F482391

General Info

Members Datasets Scaffolds Average Seq Length
824 354 1644 449

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0092628|Ga0316584_0092628_195_1640
Length 481
Sequence LDFSKVQSFQREGTSQVKNNAVGSRVKVSADGQGVVSHAGMALLRELADRTGLSAQVTAALADTYRGPWVYAPGDVFADLAAAVADGADCIDGVGQLCGDREHVFGAKASTTTMWRLVDERIDAAHLPAIRAARSSARAAAWSAGAAPASGQWLHIDIDATLVIDHSDNTELAAPTWKKTFGLHPLLAFLDRPEIAGGEALAGLLRTGRAGSNTAADHITVLHQALASLPAHWRPDPHDPDTARVLVRCDTAGATHDFATACRTAGVGFSFGYPVDARVQDAVDTLNLGNAWYPAIDTDGGIRDGAWVAEATDLVNLSSWPAGTRLILRKERPHPGAQLRFTDADGMRVTAFITDTPTGVVPGQVAGLELRHRQHARIEDRIRELKATGLRNLPCHSFSANAAWLEIILAAADLVTWCRLLGFTGHPDLGRVEITTFRYRVLHMAARITRGARQTRLRIDATWRWAAIIATAWQAIRTAFG

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
193 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
196 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
197 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
204 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
211 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
228 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
242 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
243 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
244 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
245 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
252 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
276 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
279 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
299 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
341 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
346 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
350 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0
Isolates 0.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 7.4
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 0.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0092628 3300036712 Bacteria 2262
2 JGI24736J21556_1008923 3300001904 Bacteria 1661
3 JGI24746J21847_1007238 3300001977 Bacteria 1702
4 JGI24746J21847_1007383 3300001977 Bacteria 1684
5 JGI24747J21853_1001697 3300001978 Bacteria 1690
6 JGI24747J21853_1002064 3300001978 Bacteria 1588
7 JGI24739J22299_10034178 3300001989 Bacteria 1734
8 JGI24739J22299_10034798 3300001989 Bacteria 1713
9 JGI24739J22299_10041781 3300001989 Bacteria 1523
10 JGI24737J22298_10030397 3300001990 Bacteria 1690
11 JGI24743J22301_10009823 3300001991 Bacteria 1701
12 JGI24743J22301_10009973 3300001991 Bacteria 1690
13 JGI24735J21928_10008388 3300002067 Bacteria 3341
14 JGI24735J21928_10026974 3300002067 Bacteria 1723
15 JGI24750J21931_1004411 3300002070 Bacteria 1704
16 JGI24750J21931_1004547 3300002070 Bacteria 1684
17 JGI24745J21846_1002594 3300002073 Bacteria 1853
18 JGI24745J21846_1003253 3300002073 Bacteria 1691
19 JGI24745J21846_1003893 3300002073 Bacteria 1578
20 JGI24748J21848_1003987 3300002074 Bacteria 1692
21 JGI24738J21930_10014360 3300002075 Bacteria 1699
22 JGI24738J21930_10014579 3300002075 Bacteria 1685
23 JGI24749J21850_1006030 3300002076 Bacteria 1688
24 JGI24749J21850_1006687 3300002076 Bacteria 1604
25 JGI24744J21845_10010146 3300002077 Bacteria 1931
26 JGI24744J21845_10012850 3300002077 Bacteria 1692
27 JGI24744J21845_10014660 3300002077 Bacteria 1571
28 JGI24034J26672_10006156 3300002239 Bacteria 1728
29 JGI24742J22300_10008261 3300002244 Bacteria 1717
30 JGI24742J22300_10008491 3300002244 Bacteria 1695
31 JGI24742J22300_10010071 3300002244 Bacteria 1562
32 Ga0070676_10052413 3300005328 Bacteria 2399
33 Ga0070676_10098620 3300005328 Bacteria 1802
34 Ga0070690_100093664 3300005330 Bacteria 1982
35 Ga0070690_100171910 3300005330 Bacteria 1491
36 Ga0070677_10028372 3300005333 Bacteria 2114
37 Ga0070677_10036988 3300005333 Bacteria 1902
38 Ga0068869_100082662 3300005334 Bacteria 2400
39 Ga0068869_100106218 3300005334 Bacteria 2131
40 Ga0068869_100143329 3300005334 Bacteria 1847
41 Ga0068869_100180979 3300005334 Bacteria 1652
42 Ga0070666_10121181 3300005335 Bacteria 1814
43 Ga0070666_10129268 3300005335 Bacteria 1754
44 Ga0070680_100081691 3300005336 Bacteria 2666
45 Ga0070682_100105072 3300005337 Bacteria 1872
46 Ga0070682_100106241 3300005337 Bacteria 1863
47 Ga0068868_100057465 3300005338 Bacteria 3074
48 Ga0068868_100122225 3300005338 Bacteria 2125
49 Ga0068868_100150001 3300005338 Bacteria 1919
50 Ga0068868_100154392 3300005338 Bacteria 1892
51 Ga0070660_100086512 3300005339 Bacteria 2466
52 Ga0070660_100103330 3300005339 Bacteria 2260
53 Ga0070689_100110455 3300005340 Bacteria 2186
54 Ga0070689_100147560 3300005340 Bacteria 1895
55 Ga0070691_10049316 3300005341 Bacteria 2005
56 Ga0070691_10053197 3300005341 Bacteria 1936
57 Ga0070687_100004946 3300005343 Bacteria 5353
58 Ga0070687_100091065 3300005343 Bacteria 1687
59 Ga0070661_100064418 3300005344 Bacteria 2693
60 Ga0070692_10045665 3300005345 Bacteria 2260
61 Ga0070668_100125693 3300005347 Bacteria 2054
62 Ga0070668_100127496 3300005347 Bacteria 2039
63 Ga0070668_100138368 3300005347 Bacteria 1960
64 Ga0070668_100148844 3300005347 Bacteria 1891
65 Ga0070669_100122419 3300005353 Bacteria 1986
66 Ga0070669_100131369 3300005353 Bacteria 1921
67 Ga0070669_100149945 3300005353 Bacteria 1804
68 Ga0070675_100148316 3300005354 Bacteria 2010
69 Ga0070675_100171179 3300005354 Bacteria 1873
70 Ga0070675_100212770 3300005354 Bacteria 1681
71 Ga0070671_100085337 3300005355 Bacteria 2641
72 Ga0070674_100048619 3300005356 Bacteria 2912
73 Ga0070674_100064230 3300005356 Bacteria 2571
74 Ga0070674_100072186 3300005356 Bacteria 2443
75 Ga0070674_100112195 3300005356 Bacteria 2004
76 Ga0070674_100145930 3300005356 Bacteria 1781
77 Ga0070674_100148095 3300005356 Bacteria 1769
78 Ga0070674_100155170 3300005356 Bacteria 1731
79 Ga0070673_100058498 3300005364 Bacteria 3048
80 Ga0070673_100144497 3300005364 Bacteria 2010
81 Ga0070688_100042370 3300005365 Bacteria 2800
82 Ga0070688_100114459 3300005365 Bacteria 1798
83 Ga0070659_100162366 3300005366 Bacteria 1827
84 Ga0070667_100000063 3300005367 Bacteria 138777
85 Ga0070667_100128810 3300005367 Bacteria 2207
86 Ga0070667_100130453 3300005367 Bacteria 2193
87 Ga0070667_100256814 3300005367 Bacteria 1564
88 Ga0070703_10022305 3300005406 Bacteria 1858
89 Ga0070709_10108591 3300005434 Bacteria 1861
90 Ga0070709_10115192 3300005434 Bacteria 1812
91 Ga0070709_10156882 3300005434 Bacteria 1578
92 Ga0070714_100034024 3300005435 Bacteria 4266
93 Ga0070714_100046110 3300005435 Bacteria 3696
94 Ga0070714_100092755 3300005435 Bacteria 2647
95 Ga0070713_100171062 3300005436 Bacteria 1946
96 Ga0070713_100180529 3300005436 Bacteria 1896
97 Ga0070713_100218749 3300005436 Bacteria 1727
98 Ga0070713_100226679 3300005436 Bacteria 1697
99 Ga0070710_10001139 3300005437 Bacteria 12601
100 Ga0070710_10052565 3300005437 Bacteria 2292
101 Ga0070710_10079364 3300005437 Bacteria 1912
102 Ga0070710_10094295 3300005437 Bacteria 1771
103 Ga0070710_10106762 3300005437 Bacteria 1676
104 Ga0070701_10051751 3300005438 Bacteria 2131
105 Ga0070711_100042451 3300005439 Bacteria 3074
106 Ga0070711_100073662 3300005439 Bacteria 2414
107 Ga0070711_100143027 3300005439 Bacteria 1795
108 Ga0070711_100145864 3300005439 Bacteria 1780
109 Ga0070711_100149893 3300005439 Bacteria 1758
110 Ga0070705_100092565 3300005440 Bacteria 1887
111 Ga0070705_100108187 3300005440 Bacteria 1770
112 Ga0070700_100084271 3300005441 Bacteria 2059
113 Ga0070700_100086296 3300005441 Bacteria 2037
114 Ga0070694_100095944 3300005444 Bacteria 2089
115 Ga0070694_100113341 3300005444 Bacteria 1935
116 Ga0070708_100226806 3300005445 Bacteria 1753
117 Ga0070663_100078758 3300005455 Bacteria 2416
118 Ga0070663_100104094 3300005455 Bacteria 2122
119 Ga0070663_100133939 3300005455 Bacteria 1885
120 Ga0070663_100136394 3300005455 Bacteria 1869
121 Ga0070678_100133167 3300005456 Bacteria 1978
