga0163162_10034504 3300013306 Bacteria 5035
262 Ga0163162_10073465 3300013306 Bacteria 3476
263 Ga0163162_10183446 3300013306 Bacteria 2219
264 Ga0157375_10421355 3300013308 Bacteria 1501
265 Ga0157375_10466578 3300013308 Unclassified 1428
266 Ga0157375_10480204 3300013308 Bacteria 1408
267 Ga0163163_10055234 3300014325 Bacteria 3925
268 Ga0163163_10072190 3300014325 Bacteria 3441
269 Ga0157380_10029265 3300014326 Bacteria 4209
270 Ga0157377_10166470 3300014745 Unclassified 1375
271 Ga0157377_10362634 3300014745 Bacteria 976
272 Ga0157379_10014155 3300014968 Bacteria 6995
273 Ga0157379_10208325 3300014968 Bacteria 1769
274 Ga0157376_10015092 3300014969 Bacteria 5823
275 Ga0157376_10106649 3300014969 Bacteria 2458
276 Ga0163161_10496137 3300017792 Bacteria 993
277 Ga0213876_10005772 3300021384 Bacteria 6779
278 Ga0207656_10022769 3300025321 Bacteria 2517
279 Ga0207653_10001281 3300025885 Bacteria 8189
280 Ga0207653_10019655 3300025885 Bacteria 2131
281 Ga0207692_10098042 3300025898 Bacteria 1603
282 Ga0207692_10152619 3300025898 Bacteria 1324
283 Ga0207642_10054406 3300025899 Unclassified 1826
284 Ga0207642_10224017 3300025899 Unclassified 1052
285 Ga0207688_10008143 3300025901 Bacteria 5698
286 Ga0207688_10031063 3300025901 Unclassified 2947
287 Ga0207688_10080712 3300025901 Bacteria 1857
288 Ga0207699_10013847 3300025906 Bacteria 4139
289 Ga0207699_10036367 3300025906 Bacteria 2806
290 Ga0207699_10221283 3300025906 Bacteria 1292
291 Ga0207645_10018387 3300025907 Bacteria 4597
292 Ga0207645_10090842 3300025907 Bacteria 1964
293 Ga0207643_10000527 3300025908 Bacteria 24547
294 Ga0207684_10072851 3300025910 Unclassified 2917
295 Ga0207684_10086646 3300025910 Bacteria 2668
296 Ga0207684_10252637 3300025910 Bacteria 1521
297 Ga0207684_10263273 3300025910 Bacteria 1488
298 Ga0207654_10166275 3300025911 Unclassified 1429
299 Ga0207693_10005408 3300025915 Bacteria 10668
300 Ga0207693_10011813 3300025915 Bacteria 7057
301 Ga0207693_10021966 3300025915 Bacteria 5073
302 Ga0207693_10069084 3300025915 Bacteria 2765
303 Ga0207693_10087993 3300025915 Bacteria 2434
304 Ga0207693_10386072 3300025915 Unclassified 1095
305 Ga0207663_10002883 3300025916 Bacteria 8306
306 Ga0207663_10013680 3300025916 Bacteria 4417
307 Ga0207663_10014107 3300025916 Bacteria 4365
308 Ga0207663_10043586 3300025916 Bacteria 2748
309 Ga0207663_10160951 3300025916 Bacteria 1584
310 Ga0207660_10052549 3300025917 Bacteria 2901
311 Ga0207662_10181687 3300025918 Unclassified 1354
312 Ga0207657_10047961 3300025919 Bacteria 3731
313 Ga0207649_10431994 3300025920 Bacteria 991
314 Ga0207652_10135455 3300025921 Bacteria 2199
315 Ga0207646_10007257 3300025922 Bacteria 11300
316 Ga0207646_10059733 3300025922 Unclassified 3405
317 Ga0207650_10006885 3300025925 Bacteria 7751
318 Ga0207650_10024317 3300025925 Bacteria 4305
319 Ga0207659_10095510 3300025926 Bacteria 2229
320 Ga0207659_10289286 3300025926 Unclassified 1342
321 Ga0207687_10131962 3300025927 Bacteria 1884
322 Ga0207687_10146722 3300025927 Bacteria 1796
323 Ga0207687_10242239 3300025927 Bacteria 1430
324 Ga0207700_10038736 3300025928 Bacteria 3463
325 Ga0207700_10099906 3300025928 Bacteria 2311
326 Ga0207700_10131655 3300025928 Bacteria 2043
327 Ga0207664_10015497 3300025929 Bacteria 5535
328 Ga0207664_10020772 3300025929 Bacteria 4873
329 Ga0207664_10032523 3300025929 Bacteria 3999
330 Ga0207690_10061927 3300025932 Bacteria 2545
331 Ga0207706_10045210 3300025933 Bacteria 3901
332 Ga0207706_10133067 3300025933 Bacteria 2187
333 Ga0207709_10059908 3300025935 Bacteria 2371
334 Ga0207709_10141361 3300025935 Unclassified 1655
335 Ga0207709_10238285 3300025935 Unclassified 1322
336 Ga0207670_10051476 3300025936 Bacteria 2765
337 Ga0207704_10088469 3300025938 Bacteria 2026
338 Ga0207665_10019918 3300025939 Bacteria 4409
339 Ga0207665_10047351 3300025939 Bacteria 2883
340 Ga0207665_10153970 3300025939 Bacteria 1649
341 Ga0207691_10068532 3300025940 Bacteria 3205
342 Ga0207711_10378447 3300025941 Bacteria 1313
343 Ga0207689_10126335 3300025942 Bacteria 2104
344 Ga0207689_10161033 3300025942 Bacteria 1849
345 Ga0207661_10323747 3300025944 Unclassified 1386
346 Ga0207679_10045086 3300025945 Bacteria 3187
347 Ga0207667_10043411 3300025949 Bacteria 4771
348 Ga0207651_10131712 3300025960 Bacteria 1915
349 Ga0207712_10078488 3300025961 Bacteria 2396
350 Ga0207712_10082165 3300025961 Bacteria 2348
351 Ga0207712_10499441 3300025961 Bacteria 1040
352 Ga0207668_10096569 3300025972 Bacteria 2185
353 Ga0207668_10128671 3300025972 Unclassified 1930
354 Ga0207668_10172902 3300025972 Bacteria 1696
355 Ga0207640_10598187 3300025981 Bacteria 933
356 Ga0207677_10067037 3300026023 Bacteria 2513
357 Ga0207677_10157147 3300026023 Bacteria 1762
358 Ga0207678_10073770 3300026067 Bacteria 2924
359 Ga0207678_10094897 3300026067 Bacteria 2549
360 Ga0207678_10308547 3300026067 Unclassified 1360
361 Ga0207708_10001608 3300026075 Bacteria 16828
362 Ga0207708_10006647 3300026075 Bacteria 8555
363 Ga0207708_10055758 3300026075 Bacteria 3013
364 Ga0207708_10087051 3300026075 Bacteria 2405
365 Ga0207708_10239186 3300026075 Bacteria 1460
366 Ga0207702_10023714 3300026078 Bacteria 5090
367 Ga0207702_10090343 3300026078 Bacteria 2680
368 Ga0207702_10169476 3300026078 Bacteria 2001
369 Ga0207702_10170408 3300026078 Bacteria 1996
370 Ga0207702_10175810 3300026078 Bacteria 1967
371 Ga0207641_10009676 3300026088 Bacteria 7941
372 Ga0207648_10002938 3300026089 Bacteria 18038
373 Ga0207648_10022072 3300026089 Bacteria 5718
374 Ga0207648_10078940 3300026089 Bacteria 2872
375 Ga0207648_10294015 3300026089 Unclassified 1455
376 Ga0207648_10484094 3300026089 Bacteria 1130
377 Ga0207676_10121440 3300026095 Bacteria 2204
378 Ga0207676_10506138 3300026095 Bacteria 1147
379 Ga0207674_10002510 3300026116 Bacteria 23138
380 Ga0207674_10002573 3300026116 Bacteria 22845
381 Ga0207674_10024468 3300026116 Bacteria 6453
382 Ga0207674_10061131 3300026116 Bacteria 3807
383 Ga0207675_100001956 3300026118 Bacteria 20587
384 Ga0207675_100005728 3300026118 Bacteria 11889
385 Ga0207675_100075423 3300026118 Bacteria 3157
