F482431

General Info

Members Datasets Scaffolds Average Seq Length
825 464 1650 108

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10622653|Ga0207699_106226531
Length 115
Sequence MTDDDDASVENIPGAAVPTGAVSKDLLIINKRGLHARASAKFVQMVERFTSEVWVTRGSETVGGRSIMGLMMLAAGPGTTVTVSAIGPDAEQAITAITELVESKFNVRILATLFG

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
84 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
180 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
181 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
199 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
200 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
211 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
220 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
241 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
242 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
243 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
249 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
250 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
251 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
259 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
260 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
264 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
271 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
288 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
294 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
295 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
302 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
303 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
304 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
324 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
325 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
326 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
329 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
339 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
340 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
341 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
357 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
374 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
387 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
388 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
389 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
390 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
391 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
392 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
393 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
394 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
395 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
396 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
397 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
398 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
399 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
400 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
401 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
402 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
403 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
404 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
405 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
406 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
407 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
408 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
409 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
410 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
411 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
412 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
413 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
414 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
415 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
416 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
417 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
418 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
419 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
420 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
421 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
422 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
423 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
424 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
425 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
426 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
427 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
428 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
429 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
430 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
431 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
432 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
433 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
434 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
435 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
436 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
437 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
438 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
439 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
440 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
441 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
442 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
443 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
444 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
445 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
446 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
447 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
448 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
449 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
450 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
451 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
452 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
453 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
454 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
455 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
456 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
457 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
458 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
459 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
460 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
461 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
462 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
463 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
464 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 0.48
Isolates 5.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.39
Nodule 5.33
Rhizoplane 4.24
Rhizosphere 77.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10622653 3300025906 Bacteria 787
2 Ga0070658_10074107 3300005327 Bacteria 2792
3 Ga0070676_11319277 3300005328 Bacteria 551
4 Ga0070683_100070645 3300005329 Bacteria 3257
5 Ga0070683_100071062 3300005329 Bacteria 3247
6 Ga0070683_100554795 3300005329 Bacteria 1099
7 Ga0070683_100639596 3300005329 Bacteria 1018
8 Ga0070683_102379668 3300005329 Bacteria 508
9 Ga0070670_100499444 3300005331 Bacteria 1082
10 Ga0068869_100147079 3300005334 Bacteria 1824
11 Ga0070680_100080317 3300005336 Bacteria 2689
12 Ga0070680_100286712 3300005336 Bacteria 1395
13 Ga0070680_100329891 3300005336 Bacteria 1296
14 Ga0070680_101290745 3300005336 Bacteria 632
15 Ga0070682_100030995 3300005337 Bacteria 3231
16 Ga0070682_100411429 3300005337 Bacteria 1025
17 Ga0068868_100463239 3300005338 Bacteria 1104
18 Ga0070660_100132091 3300005339 Bacteria 1998
19 Ga0070660_100390557 3300005339 Bacteria 1149
20 Ga0070660_101027871 3300005339 Bacteria 697
21 Ga0070691_10047567 3300005341 Bacteria 2040
22 Ga0070691_10286962 3300005341 Bacteria 895
23 Ga0070687_100420235 3300005343 Bacteria 882
24 Ga0070661_100058378 3300005344 Bacteria 2828
25 Ga0070661_100278687 3300005344 Bacteria 1296
26 Ga0070692_11299386 3300005345 Bacteria 522
27 Ga0070668_100131222 3300005347 Bacteria 2011
28 Ga0070668_100395851 3300005347 Bacteria 1178
29 Ga0070668_100410706 3300005347 Bacteria 1157