122 Ga0070678_100141851 3300005456 Bacteria 1923
123 Ga0070678_100147380 3300005456 Bacteria 1891
124 Ga0070678_100161984 3300005456 Bacteria 1813
125 Ga0070678_100226962 3300005456 Bacteria 1555
126 Ga0070662_100054514 3300005457 Bacteria 2897
127 Ga0070662_100105168 3300005457 Bacteria 2142
128 Ga0070662_100118176 3300005457 Bacteria 2029
129 Ga0070681_10237430 3300005458 Bacteria 1737
130 Ga0068867_100094833 3300005459 Bacteria 2270
131 Ga0068867_100108520 3300005459 Bacteria 2129
132 Ga0068867_100117673 3300005459 Bacteria 2049
133 Ga0068867_100118654 3300005459 Bacteria 2041
134 Ga0068867_100132039 3300005459 Bacteria 1942
135 Ga0068867_100151773 3300005459 Bacteria 1820
136 Ga0070685_10103806 3300005466 Bacteria 1740
137 Ga0070685_10111844 3300005466 Bacteria 1684
138 Ga0070706_100108618 3300005467 Bacteria 2581
139 Ga0070706_100229665 3300005467 Bacteria 1732
140 Ga0070707_100066924 3300005468 Bacteria 3454
141 Ga0070679_100207312 3300005530 Bacteria 1924
142 Ga0070684_100181523 3300005535 Bacteria 1914
143 Ga0070697_100042658 3300005536 Bacteria 3671
144 Ga0070697_100133862 3300005536 Bacteria 2080
145 Ga0068853_100116137 3300005539 Bacteria 2382
146 Ga0068853_100234930 3300005539 Bacteria 1678
147 Ga0070672_100121482 3300005543 Bacteria 2138
148 Ga0070672_100138813 3300005543 Bacteria 2003
149 Ga0070672_100141339 3300005543 Bacteria 1986
150 Ga0070686_100103932 3300005544 Bacteria 1923
151 Ga0070695_100034573 3300005545 Bacteria 3169
152 Ga0070695_100120602 3300005545 Bacteria 1793
153 Ga0070696_100046796 3300005546 Bacteria 3000
154 Ga0070696_100092825 3300005546 Bacteria 2152
155 Ga0070696_100144830 3300005546 Bacteria 1739
156 Ga0070693_100076889 3300005547 Bacteria 1979
157 Ga0070693_100112966 3300005547 Bacteria 1674
158 Ga0070693_100130170 3300005547 Bacteria 1572
159 Ga0070665_100038845 3300005548 Bacteria 4786
160 Ga0070665_100121416 3300005548 Bacteria 2614
161 Ga0070704_100027777 3300005549 Bacteria 3758
162 Ga0070704_100134279 3300005549 Bacteria 1923
163 Ga0070704_100169368 3300005549 Bacteria 1735
164 Ga0068855_100202461 3300005563 Bacteria 2234
165 Ga0068854_100084019 3300005578 Bacteria 2355
166 Ga0068854_100095405 3300005578 Bacteria 2220
167 Ga0068854_100105391 3300005578 Bacteria 2119
168 Ga0068854_100107339 3300005578 Bacteria 2101
169 Ga0068854_100121527 3300005578 Bacteria 1983
170 Ga0068856_100241295 3300005614 Bacteria 1822
171 Ga0070702_100057598 3300005615 Bacteria 2248
172 Ga0070702_100069975 3300005615 Bacteria 2069
173 Ga0070702_100074727 3300005615 Bacteria 2012
174 Ga0070702_100098659 3300005615 Bacteria 1787
175 Ga0068852_100106604 3300005616 Bacteria 2541
176 Ga0068852_100179614 3300005616 Bacteria 1989
177 Ga0068859_100046582 3300005617 Bacteria 4354
178 Ga0068859_100110083 3300005617 Bacteria 2816
179 Ga0068859_100266080 3300005617 Bacteria 1806
180 Ga0068864_100200293 3300005618 Bacteria 1834
181 Ga0068866_10012648 3300005718 Bacteria 3683
182 Ga0068866_10058771 3300005718 Bacteria 1987
183 Ga0068866_10060278 3300005718 Bacteria 1966
184 Ga0068866_10071665 3300005718 Bacteria 1833
185 Ga0068866_10086420 3300005718 Bacteria 1697
186 Ga0068861_100135483 3300005719 Bacteria 2003
187 Ga0068861_100185579 3300005719 Bacteria 1734
188 Ga0068861_100191745 3300005719 Bacteria 1709
189 Ga0068861_100215980 3300005719 Bacteria 1618
190 Ga0068851_10082013 3300005834 Bacteria 1685
191 Ga0068870_10041190 3300005840 Bacteria 2399
192 Ga0068870_10068266 3300005840 Bacteria 1931
193 Ga0068863_100222363 3300005841 Bacteria 1819
194 Ga0068863_100267846 3300005841 Bacteria 1653
195 Ga0068858_100148409 3300005842 Bacteria 2203
196 Ga0068858_100172547 3300005842 Bacteria 2039
197 Ga0068858_100245872 3300005842 Bacteria 1698
198 Ga0068860_100000065 3300005843 Bacteria 186634
199 Ga0068860_100106472 3300005843 Bacteria 2678
200 Ga0068860_100117524 3300005843 Bacteria 2544
201 Ga0068860_100164410 3300005843 Bacteria 2141
202 Ga0068860_100228677 3300005843 Bacteria 1807
203 Ga0068860_100269031 3300005843 Bacteria 1663
204 Ga0068862_100117701 3300005844 Bacteria 2338
205 Ga0068862_100140727 3300005844 Bacteria 2141
206 Ga0068862_100180125 3300005844 Bacteria 1896
207 Ga0068862_100201591 3300005844 Bacteria 1794
208 Ga0068862_100259021 3300005844 Bacteria 1587
209 Ga0081455_10024008 3300005937 Bacteria 5657
210 Ga0070717_10164020 3300006028 Bacteria 1929
211 Ga0070715_10006400 3300006163 Bacteria 4001
212 Ga0070715_10022166 3300006163 Bacteria 2473
213 Ga0070715_10046738 3300006163 Bacteria 1842
214 Ga0070715_10052963 3300006163 Bacteria 1752
215 Ga0070716_100021128 3300006173 Bacteria 3426
216 Ga0070716_100060093 3300006173 Bacteria 2194
217 Ga0070716_100072275 3300006173 Bacteria 2031
218 Ga0070716_100075175 3300006173 Bacteria 1998
219 Ga0070716_100115957 3300006173 Bacteria 1668
220 Ga0070716_100139979 3300006173 Bacteria 1541
221 Ga0070712_100073229 3300006175 Bacteria 2456
222 Ga0070712_100102328 3300006175 Bacteria 2121
223 Ga0070712_100122845 3300006175 Bacteria 1956
224 Ga0070712_100123732 3300006175 Bacteria 1950
225 Ga0070712_100124855 3300006175 Bacteria 1942
226 Ga0070712_100137363 3300006175 Bacteria 1860
227 Ga0070712_100146887 3300006175 Bacteria 1806
228 Ga0070712_100147024 3300006175 Bacteria 1805
229 Ga0097621_100107882 3300006237 Bacteria 2350
230 Ga0097621_100117859 3300006237 Bacteria 2250
231 Ga0097621_100217130 3300006237 Bacteria 1665
232 Ga0068871_100083879 3300006358 Bacteria 2643
233 Ga0068871_100118842 3300006358 Bacteria 2231
234 Ga0068871_100132922 3300006358 Bacteria 2111
235 Ga0068871_100150027 3300006358 Bacteria 1987
236 Ga0068871_100162762 3300006358 Bacteria 1909
237 Ga0068865_100090256 3300006881 Bacteria 2221
238 Ga0068865_100139230 3300006881 Bacteria 1828
239 Ga0097620_100046579 3300006931 Bacteria 4354
240 Ga0097620_100110087 3300006931 Bacteria 2816
241 Ga0097620_100266077 3300006931 Bacteria 1806
242 Ga0105244_10050511 3300009036 Bacteria 2121
243 Ga0105244_10051869 3300009036 Bacteria 2090
244 Ga0105250_10010472 3300009092 Bacteria 3864
245 Ga0105250_10011370 3300009092 Bacteria 3693
246 Ga0105240_10238190 3300009093 Bacteria 2111
247 Ga0111539_10181138 3300009094 Bacteria 2460
248 Ga0105245_10175493 3300009098 Bacteria 2044
249 Ga0105245_10198350 3300009098 Bacteria 1926
250 Ga0105245_10205842 3300009098 Bacteria 1892
251 Ga0105245_10206502 3300009098 Bacteria 1889
252 Ga0105247_10018197 3300009101 Bacteria 4214
253 Ga0105247_10074659 3300009101 Bacteria 2127
254 Ga0105247_10077042 3300009101 Bacteria 2095
255 Ga0105247_10084794 3300009101 Bacteria 2002
256 Ga0105247_10140192 3300009101 Bacteria 1583
257 Ga0114129_10201000 3300009147 Bacteria 2699
258 Ga0105243_10096278 3300009148 Bacteria 2448
259 Ga0105243_10129815 3300009148 Bacteria 2136
260 Ga0105243_10144619 3300009148 Bacteria 2033
261 Ga0105243_10146541 3300009148 Bacteria 2020
262 Ga0105243_10234548 3300009148 Bacteria 1630
263 Ga0105241_10124787 3300009174 Bacteria 2078
264 Ga0105241_10173602 3300009174 Bacteria 1782
265 Ga0105242_10070714 3300009176 Bacteria 2894
266 Ga0105242_10126657 3300009176 Bacteria 2199
267 Ga0105242_10160459 3300009176 Bacteria 1967
268 Ga0105242_10165039 3300009176 Bacteria 1942
269 Ga0105242_10166764 3300009176 Bacteria 1932
270 Ga0105242_10182243 3300009176 Bacteria 1854
271 Ga0105248_10000074 3300009177 Bacteria 114554
272 Ga0105248_10235160 3300009177 Bacteria 2063
273 Ga0105248_10341436 3300009177 Bacteria 1686
274 Ga0105248_10344902 3300009177 Bacteria 1677
275 Ga0105237_10208005 3300009545 Bacteria 1957
276 Ga0105238_10099388 3300009551 Bacteria 2893
277 Ga0105238_10194412 3300009551 Bacteria 2004
278 Ga0105238_10210862 3300009551 Bacteria 1918
279 Ga0105249_10005488 3300009553 Bacteria 10956
280 Ga0105249_10130511 3300009553 Bacteria 2399
281 Ga0105249_10153070 3300009553 Bacteria 2222