386 Ga0207683_10006879 3300026121 Bacteria 9740
387 Ga0207683_10007217 3300026121 Bacteria 9528
388 Ga0207683_10045061 3300026121 Bacteria 3857
389 Ga0207683_10184222 3300026121 Unclassified 1894
390 Ga0207428_10000677 3300027907 Bacteria 39885
391 Ga0207428_10001781 3300027907 Bacteria 22060
392 Ga0207428_10003568 3300027907 Bacteria 15031
393 Ga0207428_10039435 3300027907 Bacteria 3836
394 Ga0207428_10046080 3300027907 Bacteria 3508
395 Ga0268266_10334699 3300028379 Bacteria 1420
396 Ga0268265_10106248 3300028380 Bacteria 2280
397 Ga0268265_10205737 3300028380 Bacteria 1711
398 Ga0268265_10832424 3300028380 Bacteria 902
399 Ga0268264_10048357 3300028381 Bacteria 3538
400 Ga0268264_10154737 3300028381 Bacteria 2059
401 Ga0268264_10218176 3300028381 Bacteria 1754
402 Ga0268264_10324821 3300028381 Unclassified 1456
403 Ga0307405_10127801 3300031731 Bacteria 1751
404 Ga0307405_10150169 3300031731 Unclassified 1637
405 Ga0307413_10441711 3300031824 Bacteria 1030
406 Ga0307416_100100906 3300032002 Unclassified 2512
407 Ga0307415_100370090 3300032126 Unclassified 1213
408 Ga0373948_0049470 3300034817 Bacteria 900
409 Ga0373950_0002657 3300034818 Bacteria 2482
410 Ga0373958_0002312 3300034819 Bacteria 2656
411 Ga0373959_0034270 3300034820 Bacteria 1039
412 Ga0373959_0055272 3300034820 Bacteria 867
413 Ga0373938_0002500 3300034957 Unclassified 2969
414 Ga0373928_0004080 3300035084 Bacteria 2785
415 Ga0373928_0031857 3300035084 Bacteria 1173
416 Ga0373949_0003358 3300035090 Unclassified 3839
417 Ga0373949_0009384 3300035090 Bacteria 2144
418 Ga0373932_0001826 3300035112 Bacteria 5718
419 Ga0373941_0005767 3300035115 Bacteria 2939
420 Ga0373941_0019618 3300035115 Unclassified 1885
421 Ga0373941_0032241 3300035115 Bacteria 1567
422 Ga0373941_0113788 3300035115 Bacteria 957
423 Ga0373960_0005431 3300035121 Bacteria 2953
424 Ga0373960_0016022 3300035121 Bacteria 1922
425 Ga0373960_0017010 3300035121 Bacteria 1878
426 Ga0373943_0008391 3300035170 Bacteria 4636
427 Ga0373946_0018521 3300035171 Bacteria 2675
428 Ga0373942_0037060 3300035207 Bacteria 1316
429 Ga0373942_0052177 3300035207 Bacteria 1150
430 Ga0373961_0005634 3300035241 Unclassified 3006
431 Ga0373962_0013589 3300035242 Unclassified 2065
432 Ga0373931_0014004 3300035691 Unclassified 3913
433 Ga0373931_0112172 3300035691 Unclassified 1548
434 Ga0373931_0113989 3300035691 Bacteria 1537
435 Ga0373947_0002805 3300035725 Bacteria 10416
436 Ga0373925_0016048 3300037068 Bacteria 5422
437 Ga0373925_0022241 3300037068 Bacteria 4624
438 Ga0373925_0235302 3300037068 Bacteria 1466
439 Ga0373925_0311872 3300037068 Unclassified 1272
440 Ga0395899_0003008 3300037312 Bacteria 13460
441 Ga0395899_0027902 3300037312 Bacteria 4252
442 Ga0395899_0035400 3300037312 Unclassified 3748
443 Ga0395899_0036227 3300037312 Bacteria 3701
444 Ga0395899_0138410 3300037312 Bacteria 1734
445 Ga0395899_0272547 3300037312 Bacteria 1154
446 Ga0395899_0308123 3300037312 Bacteria 1070
447 Ga0395900_0002545 3300037418 Bacteria 19969
448 Ga0395900_0004907 3300037418 Bacteria 14086
449 Ga0395900_0016158 3300037418 Bacteria 7602
450 Ga0395900_0016253 3300037418 Bacteria 7583
451 Ga0395900_0053915 3300037418 Bacteria 4139
452 Ga0395900_0107826 3300037418 Bacteria 2861
453 Ga0395900_0179669 3300037418 Bacteria 2151
454 Ga0395900_0315072 3300037418 Bacteria 1546
455 Ga0395900_0377714 3300037418 Bacteria 1386
456 Ga0395900_0414983 3300037418 Bacteria 1308
457 Ga0395900_0489434 3300037418 Bacteria 1182
458 Ga0395898_0002860 3300037466 Bacteria 19703
459 Ga0395898_0004729 3300037466 Bacteria 14820
460 Ga0395898_0008218 3300037466 Bacteria 11036
461 Ga0395898_0013665 3300037466 Bacteria 8353
462 Ga0395898_0131318 3300037466 Bacteria 2399
463 Ga0395898_0596165 3300037466 Bacteria 1047
464 Ga0395905_0003136 3300037471 Bacteria 17816
465 Ga0395905_0004049 3300037471 Bacteria 15373
466 Ga0395905_0033459 3300037471 Bacteria 4828
467 Ga0395905_0049114 3300037471 Unclassified 3953
468 Ga0395905_0102994 3300037471 Bacteria 2680
469 Ga0395905_0395294 3300037471 Bacteria 1277
470 Ga0395905_0536197 3300037471 Bacteria 1071
471 Ga0395905_0550878 3300037471 Bacteria 1054
472 Ga0395905_0697845 3300037471 Unclassified 917
473 Ga0436364_0677119 3300037853 Bacteria 3871
474 Ga0395901_0001407 3300038443 Bacteria 25117
475 Ga0395901_0002611 3300038443 Bacteria 18245
476 Ga0395901_0007150 3300038443 Bacteria 11268
477 Ga0395901_0013743 3300038443 Bacteria 8229
478 Ga0395901_0049334 3300038443 Bacteria 4373
479 Ga0395901_0061347 3300038443 Bacteria 3912
480 Ga0395901_0063344 3300038443 Bacteria 3848
481 Ga0395901_0072010 3300038443 Bacteria 3602
482 Ga0395901_0079798 3300038443 Bacteria 3416
483 Ga0395901_0109293 3300038443 Bacteria 2903
484 Ga0395901_0180697 3300038443 Unclassified 2213
485 Ga0395901_0262999 3300038443 Bacteria 1795
486 Ga0395901_0599276 3300038443 Bacteria 1111
487 Ga0395901_0756359 3300038443 Bacteria 964
488 Ga0242420_023834 3300038996 Bacteria 1106
489 Ga0436365_1193809 3300039437 Bacteria 7696
490 Ga0439450_057375 3300042008 Bacteria 935
491 Ga0439456_022924 3300042013 Bacteria 1323
492 Ga0439435_0072300 3300042436 Bacteria 1023
493 Ga0466966_0210733 3300044684 Unclassified 1174
494 Ga0466964_0041384 3300044706 Bacteria 1863
495 Ga0466959_0015481 3300045049 Bacteria 5557
496 Ga0466959_0189993 3300045049 Bacteria 1434
497 Ga0451576_0017984 3300045051 Bacteria 7757
498 Ga0451576_0120488 3300045051 Bacteria 2731
499 Ga0451576_0594715 3300045051 Bacteria 1163
500 Ga0466967_0021485 3300045976 Bacteria 5244
501 Ga0495603_0003521 3300046455 Bacteria 9320
502 Ga0495603_0246200 3300046455 Unclassified 1029
503 Ga0495629_0001783 3300046459 Bacteria 16883
504 Ga0495641_0001752 3300046461 Bacteria 18080
505 Ga0495641_0066965 3300046461 Bacteria 1615
506 Ga0495580_0024717 3300046472 Bacteria 4395
507 Ga0495582_0000046 3300046473 Bacteria 62677
508 Ga0495582_0023121 3300046473 Bacteria 3400
509 Ga0495605_0150702 3300046474 Unclassified 1038
510 Ga0495639_0010832 3300046475 Bacteria 3927
511 Ga0495584_0019832 3300046491 Bacteria 3416