30 Ga0070668_100599513 3300005347 Bacteria 963
31 Ga0070669_100269291 3300005353 Bacteria 1361
32 Ga0070669_101221902 3300005353 Bacteria 650
33 Ga0070675_100539001 3300005354 Bacteria 1054
34 Ga0070675_101044717 3300005354 Bacteria 751
35 Ga0070671_101245036 3300005355 Bacteria 655
36 Ga0070674_100383903 3300005356 Bacteria 1143
37 Ga0070674_100615442 3300005356 Bacteria 919
38 Ga0070673_101458780 3300005364 Bacteria 645
39 Ga0070688_100150195 3300005365 Bacteria 1592
40 Ga0070667_100169727 3300005367 Bacteria 1925
41 Ga0070709_10165845 3300005434 Bacteria 1539
42 Ga0070709_10646004 3300005434 Bacteria 819
43 Ga0070714_100111422 3300005435 Bacteria 2423
44 Ga0070714_100146761 3300005435 Bacteria 2123
45 Ga0070714_101812471 3300005435 Bacteria 596
46 Ga0070713_100014007 3300005436 Bacteria 5937
47 Ga0070713_100037665 3300005436 Bacteria 3911
48 Ga0070713_100047145 3300005436 Bacteria 3540
49 Ga0070713_100599076 3300005436 Bacteria 1047
50 Ga0070713_100764899 3300005436 Bacteria 925
51 Ga0070710_10181884 3300005437 Bacteria 1317
52 Ga0070710_11545636 3300005437 Bacteria 500
53 Ga0070701_10741542 3300005438 Bacteria 665
54 Ga0070711_100262060 3300005439 Bacteria 1360
55 Ga0070711_101577813 3300005439 Bacteria 574
56 Ga0070700_100502963 3300005441 Bacteria 932
57 Ga0070700_101755186 3300005441 Bacteria 533
58 Ga0070694_100240093 3300005444 Bacteria 1366
59 Ga0070708_101148517 3300005445 Bacteria 727
60 Ga0070663_100029875 3300005455 Bacteria 3729
61 Ga0070663_102080410 3300005455 Bacteria 511
62 Ga0070678_100058786 3300005456 Bacteria 2823
63 Ga0070662_100681586 3300005457 Bacteria 869
64 Ga0070662_100756176 3300005457 Bacteria 824
65 Ga0070681_10233085 3300005458 Bacteria 1755
66 Ga0070681_10494310 3300005458 Bacteria 1136
67 Ga0070681_10666459 3300005458 Bacteria 955
68 Ga0068867_100163822 3300005459 Bacteria 1755
69 Ga0068867_101762793 3300005459 Bacteria 582
70 Ga0070706_101438542 3300005467 Bacteria 631
71 Ga0070698_100075583 3300005471 Bacteria 3372
72 Ga0070698_100159832 3300005471 Bacteria 2197
73 Ga0070698_100919762 3300005471 Bacteria 821
74 Ga0070699_101441519 3300005518 Bacteria 631
75 Ga0070699_102056024 3300005518 Bacteria 522
76 Ga0070679_100018335 3300005530 Bacteria 6790
77 Ga0070679_100111322 3300005530 Bacteria 2724
78 Ga0070679_100226998 3300005530 Bacteria 1827
79 Ga0070679_100516992 3300005530 Bacteria 1138
80 Ga0070684_100005197 3300005535 Bacteria 9952
81 Ga0070684_100073578 3300005535 Bacteria 3011
82 Ga0070684_101951615 3300005535 Bacteria 554
83 Ga0070697_101603123 3300005536 Bacteria 582
84 Ga0070697_102124061 3300005536 Bacteria 503
85 Ga0068853_100003616 3300005539 Bacteria 11845
86 Ga0068853_100075062 3300005539 Bacteria 2950
87 Ga0068853_100078000 3300005539 Bacteria 2895
88 Ga0068853_100372477 3300005539 Bacteria 1332
89 Ga0068853_100603201 3300005539 Bacteria 1043
90 Ga0070693_100167533 3300005547 Bacteria 1404
91 Ga0070693_100221514 3300005547 Bacteria 1240
92 Ga0070693_100639024 3300005547 Bacteria 773
93 Ga0070693_101382922 3300005547 Bacteria 547
94 Ga0070665_100282285 3300005548 Bacteria 1662
95 Ga0068855_100151048 3300005563 Bacteria 2641
96 Ga0068855_100167580 3300005563 Bacteria 2489
97 Ga0068855_100292767 3300005563 Bacteria 1804
98 Ga0068855_100324958 3300005563 Bacteria 1699
99 Ga0068855_102561014 3300005563 Bacteria 507
100 Ga0070664_100752444 3300005564 Bacteria 910
101 Ga0068857_100129633 3300005577 Bacteria 2274
102 Ga0068857_100327863 3300005577 Bacteria 1414
103 Ga0068857_100520620 3300005577 Bacteria 1118
104 Ga0068857_100830229 3300005577 Bacteria 883
105 Ga0068854_100108189 3300005578 Bacteria 2093
106 Ga0068854_100378708 3300005578 Bacteria 1165
107 Ga0068856_100311237 3300005614 Bacteria 1592
108 Ga0068856_102058761 3300005614 Bacteria 581
109 Ga0070702_100355343 3300005615 Bacteria 1033
110 Ga0068852_100419692 3300005616 Bacteria 1319
111 Ga0068852_101869504 3300005616 Bacteria 623
112 Ga0068852_102481524 3300005616 Bacteria 539
113 Ga0068859_100280321 3300005617 Bacteria 1759
114 Ga0068866_10154120 3300005718 Bacteria 1334
115 Ga0068866_10246165 3300005718 Bacteria 1091
116 Ga0068861_100465729 3300005719 Bacteria 1135
117 Ga0068861_100546912 3300005719 Bacteria 1054
118 Ga0068861_101001793 3300005719 Bacteria 797
119 Ga0068851_10239997 3300005834 Bacteria 1024
120 Ga0068851_10375911 3300005834 Bacteria 831
121 Ga0068870_10151753 3300005840 Bacteria 1365
122 Ga0068870_10290996 3300005840 Bacteria 1027
123 Ga0068863_100100841 3300005841 Bacteria 2744
124 Ga0068863_100460073 3300005841 Bacteria 1249
125 Ga0068863_101397799 3300005841 Bacteria 708
126 Ga0068863_101664071 3300005841 Bacteria 648
127 Ga0068858_100232849 3300005842 Bacteria 1746
128 Ga0068860_100261654 3300005843 Bacteria 1686
129 Ga0068860_100317201 3300005843 Bacteria 1529
130 Ga0068860_100797709 3300005843 Bacteria 957
131 Ga0068862_100479298 3300005844 Bacteria 1177
132 Ga0068862_101368168 3300005844 Bacteria 710
133 Ga0081538_10018847 3300005981 Bacteria 5161
134 Ga0081540_1010741 3300005983 Bacteria 6164
135 Ga0081540_1044066 3300005983 Bacteria 2281
136 Ga0081540_1116925 3300005983 Bacteria 1115
137 Ga0081540_1129022 3300005983 Bacteria 1036
138 Ga0070717_10002055 3300006028 Bacteria 14098
139 Ga0070717_10025850 3300006028 Bacteria 4678
140 Ga0070717_10062684 3300006028 Bacteria 3084
141 Ga0070717_10447604 3300006028 Bacteria 1164
142 Ga0070717_10527968 3300006028 Bacteria 1068
143 Ga0070717_11513686 3300006028 Bacteria 609
144 Ga0075365_10064210 3300006038 Bacteria 2459
145 Ga0075365_10449078 3300006038 Bacteria 910
146 Ga0075368_10086302 3300006042 Bacteria 1280
147 Ga0075364_10056674 3300006051 Bacteria 2566
148 Ga0075364_10091500 3300006051 Bacteria 2018
149 Ga0070715_10231657 3300006163 Bacteria 955
150 Ga0070716_100085755 3300006173 Bacteria 1892
151 Ga0070712_100036410 3300006175 Bacteria 3349
152 Ga0070712_100217510 3300006175 Bacteria 1510
153 Ga0070712_100679598 3300006175 Bacteria 876
154 Ga0075362_10459273 3300006177 Bacteria 648
155 Ga0075362_10710474 3300006177 Bacteria 525
156 Ga0075367_10101385 3300006178 Bacteria 1760
157 Ga0075369_10074650 3300006186 Bacteria 1496
158 Ga0075369_10079522 3300006186 Bacteria 1452
159 Ga0075369_10322525 3300006186 Bacteria 723
160 Ga0075366_10232338 3300006195 Bacteria 1124
161 Ga0075366_10734001 3300006195 Bacteria 614
162 Ga0097621_102126650 3300006237 Bacteria 537
163 Ga0097621_102326284 3300006237 Bacteria 513
164 Ga0075370_10292872 3300006353 Bacteria 967
165 Ga0075370_10370304 3300006353 Bacteria 857
166 Ga0068871_100473540 3300006358 Bacteria 1125
167 Ga0075428_100071481 3300006844 Bacteria 3792
168 Ga0075434_100913673 3300006871 Bacteria 893
169 Ga0068865_100378702 3300006881 Bacteria 1154
170 Ga0068865_100894952 3300006881 Bacteria 772
171 Ga0075436_100338525 3300006914 Bacteria 1083
172 Ga0097620_100280339 3300006931 Bacteria 1759
173 Ga0099824_1009956 3300006942 Bacteria 11459
174 Ga0099822_1003320 3300006943 Bacteria 20578
175 Ga0075435_100142716 3300007076 Bacteria 2010
176 Ga0099794_10103337 3300007265 Bacteria 1423
177 Ga0105244_10430514 3300009036 Bacteria 607
178 Ga0105240_10027735 3300009093 Bacteria 7411
179 Ga0105240_10039101 3300009093 Bacteria 6078
180 Ga0105240_11123228 3300009093 Bacteria 835
181 Ga0105240_11282958 3300009093 Bacteria 773
182 Ga0105240_11537270 3300009093 Bacteria 697
183 Ga0105240_11994006 3300009093 Bacteria 603
184 Ga0111539_11315444 3300009094 Bacteria 839
185 Ga0105245_10520441 3300009098 Bacteria 1208
186 Ga0105247_10030902 3300009101 Bacteria 3249
187 Ga0114129_10186448 3300009147 Bacteria 2819
188 Ga0105243_10625738 3300009148 Bacteria 1040
189 Ga0105241_10213333 3300009174 Bacteria 1618
190 Ga0105241_10230294 3300009174 Bacteria 1562
191 Ga0105241_11580498 3300009174 Bacteria 634
192 Ga0105241_11976819 3300009174 Bacteria 573
193 Ga0105241_12124722 3300009174 Bacteria 555
194 Ga0105242_11174516 3300009176 Bacteria 785
195 Ga0105237_10083252 3300009545 Bacteria 3191
196 Ga0105237_10114579 3300009545 Bacteria 2689
197 Ga0105237_10173918 3300009545 Bacteria 2153
198 Ga0105237_10207347 3300009545 Bacteria 1960
199 Ga0105237_10291768 3300009545 Bacteria 1634
200 Ga0105237_11503513 3300009545 Bacteria 680
201 Ga0105237_12755759 3300009545 Bacteria 503
202 Ga0105238_10024432 3300009551 Bacteria 6159