282 Ga0105249_10162416 3300009553 Bacteria 2160
283 Ga0105249_10243347 3300009553 Bacteria 1779
284 Ga0105239_10152478 3300010375 Bacteria 2579
285 Ga0105239_10279249 3300010375 Bacteria 1880
286 Ga0105246_10098936 3300011119 Bacteria 2120
287 Ga0157373_10076071 3300013100 Bacteria 2369
288 Ga0157371_10105562 3300013102 Bacteria 1999
289 Ga0157371_10139466 3300013102 Bacteria 1727
290 Ga0157370_10079054 3300013104 Bacteria 3097
291 Ga0157369_10205491 3300013105 Bacteria 2066
292 Ga0157369_10245508 3300013105 Bacteria 1869
293 Ga0157374_10086029 3300013296 Bacteria 2990
294 Ga0157374_10179760 3300013296 Bacteria 2066
295 Ga0157378_10107489 3300013297 Bacteria 2553
296 Ga0157378_10116160 3300013297 Bacteria 2460
297 Ga0157378_10156697 3300013297 Bacteria 2127
298 Ga0163162_10151564 3300013306 Bacteria 2437
299 Ga0163162_10197558 3300013306 Bacteria 2140
300 Ga0163162_10219402 3300013306 Bacteria 2032
301 Ga0163162_10336358 3300013306 Bacteria 1642
302 Ga0157372_10186498 3300013307 Bacteria 2402
303 Ga0157372_10292229 3300013307 Bacteria 1895
304 Ga0157372_10328130 3300013307 Bacteria 1782
305 Ga0157372_10357068 3300013307 Bacteria 1703
306 Ga0157375_10124924 3300013308 Bacteria 2687
307 Ga0157375_10158899 3300013308 Bacteria 2401
308 Ga0157375_10226266 3300013308 Bacteria 2029
309 Ga0157375_10253535 3300013308 Bacteria 1921
310 Ga0157375_10268044 3300013308 Bacteria 1869
311 Ga0157375_10357732 3300013308 Bacteria 1626
312 Ga0163163_10162796 3300014325 Bacteria 2277
313 Ga0163163_10237795 3300014325 Bacteria 1871
314 Ga0163163_10256350 3300014325 Bacteria 1800
315 Ga0157380_10104185 3300014326 Bacteria 2369
316 Ga0157380_10122033 3300014326 Bacteria 2209
317 Ga0157380_10176394 3300014326 Bacteria 1873
318 Ga0157377_10022063 3300014745 Bacteria 3358
319 Ga0157377_10061441 3300014745 Bacteria 2147
320 Ga0157377_10065365 3300014745 Bacteria 2089
321 Ga0157377_10097085 3300014745 Bacteria 1749
322 Ga0157379_10177908 3300014968 Bacteria 1922
323 Ga0157379_10199309 3300014968 Bacteria 1810
324 Ga0157379_10208814 3300014968 Bacteria 1767
325 Ga0157376_10122003 3300014969 Bacteria 2311
326 Ga0163161_10078566 3300017792 Bacteria 2425
327 Ga0163161_10097450 3300017792 Bacteria 2184
328 Ga0207653_10011234 3300025885 Bacteria 2795
329 Ga0207682_10047917 3300025893 Bacteria 1761
330 Ga0207682_10048845 3300025893 Bacteria 1745
331 Ga0207682_10049751 3300025893 Bacteria 1731
332 Ga0207692_10080080 3300025898 Bacteria 1744
333 Ga0207692_10082452 3300025898 Bacteria 1723
334 Ga0207692_10082808 3300025898 Bacteria 1720
335 Ga0207642_10052756 3300025899 Bacteria 1846
336 Ga0207642_10054505 3300025899 Bacteria 1824
337 Ga0207642_10063237 3300025899 Bacteria 1730
338 Ga0207642_10063308 3300025899 Bacteria 1729
339 Ga0207642_10063330 3300025899 Bacteria 1729
340 Ga0207710_10014877 3300025900 Bacteria 3286
341 Ga0207710_10061331 3300025900 Bacteria 1707
342 Ga0207688_10035879 3300025901 Bacteria 2747
343 Ga0207688_10078978 3300025901 Bacteria 1876
344 Ga0207688_10081895 3300025901 Bacteria 1844
345 Ga0207688_10098236 3300025901 Bacteria 1688
346 Ga0207680_10106684 3300025903 Bacteria 1809
347 Ga0207647_10028900 3300025904 Bacteria 3595
348 Ga0207647_10062976 3300025904 Bacteria 2258
349 Ga0207685_10038422 3300025905 Bacteria 1770
350 Ga0207685_10041214 3300025905 Bacteria 1726
351 Ga0207685_10042597 3300025905 Bacteria 1706
352 Ga0207699_10014279 3300025906 Bacteria 4089
353 Ga0207699_10117222 3300025906 Bacteria 1716
354 Ga0207699_10117372 3300025906 Bacteria 1715
355 Ga0207645_10031504 3300025907 Bacteria 3411
356 Ga0207645_10088718 3300025907 Bacteria 1988
357 Ga0207643_10045773 3300025908 Bacteria 2472
358 Ga0207643_10084743 3300025908 Bacteria 1840
359 Ga0207643_10101003 3300025908 Bacteria 1692
360 Ga0207684_10066330 3300025910 Bacteria 3065
361 Ga0207654_10111411 3300025911 Bacteria 1704
362 Ga0207707_10165888 3300025912 Bacteria 1930
363 Ga0207695_10218326 3300025913 Bacteria 1815
364 Ga0207671_10123767 3300025914 Bacteria 1979
365 Ga0207693_10031494 3300025915 Bacteria 4190
366 Ga0207693_10048292 3300025915 Bacteria 3342
367 Ga0207693_10065313 3300025915 Bacteria 2850
368 Ga0207693_10091203 3300025915 Bacteria 2389
369 Ga0207693_10117911 3300025915 Bacteria 2084
370 Ga0207693_10135061 3300025915 Bacteria 1939
371 Ga0207693_10137711 3300025915 Bacteria 1920
372 Ga0207693_10146716 3300025915 Bacteria 1855
373 Ga0207693_10154028 3300025915 Bacteria 1808
374 Ga0207663_10061868 3300025916 Bacteria 2377
375 Ga0207663_10089404 3300025916 Bacteria 2039
376 Ga0207663_10113065 3300025916 Bacteria 1845
377 Ga0207663_10118820 3300025916 Bacteria 1806
378 Ga0207663_10139023 3300025916 Bacteria 1689
379 Ga0207660_10165849 3300025917 Bacteria 1707
380 Ga0207660_10200731 3300025917 Bacteria 1557
381 Ga0207662_10026945 3300025918 Bacteria 3317
382 Ga0207662_10097741 3300025918 Bacteria 1815
383 Ga0207662_10131533 3300025918 Bacteria 1578
384 Ga0207657_10033851 3300025919 Bacteria 4601
385 Ga0207657_10058021 3300025919 Bacteria 3333
386 Ga0207649_10045896 3300025920 Bacteria 2681
387 Ga0207646_10036463 3300025922 Bacteria 4439
388 Ga0207681_10055819 3300025923 Bacteria 2692
389 Ga0207681_10075683 3300025923 Bacteria 2362
390 Ga0207681_10141431 3300025923 Bacteria 1792
391 Ga0207694_10120275 3300025924 Bacteria 2096
392 Ga0207694_10146591 3300025924 Bacteria 1900
393 Ga0207694_10160748 3300025924 Bacteria 1814
394 Ga0207694_10192285 3300025924 Bacteria 1658
395 Ga0207659_10157815 3300025926 Bacteria 1778
396 Ga0207659_10171136 3300025926 Bacteria 1713
397 Ga0207687_10109052 3300025927 Bacteria 2051
398 Ga0207687_10156827 3300025927 Bacteria 1743
399 Ga0207687_10163245 3300025927 Bacteria 1712
400 Ga0207687_10174405 3300025927 Bacteria 1661
401 Ga0207700_10170684 3300025928 Bacteria 1814
402 Ga0207700_10180337 3300025928 Bacteria 1768
403 Ga0207700_10181373 3300025928 Bacteria 1763
404 Ga0207700_10191304 3300025928 Bacteria 1719
405 Ga0207664_10193825 3300025929 Bacteria 1750
406 Ga0207664_10205422 3300025929 Bacteria 1702
407 Ga0207690_10137570 3300025932 Bacteria 1795
408 Ga0207690_10152317 3300025932 Bacteria 1715
409 Ga0207706_10082506 3300025933 Bacteria 2826
410 Ga0207706_10087038 3300025933 Bacteria 2746
411 Ga0207706_10112929 3300025933 Bacteria 2390
412 Ga0207686_10064763 3300025934 Bacteria 2328
413 Ga0207686_10165103 3300025934 Bacteria 1556
414 Ga0207709_10112077 3300025935 Bacteria 1826
415 Ga0207709_10117987 3300025935 Bacteria 1787
416 Ga0207709_10131655 3300025935 Bacteria 1706
417 Ga0207670_10160164 3300025936 Bacteria 1679
418 Ga0207669_10068171 3300025937 Bacteria 2220
419 Ga0207669_10114986 3300025937 Bacteria 1812
420 Ga0207669_10130324 3300025937 Bacteria 1726
421 Ga0207669_10136798 3300025937 Bacteria 1693
422 Ga0207704_10045292 3300025938 Bacteria 2613
423 Ga0207704_10091729 3300025938 Bacteria 1997
424 Ga0207704_10136071 3300025938 Bacteria 1710
425 Ga0207665_10056311 3300025939 Bacteria 2654
426 Ga0207665_10066665 3300025939 Bacteria 2450
427 Ga0207665_10111152 3300025939 Bacteria 1926
428 Ga0207665_10121130 3300025939 Bacteria 1848
429 Ga0207665_10123147 3300025939 Bacteria 1833
430 Ga0207691_10147516 3300025940 Bacteria 2070
431 Ga0207691_10156584 3300025940 Bacteria 2000
432 Ga0207691_10180181 3300025940 Bacteria 1846
433 Ga0207711_10000149 3300025941 Bacteria 74062
434 Ga0207711_10232637 3300025941 Bacteria 1688
435 Ga0207689_10027585 3300025942 Bacteria 4751
436 Ga0207689_10062544 3300025942 Bacteria 3061
437 Ga0207667_10249577 3300025949 Bacteria 1815
438 Ga0207651_10155562 3300025960 Bacteria 1785
439 Ga0207712_10032449 3300025961 Bacteria 3526
440 Ga0207712_10048856 3300025961 Bacteria 2945
441 Ga0207712_10164958 3300025961 Bacteria 1726
442 Ga0207712_10165213 3300025961 Bacteria 1725
443 Ga0207668_10165632 3300025972 Bacteria 1727
444 Ga0207668_10167747 3300025972 Bacteria 1718