512 Ga0495585_0251073 3300046492 Unclassified 883
513 Ga0495594_0005092 3300046499 Bacteria 6765
514 Ga0495596_0026310 3300046500 Bacteria 2346
515 Ga0495607_0082757 3300046501 Bacteria 1760
516 Ga0495607_0178103 3300046501 Bacteria 1068
517 Ga0495630_0015682 3300046517 Bacteria 5537
518 Ga0495630_0037841 3300046517 Bacteria 3608
519 Ga0495631_0025017 3300046518 Bacteria 2752
520 Ga0495637_0072285 3300046520 Bacteria 1389
521 Ga0495637_0164808 3300046520 Bacteria 829
522 Ga0495644_0033168 3300046523 Bacteria 1951
523 Ga0495644_0102308 3300046523 Bacteria 1084
524 Ga0495663_0009180 3300046525 Unclassified 2742
525 Ga0495663_0036935 3300046525 Bacteria 1472
526 Ga0495666_0098231 3300046526 Unclassified 1381
527 Ga0495666_0152401 3300046526 Bacteria 1074
528 Ga0495642_0027367 3300046528 Bacteria 2269
529 Ga0495642_0139042 3300046528 Bacteria 1048
530 Ga0495665_0088732 3300046531 Bacteria 1625
531 Ga0495665_0089737 3300046531 Bacteria 1615
532 Ga0495667_0066513 3300046559 Bacteria 2356
533 Ga0495656_0017822 3300046615 Bacteria 2716
534 Ga0495656_0263096 3300046615 Unclassified 874
535 Ga0495656_0304640 3300046615 Bacteria 817
536 Ga0495659_0068575 3300046664 Bacteria 1325
537 Ga0495588_0001448 3300046674 Bacteria 10166
538 Ga0495588_0116517 3300046674 Unclassified 1408
539 Ga0495658_0000392 3300046683 Bacteria 24645
540 Ga0495658_0020824 3300046683 Bacteria 3449
541 Ga0495658_0256497 3300046683 Bacteria 1100
542 Ga0495658_0413318 3300046683 Bacteria 860
543 Ga0495613_0000466 3300046689 Bacteria 34644
544 Ga0495613_0277176 3300046689 Bacteria 1165
545 Ga0495670_0130212 3300046691 Bacteria 1311
546 Ga0495589_0019725 3300046794 Bacteria 3451
547 Ga0495589_0098219 3300046794 Unclassified 1418
548 Ga0495581_0003492 3300047315 Bacteria 9025
549 Ga0495672_0018007 3300047320 Bacteria 4705
550 Ga0495676_0013741 3300047321 Bacteria 7263
551 Ga0495676_0020917 3300047321 Bacteria 5729
552 Ga0495676_0028913 3300047321 Bacteria 4726
553 Ga0495676_0338886 3300047321 Unclassified 1007
554 Ga0495685_075506 3300047447 Unclassified 1126
555 Ga0495614_0008400 3300048089 Bacteria 4593
556 Ga0495615_0046162 3300048090 Unclassified 1106
557 Ga0496100_0009969 3300048903 Bacteria 5361
558 Ga0496100_0038687 3300048903 Bacteria 3024
559 Ga0496100_0102223 3300048903 Unclassified 1977
560 Ga0496100_0133585 3300048903 Unclassified 1751
561 Ga0496100_0242387 3300048903 Bacteria 1331
562 Ga0496100_0484665 3300048903 Bacteria 951
563 Ga0496101_0003207 3300048904 Bacteria 10145
564 Ga0496101_0007809 3300048904 Bacteria 6955
565 Ga0496101_0033934 3300048904 Bacteria 3603
566 Ga0496101_0061592 3300048904 Bacteria 2726
567 Ga0496101_0064839 3300048904 Bacteria 2662
568 Ga0496101_0177446 3300048904 Bacteria 1639
569 Ga0496101_0214939 3300048904 Bacteria 1491
570 Ga0496101_0274906 3300048904 Unclassified 1315
571 Ga0496102_0021593 3300048905 Bacteria 5694
572 Ga0496102_0054480 3300048905 Unclassified 3647
573 Ga0496102_0113109 3300048905 Bacteria 2532
574 Ga0496102_0114292 3300048905 Bacteria 2518
575 Ga0496102_0167333 3300048905 Bacteria 2069
576 Ga0496102_0217841 3300048905 Bacteria 1799
577 Ga0496103_0010233 3300048906 Bacteria 5548
578 Ga0496103_0047946 3300048906 Bacteria 2640
579 Ga0496104_0007945 3300048907 Bacteria 9407
580 Ga0496104_0050672 3300048907 Bacteria 3917
581 Ga0496104_0079265 3300048907 Bacteria 3130
582 Ga0496104_0093148 3300048907 Unclassified 2881
583 Ga0496105_0001914 3300048908 Bacteria 14954
584 Ga0496105_0016257 3300048908 Bacteria 5938
585 Ga0496105_0017456 3300048908 Bacteria 5756
586 Ga0496105_0039033 3300048908 Bacteria 3912
587 Ga0496106_0009322 3300048909 Bacteria 7256
588 Ga0496106_0028534 3300048909 Bacteria 4157
589 Ga0496106_0084186 3300048909 Unclassified 2447
590 Ga0496107_0005857 3300048910 Bacteria 8414
591 Ga0496107_0030422 3300048910 Bacteria 3848
592 Ga0496107_0043111 3300048910 Bacteria 3241
593 Ga0496107_0228138 3300048910 Unclassified 1385
594 Ga0496107_0333178 3300048910 Unclassified 1129
595 Ga0496108_0002151 3300048911 Bacteria 15780
596 Ga0496108_0015849 3300048911 Bacteria 6144
597 Ga0496108_0067015 3300048911 Bacteria 3028
598 Ga0496109_0008507 3300048912 Bacteria 8725
599 Ga0496109_0016026 3300048912 Bacteria 6550
600 Ga0496109_0025127 3300048912 Bacteria 5305
601 Ga0496109_0039594 3300048912 Bacteria 4267
602 Ga0496109_0044581 3300048912 Bacteria 4023
603 Ga0496109_0044829 3300048912 Bacteria 4012
604 Ga0496109_0049293 3300048912 Bacteria 3833
605 Ga0496109_0110512 3300048912 Bacteria 2555
606 Ga0496109_0158195 3300048912 Bacteria 2122
607 Ga0496109_0375837 3300048912 Bacteria 1342
608 Ga0496109_0539739 3300048912 Bacteria 1100
609 Ga0496110_0008459 3300048913 Bacteria 8282
610 Ga0496110_0010897 3300048913 Bacteria 7412
611 Ga0496110_0011941 3300048913 Bacteria 7135
612 Ga0496110_0028852 3300048913 Bacteria 4769
613 Ga0496110_0060301 3300048913 Unclassified 3345
614 Ga0496110_0083846 3300048913 Bacteria 2844
615 Ga0496110_0211487 3300048913 Unclassified 1763
616 Ga0496110_0259534 3300048913 Bacteria 1581
617 Ga0496110_0814370 3300048913 Unclassified 838
618 Ga0496111_0000412 3300048914 Bacteria 21482
619 Ga0496111_0002040 3300048914 Bacteria 12017
620 Ga0496111_0003390 3300048914 Bacteria 9853
621 Ga0496111_0006871 3300048914 Bacteria 7426
622 Ga0496111_0050907 3300048914 Bacteria 2989
623 Ga0496111_0153618 3300048914 Bacteria 1708
624 Ga0496111_0179655 3300048914 Unclassified 1573
625 Ga0496112_0017997 3300048915 Bacteria 6649
626 Ga0496112_0027781 3300048915 Bacteria 5457
627 Ga0496112_0038723 3300048915 Bacteria 4657
628 Ga0496112_0044930 3300048915 Bacteria 4329
629 Ga0496112_0294698 3300048915 Bacteria 1568
630 Ga0496112_0390919 3300048915 Bacteria 1331
631 Ga0496113_0003830 3300048916 Bacteria 9101
632 Ga0496113_0011816 3300048916 Bacteria 5849
633 Ga0496113_0015551 3300048916 Bacteria 5235
634 Ga0496113_0018202 3300048916 Bacteria 4891
635 Ga0496113_0284703 3300048916 Bacteria 1322
636 Ga0496113_0389657 3300048916 Bacteria 1118
637 Ga0496113_0392941 3300048916 Unclassified 1113
638 Ga0496114_0032611 3300048917 Bacteria 4288