203 Ga0105238_10426567 3300009551 Bacteria 1321
204 Ga0105238_10969713 3300009551 Bacteria 870
205 Ga0105238_11233736 3300009551 Bacteria 773
206 Ga0105238_11247638 3300009551 Bacteria 768
207 Ga0105249_10447826 3300009553 Bacteria 1329
208 Ga0105249_12999847 3300009553 Bacteria 542
209 Ga0105239_12421231 3300010375 Bacteria 611
210 Ga0157373_11191158 3300013100 Bacteria 574
211 Ga0157371_11583846 3300013102 Bacteria 512
212 Ga0157370_10291533 3300013104 Bacteria 1507
213 Ga0157369_10010577 3300013105 Bacteria 10503
214 Ga0157369_10029140 3300013105 Bacteria 6102
215 Ga0157369_10057631 3300013105 Bacteria 4190
216 Ga0157369_10256069 3300013105 Bacteria 1826
217 Ga0157369_10395721 3300013105 Bacteria 1433
218 Ga0157369_10937136 3300013105 Bacteria 887
219 Ga0157374_10127650 3300013296 Bacteria 2459
220 Ga0157374_10130073 3300013296 Bacteria 2436
221 Ga0157378_12723656 3300013297 Bacteria 547
222 Ga0163162_11258510 3300013306 Bacteria 840
223 Ga0157372_10191292 3300013307 Bacteria 2370
224 Ga0157372_10231909 3300013307 Bacteria 2140
225 Ga0157372_10624217 3300013307 Bacteria 1256
226 Ga0157372_11000251 3300013307 Bacteria 968
227 Ga0157372_11992369 3300013307 Bacteria 667
228 Ga0157375_10742873 3300013308 Bacteria 1133
229 Ga0157375_10951434 3300013308 Bacteria 1001
230 Ga0163163_10978299 3300014325 Bacteria 909
231 Ga0157380_10710528 3300014326 Bacteria 1011
232 Ga0182008_10911311 3300014497 Bacteria 518
233 Ga0157377_10576315 3300014745 Bacteria 799
234 Ga0157379_10593588 3300014968 Bacteria 1033
235 Ga0157379_10624234 3300014968 Bacteria 1007
236 Ga0157376_12075156 3300014969 Bacteria 607
237 Ga0163161_10223335 3300017792 Bacteria 1459
238 Ga0206354_10897466 3300020081 Bacteria 587
239 Ga0206353_10806392 3300020082 Bacteria 518
240 Ga0213872_10184447 3300021361 Bacteria 900
241 Ga0213872_10271858 3300021361 Bacteria 709
242 Ga0213874_10326507 3300021377 Bacteria 583
243 Ga0213876_10048068 3300021384 Bacteria 2255
244 Ga0213876_10073542 3300021384 Bacteria 1805
245 Ga0213876_10198895 3300021384 Bacteria 1065
246 Ga0213871_10036026 3300021441 Bacteria 1311
247 Ga0213871_10039473 3300021441 Bacteria 1263
248 Ga0207697_10228229 3300025315 Bacteria 822
249 Ga0207656_10030324 3300025321 Bacteria 2233
250 Ga0207656_10246355 3300025321 Bacteria 874
251 Ga0207696_1070874 3300025711 Bacteria 969
252 Ga0207653_10032153 3300025885 Bacteria 1696
253 Ga0207692_10019382 3300025898 Bacteria 3073
254 Ga0207692_10270998 3300025898 Bacteria 1024
255 Ga0207710_10035980 3300025900 Bacteria 2181
256 Ga0207710_10310691 3300025900 Bacteria 798
257 Ga0207688_10087147 3300025901 Bacteria 1790
258 Ga0207688_10296481 3300025901 Bacteria 988
259 Ga0207647_10078632 3300025904 Bacteria 1981
260 Ga0207647_10295479 3300025904 Bacteria 923
261 Ga0207685_10143462 3300025905 Bacteria 1073
262 Ga0207685_10327559 3300025905 Bacteria 766
263 Ga0207699_10059264 3300025906 Bacteria 2294
264 Ga0207699_10144448 3300025906 Bacteria 1567
265 Ga0207699_10215010 3300025906 Bacteria 1309
266 Ga0207699_10581456 3300025906 Bacteria 814
267 Ga0207699_10607743 3300025906 Bacteria 796
268 Ga0207645_10305965 3300025907 Bacteria 1059
269 Ga0207643_10061232 3300025908 Bacteria 2149
270 Ga0207643_10410818 3300025908 Bacteria 857
271 Ga0207705_10338064 3300025909 Bacteria 1159
272 Ga0207654_10146409 3300025911 Bacteria 1512
273 Ga0207654_10418811 3300025911 Bacteria 934
274 Ga0207654_10633747 3300025911 Bacteria 765
275 Ga0207707_10016071 3300025912 Bacteria 6527
276 Ga0207707_10022743 3300025912 Bacteria 5482
277 Ga0207707_10161790 3300025912 Bacteria 1957
278 Ga0207707_10185538 3300025912 Bacteria 1815
279 Ga0207695_10079841 3300025913 Bacteria 3314
280 Ga0207695_10461212 3300025913 Bacteria 1154
281 Ga0207671_10071044 3300025914 Bacteria 2596
282 Ga0207671_10147627 3300025914 Bacteria 1815
283 Ga0207671_10163432 3300025914 Bacteria 1725
284 Ga0207671_10340856 3300025914 Bacteria 1188
285 Ga0207671_10871093 3300025914 Bacteria 713
286 Ga0207671_11220028 3300025914 Bacteria 588
287 Ga0207693_10021733 3300025915 Bacteria 5101
288 Ga0207693_10037984 3300025915 Bacteria 3793
289 Ga0207693_10612279 3300025915 Bacteria 847
290 Ga0207693_11189201 3300025915 Bacteria 575
291 Ga0207663_10018567 3300025916 Bacteria 3900
292 Ga0207663_10296574 3300025916 Bacteria 1206
293 Ga0207663_10866463 3300025916 Bacteria 721
294 Ga0207660_10060229 3300025917 Bacteria 2728
295 Ga0207660_10198844 3300025917 Bacteria 1565
296 Ga0207660_10294905 3300025917 Bacteria 1290
297 Ga0207662_10089675 3300025918 Bacteria 1889
298 Ga0207662_10687789 3300025918 Bacteria 716
299 Ga0207657_10003938 3300025919 Bacteria 15764
300 Ga0207657_10184151 3300025919 Bacteria 1687
301 Ga0207649_10027984 3300025920 Bacteria 3314
302 Ga0207649_10088726 3300025920 Bacteria 2020
303 Ga0207652_10015649 3300025921 Bacteria 6174
304 Ga0207652_10235463 3300025921 Bacteria 1650
305 Ga0207652_10247740 3300025921 Bacteria 1607
306 Ga0207646_11164086 3300025922 Bacteria 677
307 Ga0207681_10108689 3300025923 Bacteria 2013
308 Ga0207694_10202304 3300025924 Bacteria 1616
309 Ga0207694_10245974 3300025924 Bacteria 1462
310 Ga0207694_10280831 3300025924 Bacteria 1368
311 Ga0207694_10283757 3300025924 Bacteria 1360
312 Ga0207694_10337857 3300025924 Bacteria 1245
313 Ga0207694_10917372 3300025924 Bacteria 741
314 Ga0207659_10566268 3300025926 Bacteria 967
315 Ga0207687_10029053 3300025927 Bacteria 3717
316 Ga0207687_10404262 3300025927 Bacteria 1124
317 Ga0207700_10004386 3300025928 Bacteria 8309
318 Ga0207700_10253122 3300025928 Bacteria 1505
319 Ga0207700_10330785 3300025928 Bacteria 1322
320 Ga0207700_10402611 3300025928 Bacteria 1199
321 Ga0207700_10779679 3300025928 Bacteria 855
322 Ga0207664_10112953 3300025929 Bacteria 2262
323 Ga0207664_10175510 3300025929 Bacteria 1837
324 Ga0207664_10320507 3300025929 Bacteria 1368
325 Ga0207644_11796175 3300025931 Bacteria 513
326 Ga0207706_10083263 3300025933 Bacteria 2812
327 Ga0207706_10654616 3300025933 Bacteria 899
328 Ga0207709_10462319 3300025935 Bacteria 983
329 Ga0207669_10647924 3300025937 Bacteria 863
330 Ga0207704_10411449 3300025938 Bacteria 1070
331 Ga0207665_10047449 3300025939 Bacteria 2880
332 Ga0207665_10289424 3300025939 Bacteria 1221
333 Ga0207665_10426702 3300025939 Bacteria 1014
334 Ga0207665_10440802 3300025939 Bacteria 998
335 Ga0207711_11024845 3300025941 Bacteria 765
336 Ga0207689_10084246 3300025942 Bacteria 2613
337 Ga0207689_10110205 3300025942 Bacteria 2262
338 Ga0207689_10268731 3300025942 Bacteria 1412
339 Ga0207661_10000379 3300025944 Bacteria 28634
340 Ga0207661_10042228 3300025944 Bacteria 3594
341 Ga0207661_10134977 3300025944 Bacteria 2118
342 Ga0207661_12026075 3300025944 Bacteria 522
343 Ga0207667_10014216 3300025949 Bacteria 9083
344 Ga0207667_10101158 3300025949 Bacteria 2973
345 Ga0207667_10153163 3300025949 Bacteria 2372
346 Ga0207667_10219602 3300025949 Bacteria 1948
347 Ga0207667_10352714 3300025949 Bacteria 1500
348 Ga0207667_10371583 3300025949 Bacteria 1457
349 Ga0207667_11249746 3300025949 Bacteria 721
350 Ga0207712_10452450 3300025961 Bacteria 1089
351 Ga0207668_10023201 3300025972 Bacteria 3983
352 Ga0207668_10156973 3300025972 Bacteria 1768
353 Ga0207640_10334805 3300025981 Bacteria 1210
354 Ga0207640_10481486 3300025981 Bacteria 1029
355 Ga0207640_10520830 3300025981 Bacteria 994
356 Ga0207640_10560721 3300025981 Bacteria 961
357 Ga0207640_10618257 3300025981 Bacteria 919
358 Ga0207658_10539905 3300025986 Bacteria 1042
359 Ga0207677_10162774 3300026023 Bacteria 1735
360 Ga0207703_10039783 3300026035 Bacteria 3759
361 Ga0207639_10062959 3300026041 Bacteria 2870
362 Ga0207639_10488318 3300026041 Bacteria 1123
363 Ga0207639_10567287 3300026041 Bacteria 1044
364 Ga0207678_10052855 3300026067 Bacteria 3502
365 Ga0207678_10139221 3300026067 Bacteria 2071
366 Ga0207678_10246721 3300026067 Bacteria 1529
367 Ga0207708_10482312 3300026075 Bacteria 1037
368 Ga0207702_10397605 3300026078 Bacteria 1328
369 Ga0207702_11879266 3300026078 Bacteria 590
370 Ga0207702_12327202 3300026078 Bacteria 523
371 Ga0207702_12347953 3300026078 Bacteria 521
372 Ga0207641_10105524 3300026088 Bacteria 2488
373 Ga0207641_12130722 3300026088 Bacteria 561
374 Ga0207648_10052913 3300026089 Bacteria 3549
375 Ga0207676_10238609 3300026095 Bacteria 1629