445 Ga0207640_10141512 3300025981 Bacteria 1754
446 Ga0207640_10143607 3300025981 Bacteria 1743
447 Ga0207640_10146580 3300025981 Bacteria 1728
448 Ga0207658_10135417 3300025986 Bacteria 1985
449 Ga0207658_10184896 3300025986 Bacteria 1727
450 Ga0207677_10149416 3300026023 Bacteria 1800
451 Ga0207677_10164608 3300026023 Bacteria 1727
452 Ga0207677_10165509 3300026023 Bacteria 1723
453 Ga0207677_10171208 3300026023 Bacteria 1698
454 Ga0207677_10226418 3300026023 Bacteria 1503
455 Ga0207703_10164132 3300026035 Bacteria 1947
456 Ga0207703_10166836 3300026035 Bacteria 1933
457 Ga0207703_10220571 3300026035 Bacteria 1695
458 Ga0207639_10085159 3300026041 Bacteria 2513
459 Ga0207639_10194635 3300026041 Bacteria 1734
460 Ga0207639_10245084 3300026041 Bacteria 1560
461 Ga0207678_10079811 3300026067 Bacteria 2801
462 Ga0207678_10080753 3300026067 Bacteria 2784
463 Ga0207678_10093904 3300026067 Bacteria 2563
464 Ga0207678_10174851 3300026067 Bacteria 1833
465 Ga0207708_10077415 3300026075 Bacteria 2552
466 Ga0207708_10131806 3300026075 Bacteria 1955
467 Ga0207708_10154657 3300026075 Bacteria 1808
468 Ga0207641_10239999 3300026088 Bacteria 1688
469 Ga0207648_10046105 3300026089 Bacteria 3822
470 Ga0207648_10053015 3300026089 Bacteria 3546
471 Ga0207648_10143032 3300026089 Bacteria 2109
472 Ga0207648_10158916 3300026089 Bacteria 1996
473 Ga0207648_10194792 3300026089 Bacteria 1797
474 Ga0207676_10192342 3300026095 Bacteria 1796
475 Ga0207675_100098853 3300026118 Bacteria 2749
476 Ga0207675_100102447 3300026118 Bacteria 2698
477 Ga0207675_100175603 3300026118 Bacteria 2049
478 Ga0207675_100180716 3300026118 Bacteria 2020
479 Ga0207675_100212954 3300026118 Bacteria 1859
480 Ga0207675_100227055 3300026118 Bacteria 1800
481 Ga0207675_100255217 3300026118 Bacteria 1698
482 Ga0207683_10001944 3300026121 Bacteria 18296
483 Ga0207683_10046881 3300026121 Bacteria 3783
484 Ga0207683_10060717 3300026121 Bacteria 3324
485 Ga0207683_10119321 3300026121 Bacteria 2366
486 Ga0207683_10172427 3300026121 Bacteria 1960
487 Ga0207683_10177015 3300026121 Bacteria 1933
488 Ga0207698_10116945 3300026142 Bacteria 2248
489 Ga0209179_1007451 3300027512 Bacteria 1808
490 Ga0268266_10066030 3300028379 Bacteria 3128
491 Ga0268266_10196423 3300028379 Bacteria 1844
492 Ga0268265_10171810 3300028380 Bacteria 1853
493 Ga0268265_10203951 3300028380 Bacteria 1717
494 Ga0268265_10218129 3300028380 Bacteria 1667
495 Ga0268265_10243788 3300028380 Bacteria 1587
496 Ga0268265_10253766 3300028380 Bacteria 1559
497 Ga0268264_10000024 3300028381 Bacteria 470081
498 Ga0268264_10112727 3300028381 Bacteria 2385
499 Ga0268264_10228405 3300028381 Bacteria 1717
500 Ga0268264_10240195 3300028381 Bacteria 1677
501 Ga0265340_10000902 3300031247 Bacteria 16831
502 Ga0316576_10175208 3300031727 Bacteria 1618
503 Ga0316578_10030517 3300031728 Bacteria 3065
504 Ga0307416_100169427 3300032002 Bacteria 2030
505 Ga0307415_100133207 3300032126 Bacteria 1885
506 Ga0373950_0003697 3300034818 Bacteria 2205
507 Ga0373950_0007354 3300034818 Bacteria 1707
508 Ga0373958_0005416 3300034819 Bacteria 1939
509 Ga0373959_0008836 3300034820 Bacteria 1724
510 Ga0373959_0008997 3300034820 Bacteria 1711
511 Ga0373959_0010531 3300034820 Bacteria 1617
512 Ga0373938_0001725 3300034957 Bacteria 3489
513 Ga0373938_0007416 3300034957 Bacteria 1928
514 Ga0373928_0012242 3300035084 Bacteria 1708
515 Ga0373929_0007146 3300035085 Bacteria 2033
516 Ga0373934_0000183 3300035086 Bacteria 22993
517 Ga0373934_0017645 3300035086 Bacteria 2726
518 Ga0373940_0013854 3300035088 Bacteria 1958
519 Ga0373944_0034817 3300035089 Bacteria 1532
520 Ga0373949_0006425 3300035090 Bacteria 2584
521 Ga0373949_0024327 3300035090 Bacteria 1408
522 Ga0373951_0010040 3300035091 Bacteria 2124
523 Ga0373951_0014104 3300035091 Bacteria 1795
524 Ga0373952_0009619 3300035092 Bacteria 1855
525 Ga0373923_0013152 3300035111 Bacteria 3077
526 Ga0373923_0014432 3300035111 Bacteria 2967
527 Ga0373936_0014623 3300035113 Bacteria 3003
528 Ga0373936_0023705 3300035113 Bacteria 2393
529 Ga0373939_0012601 3300035114 Bacteria 2158
530 Ga0373939_0012741 3300035114 Bacteria 2149
531 Ga0373941_0019110 3300035115 Bacteria 1902
532 Ga0373941_0020773 3300035115 Bacteria 1844
533 Ga0373953_0005599 3300035117 Bacteria 4088
534 Ga0373953_0049121 3300035117 Bacteria 1701
535 Ga0373954_0022740 3300035118 Bacteria 2846
536 Ga0373954_0027397 3300035118 Bacteria 2615
537 Ga0373956_0004474 3300035119 Bacteria 5590
538 Ga0373956_0005312 3300035119 Bacteria 5158
539 Ga0373957_0013501 3300035120 Bacteria 2772
540 Ga0373957_0016273 3300035120 Bacteria 2572
541 Ga0373960_0021569 3300035121 Bacteria 1714
542 Ga0373943_0020626 3300035170 Bacteria 3040
543 Ga0373943_0065192 3300035170 Bacteria 1831
544 Ga0373946_0029097 3300035171 Bacteria 2196
545 Ga0373955_0015249 3300035172 Bacteria 3756
546 Ga0373955_0095467 3300035172 Bacteria 1700
547 Ga0373942_0008582 3300035207 Bacteria 2385
548 Ga0373942_0019647 3300035207 Bacteria 1688
549 Ga0373961_0012545 3300035241 Bacteria 2123
550 Ga0373924_0013939 3300035410 Bacteria 3028
551 Ga0373924_0035143 3300035410 Bacteria 2031
552 Ga0373931_0026289 3300035691 Bacteria 2961
553 Ga0373931_0065630 3300035691 Bacteria 1967
554 Ga0373935_0067113 3300035692 Bacteria 2305
555 Ga0373935_0068868 3300035692 Bacteria 2277
556 Ga0373927_0065907 3300035695 Bacteria 2342
557 Ga0373933_0001777 3300035724 Bacteria 12478
558 Ga0373933_0112335 3300035724 Bacteria 1700
559 Ga0373947_0080285 3300035725 Bacteria 2017
560 Ga0373947_0101979 3300035725 Bacteria 1804
561 Ga0373937_0039398 3300036401 Bacteria 4306
562 Ga0373937_0241866 3300036401 Bacteria 1700
563 Ga0316582_0181167 3300036647 Bacteria 1433
564 Ga0373925_0078245 3300037068 Bacteria 2511
565 Ga0373925_0084868 3300037068 Bacteria 2413
566 Ga0373925_0105603 3300037068 Bacteria 2170
567 Ga0451791_0896479 3300041451 Bacteria 1939
568 Ga0451839_0487775 3300041496 Bacteria 1946
569 Ga0451839_1253757 3300041496 Bacteria 1944
570 Ga0451853_0064727 3300041512 Bacteria 1412
571 Ga0451853_2992131 3300041512 Bacteria 2191
572 Ga0466972_0057305 3300044658 Bacteria 1871
573 Ga0466965_0046756 3300044683 Bacteria 2142
574 Ga0466966_0000804 3300044684 Bacteria 19979
575 Ga0466966_0097111 3300044684 Bacteria 1824
576 Ga0466963_0126589 3300044694 Bacteria 1761
577 Ga0466964_0023440 3300044706 Bacteria 2399
578 Ga0466964_0026432 3300044706 Bacteria 2272
579 Ga0466971_0048743 3300044719 Bacteria 1904
580 Ga0466968_0042071 3300044735 Bacteria 1930
581 Ga0466970_0079394 3300044765 Bacteria 1771
582 Ga0466959_0124946 3300045049 Bacteria 1826
583 Ga0466967_0066221 3300045976 Bacteria 3218
584 Ga0466967_0160989 3300045976 Bacteria 2106
585 Ga0495592_0018342 3300046454 Bacteria 5320
586 Ga0495592_0121993 3300046454 Bacteria 1832
587 Ga0495592_0134597 3300046454 Bacteria 1725
588 Ga0495592_0137746 3300046454 Bacteria 1700
589 Ga0495629_0004201 3300046459 Bacteria 10812
590 Ga0495641_0008547 3300046461 Bacteria 6222
591 Ga0495641_0039151 3300046461 Bacteria 2212
592 Ga0495651_0001214 3300046462 Bacteria 19902
593 Ga0495651_0133649 3300046462 Bacteria 1808
594 Ga0495651_0147315 3300046462 Bacteria 1700
595 Ga0495653_0011376 3300046463 Bacteria 7271
596 Ga0495653_0126440 3300046463 Bacteria 1815
597 Ga0495653_0140214 3300046463 Bacteria 1701
598 Ga0495650_0044738 3300046471 Bacteria 1868
599 Ga0495580_0076103 3300046472 Bacteria 2341
600 Ga0495582_0037545 3300046473 Bacteria 2664
601 Ga0495605_0055060 3300046474 Bacteria 1923
602 Ga0495639_0058622 3300046475 Bacteria 1761
603 Ga0495639_0059678 3300046475 Bacteria 1746
604 Ga0495662_0043058 3300046476 Bacteria 2179
605 Ga0495664_0014288 3300046477 Bacteria 4498
606 Ga0495664_0039797 3300046477 Bacteria 2778
607 Ga0495664_0099662 3300046477 Bacteria 1749
608 Ga0495585_0098621 3300046492 Bacteria 1565