639 Ga0496114_0032959 3300048917 Bacteria 4266
640 Ga0496114_0220339 3300048917 Unclassified 1665
641 Ga0496114_0231540 3300048917 Bacteria 1623
642 Ga0496114_0295584 3300048917 Bacteria 1429
643 Ga0496115_0015970 3300048918 Bacteria 5708
644 Ga0496115_0025433 3300048918 Bacteria 4608
645 Ga0496115_0071383 3300048918 Bacteria 2816
646 Ga0501031_0000110 3300049568 Bacteria 43369
647 Ga0501031_0002523 3300049568 Bacteria 11655
648 Ga0501031_0241417 3300049568 Bacteria 1174
649 Ga0501032_0002808 3300049569 Bacteria 13538
650 Ga0501033_0012655 3300049570 Bacteria 6435
651 Ga0501033_0051916 3300049570 Bacteria 3039
652 Ga0501034_0014796 3300049571 Bacteria 8028
653 Ga0501034_0039823 3300049571 Bacteria 4759
654 Ga0501036_0000848 3300049572 Bacteria 22769
655 Ga0501036_0059348 3300049572 Bacteria 3241
656 Ga0501037_0001347 3300049573 Bacteria 18047
657 Ga0501037_0002198 3300049573 Bacteria 14096
658 Ga0501037_0023626 3300049573 Bacteria 4545
659 Ga0501037_0115338 3300049573 Bacteria 1933
660 Ga0501038_0000237 3300049574 Bacteria 46387
661 Ga0501038_0003056 3300049574 Bacteria 15605
662 Ga0501038_0040534 3300049574 Bacteria 4066
663 Ga0501038_0175405 3300049574 Bacteria 1732
664 Ga0501039_0000285 3300049575 Bacteria 36222
665 Ga0501039_0020218 3300049575 Bacteria 5104
666 Ga0501039_0034948 3300049575 Bacteria 3879
667 Ga0501040_0000576 3300049576 Bacteria 22338
668 Ga0501040_0002203 3300049576 Bacteria 12542
669 Ga0501040_0037258 3300049576 Bacteria 3303
670 Ga0501040_0065544 3300049576 Bacteria 2501
671 Ga0501040_0104439 3300049576 Bacteria 1979
672 Ga0501040_0251674 3300049576 Bacteria 1260
673 Ga0501041_0001246 3300049577 Bacteria 13952
674 Ga0501041_0007464 3300049577 Bacteria 6417
675 Ga0501041_0084237 3300049577 Bacteria 1959
676 Ga0501042_0000013 3300049578 Bacteria 53996
677 Ga0501042_0015921 3300049578 Bacteria 5156
678 Ga0501042_0113119 3300049578 Bacteria 1954
679 Ga0501042_0274373 3300049578 Unclassified 1217
680 Ga0501043_0001144 3300049579 Bacteria 23348
681 Ga0501043_0020340 3300049579 Bacteria 5206
682 Ga0501043_0038719 3300049579 Bacteria 3749
683 Ga0501043_0044465 3300049579 Bacteria 3492
684 Ga0501046_0001149 3300049580 Bacteria 25728
685 Ga0501046_0007119 3300049580 Bacteria 9841
686 Ga0501046_0032829 3300049580 Bacteria 4199
687 Ga0501046_0068158 3300049580 Bacteria 2769
688 Ga0501046_0329069 3300049580 Bacteria 1112
689 Ga0501047_0000927 3300049581 Bacteria 29952
690 Ga0501048_0000042 3300049582 Bacteria 62023
691 Ga0501048_0006175 3300049582 Bacteria 9118
692 Ga0501048_0072605 3300049582 Bacteria 2429
693 Ga0501048_0201043 3300049582 Bacteria 1412
694 Ga0501067_0003510 3300049583 Bacteria 8622
695 Ga0501067_0023275 3300049583 Bacteria 3433
696 Ga0501068_0000199 3300049584 Bacteria 28546
697 Ga0501068_0034378 3300049584 Bacteria 3022
698 Ga0501068_0041296 3300049584 Bacteria 2771
699 Ga0501068_0042859 3300049584 Bacteria 2721
700 Ga0501069_0001814 3300049585 Bacteria 10677
701 Ga0501069_0095963 3300049585 Bacteria 1679
702 Ga0501070_0005526 3300049586 Bacteria 10780
703 Ga0501070_0009629 3300049586 Bacteria 8165
704 Ga0501071_0000384 3300049587 Bacteria 21781
705 Ga0501071_0111562 3300049587 Unclassified 2021
706 Ga0501071_0203756 3300049587 Bacteria 1486
707 Ga0501071_0527894 3300049587 Unclassified 906
708 Ga0501072_0002936 3300049588 Bacteria 12825
709 Ga0501072_0017435 3300049588 Bacteria 5516
710 Ga0501072_0030419 3300049588 Bacteria 4222
711 Ga0501072_0110375 3300049588 Unclassified 2189
712 Ga0501072_0206107 3300049588 Bacteria 1568
713 Ga0501073_0001106 3300049589 Bacteria 19561
714 Ga0501073_0025007 3300049589 Bacteria 4285
715 Ga0501073_0166853 3300049589 Bacteria 1524
716 Ga0501074_0008119 3300049590 Bacteria 7606
717 Ga0501074_0080429 3300049590 Bacteria 2338
718 Ga0501074_0196311 3300049590 Bacteria 1438
719 Ga0501074_0216240 3300049590 Bacteria 1365
720 Ga0501075_0000032 3300049591 Bacteria 56088
721 Ga0501075_0026946 3300049591 Bacteria 4233
722 Ga0501075_0027117 3300049591 Bacteria 4220
723 Ga0501075_0064142 3300049591 Bacteria 2770
724 Ga0501076_0001224 3300049592 Bacteria 17055
725 Ga0501076_0058833 3300049592 Unclassified 3055
726 Ga0501076_0093765 3300049592 Bacteria 2416
727 Ga0501077_0002257 3300049593 Bacteria 11624
728 Ga0501077_0006095 3300049593 Bacteria 7359
729 Ga0501077_0021209 3300049593 Bacteria 4111
730 Ga0501077_0038619 3300049593 Bacteria 3041
731 Ga0501077_0149880 3300049593 Bacteria 1480
732 Ga0501077_0155745 3300049593 Bacteria 1450
733 Ga0501077_0202952 3300049593 Bacteria 1259
734 Ga0501249_065184 3300049679 Bacteria 847
735 Ga0501079_0000096 3300049741 Bacteria 43720
736 Ga0501079_0001183 3300049741 Bacteria 18298
737 Ga0501079_0014139 3300049741 Bacteria 6083
738 Ga0501079_0137930 3300049741 Bacteria 1899
739 Ga0501079_0641460 3300049741 Bacteria 836
740 Ga0501080_0000105 3300049742 Bacteria 57665
741 Ga0501080_0035887 3300049742 Bacteria 4628
742 Ga0501080_0345802 3300049742 Bacteria 1343
743 Ga0501080_0663494 3300049742 Unclassified 922
744 Ga0501081_0000180 3300049743 Bacteria 30061
745 Ga0501081_0010256 3300049743 Bacteria 6116
746 Ga0501081_0019424 3300049743 Bacteria 4525
747 Ga0501081_0025883 3300049743 Bacteria 3951
748 Ga0501081_0036374 3300049743 Bacteria 3357
749 Ga0501081_0163996 3300049743 Bacteria 1602
750 Ga0501081_0343629 3300049743 Bacteria 1099
751 Ga0501081_0434632 3300049743 Bacteria 974
752 Ga0501083_0000081 3300049744 Bacteria 64501
753 Ga0501083_0006567 3300049744 Bacteria 8253
754 Ga0501035_0001604 3300049822 Bacteria 22883
755 Ga0501035_0005200 3300049822 Bacteria 12314
756 Ga0501035_0212790 3300049822 Bacteria 1653
757 Ga0501044_0025046 3300049823 Bacteria 6327
758 Ga0501044_0050811 3300049823 Bacteria 4277
759 Ga0501044_0190642 3300049823 Bacteria 2013
760 Ga0501045_0000194 3300049824 Bacteria 34373
761 Ga0501045_0014884 3300049824 Bacteria 5517
762 Ga0501045_0056197 3300049824 Bacteria 2878
763 Ga0501045_0057695 3300049824 Bacteria 2841
764 Ga0501045_0075235 3300049824 Bacteria 2487
765 nmdc:mga00v17_46279_c1 3300050491 Bacteria 2632
766 nmdc:mga0yw44_202250_c1 3300050492 Bacteria 1312