376 Ga0207674_10011007 3300026116 Bacteria 10173
377 Ga0207674_10028810 3300026116 Bacteria 5855
378 Ga0207674_10039718 3300026116 Bacteria 4877
379 Ga0207674_10098292 3300026116 Bacteria 2911
380 Ga0207674_11154903 3300026116 Bacteria 744
381 Ga0207675_100093476 3300026118 Bacteria 2828
382 Ga0207675_100339181 3300026118 Bacteria 1471
383 Ga0207675_100659012 3300026118 Bacteria 1053
384 Ga0207683_11883678 3300026121 Bacteria 547
385 Ga0207698_10143546 3300026142 Bacteria 2061
386 Ga0207698_10158800 3300026142 Bacteria 1974
387 Ga0207698_10460099 3300026142 Bacteria 1230
388 Ga0207698_10986748 3300026142 Bacteria 852
389 Ga0207698_11074526 3300026142 Bacteria 817
390 Ga0209589_1000276 3300027357 Bacteria 65299
391 Ga0209489_100714 3300027361 Bacteria 65299
392 Ga0209700_100732 3300027363 Bacteria 65299
393 Ga0209179_1064997 3300027512 Bacteria 794
394 Ga0268266_10059890 3300028379 Bacteria 3280
395 Ga0268266_10184839 3300028379 Bacteria 1900
396 Ga0268265_10052897 3300028380 Bacteria 3073
397 Ga0268265_10502666 3300028380 Bacteria 1142
398 Ga0268265_11090794 3300028380 Bacteria 792
399 Ga0268265_11855011 3300028380 Bacteria 609
400 Ga0268264_10197436 3300028381 Bacteria 1838
401 Ga0268264_10605392 3300028381 Bacteria 1080
402 Ga0307515_10641599 3300028794 Bacteria 674
403 Ga0265770_1092733 3300030878 Bacteria 605
404 Ga0307408_100985233 3300031548 Bacteria 776
405 Ga0307508_10000613 3300031616 Bacteria 42773
406 Ga0307508_10223138 3300031616 Bacteria 1484
407 Ga0307516_10217401 3300031730 Bacteria 1622
408 Ga0307405_10990885 3300031731 Bacteria 716
409 Ga0307413_10944247 3300031824 Bacteria 735
410 Ga0307410_11803588 3300031852 Bacteria 543
411 Ga0307407_10688089 3300031903 Bacteria 769
412 Ga0307412_12072206 3300031911 Bacteria 528
413 Ga0307409_100796271 3300031995 Bacteria 952
414 Ga0307415_100442605 3300032126 Bacteria 1121
415 Ga0307510_10083149 3300033180 Bacteria 3093
416 Ga0315911_1000024 3300033442 Bacteria 97712
417 Ga0316215_1008078 3300033544 Bacteria 1032
418 Ga0373930_0087063 3300034816 Bacteria 729
419 Ga0373934_0025525 3300035086 Bacteria 2289
420 Ga0373944_0131102 3300035089 Bacteria 871
421 Ga0373951_0027302 3300035091 Bacteria 1333
422 Ga0373923_0004740 3300035111 Bacteria 4544
423 Ga0373923_0059980 3300035111 Bacteria 1614
424 Ga0373936_0058563 3300035113 Bacteria 1568
425 Ga0373936_0184379 3300035113 Bacteria 916
426 Ga0373941_0476254 3300035115 Bacteria 528
427 Ga0373945_0108419 3300035116 Bacteria 1093
428 Ga0373953_0000315 3300035117 Bacteria 12982
429 Ga0373953_0149027 3300035117 Bacteria 1002
430 Ga0373954_0000544 3300035118 Bacteria 14116
431 Ga0373954_0059130 3300035118 Bacteria 1806
432 Ga0373956_0001464 3300035119 Bacteria 9759
433 Ga0373957_0000132 3300035120 Bacteria 18518
434 Ga0373960_0443987 3300035121 Bacteria 507
435 Ga0373943_0008271 3300035170 Bacteria 4668
436 Ga0373943_0233956 3300035170 Bacteria 1027
437 Ga0373943_0900322 3300035170 Bacteria 529
438 Ga0373946_0052464 3300035171 Bacteria 1710
439 Ga0373946_0180246 3300035171 Bacteria 1002
440 Ga0373946_0205645 3300035171 Bacteria 945
441 Ga0373955_0001029 3300035172 Bacteria 11840
442 Ga0373955_0012972 3300035172 Bacteria 4018
443 Ga0373924_0002229 3300035410 Bacteria 6496
444 Ga0373924_0025023 3300035410 Bacteria 2357
445 Ga0373935_0008474 3300035692 Bacteria 6153
446 Ga0373927_0026977 3300035695 Bacteria 3753
447 Ga0373927_0081198 3300035695 Bacteria 2101
448 Ga0373927_0160437 3300035695 Bacteria 1473
449 Ga0373933_0004346 3300035724 Bacteria 7780
450 Ga0373933_0090500 3300035724 Bacteria 1887
451 Ga0373947_0005615 3300035725 Bacteria 7313
452 Ga0373947_0052888 3300035725 Bacteria 2447
453 Ga0373947_0394156 3300035725 Bacteria 933
454 Ga0373947_1149472 3300035725 Bacteria 529
455 Ga0373937_0011261 3300036401 Bacteria 7840
456 Ga0373937_0154490 3300036401 Bacteria 2150
457 Ga0372808_020526 3300036459 Bacteria 950
458 Ga0373925_0101568 3300037068 Bacteria 2211
459 Ga0373925_0139226 3300037068 Bacteria 1898
460 Ga0373925_0189088 3300037068 Bacteria 1633
461 Ga0373925_0189390 3300037068 Bacteria 1632
462 Ga0395899_0047216 3300037312 Bacteria 3206
463 Ga0395900_0041199 3300037418 Bacteria 4762
464 Ga0395900_0133440 3300037418 Bacteria 2544
465 Ga0395900_0584068 3300037418 Bacteria 1059
466 Ga0395900_1044521 3300037418 Bacteria 736
467 Ga0395898_0074171 3300037466 Bacteria 3287
468 Ga0395898_0195700 3300037466 Bacteria 1931
469 Ga0395898_0571924 3300037466 Bacteria 1072
470 Ga0395898_1077814 3300037466 Bacteria 737
471 Ga0395905_0061218 3300037471 Bacteria 3521
472 Ga0436364_0625313 3300037853 Bacteria 1288
473 Ga0436364_0846361 3300037853 Bacteria 769
474 Ga0436364_0897381 3300037853 Bacteria 1114
475 Ga0395901_0181707 3300038443 Bacteria 2206
476 Ga0395901_0747049 3300038443 Bacteria 972
477 Ga0395901_0837938 3300038443 Bacteria 906
478 Ga0436365_0546711 3300039437 Bacteria 1807
479 Ga0436365_0679202 3300039437 Bacteria 2632
480 Ga0436365_1575698 3300039437 Bacteria 1301
481 Ga0436365_1636461 3300039437 Bacteria 2533
482 Ga0436360_0605888 3300039438 Bacteria 1164
483 Ga0436360_0623614 3300039438 Bacteria 677
484 Ga0436360_0900103 3300039438 Bacteria 711
485 Ga0436361_0415653 3300039447 Bacteria 2970
486 Ga0436361_0536082 3300039447 Bacteria 3581
487 Ga0436361_0871366 3300039447 Bacteria 1370
488 Ga0436361_1070125 3300039447 Bacteria 632
489 Ga0436363_0255034 3300039450 Bacteria 1737
490 Ga0436363_1470508 3300039450 Bacteria 795
491 Ga0436363_1523880 3300039450 Bacteria 736
492 Ga0436363_1552585 3300039450 Bacteria 544
493 Ga0439465_0063161 3300041413 Bacteria 1230
494 Ga0451789_0987762 3300041443 Bacteria 584
495 Ga0451791_0399830 3300041451 Bacteria 697
496 Ga0451793_1408444 3300041452 Bacteria 2461
497 Ga0451797_0664391 3300041453 Bacteria 578
498 Ga0451795_0323264 3300041456 Bacteria 572
499 Ga0451802_0065833 3300041460 Bacteria 1019
500 Ga0451804_0799267 3300041463 Bacteria 857
501 Ga0451841_0245673 3300041498 Bacteria 1742
502 Ga0451849_0016062 3300041505 Bacteria 662
503 Ga0451843_0952249 3300041509 Bacteria 2175
504 Ga0451853_2076652 3300041512 Bacteria 2420
505 Ga0451853_3346658 3300041512 Bacteria 792
506 Ga0439431_0067454 3300041997 Bacteria 949
507 Ga0466969_0121469 3300044656 Bacteria 1216
508 Ga0466969_0153426 3300044656 Bacteria 1060
509 Ga0466972_0381847 3300044658 Bacteria 660
510 Ga0466966_0664179 3300044684 Bacteria 628
511 Ga0466961_0322890 3300044693 Bacteria 941
512 Ga0466963_0309322 3300044694 Bacteria 1111
513 Ga0466963_0723513 3300044694 Bacteria 702
514 Ga0466964_0834151 3300044706 Bacteria 523
515 Ga0466968_0228936 3300044735 Bacteria 877
516 Ga0466970_0110162 3300044765 Bacteria 1503
517 Ga0466957_0467670 3300044842 Bacteria 871
518 Ga0466959_0034315 3300045049 Bacteria 3752
519 Ga0466959_0040827 3300045049 Bacteria 3427
520 Ga0466967_0094270 3300045976 Bacteria 2726
521 Ga0466967_0934359 3300045976 Bacteria 863
522 Ga0466967_1239705 3300045976 Bacteria 743
523 Ga0466967_1344867 3300045976 Bacteria 711
524 Ga0466967_1779922 3300045976 Bacteria 613
525 Ga0495617_023921 3300046452 Bacteria 2062
526 Ga0495617_105714 3300046452 Bacteria 912
527 Ga0495592_0002799 3300046454 Bacteria 12368
528 Ga0495603_0019207 3300046455 Bacteria 4138
529 Ga0495603_0099252 3300046455 Bacteria 1700
530 Ga0495603_0387489 3300046455 Bacteria 801
531 Ga0495590_0323275 3300046457 Bacteria 583
532 Ga0495629_0001273 3300046459 Bacteria 19816
533 Ga0495629_0183840 3300046459 Bacteria 1448
534 Ga0495638_0248546 3300046460 Bacteria 981
535 Ga0495651_0032471 3300046462 Bacteria 4071
536 Ga0495653_0005040 3300046463 Bacteria 10720
537 Ga0495580_0014347 3300046472 Bacteria 6010
538 Ga0495580_1033455 3300046472 Bacteria 522
539 Ga0495582_0038446 3300046473 Bacteria 2633
540 Ga0495582_0523143 3300046473 Bacteria 686
541 Ga0495605_0111864 3300046474 Bacteria 1245
542 Ga0495639_0003783 3300046475 Bacteria 6502
543 Ga0495639_0278472 3300046475 Bacteria 831
544 Ga0495639_0697641 3300046475 Bacteria 524
545 Ga0495662_0069547 3300046476 Bacteria 1705
546 Ga0495664_0316327 3300046477 Bacteria 942
547 Ga0495664_0346038 3300046477 Bacteria 895
548 Ga0495664_0475175 3300046477 Bacteria 747
549 Ga0495584_0157138 3300046491 Bacteria 1155
550 Ga0495584_0201238 3300046491 Bacteria 1012
551 Ga0495584_0462738 3300046491 Bacteria 645