609 Ga0495607_0089677 3300046501 Bacteria 1669
610 Ga0495608_0039028 3300046511 Bacteria 3184
611 Ga0495608_0072314 3300046511 Bacteria 2250
612 Ga0495608_0117595 3300046511 Bacteria 1705
613 Ga0495618_0032235 3300046514 Bacteria 3281
614 Ga0495618_0080050 3300046514 Bacteria 2084
615 Ga0495620_0029229 3300046515 Bacteria 2554
616 Ga0495620_0046099 3300046515 Bacteria 1884
617 Ga0495628_0034706 3300046516 Bacteria 4056
618 Ga0495628_0125462 3300046516 Bacteria 1967
619 Ga0495628_0161820 3300046516 Bacteria 1700
620 Ga0495630_0025867 3300046517 Bacteria 4342
621 Ga0495631_0056529 3300046518 Bacteria 1708
622 Ga0495644_0038037 3300046523 Bacteria 1815
623 Ga0495648_0076416 3300046524 Bacteria 1923
624 Ga0495663_0025189 3300046525 Bacteria 1733
625 Ga0495666_0047752 3300046526 Bacteria 2062
626 Ga0495652_0022895 3300046529 Bacteria 5542
627 Ga0495652_0075561 3300046529 Bacteria 2798
628 Ga0495652_0167247 3300046529 Bacteria 1700
629 Ga0495665_0017807 3300046531 Bacteria 3818
630 Ga0495665_0061234 3300046531 Unclassified 1987
631 Ga0495640_0018180 3300046533 Bacteria 5222
632 Ga0495640_0068941 3300046533 Bacteria 2379
633 Ga0495640_0078925 3300046533 Bacteria 2192
634 Ga0495587_0004061 3300046536 Bacteria 9693
635 Ga0495587_0064521 3300046536 Bacteria 2140
636 Ga0495587_0076914 3300046536 Bacteria 1938
637 Ga0495587_0096545 3300046536 Bacteria 1704
638 Ga0495621_0038796 3300046539 Bacteria 1663
639 Ga0495645_0014683 3300046543 Bacteria 5561
640 Ga0495645_0070435 3300046543 Bacteria 2523
641 Ga0495645_0117580 3300046543 Bacteria 1875
642 Ga0495622_0066983 3300046557 Bacteria 1659
643 Ga0495667_0019874 3300046559 Bacteria 4532
644 Ga0495667_0104705 3300046559 Bacteria 1829
645 Ga0495667_0119706 3300046559 Bacteria 1700
646 Ga0495668_0068433 3300046616 Bacteria 1953
647 Ga0495634_0022392 3300046642 Bacteria 4452
648 Ga0495635_0015644 3300046663 Bacteria 5299
649 Ga0495635_0033590 3300046663 Bacteria 3558
650 Ga0495635_0078603 3300046663 Bacteria 2258
651 Ga0495588_0069404 3300046674 Bacteria 1831
652 Ga0495657_0017067 3300046675 Bacteria 5276
653 Ga0495657_0114850 3300046675 Bacteria 1701
654 Ga0495599_0010767 3300046678 Bacteria 5603
655 Ga0495599_0111714 3300046678 Bacteria 1701
656 Ga0495599_0119197 3300046678 Bacteria 1641
657 Ga0495623_0044426 3300046679 Bacteria 2823
658 Ga0495623_0106372 3300046679 Bacteria 1704
659 Ga0495646_0006368 3300046680 Bacteria 7485
660 Ga0495646_0058208 3300046680 Bacteria 2310
661 Ga0495658_0026934 3300046683 Bacteria 3087
662 Ga0495658_0067709 3300046683 Unclassified 2065
663 Ga0495669_0068703 3300046684 Bacteria 1612
664 Ga0495613_0048515 3300046689 Bacteria 3135
665 Ga0495624_0014034 3300046690 Bacteria 5451
666 Ga0495624_0089438 3300046690 Bacteria 1900
667 Ga0495671_0055202 3300046692 Bacteria 1968
668 Ga0495671_0079422 3300046692 Bacteria 1608
669 Ga0495649_0033599 3300046694 Bacteria 2823
670 Ga0495589_0039265 3300046794 Bacteria 2366
671 Ga0495600_0009524 3300046809 Bacteria 6004
672 Ga0495600_0042327 3300046809 Bacteria 2969
673 Ga0495600_0121128 3300046809 Bacteria 1701
674 Ga0495581_0005388 3300047315 Bacteria 7399
675 Ga0495581_0068106 3300047315 Unclassified 2058
676 Ga0495604_0022509 3300047317 Bacteria 5031
677 Ga0495604_0104135 3300047317 Bacteria 2080
678 Ga0495604_0106408 3300047317 Bacteria 2052
679 Ga0495604_0143925 3300047317 Bacteria 1700
680 Ga0495674_0075408 3300047319 Bacteria 2902
681 Ga0495674_0105342 3300047319 Bacteria 2396
682 Ga0495674_0110394 3300047319 Bacteria 2332
683 Ga0495674_0111055 3300047319 Bacteria 2324
684 Ga0495674_0138880 3300047319 Bacteria 2043
685 Ga0495676_0078830 3300047321 Bacteria 2506
686 Ga0495680_0021054 3300047322 Bacteria 5465
687 Ga0495680_0150005 3300047322 Bacteria 1700
688 Ga0495683_0111708 3300047323 Bacteria 1304
689 Ga0495675_0070263 3300047444 Bacteria 2210
690 Ga0495675_0091642 3300047444 Bacteria 1907
691 Ga0495673_0026125 3300047469 Bacteria 2796
692 Ga0495673_0071530 3300047469 Bacteria 1458
693 Ga0495684_0017097 3300047471 Bacteria 5586
694 Ga0495684_0105931 3300047471 Bacteria 2124
695 Ga0495593_0025805 3300047673 Bacteria 3251
696 Ga0495602_0009748 3300048088 Bacteria 9979
697 Ga0495602_0083352 3300048088 Bacteria 2679
698 Ga0495602_0094061 3300048088 Bacteria 2478
699 Ga0495602_0103669 3300048088 Bacteria 2328
700 Ga0495602_0168722 3300048088 Bacteria 1700
701 Ga0496100_0027225 3300048903 Bacteria 3514
702 Ga0496100_0081914 3300048903 Bacteria 2181
703 Ga0496100_0113830 3300048903 Bacteria 1883
704 Ga0496100_0121835 3300048903 Bacteria 1825
705 Ga0496100_0179014 3300048903 Bacteria 1532
706 Ga0496101_0049408 3300048904 Bacteria 3025
707 Ga0496101_0125553 3300048904 Bacteria 1944
708 Ga0496101_0131245 3300048904 Bacteria 1902
709 Ga0496102_0000780 3300048905 Bacteria 31010
710 Ga0496102_0014853 3300048905 Bacteria 6775
711 Ga0496102_0138505 3300048905 Bacteria 2281
712 Ga0496102_0165214 3300048905 Bacteria 2082
713 Ga0496102_0196400 3300048905 Bacteria 1901
714 Ga0496102_0205182 3300048905 Bacteria 1858
715 Ga0496102_0211109 3300048905 Bacteria 1830
716 Ga0496102_0232397 3300048905 Bacteria 1738
717 Ga0496102_0242484 3300048905 Bacteria 1699
718 Ga0496102_0252734 3300048905 Bacteria 1662
719 Ga0496102_0286497 3300048905 Bacteria 1552
720 Ga0496103_0001409 3300048906 Bacteria 16139
721 Ga0496103_0045301 3300048906 Bacteria 2714
722 Ga0496103_0049913 3300048906 Bacteria 2587
723 Ga0496103_0078295 3300048906 Bacteria 2076
724 Ga0496103_0141349 3300048906 Bacteria 1539
725 Ga0496103_0162184 3300048906 Bacteria 1434
726 Ga0496104_0111288 3300048907 Bacteria 2625
727 Ga0496104_0181495 3300048907 Bacteria 2015
728 Ga0496104_0229602 3300048907 Bacteria 1768
729 Ga0496105_0179376 3300048908 Bacteria 1734
730 Ga0496106_0001315 3300048909 Bacteria 18626
731 Ga0496106_0148416 3300048909 Bacteria 1848
732 Ga0496106_0157468 3300048909 Bacteria 1794
733 Ga0496106_0162878 3300048909 Bacteria 1764
734 Ga0496106_0167670 3300048909 Bacteria 1739
735 Ga0496107_0045716 3300048910 Bacteria 3150
736 Ga0496107_0090386 3300048910 Bacteria 2236
737 Ga0496107_0150818 3300048910 Bacteria 1719
738 Ga0496108_0146143 3300048911 Bacteria 2038
739 Ga0496108_0208830 3300048911 Bacteria 1695
740 Ga0496109_0109667 3300048912 Bacteria 2566
741 Ga0496109_0419960 3300048912 Bacteria 1263
742 Ga0496110_0135366 3300048913 Bacteria 2226
743 Ga0496110_0194757 3300048913 Bacteria 1840
744 Ga0496110_0199118 3300048913 Bacteria 1819
745 Ga0496111_0119393 3300048914 Bacteria 1947
746 Ga0496111_0138597 3300048914 Bacteria 1802
747 Ga0496112_0263831 3300048915 Bacteria 1671
748 Ga0496114_0000172 3300048917 Bacteria 45915
749 Ga0496114_0073460 3300048917 Bacteria 2878
750 Ga0496114_0077750 3300048917 Bacteria 2798
751 Ga0496114_0083306 3300048917 Bacteria 2705
752 Ga0496114_0130052 3300048917 Bacteria 2173
753 Ga0496114_0158370 3300048917 Bacteria 1967
754 Ga0496114_0180898 3300048917 Bacteria 1841
755 Ga0496114_0208006 3300048917 Bacteria 1715
756 Ga0496114_0210628 3300048917 Bacteria 1704
757 Ga0496115_0066955 3300048918 Bacteria 2903
758 Ga0496115_0096184 3300048918 Bacteria 2424
759 Ga0496115_0197856 3300048918 Bacteria 1660
760 Ga0496115_0220393 3300048918 Bacteria 1565
761 Ga0496116_0036741 3300048919 Bacteria 3423
762 Ga0496117_0001267 3300048920 Bacteria 37488
763 Ga0496118_0004668 3300048921 Bacteria 16064
764 Ga0496119_0048087 3300048922 Bacteria 2648
765 Ga0496120_0105618 3300048923 Bacteria 1480
766 Ga0496121_0093045 3300048924 Bacteria 2348
767 Ga0496124_0187214 3300048927 Bacteria 1587
768 Ga0496125_0109827 3300048928 Bacteria 2001
769 Ga0496126_0001691 3300048929 Bacteria 32861
770 Ga0496126_0191215 3300048929 Bacteria 1733
771 Ga0501032_0072444 3300049569 Bacteria 2296
772 Ga0501032_0120579 3300049569 Bacteria 1734
773 Ga0501033_0096004 3300049570 Bacteria 2166
774 Ga0501033_0106322 3300049570 Bacteria 2044