767 nmdc:mga05p37_23774_c1 3300050507 Bacteria 3660
768 nmdc:mga05p37_248416_c1 3300050507 Bacteria 2135
769 nmdc:mga05p37_516917_c1 3300050507 Bacteria 1367
770 nmdc:mga05p37_782_c1 3300050507 Bacteria 35364
771 nmdc:mga05p37_8278_c1 3300050507 Bacteria 12297
772 nmdc:mga05p37_91832_c1 3300050507 Bacteria 3741
773 nmdc:mga09592_3984_c1 3300050508 Bacteria 11899
774 nmdc:mga09592_93624_c1 3300050508 Bacteria 2570
775 nmdc:mga0qj67_113371_c1 3300050509 Bacteria 2189
776 nmdc:mga0qj67_128029_c1 3300050509 Bacteria 2055
777 nmdc:mga0qj67_241436_c1 3300050509 Bacteria 1466
778 nmdc:mga0qj67_25424_c1 3300050509 Bacteria 4575
779 nmdc:mga0qj67_36354_c1 3300050509 Bacteria 3852
780 nmdc:mga0qj67_75828_c1 3300050509 Bacteria 2689
781 nmdc:mga06r32_101759_c1 3300050510 Bacteria 2820
782 nmdc:mga06r32_285921_c1 3300050510 Bacteria 1636
783 nmdc:mga06r32_6240_c1 3300050510 Bacteria 10700
784 nmdc:mga06r32_701346_c1 3300050510 Bacteria 978
785 nmdc:mga08y16_46277_c1 3300050511 Bacteria 4555
786 nmdc:mga08y16_470585_c1 3300050511 Bacteria 1280
787 nmdc:mga08y16_54942_c1 3300050511 Bacteria 4162
788 nmdc:mga08y16_6329_c1 3300050511 Bacteria 12416
789 nmdc:mga08y16_736813_c1 3300050511 Bacteria 983
790 nmdc:mga0n895_148945_c1 3300050512 Bacteria 2370
791 nmdc:mga0n895_298364_c1 3300050512 Bacteria 1634
792 nmdc:mga0n895_359870_c1 3300050512 Bacteria 1474
793 nmdc:mga0n895_51598_c1 3300050512 Bacteria 4035
794 nmdc:mga0n895_54468_c1 3300050512 Unclassified 3935
795 nmdc:mga0n895_5857_c1 3300050512 Bacteria 10333
796 nmdc:mga0rr50_130036_c1 3300050513 Bacteria 2015
797 nmdc:mga0rr50_15083_c1 3300050513 Bacteria 5093
798 nmdc:mga0rr50_22100_c1 3300050513 Bacteria 4359
799 nmdc:mga0rr50_233129_c1 3300050513 Bacteria 1524
800 nmdc:mga0rr50_43734_c1 3300050513 Bacteria 3281
801 nmdc:mga08x19_14698_c1 3300050514 Bacteria 4754
802 nmdc:mga08x19_16604_c2 3300050514 Bacteria 1813
803 nmdc:mga08x19_345218_c1 3300050514 Bacteria 1039
804 nmdc:mga08x19_6908_c1 3300050514 Bacteria 6741
805 nmdc:mga0a205_113418_c1 3300050515 Bacteria 2610
806 nmdc:mga0a205_12986_c1 3300050515 Bacteria 7732
807 nmdc:mga0a205_82931_c1 3300050515 Bacteria 3097
808 Ga0495601_0073853 3300053077 Bacteria 2181
809 Ga0495655_0070373 3300053083 Unclassified 977
810 Ga0495595_0197559 3300053084 Bacteria 1001
811 Ga0501084_0000642 3300054114 Bacteria 26592
812 Ga0501084_0004452 3300054114 Bacteria 11438
813 Ga0501084_0032360 3300054114 Bacteria 4374
814 Ga0501084_0157177 3300054114 Bacteria 1918
815 Ga0501082_0001914 3300060353 Bacteria 18294
816 Ga0501082_0002192 3300060353 Bacteria 17101
817 Ga0501082_0062260 3300060353 Bacteria 3211
818 Ga0501082_0091118 3300060353 Bacteria 2632
819 Ga0501082_0100973 3300060353 Bacteria 2495
820 Ga0501082_0101986 3300060353 Bacteria 2483
821 Ga0501082_0204282 3300060353 Unclassified 1719
822 Ga0501082_0232802 3300060353 Bacteria 1603
823 Ga0530510_0001349 3300061734 Bacteria 16423
824 Ga0530510_0003318 3300061734 Bacteria 11072
825 Ga0530510_0009789 3300061734 Bacteria 6726
826 Ga0530510_0031808 3300061734 Bacteria 3794
827 Ga0530510_0072226 3300061734 Bacteria 2504
828 Ga0530510_0072382 3300061734 Bacteria 2501
829 Ga0501032_0266365
830 JGI24751J29686_10000700
831 JGI25407J50210_10002835
832 Ga0070676_10149857
833 Ga0070683_100044810
834 Ga0070683_100100193
835 Ga0070690_100047913
836 Ga0070690_100109945
837 Ga0070670_100689956
838 Ga0070677_10045842
839 Ga0068869_100095873
840 Ga0070680_100071905
841 Ga0070682_100064611
842 Ga0068868_100168965
843 Ga0070660_100404882
844 Ga0070689_100210873
845 Ga0070691_10011801
846 Ga0070687_100117925
847 Ga0070661_100013685
848 Ga0070661_100094597
849 Ga0070692_10032084
850 Ga0070692_10162161
851 Ga0070668_100055241
852 Ga0070668_100232903
853 Ga0070669_100048987
854 Ga0070675_100026048
855 Ga0070675_100770916
856 Ga0070671_100064736
857 Ga0070673_100146019
858 Ga0070688_100006481
859 Ga0070659_100402659
860 Ga0070667_100174377
861 Ga0070703_10011929
862 Ga0070709_10109500
863 Ga0070714_100032783
864 Ga0070713_100092946
865 Ga0070710_10029427
866 Ga0070710_10059018
867 Ga0070710_10127993
868 Ga0070701_10011678
869 Ga0070701_10086611
870 Ga0070701_10285324
871 Ga0070711_100037538
872 Ga0070705_100015924
873 Ga0070705_100032998
874 Ga0070705_100082675
875 Ga0070700_100018370
876 Ga0070700_100020942
877 Ga0070700_100041153
878 Ga0070700_100216507
879 Ga0070694_100095759
880 Ga0070694_100187991
881 Ga0070694_100208461
882 Ga0070694_100267670
883 Ga0070708_100035691
884 Ga0070708_100046365
885 Ga0070708_100077637
886 Ga0070708_100408808
887 Ga0070663_100186509
888 Ga0070663_100187611
889 Ga0070663_100208962
890 Ga0070663_100553567
891 Ga0070678_100020914
892 Ga0070678_100038279
893 Ga0070678_100235770
894 Ga0070706_100069253
895 Ga0070706_100080458
896 Ga0070706_100143031
897 Ga0070706_100177515
898 Ga0070707_100001269
899 Ga0070707_100005768
900 Ga0070707_100063543
901 Ga0070707_100548942
902 Ga0070707_100549987
903 Ga0070698_100013492
904 Ga0070698_100015114
905 Ga0070698_100050879
906 Ga0070698_100149148
907 Ga0070698_100237995
908 Ga0070699_100008164
909 Ga0070699_100017455
910 Ga0070699_100062894
911 Ga0070699_100113585
912 Ga0070679_100002322
913 Ga0070679_100357076
914 Ga0070684_100001333
915 Ga0070684_100023606
916 Ga0070684_100238387
917 Ga0070697_100335315
918 Ga0068853_100186390
919 Ga0070672_100073290
920 Ga0070686_100023802
921 Ga0070686_100058111
922 Ga0070695_100247655
923 Ga0070695_100286999
924 Ga0070696_100016581
925 Ga0070696_100129979
926 Ga0070696_100130198
927 Ga0070696_100377539
928 Ga0070693_100000985
929 Ga0070693_100049896
930 Ga0070693_100109006
931 Ga0070704_100403854
932 Ga0068855_100037605
933 Ga0068855_100545613
934 Ga0068855_100755280
935 Ga0070664_100040186
936 Ga0070664_100291863
937 Ga0070664_100414415
938 Ga0068857_100008660
939 Ga0068857_100106533
940 Ga0068857_100163784
941 Ga0068857_100401434
942 Ga0068854_100176424
943 Ga0068856_100049450
944 Ga0068856_100077950
945 Ga0068856_100125130
946 Ga0068856_100129730
947 Ga0070702_100017566
948 Ga0070702_100038165
949 Ga0070702_100243752