552 Ga0495585_0396084 3300046492 Bacteria 665
553 Ga0495594_0051169 3300046499 Bacteria 2273
554 Ga0495594_0201816 3300046499 Bacteria 1133
555 Ga0495594_0255973 3300046499 Bacteria 997
556 Ga0495596_0134256 3300046500 Bacteria 960
557 Ga0495596_0445718 3300046500 Bacteria 505
558 Ga0495607_0061227 3300046501 Bacteria 2139
559 Ga0495583_0335328 3300046506 Bacteria 598
560 Ga0495606_0070867 3300046507 Bacteria 2197
561 Ga0495608_0001214 3300046511 Bacteria 18263
562 Ga0495610_0032392 3300046512 Bacteria 2715
563 Ga0495618_0030915 3300046514 Bacteria 3347
564 Ga0495618_0110963 3300046514 Bacteria 1756
565 Ga0495628_0081568 3300046516 Bacteria 2512
566 Ga0495630_0020544 3300046517 Bacteria 4869
567 Ga0495630_0506053 3300046517 Bacteria 926
568 Ga0495631_0050637 3300046518 Bacteria 1816
569 Ga0495631_0095958 3300046518 Bacteria 1276
570 Ga0495631_0197220 3300046518 Bacteria 861
571 Ga0495632_0406455 3300046519 Bacteria 594
572 Ga0495632_0422409 3300046519 Bacteria 580
573 Ga0495637_0141262 3300046520 Bacteria 913
574 Ga0495644_0035431 3300046523 Bacteria 1884
575 Ga0495644_0121088 3300046523 Bacteria 995
576 Ga0495648_0174069 3300046524 Bacteria 1100
577 Ga0495648_0414890 3300046524 Bacteria 598
578 Ga0495663_0168339 3300046525 Bacteria 754
579 Ga0495666_0077876 3300046526 Bacteria 1571
580 Ga0495666_0107489 3300046526 Bacteria 1312
581 Ga0495652_0003248 3300046529 Bacteria 16204
582 Ga0495665_0149052 3300046531 Bacteria 1221
583 Ga0495640_0010798 3300046533 Bacteria 7045
584 Ga0495586_0082041 3300046535 Bacteria 1773
585 Ga0495587_0047714 3300046536 Bacteria 2538
586 Ga0495598_0075975 3300046537 Bacteria 1068
587 Ga0495598_0099920 3300046537 Bacteria 958
588 Ga0495609_0148466 3300046538 Bacteria 998
589 Ga0495621_0129584 3300046539 Bacteria 980
590 Ga0495645_0013653 3300046543 Bacteria 5754
591 Ga0495645_0053615 3300046543 Bacteria 2931
592 Ga0495645_0107774 3300046543 Bacteria 1974
593 Ga0495622_0405262 3300046557 Bacteria 587
594 Ga0495633_0074605 3300046558 Bacteria 1580
595 Ga0495667_0000340 3300046559 Bacteria 29603
596 Ga0495667_0052128 3300046559 Bacteria 2697
597 Ga0495656_0048878 3300046615 Bacteria 1799
598 Ga0495656_0178515 3300046615 Bacteria 1042
599 Ga0495656_0482028 3300046615 Bacteria 656
600 Ga0495668_0133035 3300046616 Bacteria 1361
601 Ga0495634_0056236 3300046642 Bacteria 2629
602 Ga0495625_0309108 3300046660 Bacteria 1009
603 Ga0495625_0446786 3300046660 Bacteria 799
604 Ga0495625_0901072 3300046660 Bacteria 507
605 Ga0495635_0000220 3300046663 Bacteria 36107
606 Ga0495635_0035176 3300046663 Bacteria 3473
607 Ga0495659_0025848 3300046664 Bacteria 2012
608 Ga0495659_0230223 3300046664 Bacteria 767
609 Ga0495661_0109013 3300046665 Bacteria 1546
610 Ga0495661_0171133 3300046665 Bacteria 1158
611 Ga0495588_0012335 3300046674 Bacteria 4036
612 Ga0495588_0351800 3300046674 Bacteria 774
613 Ga0495657_0560963 3300046675 Bacteria 663
614 Ga0495599_0009707 3300046678 Bacteria 5887
615 Ga0495599_0028612 3300046678 Bacteria 3493
616 Ga0495623_0040283 3300046679 Bacteria 2983
617 Ga0495646_0026782 3300046680 Bacteria 3618
618 Ga0495646_0156901 3300046680 Bacteria 1262
619 Ga0495646_0201447 3300046680 Bacteria 1084
620 Ga0495647_0005990 3300046681 Bacteria 4006
621 Ga0495658_0008260 3300046683 Bacteria 5156
622 Ga0495658_0186030 3300046683 Bacteria 1290
623 Ga0495613_0024162 3300046689 Bacteria 4529
624 Ga0495624_0258495 3300046690 Bacteria 1052
625 Ga0495670_0039761 3300046691 Bacteria 2345
626 Ga0495670_0085695 3300046691 Bacteria 1608
627 Ga0495671_0033230 3300046692 Bacteria 2629
628 Ga0495589_0203592 3300046794 Bacteria 933
629 Ga0495589_0290125 3300046794 Bacteria 759
630 Ga0495600_0000811 3300046809 Bacteria 16603
631 Ga0495600_0426703 3300046809 Bacteria 822
632 Ga0495581_0035389 3300047315 Bacteria 2890
633 Ga0495604_0000980 3300047317 Bacteria 23805
634 Ga0495604_0119063 3300047317 Bacteria 1913
635 Ga0495604_0149347 3300047317 Bacteria 1662
636 Ga0495636_0054292 3300047318 Bacteria 1683
637 Ga0495636_0304861 3300047318 Bacteria 745
638 Ga0495636_0561487 3300047318 Bacteria 556
639 Ga0495674_0013462 3300047319 Bacteria 7692
640 Ga0495674_0132644 3300047319 Bacteria 2098
641 Ga0495674_1392530 3300047319 Bacteria 523
642 Ga0495676_0158086 3300047321 Bacteria 1606
643 Ga0495676_0209517 3300047321 Bacteria 1349
644 Ga0495676_0307297 3300047321 Bacteria 1068
645 Ga0495680_0003737 3300047322 Bacteria 14826
646 Ga0495680_0254455 3300047322 Bacteria 1244
647 Ga0495683_0156371 3300047323 Bacteria 1057
648 Ga0495675_0039158 3300047444 Bacteria 3018
649 Ga0495673_0125321 3300047469 Bacteria 1013
650 Ga0495684_0000133 3300047471 Bacteria 54433
651 Ga0495684_0120392 3300047471 Bacteria 1977
652 Ga0495686_0525604 3300047472 Bacteria 620
653 Ga0495593_0001898 3300047673 Bacteria 12447
654 Ga0495593_0030634 3300047673 Bacteria 2943
655 Ga0495602_0006150 3300048088 Bacteria 12589
656 Ga0495614_0184642 3300048089 Bacteria 939
657 Ga0496100_0050556 3300048903 Bacteria 2694
658 Ga0496101_0075387 3300048904 Bacteria 2483
659 Ga0496101_0469253 3300048904 Bacteria 993
660 Ga0496102_0171328 3300048905 Bacteria 2043
661 Ga0496102_0399426 3300048905 Bacteria 1292
662 Ga0496102_1016668 3300048905 Bacteria 749
663 Ga0496103_0620976 3300048906 Bacteria 688
664 Ga0496103_0651973 3300048906 Bacteria 669
665 Ga0496105_0386644 3300048908 Bacteria 1113
666 Ga0496105_0467669 3300048908 Bacteria 994
667 Ga0496105_0596159 3300048908 Bacteria 858
668 Ga0496106_0235794 3300048909 Bacteria 1461
669 Ga0496107_0366915 3300048910 Bacteria 1071
670 Ga0496108_0392240 3300048911 Bacteria 1212
671 Ga0496108_0664579 3300048911 Bacteria 905
672 Ga0496109_0042780 3300048912 Bacteria 4105
673 Ga0496110_0444183 3300048913 Bacteria 1182
674 Ga0496110_0541805 3300048913 Bacteria 1058
675 Ga0496111_1172836 3300048914 Bacteria 545
676 Ga0496112_0051810 3300048915 Bacteria 4026
677 Ga0496112_0799485 3300048915 Bacteria 868
678 Ga0496113_0197356 3300048916 Bacteria 1599
679 Ga0496113_0617559 3300048916 Bacteria 868
680 Ga0496114_1185317 3300048917 Bacteria 650
681 Ga0496115_0163342 3300048918 Bacteria 1841
682 Ga0496115_0399851 3300048918 Bacteria 1115
683 Ga0496115_0467388 3300048918 Bacteria 1017
684 Ga0496115_1248625 3300048918 Bacteria 556
685 Ga0496118_0299268 3300048921 Bacteria 884
686 Ga0496120_0265684 3300048923 Bacteria 799
687 Ga0496121_0078321 3300048924 Bacteria 2628
688 Ga0496121_0168427 3300048924 Bacteria 1594
689 Ga0496121_0271403 3300048924 Bacteria 1165
690 Ga0496122_0056773 3300048925 Bacteria 2915
691 Ga0496124_0723072 3300048927 Bacteria 628
692 Ga0496126_0021458 3300048929 Bacteria 6306
693 Ga0496126_0066263 3300048929 Bacteria 3229
694 Ga0496126_0144871 3300048929 Bacteria 2041
695 Ga0496126_0158268 3300048929 Bacteria 1937
696 Ga0496126_0364066 3300048929 Bacteria 1180
697 Ga0496126_0624127 3300048929 Bacteria 846
698 Ga0496126_1046825 3300048929 Bacteria 609
699 Ga0496126_1405024 3300048929 Bacteria 504
700 Ga0495682_0013468 3300049460 Bacteria 3114
701 Ga0495682_0144185 3300049460 Bacteria 850
702 Ga0501032_0285423 3300049569 Bacteria 1068
703 Ga0501033_0183383 3300049570 Bacteria 1500
704 Ga0501033_0446318 3300049570 Bacteria 899
705 Ga0501034_1168516 3300049571 Bacteria 649
706 Ga0501034_1708582 3300049571 Bacteria 502
707 Ga0501038_0294577 3300049574 Bacteria 1274
708 Ga0501046_0860292 3300049580 Bacteria 634
709 Ga0501047_0069234 3300049581 Bacteria 3398
710 Ga0501067_0286132 3300049583 Bacteria 918
711 Ga0501070_0075254 3300049586 Bacteria 2795
712 Ga0501074_0032975 3300049590 Bacteria 3753
713 Ga0501080_0004892 3300049742 Bacteria 11942
714 Ga0501035_0298879 3300049822 Bacteria 1357
715 Ga0501044_0509884 3300049823 Bacteria 1103
716 Ga0501044_0748363 3300049823 Bacteria 860
717 Ga0501044_1282063 3300049823 Bacteria 599
718 nmdc:mga03683_175667_c1 3300050489 Bacteria 975
719 nmdc:mga03n38_185721_c1 3300050490 Bacteria 1068
720 nmdc:mga03n38_398259_c1 3300050490 Bacteria 757
721 nmdc:mga0yw44_43805_c1 3300050492 Bacteria 2674
722 nmdc:mga0yw44_525991_c1 3300050492 Bacteria 803
723 nmdc:mga0k408_630445_c1 3300050493 Bacteria 631
724 nmdc:mga07m45_692081_c1 3300050496 Bacteria 586
725 nmdc:mga09592_271786_c1 3300050508 Bacteria 1470
726 nmdc:mga06r32_472510_c1 3300050510 Bacteria 1232
727 nmdc:mga08y16_661186_c1 3300050511 Bacteria 1048