775 Ga0501034_0086325 3300049571 Bacteria 3139
776 Ga0501034_0224539 3300049571 Bacteria 1829
777 Ga0501036_0105439 3300049572 Bacteria 2384
778 Ga0501036_0168028 3300049572 Bacteria 1848
779 Ga0501039_0033044 3300049575 Bacteria 3991
780 Ga0501043_0034242 3300049579 Bacteria 3995
781 Ga0501046_0125899 3300049580 Bacteria 1946
782 Ga0501047_0021913 3300049581 Bacteria 6135
783 Ga0501047_0114058 3300049581 Bacteria 2584
784 Ga0501047_0269776 3300049581 Bacteria 1548
785 Ga0501048_0124530 3300049582 Bacteria 1822
786 Ga0501068_0071206 3300049584 Bacteria 2122
787 Ga0501069_0004207 3300049585 Bacteria 7433
788 Ga0501069_0067461 3300049585 Bacteria 2001
789 Ga0501070_0122813 3300049586 Bacteria 2146
790 Ga0501070_0186035 3300049586 Bacteria 1708
791 Ga0501071_0102731 3300049587 Bacteria 2108
792 Ga0501080_0156818 3300049742 Bacteria 2102
793 Ga0501083_0099480 3300049744 Bacteria 1918
794 Ga0501035_0015721 3300049822 Bacteria 6984
795 Ga0501044_0001622 3300049823 Bacteria 26359
796 Ga0501044_0153423 3300049823 Bacteria 2284
797 nmdc:mga09592_30174_c1 3300050508 Bacteria 4512
798 nmdc:mga0qj67_171128_c1 3300050509 Bacteria 1764
799 nmdc:mga08y16_184638_c1 3300050511 Bacteria 2165
800 nmdc:mga08y16_196406_c1 3300050511 Bacteria 2091
801 nmdc:mga0a205_244506_c1 3300050515 Bacteria 1675
802 nmdc:mga0a205_315956_c1 3300050515 Bacteria 1433
803 Ga0495601_0059405 3300053077 Bacteria 2424
804 Ga0495601_0062065 3300053077 Bacteria 2373
805 Ga0495601_0072599 3300053077 Bacteria 2198
806 Ga0495601_0103165 3300053077 Bacteria 1843
807 Ga0495612_0044201 3300053078 Bacteria 1822
808 Ga0495655_0007074 3300053083 Bacteria 2069
809 Ga0495595_0060650 3300053084 Bacteria 1770
810 Ga0495595_0066194 3300053084 Bacteria 1700
811 Ga0495619_0016726 3300053085 Bacteria 4642
812 Ga0495619_0116563 3300053085 Bacteria 1828
813 Ga0500643_002834 3300053087 Bacteria 8657
814 Ga0500556_0042340 3300053104 Bacteria 1610
815 Ga0500568_0044317 3300053139 Bacteria 1775
816 Ga0500645_008933 3300053730 Bacteria 3389
817 Ga0466962_0063888 3300061719 Bacteria 1757
818 2883822506 2883821847 Bacteria 5121194
819 2883822837 2883821847 Bacteria 5121194
820 2883823433 2883821847 Bacteria 5121194
821 2883824879 2883821847 Bacteria 5121194
822 2883825258 2883821847 Bacteria 5121194
823 Ga0316584_0092628
824 JGI24736J21556_1008923
825 JGI24746J21847_1007238
826 JGI24746J21847_1007383
827 JGI24747J21853_1001697
828 JGI24747J21853_1002064
829 JGI24739J22299_10034178
830 JGI24739J22299_10034798
831 JGI24739J22299_10041781
832 JGI24737J22298_10030397
833 JGI24743J22301_10009823
834 JGI24743J22301_10009973
835 JGI24735J21928_10008388
836 JGI24735J21928_10026974
837 JGI24750J21931_1004411
838 JGI24750J21931_1004547
839 JGI24745J21846_1002594
840 JGI24745J21846_1003253
841 JGI24745J21846_1003893
842 JGI24748J21848_1003987
843 JGI24738J21930_10014360
844 JGI24738J21930_10014579
845 JGI24749J21850_1006030
846 JGI24749J21850_1006687
847 JGI24744J21845_10010146
848 JGI24744J21845_10012850
849 JGI24744J21845_10014660
850 JGI24034J26672_10006156
851 JGI24742J22300_10008261
852 JGI24742J22300_10008491
853 JGI24742J22300_10010071
854 Ga0070676_10052413
855 Ga0070676_10098620
856 Ga0070690_100093664
857 Ga0070690_100171910
858 Ga0070677_10028372
859 Ga0070677_10036988
860 Ga0068869_100082662
861 Ga0068869_100106218
862 Ga0068869_100143329
863 Ga0068869_100180979
864 Ga0070666_10121181
865 Ga0070666_10129268
866 Ga0070680_100081691
867 Ga0070682_100105072
868 Ga0070682_100106241
869 Ga0068868_100057465
870 Ga0068868_100122225
871 Ga0068868_100150001
872 Ga0068868_100154392
873 Ga0070660_100086512
874 Ga0070660_100103330
875 Ga0070689_100110455
876 Ga0070689_100147560
877 Ga0070691_10049316
878 Ga0070691_10053197
879 Ga0070687_100004946
880 Ga0070687_100091065
881 Ga0070661_100064418
882 Ga0070692_10045665
883 Ga0070668_100125693
884 Ga0070668_100127496
885 Ga0070668_100138368
886 Ga0070668_100148844
887 Ga0070669_100122419
888 Ga0070669_100131369
889 Ga0070669_100149945
890 Ga0070675_100148316
891 Ga0070675_100171179
892 Ga0070675_100212770
893 Ga0070671_100085337
894 Ga0070674_100048619
895 Ga0070674_100064230
896 Ga0070674_100072186
897 Ga0070674_100112195
898 Ga0070674_100145930
899 Ga0070674_100148095
900 Ga0070674_100155170
901 Ga0070673_100058498
902 Ga0070673_100144497
903 Ga0070688_100042370
904 Ga0070688_100114459
905 Ga0070659_100162366
906 Ga0070667_100000063
907 Ga0070667_100128810
908 Ga0070667_100130453
909 Ga0070667_100256814
910 Ga0070703_10022305
911 Ga0070709_10108591
912 Ga0070709_10115192
913 Ga0070709_10156882
914 Ga0070714_100034024
915 Ga0070714_100046110
916 Ga0070714_100092755
917 Ga0070713_100171062
918 Ga0070713_100180529
919 Ga0070713_100218749
920 Ga0070713_100226679
921 Ga0070710_10001139
922 Ga0070710_10052565
923 Ga0070710_10079364
924 Ga0070710_10094295
925 Ga0070710_10106762
926 Ga0070701_10051751
927 Ga0070711_100042451
928 Ga0070711_100073662
929 Ga0070711_100143027
930 Ga0070711_100145864
931 Ga0070711_100149893
932 Ga0070705_100092565
933 Ga0070705_100108187
934 Ga0070700_100084271
935 Ga0070700_100086296
936 Ga0070694_100095944
937 Ga0070694_100113341
938 Ga0070708_100226806
939 Ga0070663_100078758
940 Ga0070663_100104094
941 Ga0070663_100133939
942 Ga0070663_100136394
943 Ga0070678_100133167
944 Ga0070678_100141851
945 Ga0070678_100147380
946 Ga0070678_100161984
947 Ga0070678_100226962
948 Ga0070662_100054514
949 Ga0070662_100105168
950 Ga0070662_100118176
951 Ga0070681_10237430
952 Ga0068867_100094833
953 Ga0068867_100108520
954 Ga0068867_100117673
955 Ga0068867_100118654
956 Ga0068867_100132039
957 Ga0068867_100151773
958 Ga0070685_10103806
959 Ga0070685_10111844
960 Ga0070706_100108618
961 Ga0070706_100229665
962 Ga0070707_100066924
963 Ga0070679_100207312
964 Ga0070684_100181523
965 Ga0070697_100042658
966 Ga0070697_100133862
967 Ga0068853_100116137
968 Ga0068853_100234930
969 Ga0070672_100121482
970 Ga0070672_100138813
971 Ga0070672_100141339
972 Ga0070686_100103932
973 Ga0070695_100034573
974 Ga0070695_100120602
975 Ga0070696_100046796
976 Ga0070696_100092825
977 Ga0070696_100144830
978 Ga0070693_100076889
979 Ga0070693_100112966
980 Ga0070693_100130170
981 Ga0070665_100038845
982 Ga0070665_100121416
983 Ga0070704_100027777
984 Ga0070704_100134279
985 Ga0070704_100169368
986 Ga0068855_100202461
987 Ga0068854_100084019
988 Ga0068854_100095405
989 Ga0068854_100105391
990 Ga0068854_100107339
991 Ga0068854_100121527
992 Ga0068856_100241295
993 Ga0070702_100057598
994 Ga0070702_100069975
995 Ga0070702_100074727
996 Ga0070702_100098659
997 Ga0068852_100106604
998 Ga0068852_100179614
999 Ga0068859_100046582
1000 Ga0068859_100110083
1001 Ga0068859_100266080
1002 Ga0068864_100200293
1003 Ga0068866_10012648
1004 Ga0068866_10058771
1005 Ga0068866_10060278
1006 Ga0068866_10071665
1007 Ga0068866_10086420
1008 Ga0068861_100135483
1009 Ga0068861_100185579
1010 Ga0068861_100191745
1011 Ga0068861_100215980
1012 Ga0068851_10082013
1013 Ga0068870_10041190
1014 Ga0068870_10068266
1015 Ga0068863_100222363
1016 Ga0068863_100267846
1017 Ga0068858_100148409
1018 Ga0068858_100172547
1019 Ga0068858_100245872
1020 Ga0068860_100000065
1021 Ga0068860_100106472
1022 Ga0068860_100117524
1023 Ga0068860_100164410
1024 Ga0068860_100228677
1025 Ga0068860_100269031
1026 Ga0068862_100117701
1027 Ga0068862_100140727
1028 Ga0068862_100180125
1029 Ga0068862_100201591
1030 Ga0068862_100259021
1031 Ga0081455_10024008
1032 Ga0070717_10164020
1033 Ga0070715_10006400
1034 Ga0070715_10022166
1035 Ga0070715_10046738
1036 Ga0070715_10052963
1037 Ga0070716_100021128
1038 Ga0070716_100060093
1039 Ga0070716_100072275
1040 Ga0070716_100075175
1041 Ga0070716_100115957
1042 Ga0070716_100139979
1043 Ga0070712_100073229
1044 Ga0070712_100102328
1045 Ga0070712_100122845
1046 Ga0070712_100123732
1047 Ga0070712_100124855