950 Ga0070702_100527757
951 Ga0068852_100148632
952 Ga0068852_100224010
953 Ga0068859_100018378
954 Ga0068864_100010882
955 Ga0068864_100171340
956 Ga0068864_100454207
957 Ga0068866_10100334
958 Ga0068866_10242894
959 Ga0068861_100010653
960 Ga0068861_100099612
961 Ga0068851_10119004
962 Ga0068870_10003709
963 Ga0068863_100095332
964 Ga0068858_100241069
965 Ga0068860_100116180
966 Ga0068860_100132309
967 Ga0068862_100294877
968 Ga0068862_100315427
969 Ga0081455_10005485
970 Ga0081455_10005503
971 Ga0081455_10025164
972 Ga0081455_10038422
973 Ga0081455_10048335
974 Ga0081538_10000089
975 Ga0081538_10000245
976 Ga0081538_10001308
977 Ga0081538_10001549
978 Ga0081538_10001642
979 Ga0081538_10014744
980 Ga0081538_10016976
981 Ga0081538_10019498
982 Ga0081540_1004845
983 Ga0081539_10002069
984 Ga0081539_10003486
985 Ga0081539_10102143
986 Ga0070717_10112606
987 Ga0075365_10155832
988 Ga0075365_10193739
989 Ga0075364_10420708
990 Ga0075432_10005739
991 Ga0075432_10009868
992 Ga0075432_10047443
993 Ga0070715_10003344
994 Ga0070715_10007785
995 Ga0070715_10012797
996 Ga0070715_10069632
997 Ga0070716_100215355
998 Ga0070716_100243238
999 Ga0070712_100019297
1000 Ga0070712_100035361
1001 Ga0070712_100111525
1002 Ga0075366_10216130
1003 Ga0097621_100029812
1004 Ga0097621_100230231
1005 Ga0068871_100010689
1006 Ga0068871_100138003
1007 Ga0068871_100182216
1008 Ga0075428_100010997
1009 Ga0075428_100012866
1010 Ga0075428_100048126
1011 Ga0075428_100109056
1012 Ga0075428_100340594
1013 Ga0075428_100746647
1014 Ga0075430_100010666
1015 Ga0075430_100026886
1016 Ga0075430_100111993
1017 Ga0075431_100096903
1018 Ga0075431_100317481
1019 Ga0075433_10009272
1020 Ga0075433_10090658
1021 Ga0075433_10206948
1022 Ga0075433_10262686
1023 Ga0075433_10602252
1024 Ga0075434_100019501
1025 Ga0075434_100158749
1026 Ga0075434_100169729
1027 Ga0075434_100238749
1028 Ga0075434_100325516
1029 Ga0075429_100031457
1030 Ga0068865_100008729
1031 Ga0075436_100009847
1032 Ga0075436_100011299
1033 Ga0075436_100178056
1034 Ga0097620_100018376
1035 Ga0075435_100002683
1036 Ga0075435_100021766
1037 Ga0075435_100049004
1038 Ga0075435_100238999
1039 Ga0075435_100257135
1040 Ga0111539_10000579
1041 Ga0111539_10007286
1042 Ga0111539_10017387
1043 Ga0111539_10027803
1044 Ga0111539_10046085
1045 Ga0111539_10176433
1046 Ga0111539_10190636
1047 Ga0111539_10756664
1048 Ga0105245_10004716
1049 Ga0105245_10008329
1050 Ga0105245_10034329
1051 Ga0105245_10054431
1052 Ga0105247_10014964
1053 Ga0114129_10028436
1054 Ga0114129_10069809
1055 Ga0114129_10077327
1056 Ga0114129_10111656
1057 Ga0114129_10148284
1058 Ga0114129_10154381
1059 Ga0114129_10233669
1060 Ga0114129_10236865
1061 Ga0114129_10454029
1062 Ga0114129_10686657
1063 Ga0105243_10005743
1064 Ga0105243_10021509
1065 Ga0105243_10096887
1066 Ga0105243_10304678
1067 Ga0105243_10383286
1068 Ga0105241_10077750
1069 Ga0105241_10555572
1070 Ga0105242_10094515
1071 Ga0105242_10241952
1072 Ga0105248_10319811
1073 Ga0105248_10924734
1074 Ga0105237_10208181
1075 Ga0105238_10197271
1076 Ga0105249_10007425
1077 Ga0105249_10048598
1078 Ga0105249_10059391
1079 Ga0105249_10142593
1080 Ga0105249_10331421
1081 Ga0105239_10048807
1082 Ga0105239_10118367
1083 Ga0105239_10403580
1084 Ga0105239_10840767
1085 Ga0105246_10017021
1086 Ga0157371_10437959
1087 Ga0157374_11183224
1088 Ga0157378_10157307
1089 Ga0163162_10034504
1090 Ga0163162_10073465
1091 Ga0163162_10183446
1092 Ga0157375_10421355
1093 Ga0157375_10466578
1094 Ga0157375_10480204
1095 Ga0163163_10055234
1096 Ga0163163_10072190
1097 Ga0157380_10029265
1098 Ga0157377_10166470
1099 Ga0157377_10362634
1100 Ga0157379_10014155
1101 Ga0157379_10208325
1102 Ga0157376_10015092
1103 Ga0157376_10106649
1104 Ga0163161_10496137
1105 Ga0213876_10005772
1106 Ga0207656_10022769
1107 Ga0207653_10001281
1108 Ga0207653_10019655
1109 Ga0207692_10098042
1110 Ga0207692_10152619
1111 Ga0207642_10054406
1112 Ga0207642_10224017
1113 Ga0207688_10008143
1114 Ga0207688_10031063
1115 Ga0207688_10080712
1116 Ga0207699_10013847
1117 Ga0207699_10036367
1118 Ga0207699_10221283
1119 Ga0207645_10018387
1120 Ga0207645_10090842
1121 Ga0207643_10000527
1122 Ga0207684_10072851
1123 Ga0207684_10086646
1124 Ga0207684_10252637
1125 Ga0207684_10263273
1126 Ga0207654_10166275
1127 Ga0207693_10005408
1128 Ga0207693_10011813
1129 Ga0207693_10021966
1130 Ga0207693_10069084
1131 Ga0207693_10087993
1132 Ga0207693_10386072
1133 Ga0207663_10002883
1134 Ga0207663_10013680
1135 Ga0207663_10014107
1136 Ga0207663_10043586
1137 Ga0207663_10160951
1138 Ga0207660_10052549
1139 Ga0207662_10181687
1140 Ga0207657_10047961
1141 Ga0207649_10431994
1142 Ga0207652_10135455
1143 Ga0207646_10007257
1144 Ga0207646_10059733
1145 Ga0207650_10006885
1146 Ga0207650_10024317
1147 Ga0207659_10095510
1148 Ga0207659_10289286
1149 Ga0207687_10131962
1150 Ga0207687_10146722
1151 Ga0207687_10242239
1152 Ga0207700_10038736
1153 Ga0207700_10099906
1154 Ga0207700_10131655
1155 Ga0207664_10015497
1156 Ga0207664_10020772
1157 Ga0207664_10032523
1158 Ga0207690_10061927
1159 Ga0207706_10045210
1160 Ga0207706_10133067
1161 Ga0207709_10059908
1162 Ga0207709_10141361
1163 Ga0207709_10238285
1164 Ga0207670_10051476
1165 Ga0207704_10088469
1166 Ga0207665_10019918
1167 Ga0207665_10047351
1168 Ga0207665_10153970
1169 Ga0207691_10068532
1170 Ga0207711_10378447
1171 Ga0207689_10126335
1172 Ga0207689_10161033
1173 Ga0207661_10323747
1174 Ga0207679_10045086
1175 Ga0207667_10043411
1176 Ga0207651_10131712
1177 Ga0207712_10078488
1178 Ga0207712_10082165
1179 Ga0207712_10499441
1180 Ga0207668_10096569
1181 Ga0207668_10128671
1182 Ga0207668_10172902
1183 Ga0207640_10598187
1184 Ga0207677_10067037
1185 Ga0207677_10157147
1186 Ga0207678_10073770
1187 Ga0207678_10094897
1188 Ga0207678_10308547
1189 Ga0207708_10001608
1190 Ga0207708_10006647
1191 Ga0207708_10055758
1192 Ga0207708_10087051
1193 Ga0207708_10239186
1194 Ga0207702_10023714
1195 Ga0207702_10090343
1196 Ga0207702_10169476
1197 Ga0207702_10170408
1198 Ga0207702_10175810
1199 Ga0207641_10009676
1200 Ga0207648_10002938
1201 Ga0207648_10022072
1202 Ga0207648_10078940