728 nmdc:mga0n895_1053501_c1 3300050512 Bacteria 792
729 nmdc:mga0n895_47139_c1 3300050512 Bacteria 4213
730 nmdc:mga0rr50_1180313_c1 3300050513 Bacteria 650
731 nmdc:mga0rr50_128322_c1 3300050513 Bacteria 2027
732 nmdc:mga08x19_302987_c1 3300050514 Bacteria 1110
733 nmdc:mga0sz30_159630_c1 3300050516 Bacteria 999
734 nmdc:mga0sz30_239427_c1 3300050516 Bacteria 808
735 nmdc:mga0sz30_295724_c1 3300050516 Bacteria 722
736 nmdc:mga0sz30_38929_c1 3300050516 Bacteria 1994
737 Ga0495601_0041757 3300053077 Bacteria 2876
738 Ga0495601_0217938 3300053077 Bacteria 1246
739 Ga0495601_0366610 3300053077 Bacteria 936
740 Ga0495612_0016582 3300053078 Bacteria 2951
741 Ga0495612_0025472 3300053078 Bacteria 2375
742 Ga0500635_0017751 3300053080 Bacteria 2137
743 Ga0495655_0035481 3300053083 Bacteria 1241
744 Ga0495655_0041987 3300053083 Bacteria 1172
745 Ga0495595_0002222 3300053084 Bacteria 7550
746 Ga0495619_0000997 3300053085 Bacteria 18562
747 Ga0500643_037900 3300053087 Bacteria 1432
748 Ga0500651_0057266 3300053093 Bacteria 2439
749 Ga0500566_0000527 3300053094 Bacteria 21443
750 Ga0500566_0279508 3300053094 Bacteria 796
751 Ga0500640_150042 3300053095 Bacteria 890
752 Ga0500641_0074974 3300053096 Bacteria 1429
753 Ga0500554_028670 3300053102 Bacteria 1620
754 Ga0500555_012028 3300053103 Bacteria 2486
755 Ga0500569_085512 3300053109 Bacteria 1014
756 Ga0500572_162654 3300053111 Bacteria 730
757 Ga0500591_244542 3300053115 Bacteria 562
758 Ga0500594_0193216 3300053118 Bacteria 667
759 Ga0500608_130223 3300053122 Bacteria 1129
760 Ga0500617_099128 3300053124 Bacteria 1234
761 Ga0500652_135317 3300053131 Bacteria 1027
762 Ga0500655_024824 3300053133 Bacteria 1136
763 Ga0500658_0114807 3300053134 Bacteria 1188
764 Ga0500658_0577887 3300053134 Bacteria 504
765 Ga0500559_0090605 3300053136 Bacteria 1399
766 Ga0500577_0298151 3300053142 Bacteria 703
767 Ga0500589_136003 3300053147 Bacteria 1019
768 Ga0500590_259419 3300053148 Bacteria 684
769 Ga0500603_000471 3300053150 Bacteria 10322
770 Ga0500603_017815 3300053150 Bacteria 1702
771 Ga0500604_0064358 3300053151 Bacteria 1158
772 Ga0500630_041502 3300053159 Bacteria 2245
773 Ga0500634_0136980 3300053161 Bacteria 1165
774 Ga0500638_020824 3300053162 Bacteria 3091
775 Ga0500639_062976 3300053163 Bacteria 1907
776 Ga0500637_0117403 3300053178 Bacteria 1543
777 Ga0500637_0585898 3300053178 Bacteria 531
778 Ga0500645_007988 3300053730 Bacteria 3645
779 Ga0500609_009883 3300053731 Bacteria 1284
780 Ga0500596_008650 3300053735 Bacteria 1617
781 Ga0466962_0094852 3300061719 Bacteria 1430
782 2507504690 2507262055 Bacteria 8048963
783 2508539893 2508501009 Bacteria 7784016
784 2509149923 2508501128 Bacteria 8613869
785 2513678445 2513237098 Bacteria 9902361
786 2513714894 2513237104 Bacteria 10034502
787 2515627776 2515154112 Bacteria 8294334
788 2524466146 2524023210 Bacteria 9029266
789 2824605827 2824600985 Bacteria 8488197
790 2824611959 2824609381 Bacteria 8672835
791 2874593711 2874590934 Bacteria 8299676
792 2874647974 2874645413 Bacteria 8214782
793 2876772802 2876771140 Bacteria 8287509
794 2876826469 2876818435 Bacteria 8274608
795 2879077498 2879074833 Bacteria 8279565
796 2879134398 2879127579 Bacteria 8294491
797 2879147357 2879142872 Bacteria 8267021
798 2885369064 2885366525 Bacteria 8326213
799 2885390013 2885383462 Bacteria 9473874
800 2888427288 2888419890 Bacteria 7857137
801 2903774750 2903768456 Bacteria 9749579
802 2935615115 2935608549 Bacteria 8203142
803 2935635089 2935630451 Bacteria 8169952
804 2935825847 2935819856 Bacteria 8261050
805 2935851466 2935847175 Bacteria 8228321
806 2935910508 2935908558 Bacteria 8568796
807 2935918088 2935916978 Bacteria 9113783
808 2935927581 2935926038 Bacteria 8601059
809 2935936547 2935934488 Bacteria 8602579
810 2935943900 2935942939 Bacteria 8599779
811 2935952337 2935951376 Bacteria 8602333
812 2935969177 2935967501 Bacteria 8603075
813 2935978441 2935975950 Bacteria 8347125
814 2941511632 2941507105 Bacteria 8166816
815 2941519385 2941515067 Bacteria 8166720
816 2941527491 2941523033 Bacteria 8169134
817 8016636466 8016630954 Bacteria 9217207
818 8019622206 8019619141 Bacteria 9218857
819 8019631110 8019629233 Bacteria 8687553
820 8019639514 8019638758 Bacteria 9062356
821 8019667913 8019659431 Bacteria 8577854
822 8019677331 8019668869 Bacteria 8791617
823 8019687624 8019678201 Bacteria 8863603
824 8019696863 8019687851 Bacteria 8712826
825 8056687761 8056681323 Bacteria 8472857
826 Ga0207699_10622653
827 Ga0070658_10074107
828 Ga0070676_11319277
829 Ga0070683_100070645
830 Ga0070683_100071062
831 Ga0070683_100554795
832 Ga0070683_100639596
833 Ga0070683_102379668
834 Ga0070670_100499444
835 Ga0068869_100147079
836 Ga0070680_100080317
837 Ga0070680_100286712
838 Ga0070680_100329891
839 Ga0070680_101290745
840 Ga0070682_100030995
841 Ga0070682_100411429
842 Ga0068868_100463239
843 Ga0070660_100132091
844 Ga0070660_100390557
845 Ga0070660_101027871
846 Ga0070691_10047567
847 Ga0070691_10286962
848 Ga0070687_100420235
849 Ga0070661_100058378
850 Ga0070661_100278687
851 Ga0070692_11299386
852 Ga0070668_100131222
853 Ga0070668_100395851
854 Ga0070668_100410706
855 Ga0070668_100599513
856 Ga0070669_100269291
857 Ga0070669_101221902
858 Ga0070675_100539001
859 Ga0070675_101044717
860 Ga0070671_101245036
861 Ga0070674_100383903
862 Ga0070674_100615442
863 Ga0070673_101458780
864 Ga0070688_100150195
865 Ga0070667_100169727
866 Ga0070709_10165845
867 Ga0070709_10646004
868 Ga0070714_100111422
869 Ga0070714_100146761
870 Ga0070714_101812471
871 Ga0070713_100014007
872 Ga0070713_100037665
873 Ga0070713_100047145
874 Ga0070713_100599076
875 Ga0070713_100764899
876 Ga0070710_10181884
877 Ga0070710_11545636
878 Ga0070701_10741542
879 Ga0070711_100262060
880 Ga0070711_101577813
881 Ga0070700_100502963
882 Ga0070700_101755186
883 Ga0070694_100240093
884 Ga0070708_101148517
885 Ga0070663_100029875
886 Ga0070663_102080410
887 Ga0070678_100058786
888 Ga0070662_100681586
889 Ga0070662_100756176
890 Ga0070681_10233085
891 Ga0070681_10494310
892 Ga0070681_10666459
893 Ga0068867_100163822
894 Ga0068867_101762793
895 Ga0070706_101438542
896 Ga0070698_100075583
897 Ga0070698_100159832
898 Ga0070698_100919762
899 Ga0070699_101441519
900 Ga0070699_102056024
901 Ga0070679_100018335
902 Ga0070679_100111322
903 Ga0070679_100226998
904 Ga0070679_100516992
905 Ga0070684_100005197
906 Ga0070684_100073578
907 Ga0070684_101951615
908 Ga0070697_101603123
909 Ga0070697_102124061
910 Ga0068853_100003616
911 Ga0068853_100075062
912 Ga0068853_100078000
913 Ga0068853_100372477
914 Ga0068853_100603201
915 Ga0070693_100167533
916 Ga0070693_100221514
917 Ga0070693_100639024
918 Ga0070693_101382922
919 Ga0070665_100282285
920 Ga0068855_100151048
921 Ga0068855_100167580
922 Ga0068855_100292767
923 Ga0068855_100324958
924 Ga0068855_102561014
925 Ga0070664_100752444
926 Ga0068857_100129633
927 Ga0068857_100327863
928 Ga0068857_100520620
929 Ga0068857_100830229
930 Ga0068854_100108189
931 Ga0068854_100378708
932 Ga0068856_100311237
933 Ga0068856_102058761
934 Ga0070702_100355343
935 Ga0068852_100419692
936 Ga0068852_101869504
937 Ga0068852_102481524
938 Ga0068859_100280321
939 Ga0068866_10154120
940 Ga0068866_10246165
941 Ga0068861_100465729
942 Ga0068861_100546912
943 Ga0068861_101001793
944 Ga0068851_10239997
945 Ga0068851_10375911
946 Ga0068870_10151753
947 Ga0068870_10290996
948 Ga0068863_100100841
949 Ga0068863_100460073
950 Ga0068863_101397799
951 Ga0068863_101664071
952 Ga0068858_100232849
953 Ga0068860_100261654
954 Ga0068860_100317201
955 Ga0068860_100797709
956 Ga0068862_100479298
957 Ga0068862_101368168
958 Ga0081538_10018847
959 Ga0081540_1010741
960 Ga0081540_1044066
961 Ga0081540_1116925
962 Ga0081540_1129022
963 Ga0070717_10002055
964 Ga0070717_10025850
965 Ga0070717_10062684
966 Ga0070717_10447604
967 Ga0070717_10527968
968 Ga0070717_11513686
969 Ga0075365_10064210
970 Ga0075365_10449078
971 Ga0075368_10086302
972 Ga0075364_10056674
973 Ga0075364_10091500
974 Ga0070715_10231657
975 Ga0070716_100085755
976 Ga0070712_100036410
977 Ga0070712_100217510
978 Ga0070712_100679598
979 Ga0075362_10459273
980 Ga0075362_10710474
981 Ga0075367_10101385
982 Ga0075369_10074650
983 Ga0075369_10079522
984 Ga0075369_10322525
985 Ga0075366_10232338