1048 Ga0070712_100137363
1049 Ga0070712_100146887
1050 Ga0070712_100147024
1051 Ga0097621_100107882
1052 Ga0097621_100117859
1053 Ga0097621_100217130
1054 Ga0068871_100083879
1055 Ga0068871_100118842
1056 Ga0068871_100132922
1057 Ga0068871_100150027
1058 Ga0068871_100162762
1059 Ga0068865_100090256
1060 Ga0068865_100139230
1061 Ga0097620_100046579
1062 Ga0097620_100110087
1063 Ga0097620_100266077
1064 Ga0105244_10050511
1065 Ga0105244_10051869
1066 Ga0105250_10010472
1067 Ga0105250_10011370
1068 Ga0105240_10238190
1069 Ga0111539_10181138
1070 Ga0105245_10175493
1071 Ga0105245_10198350
1072 Ga0105245_10205842
1073 Ga0105245_10206502
1074 Ga0105247_10018197
1075 Ga0105247_10074659
1076 Ga0105247_10077042
1077 Ga0105247_10084794
1078 Ga0105247_10140192
1079 Ga0114129_10201000
1080 Ga0105243_10096278
1081 Ga0105243_10129815
1082 Ga0105243_10144619
1083 Ga0105243_10146541
1084 Ga0105243_10234548
1085 Ga0105241_10124787
1086 Ga0105241_10173602
1087 Ga0105242_10070714
1088 Ga0105242_10126657
1089 Ga0105242_10160459
1090 Ga0105242_10165039
1091 Ga0105242_10166764
1092 Ga0105242_10182243
1093 Ga0105248_10000074
1094 Ga0105248_10235160
1095 Ga0105248_10341436
1096 Ga0105248_10344902
1097 Ga0105237_10208005
1098 Ga0105238_10099388
1099 Ga0105238_10194412
1100 Ga0105238_10210862
1101 Ga0105249_10005488
1102 Ga0105249_10130511
1103 Ga0105249_10153070
1104 Ga0105249_10162416
1105 Ga0105249_10243347
1106 Ga0105239_10152478
1107 Ga0105239_10279249
1108 Ga0105246_10098936
1109 Ga0157373_10076071
1110 Ga0157371_10105562
1111 Ga0157371_10139466
1112 Ga0157370_10079054
1113 Ga0157369_10205491
1114 Ga0157369_10245508
1115 Ga0157374_10086029
1116 Ga0157374_10179760
1117 Ga0157378_10107489
1118 Ga0157378_10116160
1119 Ga0157378_10156697
1120 Ga0163162_10151564
1121 Ga0163162_10197558
1122 Ga0163162_10219402
1123 Ga0163162_10336358
1124 Ga0157372_10186498
1125 Ga0157372_10292229
1126 Ga0157372_10328130
1127 Ga0157372_10357068
1128 Ga0157375_10124924
1129 Ga0157375_10158899
1130 Ga0157375_10226266
1131 Ga0157375_10253535
1132 Ga0157375_10268044
1133 Ga0157375_10357732
1134 Ga0163163_10162796
1135 Ga0163163_10237795
1136 Ga0163163_10256350
1137 Ga0157380_10104185
1138 Ga0157380_10122033
1139 Ga0157380_10176394
1140 Ga0157377_10022063
1141 Ga0157377_10061441
1142 Ga0157377_10065365
1143 Ga0157377_10097085
1144 Ga0157379_10177908
1145 Ga0157379_10199309
1146 Ga0157379_10208814
1147 Ga0157376_10122003
1148 Ga0163161_10078566
1149 Ga0163161_10097450
1150 Ga0207653_10011234
1151 Ga0207682_10047917
1152 Ga0207682_10048845
1153 Ga0207682_10049751
1154 Ga0207692_10080080
1155 Ga0207692_10082452
1156 Ga0207692_10082808
1157 Ga0207642_10052756
1158 Ga0207642_10054505
1159 Ga0207642_10063237
1160 Ga0207642_10063308
1161 Ga0207642_10063330
1162 Ga0207710_10014877
1163 Ga0207710_10061331
1164 Ga0207688_10035879
1165 Ga0207688_10078978
1166 Ga0207688_10081895
1167 Ga0207688_10098236
1168 Ga0207680_10106684
1169 Ga0207647_10028900
1170 Ga0207647_10062976
1171 Ga0207685_10038422
1172 Ga0207685_10041214
1173 Ga0207685_10042597
1174 Ga0207699_10014279
1175 Ga0207699_10117222
1176 Ga0207699_10117372
1177 Ga0207645_10031504
1178 Ga0207645_10088718
1179 Ga0207643_10045773
1180 Ga0207643_10084743
1181 Ga0207643_10101003
1182 Ga0207684_10066330
1183 Ga0207654_10111411
1184 Ga0207707_10165888
1185 Ga0207695_10218326
1186 Ga0207671_10123767
1187 Ga0207693_10031494
1188 Ga0207693_10048292
1189 Ga0207693_10065313
1190 Ga0207693_10091203
1191 Ga0207693_10117911
1192 Ga0207693_10135061
1193 Ga0207693_10137711
1194 Ga0207693_10146716
1195 Ga0207693_10154028
1196 Ga0207663_10061868
1197 Ga0207663_10089404
1198 Ga0207663_10113065
1199 Ga0207663_10118820
1200 Ga0207663_10139023
1201 Ga0207660_10165849
1202 Ga0207660_10200731
1203 Ga0207662_10026945
1204 Ga0207662_10097741
1205 Ga0207662_10131533
1206 Ga0207657_10033851
1207 Ga0207657_10058021
1208 Ga0207649_10045896
1209 Ga0207646_10036463
1210 Ga0207681_10055819
1211 Ga0207681_10075683
1212 Ga0207681_10141431
1213 Ga0207694_10120275
1214 Ga0207694_10146591
1215 Ga0207694_10160748
1216 Ga0207694_10192285
1217 Ga0207659_10157815
1218 Ga0207659_10171136
1219 Ga0207687_10109052
1220 Ga0207687_10156827
1221 Ga0207687_10163245
1222 Ga0207687_10174405
1223 Ga0207700_10170684
1224 Ga0207700_10180337
1225 Ga0207700_10181373
1226 Ga0207700_10191304
1227 Ga0207664_10193825
1228 Ga0207664_10205422
1229 Ga0207690_10137570
1230 Ga0207690_10152317
1231 Ga0207706_10082506
1232 Ga0207706_10087038
1233 Ga0207706_10112929
1234 Ga0207686_10064763
1235 Ga0207686_10165103
1236 Ga0207709_10112077
1237 Ga0207709_10117987
1238 Ga0207709_10131655
1239 Ga0207670_10160164
1240 Ga0207669_10068171
1241 Ga0207669_10114986
1242 Ga0207669_10130324
1243 Ga0207669_10136798
1244 Ga0207704_10045292
1245 Ga0207704_10091729
1246 Ga0207704_10136071
1247 Ga0207665_10056311
1248 Ga0207665_10066665
1249 Ga0207665_10111152
1250 Ga0207665_10121130
1251 Ga0207665_10123147
1252 Ga0207691_10147516
1253 Ga0207691_10156584
1254 Ga0207691_10180181
1255 Ga0207711_10000149
1256 Ga0207711_10232637
1257 Ga0207689_10027585
1258 Ga0207689_10062544
1259 Ga0207667_10249577
1260 Ga0207651_10155562
1261 Ga0207712_10032449
1262 Ga0207712_10048856
1263 Ga0207712_10164958
1264 Ga0207712_10165213
1265 Ga0207668_10165632
1266 Ga0207668_10167747
1267 Ga0207640_10141512
1268 Ga0207640_10143607
1269 Ga0207640_10146580
1270 Ga0207658_10135417
1271 Ga0207658_10184896
1272 Ga0207677_10149416
1273 Ga0207677_10164608
1274 Ga0207677_10165509
1275 Ga0207677_10171208
1276 Ga0207677_10226418
1277 Ga0207703_10164132
1278 Ga0207703_10166836
1279 Ga0207703_10220571
1280 Ga0207639_10085159
1281 Ga0207639_10194635
1282 Ga0207639_10245084
1283 Ga0207678_10079811
1284 Ga0207678_10080753
1285 Ga0207678_10093904
1286 Ga0207678_10174851
1287 Ga0207708_10077415
1288 Ga0207708_10131806
1289 Ga0207708_10154657
1290 Ga0207641_10239999
1291 Ga0207648_10046105
1292 Ga0207648_10053015
1293 Ga0207648_10143032
1294 Ga0207648_10158916
1295 Ga0207648_10194792
1296 Ga0207676_10192342
1297 Ga0207675_100098853
1298 Ga0207675_100102447
1299 Ga0207675_100175603
1300 Ga0207675_100180716
1301 Ga0207675_100212954
1302 Ga0207675_100227055
1303 Ga0207675_100255217
1304 Ga0207683_10001944
1305 Ga0207683_10046881
1306 Ga0207683_10060717
1307 Ga0207683_10119321
1308 Ga0207683_10172427
1309 Ga0207683_10177015
1310 Ga0207698_10116945
1311 Ga0209179_1007451
1312 Ga0268266_10066030
1313 Ga0268266_10196423
1314 Ga0268265_10171810
1315 Ga0268265_10203951
1316 Ga0268265_10218129
1317 Ga0268265_10243788
1318 Ga0268265_10253766
1319 Ga0268264_10000024
1320 Ga0268264_10112727
1321 Ga0268264_10228405
1322 Ga0268264_10240195
1323 Ga0265340_10000902
1324 Ga0316576_10175208
1325 Ga0316578_10030517
1326 Ga0307416_100169427
1327 Ga0307415_100133207
1328 Ga0373950_0003697
1329 Ga0373950_0007354
1330 Ga0373958_0005416
1331 Ga0373959_0008836
1332 Ga0373959_0008997
1333 Ga0373959_0010531
1334 Ga0373938_0001725
1335 Ga0373938_0007416
1336 Ga0373928_0012242
1337 Ga0373929_0007146
1338 Ga0373934_0000183
1339 Ga0373934_0017645
1340 Ga0373940_0013854
1341 Ga0373944_0034817
1342 Ga0373949_0006425
1343 Ga0373949_0024327
1344 Ga0373951_0010040
1345 Ga0373951_0014104
1346 Ga0373952_0009619
1347 Ga0373923_0013152
1348 Ga0373923_0014432
1349 Ga0373936_0014623
1350 Ga0373936_0023705
1351 Ga0373939_0012601
1352 Ga0373939_0012741
1353 Ga0373941_0019110
1354 Ga0373941_0020773
1355 Ga0373953_0005599
1356 Ga0373953_0049121
1357 Ga0373954_0022740
1358 Ga0373954_0027397
1359 Ga0373956_0004474
1360 Ga0373956_0005312
1361 Ga0373957_0013501
1362 Ga0373957_0016273
1363 Ga0373960_0021569
1364 Ga0373943_0020626
1365 Ga0373943_0065192
1366 Ga0373946_0029097
1367 Ga0373955_0015249
1368 Ga0373955_0095467
1369 Ga0373942_0008582
1370 Ga0373942_0019647
1371 Ga0373961_0012545
1372 Ga0373924_0013939