1203 Ga0207648_10294015
1204 Ga0207648_10484094
1205 Ga0207676_10121440
1206 Ga0207676_10506138
1207 Ga0207674_10002510
1208 Ga0207674_10002573
1209 Ga0207674_10024468
1210 Ga0207674_10061131
1211 Ga0207675_100001956
1212 Ga0207675_100005728
1213 Ga0207675_100075423
1214 Ga0207683_10006879
1215 Ga0207683_10007217
1216 Ga0207683_10045061
1217 Ga0207683_10184222
1218 Ga0207428_10000677
1219 Ga0207428_10001781
1220 Ga0207428_10003568
1221 Ga0207428_10039435
1222 Ga0207428_10046080
1223 Ga0268266_10334699
1224 Ga0268265_10106248
1225 Ga0268265_10205737
1226 Ga0268265_10832424
1227 Ga0268264_10048357
1228 Ga0268264_10154737
1229 Ga0268264_10218176
1230 Ga0268264_10324821
1231 Ga0307405_10127801
1232 Ga0307405_10150169
1233 Ga0307413_10441711
1234 Ga0307416_100100906
1235 Ga0307415_100370090
1236 Ga0373948_0049470
1237 Ga0373950_0002657
1238 Ga0373958_0002312
1239 Ga0373959_0034270
1240 Ga0373959_0055272
1241 Ga0373938_0002500
1242 Ga0373928_0004080
1243 Ga0373928_0031857
1244 Ga0373949_0003358
1245 Ga0373949_0009384
1246 Ga0373932_0001826
1247 Ga0373941_0005767
1248 Ga0373941_0019618
1249 Ga0373941_0032241
1250 Ga0373941_0113788
1251 Ga0373960_0005431
1252 Ga0373960_0016022
1253 Ga0373960_0017010
1254 Ga0373943_0008391
1255 Ga0373946_0018521
1256 Ga0373942_0037060
1257 Ga0373942_0052177
1258 Ga0373961_0005634
1259 Ga0373962_0013589
1260 Ga0373931_0014004
1261 Ga0373931_0112172
1262 Ga0373931_0113989
1263 Ga0373947_0002805
1264 Ga0373925_0016048
1265 Ga0373925_0022241
1266 Ga0373925_0235302
1267 Ga0373925_0311872
1268 Ga0395899_0003008
1269 Ga0395899_0027902
1270 Ga0395899_0035400
1271 Ga0395899_0036227
1272 Ga0395899_0138410
1273 Ga0395899_0272547
1274 Ga0395899_0308123
1275 Ga0395900_0002545
1276 Ga0395900_0004907
1277 Ga0395900_0016158
1278 Ga0395900_0016253
1279 Ga0395900_0053915
1280 Ga0395900_0107826
1281 Ga0395900_0179669
1282 Ga0395900_0315072
1283 Ga0395900_0377714
1284 Ga0395900_0414983
1285 Ga0395900_0489434
1286 Ga0395898_0002860
1287 Ga0395898_0004729
1288 Ga0395898_0008218
1289 Ga0395898_0013665
1290 Ga0395898_0131318
1291 Ga0395898_0596165
1292 Ga0395905_0003136
1293 Ga0395905_0004049
1294 Ga0395905_0033459
1295 Ga0395905_0049114
1296 Ga0395905_0102994
1297 Ga0395905_0395294
1298 Ga0395905_0536197
1299 Ga0395905_0550878
1300 Ga0395905_0697845
1301 Ga0436364_0677119
1302 Ga0395901_0001407
1303 Ga0395901_0002611
1304 Ga0395901_0007150
1305 Ga0395901_0013743
1306 Ga0395901_0049334
1307 Ga0395901_0061347
1308 Ga0395901_0063344
1309 Ga0395901_0072010
1310 Ga0395901_0079798
1311 Ga0395901_0109293
1312 Ga0395901_0180697
1313 Ga0395901_0262999
1314 Ga0395901_0599276
1315 Ga0395901_0756359
1316 Ga0242420_023834
1317 Ga0436365_1193809
1318 Ga0439450_057375
1319 Ga0439456_022924
1320 Ga0439435_0072300
1321 Ga0466966_0210733
1322 Ga0466964_0041384
1323 Ga0466959_0015481
1324 Ga0466959_0189993
1325 Ga0451576_0017984
1326 Ga0451576_0120488
1327 Ga0451576_0594715
1328 Ga0466967_0021485
1329 Ga0495603_0003521
1330 Ga0495603_0246200
1331 Ga0495629_0001783
1332 Ga0495641_0001752
1333 Ga0495641_0066965
1334 Ga0495580_0024717
1335 Ga0495582_0000046
1336 Ga0495582_0023121
1337 Ga0495605_0150702
1338 Ga0495639_0010832
1339 Ga0495584_0019832
1340 Ga0495585_0251073
1341 Ga0495594_0005092
1342 Ga0495596_0026310
1343 Ga0495607_0082757
1344 Ga0495607_0178103
1345 Ga0495630_0015682
1346 Ga0495630_0037841
1347 Ga0495631_0025017
1348 Ga0495637_0072285
1349 Ga0495637_0164808
1350 Ga0495644_0033168
1351 Ga0495644_0102308
1352 Ga0495663_0009180
1353 Ga0495663_0036935
1354 Ga0495666_0098231
1355 Ga0495666_0152401
1356 Ga0495642_0027367
1357 Ga0495642_0139042
1358 Ga0495665_0088732
1359 Ga0495665_0089737
1360 Ga0495667_0066513
1361 Ga0495656_0017822
1362 Ga0495656_0263096
1363 Ga0495656_0304640
1364 Ga0495659_0068575
1365 Ga0495588_0001448
1366 Ga0495588_0116517
1367 Ga0495658_0000392
1368 Ga0495658_0020824
1369 Ga0495658_0256497
1370 Ga0495658_0413318
1371 Ga0495613_0000466
1372 Ga0495613_0277176
1373 Ga0495670_0130212
1374 Ga0495589_0019725
1375 Ga0495589_0098219
1376 Ga0495581_0003492
1377 Ga0495672_0018007
1378 Ga0495676_0013741
1379 Ga0495676_0020917
1380 Ga0495676_0028913
1381 Ga0495676_0338886
1382 Ga0495685_075506
1383 Ga0495614_0008400
1384 Ga0495615_0046162
1385 Ga0496100_0009969
1386 Ga0496100_0038687
1387 Ga0496100_0102223
1388 Ga0496100_0133585
1389 Ga0496100_0242387
1390 Ga0496100_0484665
1391 Ga0496101_0003207
1392 Ga0496101_0007809
1393 Ga0496101_0033934
1394 Ga0496101_0061592
1395 Ga0496101_0064839
1396 Ga0496101_0177446
1397 Ga0496101_0214939
1398 Ga0496101_0274906
1399 Ga0496102_0021593
1400 Ga0496102_0054480
1401 Ga0496102_0113109
1402 Ga0496102_0114292
1403 Ga0496102_0167333
1404 Ga0496102_0217841
1405 Ga0496103_0010233
1406 Ga0496103_0047946
1407 Ga0496104_0007945
1408 Ga0496104_0050672
1409 Ga0496104_0079265
1410 Ga0496104_0093148
1411 Ga0496105_0001914
1412 Ga0496105_0016257
1413 Ga0496105_0017456
1414 Ga0496105_0039033
1415 Ga0496106_0009322
1416 Ga0496106_0028534
1417 Ga0496106_0084186
1418 Ga0496107_0005857
1419 Ga0496107_0030422
1420 Ga0496107_0043111
1421 Ga0496107_0228138
1422 Ga0496107_0333178
1423 Ga0496108_0002151
1424 Ga0496108_0015849
1425 Ga0496108_0067015
1426 Ga0496109_0008507
1427 Ga0496109_0016026
1428 Ga0496109_0025127
1429 Ga0496109_0039594
1430 Ga0496109_0044581
1431 Ga0496109_0044829
1432 Ga0496109_0049293
1433 Ga0496109_0110512
1434 Ga0496109_0158195
1435 Ga0496109_0375837
1436 Ga0496109_0539739
1437 Ga0496110_0008459
1438 Ga0496110_0010897
1439 Ga0496110_0011941
1440 Ga0496110_0028852
1441 Ga0496110_0060301
1442 Ga0496110_0083846
1443 Ga0496110_0211487
1444 Ga0496110_0259534
1445 Ga0496110_0814370
1446 Ga0496111_0000412
1447 Ga0496111_0002040
1448 Ga0496111_0003390
1449 Ga0496111_0006871
1450 Ga0496111_0050907
1451 Ga0496111_0153618
1452 Ga0496111_0179655
1453 Ga0496112_0017997
1454 Ga0496112_0027781
1455 Ga0496112_0038723
1456 Ga0496112_0044930
1457 Ga0496112_0294698
1458 Ga0496112_0390919
1459 Ga0496113_0003830
1460 Ga0496113_0011816
1461 Ga0496113_0015551
1462 Ga0496113_0018202
1463 Ga0496113_0284703
1464 Ga0496113_0389657