986 Ga0075366_10734001
987 Ga0097621_102126650
988 Ga0097621_102326284
989 Ga0075370_10292872
990 Ga0075370_10370304
991 Ga0068871_100473540
992 Ga0075428_100071481
993 Ga0075434_100913673
994 Ga0068865_100378702
995 Ga0068865_100894952
996 Ga0075436_100338525
997 Ga0097620_100280339
998 Ga0099824_1009956
999 Ga0099822_1003320
1000 Ga0075435_100142716
1001 Ga0099794_10103337
1002 Ga0105244_10430514
1003 Ga0105240_10027735
1004 Ga0105240_10039101
1005 Ga0105240_11123228
1006 Ga0105240_11282958
1007 Ga0105240_11537270
1008 Ga0105240_11994006
1009 Ga0111539_11315444
1010 Ga0105245_10520441
1011 Ga0105247_10030902
1012 Ga0114129_10186448
1013 Ga0105243_10625738
1014 Ga0105241_10213333
1015 Ga0105241_10230294
1016 Ga0105241_11580498
1017 Ga0105241_11976819
1018 Ga0105241_12124722
1019 Ga0105242_11174516
1020 Ga0105237_10083252
1021 Ga0105237_10114579
1022 Ga0105237_10173918
1023 Ga0105237_10207347
1024 Ga0105237_10291768
1025 Ga0105237_11503513
1026 Ga0105237_12755759
1027 Ga0105238_10024432
1028 Ga0105238_10426567
1029 Ga0105238_10969713
1030 Ga0105238_11233736
1031 Ga0105238_11247638
1032 Ga0105249_10447826
1033 Ga0105249_12999847
1034 Ga0105239_12421231
1035 Ga0157373_11191158
1036 Ga0157371_11583846
1037 Ga0157370_10291533
1038 Ga0157369_10010577
1039 Ga0157369_10029140
1040 Ga0157369_10057631
1041 Ga0157369_10256069
1042 Ga0157369_10395721
1043 Ga0157369_10937136
1044 Ga0157374_10127650
1045 Ga0157374_10130073
1046 Ga0157378_12723656
1047 Ga0163162_11258510
1048 Ga0157372_10191292
1049 Ga0157372_10231909
1050 Ga0157372_10624217
1051 Ga0157372_11000251
1052 Ga0157372_11992369
1053 Ga0157375_10742873
1054 Ga0157375_10951434
1055 Ga0163163_10978299
1056 Ga0157380_10710528
1057 Ga0182008_10911311
1058 Ga0157377_10576315
1059 Ga0157379_10593588
1060 Ga0157379_10624234
1061 Ga0157376_12075156
1062 Ga0163161_10223335
1063 Ga0206354_10897466
1064 Ga0206353_10806392
1065 Ga0213872_10184447
1066 Ga0213872_10271858
1067 Ga0213874_10326507
1068 Ga0213876_10048068
1069 Ga0213876_10073542
1070 Ga0213876_10198895
1071 Ga0213871_10036026
1072 Ga0213871_10039473
1073 Ga0207697_10228229
1074 Ga0207656_10030324
1075 Ga0207656_10246355
1076 Ga0207696_1070874
1077 Ga0207653_10032153
1078 Ga0207692_10019382
1079 Ga0207692_10270998
1080 Ga0207710_10035980
1081 Ga0207710_10310691
1082 Ga0207688_10087147
1083 Ga0207688_10296481
1084 Ga0207647_10078632
1085 Ga0207647_10295479
1086 Ga0207685_10143462
1087 Ga0207685_10327559
1088 Ga0207699_10059264
1089 Ga0207699_10144448
1090 Ga0207699_10215010
1091 Ga0207699_10581456
1092 Ga0207699_10607743
1093 Ga0207645_10305965
1094 Ga0207643_10061232
1095 Ga0207643_10410818
1096 Ga0207705_10338064
1097 Ga0207654_10146409
1098 Ga0207654_10418811
1099 Ga0207654_10633747
1100 Ga0207707_10016071
1101 Ga0207707_10022743
1102 Ga0207707_10161790
1103 Ga0207707_10185538
1104 Ga0207695_10079841
1105 Ga0207695_10461212
1106 Ga0207671_10071044
1107 Ga0207671_10147627
1108 Ga0207671_10163432
1109 Ga0207671_10340856
1110 Ga0207671_10871093
1111 Ga0207671_11220028
1112 Ga0207693_10021733
1113 Ga0207693_10037984
1114 Ga0207693_10612279
1115 Ga0207693_11189201
1116 Ga0207663_10018567
1117 Ga0207663_10296574
1118 Ga0207663_10866463
1119 Ga0207660_10060229
1120 Ga0207660_10198844
1121 Ga0207660_10294905
1122 Ga0207662_10089675
1123 Ga0207662_10687789
1124 Ga0207657_10003938
1125 Ga0207657_10184151
1126 Ga0207649_10027984
1127 Ga0207649_10088726
1128 Ga0207652_10015649
1129 Ga0207652_10235463
1130 Ga0207652_10247740
1131 Ga0207646_11164086
1132 Ga0207681_10108689
1133 Ga0207694_10202304
1134 Ga0207694_10245974
1135 Ga0207694_10280831
1136 Ga0207694_10283757
1137 Ga0207694_10337857
1138 Ga0207694_10917372
1139 Ga0207659_10566268
1140 Ga0207687_10029053
1141 Ga0207687_10404262
1142 Ga0207700_10004386
1143 Ga0207700_10253122
1144 Ga0207700_10330785
1145 Ga0207700_10402611
1146 Ga0207700_10779679
1147 Ga0207664_10112953
1148 Ga0207664_10175510
1149 Ga0207664_10320507
1150 Ga0207644_11796175
1151 Ga0207706_10083263
1152 Ga0207706_10654616
1153 Ga0207709_10462319
1154 Ga0207669_10647924
1155 Ga0207704_10411449
1156 Ga0207665_10047449
1157 Ga0207665_10289424
1158 Ga0207665_10426702
1159 Ga0207665_10440802
1160 Ga0207711_11024845
1161 Ga0207689_10084246
1162 Ga0207689_10110205
1163 Ga0207689_10268731
1164 Ga0207661_10000379
1165 Ga0207661_10042228
1166 Ga0207661_10134977
1167 Ga0207661_12026075
1168 Ga0207667_10014216
1169 Ga0207667_10101158
1170 Ga0207667_10153163
1171 Ga0207667_10219602
1172 Ga0207667_10352714
1173 Ga0207667_10371583
1174 Ga0207667_11249746
1175 Ga0207712_10452450
1176 Ga0207668_10023201
1177 Ga0207668_10156973
1178 Ga0207640_10334805
1179 Ga0207640_10481486
1180 Ga0207640_10520830
1181 Ga0207640_10560721
1182 Ga0207640_10618257
1183 Ga0207658_10539905
1184 Ga0207677_10162774
1185 Ga0207703_10039783
1186 Ga0207639_10062959
1187 Ga0207639_10488318
1188 Ga0207639_10567287
1189 Ga0207678_10052855
1190 Ga0207678_10139221
1191 Ga0207678_10246721
1192 Ga0207708_10482312
1193 Ga0207702_10397605
1194 Ga0207702_11879266
1195 Ga0207702_12327202
1196 Ga0207702_12347953
1197 Ga0207641_10105524
1198 Ga0207641_12130722
1199 Ga0207648_10052913
1200 Ga0207676_10238609
1201 Ga0207674_10011007
1202 Ga0207674_10028810
1203 Ga0207674_10039718
1204 Ga0207674_10098292
1205 Ga0207674_11154903
1206 Ga0207675_100093476
1207 Ga0207675_100339181
1208 Ga0207675_100659012
1209 Ga0207683_11883678
1210 Ga0207698_10143546
1211 Ga0207698_10158800
1212 Ga0207698_10460099
1213 Ga0207698_10986748
1214 Ga0207698_11074526
1215 Ga0209589_1000276
1216 Ga0209489_100714
1217 Ga0209700_100732
1218 Ga0209179_1064997
1219 Ga0268266_10059890
1220 Ga0268266_10184839
1221 Ga0268265_10052897
1222 Ga0268265_10502666
1223 Ga0268265_11090794
1224 Ga0268265_11855011
1225 Ga0268264_10197436
1226 Ga0268264_10605392
1227 Ga0307515_10641599
1228 Ga0265770_1092733
1229 Ga0307408_100985233
1230 Ga0307508_10000613
1231 Ga0307508_10223138
1232 Ga0307516_10217401
1233 Ga0307405_10990885
1234 Ga0307413_10944247
1235 Ga0307410_11803588
1236 Ga0307407_10688089
1237 Ga0307412_12072206
1238 Ga0307409_100796271
1239 Ga0307415_100442605
1240 Ga0307510_10083149
1241 Ga0315911_1000024
1242 Ga0316215_1008078
1243 Ga0373930_0087063
1244 Ga0373934_0025525
1245 Ga0373944_0131102
1246 Ga0373951_0027302
1247 Ga0373923_0004740
1248 Ga0373923_0059980
1249 Ga0373936_0058563
1250 Ga0373936_0184379
1251 Ga0373941_0476254
1252 Ga0373945_0108419
1253 Ga0373953_0000315
1254 Ga0373953_0149027
1255 Ga0373954_0000544
1256 Ga0373954_0059130
1257 Ga0373956_0001464
1258 Ga0373957_0000132
1259 Ga0373960_0443987
1260 Ga0373943_0008271
1261 Ga0373943_0233956
1262 Ga0373943_0900322
1263 Ga0373946_0052464
1264 Ga0373946_0180246
1265 Ga0373946_0205645
1266 Ga0373955_0001029
1267 Ga0373955_0012972
1268 Ga0373924_0002229
1269 Ga0373924_0025023
1270 Ga0373935_0008474
1271 Ga0373927_0026977
1272 Ga0373927_0081198
1273 Ga0373927_0160437
1274 Ga0373933_0004346
1275 Ga0373933_0090500
1276 Ga0373947_0005615
1277 Ga0373947_0052888
1278 Ga0373947_0394156
1279 Ga0373947_1149472
1280 Ga0373937_0011261
1281 Ga0373937_0154490
1282 Ga0372808_020526
1283 Ga0373925_0101568
1284 Ga0373925_0139226
1285 Ga0373925_0189088
1286 Ga0373925_0189390
1287 Ga0395899_0047216
1288 Ga0395900_0041199
1289 Ga0395900_0133440
1290 Ga0395900_0584068
1291 Ga0395900_1044521
1292 Ga0395898_0074171
1293 Ga0395898_0195700
1294 Ga0395898_0571924
1295 Ga0395898_1077814
1296 Ga0395905_0061218
1297 Ga0436364_0625313
1298 Ga0436364_0846361
1299 Ga0436364_0897381
1300 Ga0395901_0181707
1301 Ga0395901_0747049
1302 Ga0395901_0837938
1303 Ga0436365_0546711
1304 Ga0436365_0679202
1305 Ga0436365_1575698
1306 Ga0436365_1636461
1307 Ga0436360_0605888
1308 Ga0436360_0623614
1309 Ga0436360_0900103
1310 Ga0436361_0415653
1311 Ga0436361_0536082
1312 Ga0436361_0871366
1313 Ga0436361_1070125
1314 Ga0436363_0255034
1315 Ga0436363_1470508
1316 Ga0436363_1523880
1317 Ga0436363_1552585
1318 Ga0439465_0063161
1319 Ga0451789_0987762
1320 Ga0451791_0399830
1321 Ga0451793_1408444
1322 Ga0451797_0664391
1323 Ga0451795_0323264
1324 Ga0451802_0065833
1325 Ga0451804_0799267
1326 Ga0451841_0245673
1327 Ga0451849_0016062
1328 Ga0451843_0952249
1329 Ga0451853_2076652
1330 Ga0451853_3346658
1331 Ga0439431_0067454
1332 Ga0466969_0121469
1333 Ga0466969_0153426
1334 Ga0466972_0381847