1373 Ga0373924_0035143
1374 Ga0373931_0026289
1375 Ga0373931_0065630
1376 Ga0373935_0067113
1377 Ga0373935_0068868
1378 Ga0373927_0065907
1379 Ga0373933_0001777
1380 Ga0373933_0112335
1381 Ga0373947_0080285
1382 Ga0373947_0101979
1383 Ga0373937_0039398
1384 Ga0373937_0241866
1385 Ga0316582_0181167
1386 Ga0373925_0078245
1387 Ga0373925_0084868
1388 Ga0373925_0105603
1389 Ga0451791_0896479
1390 Ga0451839_0487775
1391 Ga0451839_1253757
1392 Ga0451853_0064727
1393 Ga0451853_2992131
1394 Ga0466972_0057305
1395 Ga0466965_0046756
1396 Ga0466966_0000804
1397 Ga0466966_0097111
1398 Ga0466963_0126589
1399 Ga0466964_0023440
1400 Ga0466964_0026432
1401 Ga0466971_0048743
1402 Ga0466968_0042071
1403 Ga0466970_0079394
1404 Ga0466959_0124946
1405 Ga0466967_0066221
1406 Ga0466967_0160989
1407 Ga0495592_0018342
1408 Ga0495592_0121993
1409 Ga0495592_0134597
1410 Ga0495592_0137746
1411 Ga0495629_0004201
1412 Ga0495641_0008547
1413 Ga0495641_0039151
1414 Ga0495651_0001214
1415 Ga0495651_0133649
1416 Ga0495651_0147315
1417 Ga0495653_0011376
1418 Ga0495653_0126440
1419 Ga0495653_0140214
1420 Ga0495650_0044738
1421 Ga0495580_0076103
1422 Ga0495582_0037545
1423 Ga0495605_0055060
1424 Ga0495639_0058622
1425 Ga0495639_0059678
1426 Ga0495662_0043058
1427 Ga0495664_0014288
1428 Ga0495664_0039797
1429 Ga0495664_0099662
1430 Ga0495585_0098621
1431 Ga0495607_0089677
1432 Ga0495608_0039028
1433 Ga0495608_0072314
1434 Ga0495608_0117595
1435 Ga0495618_0032235
1436 Ga0495618_0080050
1437 Ga0495620_0029229
1438 Ga0495620_0046099
1439 Ga0495628_0034706
1440 Ga0495628_0125462
1441 Ga0495628_0161820
1442 Ga0495630_0025867
1443 Ga0495631_0056529
1444 Ga0495644_0038037
1445 Ga0495648_0076416
1446 Ga0495663_0025189
1447 Ga0495666_0047752
1448 Ga0495652_0022895
1449 Ga0495652_0075561
1450 Ga0495652_0167247
1451 Ga0495665_0017807
1452 Ga0495665_0061234
1453 Ga0495640_0018180
1454 Ga0495640_0068941
1455 Ga0495640_0078925
1456 Ga0495587_0004061
1457 Ga0495587_0064521
1458 Ga0495587_0076914
1459 Ga0495587_0096545
1460 Ga0495621_0038796
1461 Ga0495645_0014683
1462 Ga0495645_0070435
1463 Ga0495645_0117580
1464 Ga0495622_0066983
1465 Ga0495667_0019874
1466 Ga0495667_0104705
1467 Ga0495667_0119706
1468 Ga0495668_0068433
1469 Ga0495634_0022392
1470 Ga0495635_0015644
1471 Ga0495635_0033590
1472 Ga0495635_0078603
1473 Ga0495588_0069404
1474 Ga0495657_0017067
1475 Ga0495657_0114850
1476 Ga0495599_0010767
1477 Ga0495599_0111714
1478 Ga0495599_0119197
1479 Ga0495623_0044426
1480 Ga0495623_0106372
1481 Ga0495646_0006368
1482 Ga0495646_0058208
1483 Ga0495658_0026934
1484 Ga0495658_0067709
1485 Ga0495669_0068703
1486 Ga0495613_0048515
1487 Ga0495624_0014034
1488 Ga0495624_0089438
1489 Ga0495671_0055202
1490 Ga0495671_0079422
1491 Ga0495649_0033599
1492 Ga0495589_0039265
1493 Ga0495600_0009524
1494 Ga0495600_0042327
1495 Ga0495600_0121128
1496 Ga0495581_0005388
1497 Ga0495581_0068106
1498 Ga0495604_0022509
1499 Ga0495604_0104135
1500 Ga0495604_0106408
1501 Ga0495604_0143925
1502 Ga0495674_0075408
1503 Ga0495674_0105342
1504 Ga0495674_0110394
1505 Ga0495674_0111055
1506 Ga0495674_0138880
1507 Ga0495676_0078830
1508 Ga0495680_0021054
1509 Ga0495680_0150005
1510 Ga0495683_0111708
1511 Ga0495675_0070263
1512 Ga0495675_0091642
1513 Ga0495673_0026125
1514 Ga0495673_0071530
1515 Ga0495684_0017097
1516 Ga0495684_0105931
1517 Ga0495593_0025805
1518 Ga0495602_0009748
1519 Ga0495602_0083352
1520 Ga0495602_0094061
1521 Ga0495602_0103669
1522 Ga0495602_0168722
1523 Ga0496100_0027225
1524 Ga0496100_0081914
1525 Ga0496100_0113830
1526 Ga0496100_0121835
1527 Ga0496100_0179014
1528 Ga0496101_0049408
1529 Ga0496101_0125553
1530 Ga0496101_0131245
1531 Ga0496102_0000780
1532 Ga0496102_0014853
1533 Ga0496102_0138505
1534 Ga0496102_0165214
1535 Ga0496102_0196400
1536 Ga0496102_0205182
1537 Ga0496102_0211109
1538 Ga0496102_0232397
1539 Ga0496102_0242484
1540 Ga0496102_0252734
1541 Ga0496102_0286497
1542 Ga0496103_0001409
1543 Ga0496103_0045301
1544 Ga0496103_0049913
1545 Ga0496103_0078295
1546 Ga0496103_0141349
1547 Ga0496103_0162184
1548 Ga0496104_0111288
1549 Ga0496104_0181495
1550 Ga0496104_0229602
1551 Ga0496105_0179376
1552 Ga0496106_0001315
1553 Ga0496106_0148416
1554 Ga0496106_0157468
1555 Ga0496106_0162878
1556 Ga0496106_0167670
1557 Ga0496107_0045716
1558 Ga0496107_0090386
1559 Ga0496107_0150818
1560 Ga0496108_0146143
1561 Ga0496108_0208830
1562 Ga0496109_0109667
1563 Ga0496109_0419960
1564 Ga0496110_0135366
1565 Ga0496110_0194757
1566 Ga0496110_0199118
1567 Ga0496111_0119393
1568 Ga0496111_0138597
1569 Ga0496112_0263831
1570 Ga0496114_0000172
1571 Ga0496114_0073460
1572 Ga0496114_0077750
1573 Ga0496114_0083306
1574 Ga0496114_0130052
1575 Ga0496114_0158370
1576 Ga0496114_0180898
1577 Ga0496114_0208006
1578 Ga0496114_0210628
1579 Ga0496115_0066955
1580 Ga0496115_0096184
1581 Ga0496115_0197856
1582 Ga0496115_0220393
1583 Ga0496116_0036741
1584 Ga0496117_0001267
1585 Ga0496118_0004668
1586 Ga0496119_0048087
1587 Ga0496120_0105618
1588 Ga0496121_0093045
1589 Ga0496124_0187214
1590 Ga0496125_0109827
1591 Ga0496126_0001691
1592 Ga0496126_0191215
1593 Ga0501032_0072444
1594 Ga0501032_0120579
1595 Ga0501033_0096004
1596 Ga0501033_0106322
1597 Ga0501034_0086325
1598 Ga0501034_0224539
1599 Ga0501036_0105439
1600 Ga0501036_0168028
1601 Ga0501039_0033044
1602 Ga0501043_0034242
1603 Ga0501046_0125899
1604 Ga0501047_0021913
1605 Ga0501047_0114058
1606 Ga0501047_0269776
1607 Ga0501048_0124530
1608 Ga0501068_0071206
1609 Ga0501069_0004207
1610 Ga0501069_0067461
1611 Ga0501070_0122813
1612 Ga0501070_0186035
1613 Ga0501071_0102731
1614 Ga0501080_0156818
1615 Ga0501083_0099480
1616 Ga0501035_0015721
1617 Ga0501044_0001622
1618 Ga0501044_0153423
1619 nmdc:mga09592_30174_c1
1620 nmdc:mga0qj67_171128_c1
1621 nmdc:mga08y16_184638_c1
1622 nmdc:mga08y16_196406_c1
1623 nmdc:mga0a205_244506_c1
1624 nmdc:mga0a205_315956_c1
1625 Ga0495601_0059405
1626 Ga0495601_0062065
1627 Ga0495601_0072599
1628 Ga0495601_0103165
1629 Ga0495612_0044201
1630 Ga0495655_0007074
1631 Ga0495595_0060650
1632 Ga0495595_0066194
1633 Ga0495619_0016726
1634 Ga0495619_0116563
1635 Ga0500643_002834
1636 Ga0500556_0042340
1637 Ga0500568_0044317
1638 Ga0500645_008933
1639 Ga0466962_0063888
1640 2883822506
1641 2883822837
1642 2883823433
1643 2883824879
1644 2883825258

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13701

DDE_Tnp_1_4

Transposase DDE domain group 1

18

480

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mm8-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.5087 35 380
1mus-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with resolved outside end dna 0.4946 35 443
1muh-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with transposon end dna 0.4798 37 443
4dm0-assembly1.cif.gz_A-2 tn5 transposase: 20mer outside end 2 mn complex 0.4778 35 443
3ecp-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with 5' phosphorylated transposon end dna 0.4681 35 441
ID Description Score Start End Superfamily
af_P28916_100_246_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6809 161 252 3.30.420.10
af_P75741_104_321_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6326 147 349 3.90.350.10
af_P28917_100_343_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.5828 147 349 3.90.350.10
af_P75741_104_321_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.5523 147 349 3.90.350.10
af_A0A0G2KB79_102_308_3.90.350.10 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.5462 141 355 3.90.350.10
ID Description Score Start End GO Terms
AF-G7CBA4-F1-model_v4 Transposase 0.951 367 444
AF-G7CBA4-F1-model_v4 Transposase 0.9282 367 444
AF-A0A7I9Y367-F1-model_v4 Transposase DDE domain-containing protein 0.9276 153 364
AF-A0A5R9AZR4-F1-model_v4 IS1380 family transposase 0.926 176 301
AF-A0A498QG53-F1-model_v4 Transposase DDE domain-containing protein 0.9193 151 443

Map