1465 Ga0496113_0392941
1466 Ga0496114_0032611
1467 Ga0496114_0032959
1468 Ga0496114_0220339
1469 Ga0496114_0231540
1470 Ga0496114_0295584
1471 Ga0496115_0015970
1472 Ga0496115_0025433
1473 Ga0496115_0071383
1474 Ga0501031_0000110
1475 Ga0501031_0002523
1476 Ga0501031_0241417
1477 Ga0501032_0002808
1478 Ga0501033_0012655
1479 Ga0501033_0051916
1480 Ga0501034_0014796
1481 Ga0501034_0039823
1482 Ga0501036_0000848
1483 Ga0501036_0059348
1484 Ga0501037_0001347
1485 Ga0501037_0002198
1486 Ga0501037_0023626
1487 Ga0501037_0115338
1488 Ga0501038_0000237
1489 Ga0501038_0003056
1490 Ga0501038_0040534
1491 Ga0501038_0175405
1492 Ga0501039_0000285
1493 Ga0501039_0020218
1494 Ga0501039_0034948
1495 Ga0501040_0000576
1496 Ga0501040_0002203
1497 Ga0501040_0037258
1498 Ga0501040_0065544
1499 Ga0501040_0104439
1500 Ga0501040_0251674
1501 Ga0501041_0001246
1502 Ga0501041_0007464
1503 Ga0501041_0084237
1504 Ga0501042_0000013
1505 Ga0501042_0015921
1506 Ga0501042_0113119
1507 Ga0501042_0274373
1508 Ga0501043_0001144
1509 Ga0501043_0020340
1510 Ga0501043_0038719
1511 Ga0501043_0044465
1512 Ga0501046_0001149
1513 Ga0501046_0007119
1514 Ga0501046_0032829
1515 Ga0501046_0068158
1516 Ga0501046_0329069
1517 Ga0501047_0000927
1518 Ga0501048_0000042
1519 Ga0501048_0006175
1520 Ga0501048_0072605
1521 Ga0501048_0201043
1522 Ga0501067_0003510
1523 Ga0501067_0023275
1524 Ga0501068_0000199
1525 Ga0501068_0034378
1526 Ga0501068_0041296
1527 Ga0501068_0042859
1528 Ga0501069_0001814
1529 Ga0501069_0095963
1530 Ga0501070_0005526
1531 Ga0501070_0009629
1532 Ga0501071_0000384
1533 Ga0501071_0111562
1534 Ga0501071_0203756
1535 Ga0501071_0527894
1536 Ga0501072_0002936
1537 Ga0501072_0017435
1538 Ga0501072_0030419
1539 Ga0501072_0110375
1540 Ga0501072_0206107
1541 Ga0501073_0001106
1542 Ga0501073_0025007
1543 Ga0501073_0166853
1544 Ga0501074_0008119
1545 Ga0501074_0080429
1546 Ga0501074_0196311
1547 Ga0501074_0216240
1548 Ga0501075_0000032
1549 Ga0501075_0026946
1550 Ga0501075_0027117
1551 Ga0501075_0064142
1552 Ga0501076_0001224
1553 Ga0501076_0058833
1554 Ga0501076_0093765
1555 Ga0501077_0002257
1556 Ga0501077_0006095
1557 Ga0501077_0021209
1558 Ga0501077_0038619
1559 Ga0501077_0149880
1560 Ga0501077_0155745
1561 Ga0501077_0202952
1562 Ga0501249_065184
1563 Ga0501079_0000096
1564 Ga0501079_0001183
1565 Ga0501079_0014139
1566 Ga0501079_0137930
1567 Ga0501079_0641460
1568 Ga0501080_0000105
1569 Ga0501080_0035887
1570 Ga0501080_0345802
1571 Ga0501080_0663494
1572 Ga0501081_0000180
1573 Ga0501081_0010256
1574 Ga0501081_0019424
1575 Ga0501081_0025883
1576 Ga0501081_0036374
1577 Ga0501081_0163996
1578 Ga0501081_0343629
1579 Ga0501081_0434632
1580 Ga0501083_0000081
1581 Ga0501083_0006567
1582 Ga0501035_0001604
1583 Ga0501035_0005200
1584 Ga0501035_0212790
1585 Ga0501044_0025046
1586 Ga0501044_0050811
1587 Ga0501044_0190642
1588 Ga0501045_0000194
1589 Ga0501045_0014884
1590 Ga0501045_0056197
1591 Ga0501045_0057695
1592 Ga0501045_0075235
1593 nmdc:mga00v17_46279_c1
1594 nmdc:mga0yw44_202250_c1
1595 nmdc:mga05p37_23774_c1
1596 nmdc:mga05p37_248416_c1
1597 nmdc:mga05p37_516917_c1
1598 nmdc:mga05p37_782_c1
1599 nmdc:mga05p37_8278_c1
1600 nmdc:mga05p37_91832_c1
1601 nmdc:mga09592_3984_c1
1602 nmdc:mga09592_93624_c1
1603 nmdc:mga0qj67_113371_c1
1604 nmdc:mga0qj67_128029_c1
1605 nmdc:mga0qj67_241436_c1
1606 nmdc:mga0qj67_25424_c1
1607 nmdc:mga0qj67_36354_c1
1608 nmdc:mga0qj67_75828_c1
1609 nmdc:mga06r32_101759_c1
1610 nmdc:mga06r32_285921_c1
1611 nmdc:mga06r32_6240_c1
1612 nmdc:mga06r32_701346_c1
1613 nmdc:mga08y16_46277_c1
1614 nmdc:mga08y16_470585_c1
1615 nmdc:mga08y16_54942_c1
1616 nmdc:mga08y16_6329_c1
1617 nmdc:mga08y16_736813_c1
1618 nmdc:mga0n895_148945_c1
1619 nmdc:mga0n895_298364_c1
1620 nmdc:mga0n895_359870_c1
1621 nmdc:mga0n895_51598_c1
1622 nmdc:mga0n895_54468_c1
1623 nmdc:mga0n895_5857_c1
1624 nmdc:mga0rr50_130036_c1
1625 nmdc:mga0rr50_15083_c1
1626 nmdc:mga0rr50_22100_c1
1627 nmdc:mga0rr50_233129_c1
1628 nmdc:mga0rr50_43734_c1
1629 nmdc:mga08x19_14698_c1
1630 nmdc:mga08x19_16604_c2
1631 nmdc:mga08x19_345218_c1
1632 nmdc:mga08x19_6908_c1
1633 nmdc:mga0a205_113418_c1
1634 nmdc:mga0a205_12986_c1
1635 nmdc:mga0a205_82931_c1
1636 Ga0495601_0073853
1637 Ga0495655_0070373
1638 Ga0495595_0197559
1639 Ga0501084_0000642
1640 Ga0501084_0004452
1641 Ga0501084_0032360
1642 Ga0501084_0157177
1643 Ga0501082_0001914
1644 Ga0501082_0002192
1645 Ga0501082_0062260
1646 Ga0501082_0091118
1647 Ga0501082_0100973
1648 Ga0501082_0101986
1649 Ga0501082_0204282
1650 Ga0501082_0232802
1651 Ga0530510_0001349
1652 Ga0530510_0003318
1653 Ga0530510_0009789
1654 Ga0530510_0031808
1655 Ga0530510_0072226
1656 Ga0530510_0072382

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7342 17 190
3aqc-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6455 20 187
4tq6-assembly2.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6065 20 242
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.6001 19 190
5zlf-assembly2.cif.gz_D crystal structure of octaprenyl pyrophosphate synthase from escherichia coli with ligand bph-629 0.5966 34 236
ID Description Score Start End Superfamily
af_Q2FZM0_17_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8711 25 164 1.10.357.140
af_Q12887_160_330_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8067 30 177 1.10.357.140
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8037 30 164 1.10.357.140
af_A0A0R0IQ72_105_369_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7602 34 190 1.20.1070.10
af_Q57727_14_160_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.7599 25 158 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A2N0L117-F1-model_v4 Uncharacterized protein 0.9916 4 242 GO:0016020
AF-A0A160VBF6-F1-model_v4 Prepilin type IV endopeptidase peptidase domain-containing protein 0.9912 40 242 GO:0016020
AF-A0A1Q6XDR5-F1-model_v4 Prenyltransferase 0.991 7 243 GO:0016020
AF-A0A1Q7DBQ0-F1-model_v4 Methyltransferase domain-containing protein 0.9897 24 242 GO:0008168
GO:0016020
GO:0032259
AF-A0A7V1XP36-F1-model_v4 Uncharacterized protein 0.9896 5 243 GO:0016020

Map