1335 Ga0466966_0664179
1336 Ga0466961_0322890
1337 Ga0466963_0309322
1338 Ga0466963_0723513
1339 Ga0466964_0834151
1340 Ga0466968_0228936
1341 Ga0466970_0110162
1342 Ga0466957_0467670
1343 Ga0466959_0034315
1344 Ga0466959_0040827
1345 Ga0466967_0094270
1346 Ga0466967_0934359
1347 Ga0466967_1239705
1348 Ga0466967_1344867
1349 Ga0466967_1779922
1350 Ga0495617_023921
1351 Ga0495617_105714
1352 Ga0495592_0002799
1353 Ga0495603_0019207
1354 Ga0495603_0099252
1355 Ga0495603_0387489
1356 Ga0495590_0323275
1357 Ga0495629_0001273
1358 Ga0495629_0183840
1359 Ga0495638_0248546
1360 Ga0495651_0032471
1361 Ga0495653_0005040
1362 Ga0495580_0014347
1363 Ga0495580_1033455
1364 Ga0495582_0038446
1365 Ga0495582_0523143
1366 Ga0495605_0111864
1367 Ga0495639_0003783
1368 Ga0495639_0278472
1369 Ga0495639_0697641
1370 Ga0495662_0069547
1371 Ga0495664_0316327
1372 Ga0495664_0346038
1373 Ga0495664_0475175
1374 Ga0495584_0157138
1375 Ga0495584_0201238
1376 Ga0495584_0462738
1377 Ga0495585_0396084
1378 Ga0495594_0051169
1379 Ga0495594_0201816
1380 Ga0495594_0255973
1381 Ga0495596_0134256
1382 Ga0495596_0445718
1383 Ga0495607_0061227
1384 Ga0495583_0335328
1385 Ga0495606_0070867
1386 Ga0495608_0001214
1387 Ga0495610_0032392
1388 Ga0495618_0030915
1389 Ga0495618_0110963
1390 Ga0495628_0081568
1391 Ga0495630_0020544
1392 Ga0495630_0506053
1393 Ga0495631_0050637
1394 Ga0495631_0095958
1395 Ga0495631_0197220
1396 Ga0495632_0406455
1397 Ga0495632_0422409
1398 Ga0495637_0141262
1399 Ga0495644_0035431
1400 Ga0495644_0121088
1401 Ga0495648_0174069
1402 Ga0495648_0414890
1403 Ga0495663_0168339
1404 Ga0495666_0077876
1405 Ga0495666_0107489
1406 Ga0495652_0003248
1407 Ga0495665_0149052
1408 Ga0495640_0010798
1409 Ga0495586_0082041
1410 Ga0495587_0047714
1411 Ga0495598_0075975
1412 Ga0495598_0099920
1413 Ga0495609_0148466
1414 Ga0495621_0129584
1415 Ga0495645_0013653
1416 Ga0495645_0053615
1417 Ga0495645_0107774
1418 Ga0495622_0405262
1419 Ga0495633_0074605
1420 Ga0495667_0000340
1421 Ga0495667_0052128
1422 Ga0495656_0048878
1423 Ga0495656_0178515
1424 Ga0495656_0482028
1425 Ga0495668_0133035
1426 Ga0495634_0056236
1427 Ga0495625_0309108
1428 Ga0495625_0446786
1429 Ga0495625_0901072
1430 Ga0495635_0000220
1431 Ga0495635_0035176
1432 Ga0495659_0025848
1433 Ga0495659_0230223
1434 Ga0495661_0109013
1435 Ga0495661_0171133
1436 Ga0495588_0012335
1437 Ga0495588_0351800
1438 Ga0495657_0560963
1439 Ga0495599_0009707
1440 Ga0495599_0028612
1441 Ga0495623_0040283
1442 Ga0495646_0026782
1443 Ga0495646_0156901
1444 Ga0495646_0201447
1445 Ga0495647_0005990
1446 Ga0495658_0008260
1447 Ga0495658_0186030
1448 Ga0495613_0024162
1449 Ga0495624_0258495
1450 Ga0495670_0039761
1451 Ga0495670_0085695
1452 Ga0495671_0033230
1453 Ga0495589_0203592
1454 Ga0495589_0290125
1455 Ga0495600_0000811
1456 Ga0495600_0426703
1457 Ga0495581_0035389
1458 Ga0495604_0000980
1459 Ga0495604_0119063
1460 Ga0495604_0149347
1461 Ga0495636_0054292
1462 Ga0495636_0304861
1463 Ga0495636_0561487
1464 Ga0495674_0013462
1465 Ga0495674_0132644
1466 Ga0495674_1392530
1467 Ga0495676_0158086
1468 Ga0495676_0209517
1469 Ga0495676_0307297
1470 Ga0495680_0003737
1471 Ga0495680_0254455
1472 Ga0495683_0156371
1473 Ga0495675_0039158
1474 Ga0495673_0125321
1475 Ga0495684_0000133
1476 Ga0495684_0120392
1477 Ga0495686_0525604
1478 Ga0495593_0001898
1479 Ga0495593_0030634
1480 Ga0495602_0006150
1481 Ga0495614_0184642
1482 Ga0496100_0050556
1483 Ga0496101_0075387
1484 Ga0496101_0469253
1485 Ga0496102_0171328
1486 Ga0496102_0399426
1487 Ga0496102_1016668
1488 Ga0496103_0620976
1489 Ga0496103_0651973
1490 Ga0496105_0386644
1491 Ga0496105_0467669
1492 Ga0496105_0596159
1493 Ga0496106_0235794
1494 Ga0496107_0366915
1495 Ga0496108_0392240
1496 Ga0496108_0664579
1497 Ga0496109_0042780
1498 Ga0496110_0444183
1499 Ga0496110_0541805
1500 Ga0496111_1172836
1501 Ga0496112_0051810
1502 Ga0496112_0799485
1503 Ga0496113_0197356
1504 Ga0496113_0617559
1505 Ga0496114_1185317
1506 Ga0496115_0163342
1507 Ga0496115_0399851
1508 Ga0496115_0467388
1509 Ga0496115_1248625
1510 Ga0496118_0299268
1511 Ga0496120_0265684
1512 Ga0496121_0078321
1513 Ga0496121_0168427
1514 Ga0496121_0271403
1515 Ga0496122_0056773
1516 Ga0496124_0723072
1517 Ga0496126_0021458
1518 Ga0496126_0066263
1519 Ga0496126_0144871
1520 Ga0496126_0158268
1521 Ga0496126_0364066
1522 Ga0496126_0624127
1523 Ga0496126_1046825
1524 Ga0496126_1405024
1525 Ga0495682_0013468
1526 Ga0495682_0144185
1527 Ga0501032_0285423
1528 Ga0501033_0183383
1529 Ga0501033_0446318
1530 Ga0501034_1168516
1531 Ga0501034_1708582
1532 Ga0501038_0294577
1533 Ga0501046_0860292
1534 Ga0501047_0069234
1535 Ga0501067_0286132
1536 Ga0501070_0075254
1537 Ga0501074_0032975
1538 Ga0501080_0004892
1539 Ga0501035_0298879
1540 Ga0501044_0509884
1541 Ga0501044_0748363
1542 Ga0501044_1282063
1543 nmdc:mga03683_175667_c1
1544 nmdc:mga03n38_185721_c1
1545 nmdc:mga03n38_398259_c1
1546 nmdc:mga0yw44_43805_c1
1547 nmdc:mga0yw44_525991_c1
1548 nmdc:mga0k408_630445_c1
1549 nmdc:mga07m45_692081_c1
1550 nmdc:mga09592_271786_c1
1551 nmdc:mga06r32_472510_c1
1552 nmdc:mga08y16_661186_c1
1553 nmdc:mga0n895_1053501_c1
1554 nmdc:mga0n895_47139_c1
1555 nmdc:mga0rr50_1180313_c1
1556 nmdc:mga0rr50_128322_c1
1557 nmdc:mga08x19_302987_c1
1558 nmdc:mga0sz30_159630_c1
1559 nmdc:mga0sz30_239427_c1
1560 nmdc:mga0sz30_295724_c1
1561 nmdc:mga0sz30_38929_c1
1562 Ga0495601_0041757
1563 Ga0495601_0217938
1564 Ga0495601_0366610
1565 Ga0495612_0016582
1566 Ga0495612_0025472
1567 Ga0500635_0017751
1568 Ga0495655_0035481
1569 Ga0495655_0041987
1570 Ga0495595_0002222
1571 Ga0495619_0000997
1572 Ga0500643_037900
1573 Ga0500651_0057266
1574 Ga0500566_0000527
1575 Ga0500566_0279508
1576 Ga0500640_150042
1577 Ga0500641_0074974
1578 Ga0500554_028670
1579 Ga0500555_012028
1580 Ga0500569_085512
1581 Ga0500572_162654
1582 Ga0500591_244542
1583 Ga0500594_0193216
1584 Ga0500608_130223
1585 Ga0500617_099128
1586 Ga0500652_135317
1587 Ga0500655_024824
1588 Ga0500658_0114807
1589 Ga0500658_0577887
1590 Ga0500559_0090605
1591 Ga0500577_0298151
1592 Ga0500589_136003
1593 Ga0500590_259419
1594 Ga0500603_000471
1595 Ga0500603_017815
1596 Ga0500604_0064358
1597 Ga0500630_041502
1598 Ga0500634_0136980
1599 Ga0500638_020824
1600 Ga0500639_062976
1601 Ga0500637_0117403
1602 Ga0500637_0585898
1603 Ga0500645_007988
1604 Ga0500609_009883
1605 Ga0500596_008650
1606 Ga0466962_0094852
1607 2507504690
1608 2508539893
1609 2509149923
1610 2513678445
1611 2513714894
1612 2515627776
1613 2524466146
1614 2824605827
1615 2824611959
1616 2874593711
1617 2874647974
1618 2876772802
1619 2876826469
1620 2879077498
1621 2879134398
1622 2879147357
1623 2885369064
1624 2885390013
1625 2888427288
1626 2903774750
1627 2935615115
1628 2935635089
1629 2935825847
1630 2935851466
1631 2935910508
1632 2935918088
1633 2935927581
1634 2935936547
1635 2935943900
1636 2935952337
1637 2935969177
1638 2935978441
1639 2941511632
1640 2941519385
1641 2941527491
1642 8016636466
1643 8019622206
1644 8019631110
1645 8019639514
1646 8019667913
1647 8019677331
1648 8019687624
1649 8019696863
1650 8056687761

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

22

103

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.8843 21 103
4xwj-assembly1.cif.gz_B histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.8801 21 101
1kkm-assembly1.cif.gz_J l.casei hprk/p in complex with b.subtilis p-ser-hpr 0.8744 21 102
1pfh-assembly1.cif.gz_A the phosphorylated form of the histidine-containing phosphocarrier protein hpr 0.8707 21 101
1cm3-assembly1.cif.gz_A his15asp hpr from e. coli 0.8699 21 103
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8596 21 102 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.846 19 99 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8456 23 102 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.8419 21 106 3.30.1340.10
3oqoD00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.835 21 102 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A1M6NVE1-F1-model_v4 Phosphocarrier protein HPr 0.9198 21 100
AF-A0A1H3G2X7-F1-model_v4 Phosphocarrier protein 0.9004 21 102
AF-A0A8A7KNC3-F1-model_v4 Phosphocarrier protein HPr 0.8953 20 100 GO:0005737
GO:0009401
AF-A0A7C9M2K0-F1-model_v4 deleted 0.8914 21 106
AF-A0A6G2WYR0-F1-model_v4 deleted 0.8913 21 102

Map