F482297
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 822 | 340 | 1644 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10014527|Ga0075370_100145274 |
| Length | 328 |
| Sequence | MALMFGQCTREVDSSVCRMTRPLVSIPFTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGGGRLVIVTSKGKDGVVAHFVEDLVLEGTLEARGKHLMLEKVRRAPALIKVESVVQAEPLGLGHAVSCVEPTLLPDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVSPTEISAYGVFDVATVPDAVNPNVMRVKGMVEKPKAEDAPSLYAAAGRYILDRAIFDALRRVSRGAGGEIQLTDAIAWLIDDGHPVHVVVHRGPRHDLGNPGGYLKAAVDFALERDDYGPELRRWLAKRLGLTTPDDVRRAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 179 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 182 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 183 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 186 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 189 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 190 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 191 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 197 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 198 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 199 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 200 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 201 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 202 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 206 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 207 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 208 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 209 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 280 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 290 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 291 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 292 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 293 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 294 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 295 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 299 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 300 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 301 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 302 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 303 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 304 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 305 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 306 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 307 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 308 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 309 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 310 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 311 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 312 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 313 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 314 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 315 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 316 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 317 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 318 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 319 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 320 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 321 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 322 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 323 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 324 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 325 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 326 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 327 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 328 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 329 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 330 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 331 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 332 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 333 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 334 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 335 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 336 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 337 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 338 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 339 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 340 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.53 |
| Metatranscriptomes | 0 |
| Isolates | 5.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 11.56 |
| Nodule | 0.12 |
| Rhizoplane | 11.44 |
| Rhizosphere | 65.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075370_10014527 | 3300006353 | Bacteria | 4203 |
| 2 | JGI24746J21847_1000249 | 3300001977 | Bacteria | 7535 |
| 3 | JGI24746J21847_1001185 | 3300001977 | Bacteria | 4124 |
| 4 | JGI24747J21853_1006288 | 3300001978 | Bacteria | 1119 |
| 5 | JGI24743J22301_10015474 | 3300001991 | Bacteria | 1416 |
| 6 | JGI24745J21846_1002583 | 3300002073 | Bacteria | 1856 |
| 7 | JGI24749J21850_1011289 | 3300002076 | Bacteria | 1254 |
| 8 | JGI24744J21845_10000863 | 3300002077 | Bacteria | 5724 |
| 9 | JGI24744J21845_10002207 | 3300002077 | Bacteria | 3956 |
| 10 | JGI24034J26672_10005997 | 3300002239 | Bacteria | 1750 |
| 11 | JGI24742J22300_10010545 | 3300002244 | Bacteria | 1530 |
| 12 | rootH2_10094652 | 3300003320 | Bacteria | 6243 |
| 13 | Ga0055540_1000737 | 3300003792 | Bacteria | 22215 |
| 14 | Ga0070676_10048429 | 3300005328 | Bacteria | 2485 |
| 15 | Ga0070676_10202530 | 3300005328 | Bacteria | 1302 |
| 16 | Ga0070683_100293629 | 3300005329 | Bacteria | 1546 |
| 17 | Ga0070690_100026077 | 3300005330 | Bacteria | 3603 |
| 18 | Ga0070670_100127278 | 3300005331 | Bacteria | 2199 |
| 19 | Ga0070666_10037531 | 3300005335 | Bacteria | 3222 |
| 20 | Ga0070666_10116468 | 3300005335 | Bacteria | 1851 |
| 21 | Ga0070666_10121198 | 3300005335 | Bacteria | 1814 |
| 22 | Ga0070666_10176264 | 3300005335 | Bacteria | 1499 |
| 23 | Ga0070680_100248524 | 3300005336 | Bacteria | 1504 |
| 24 | Ga0070682_100011980 | 3300005337 | Bacteria | 4962 |
| 25 | Ga0070682_100032669 | 3300005337 | Bacteria | 3158 |
| 26 | Ga0070682_100105755 | 3300005337 | Bacteria | 1866 |
| 27 | Ga0068868_100005086 | 3300005338 | Bacteria | 9229 |
| 28 | Ga0070660_100032332 | 3300005339 | Bacteria | 3936 |
| 29 | Ga0070660_100336894 | 3300005339 | Bacteria | 1241 |
| 30 | Ga0070689_100003641 | 3300005340 | Bacteria | 10282 |
| 31 | Ga0070689_100004126 | 3300005340 | Bacteria | 9782 |
| 32 | Ga0070691_10008508 | 3300005341 | Bacteria | 4697 |
| 33 | Ga0070691_10009526 | 3300005341 | Bacteria | 4435 |
| 34 | Ga0070691_10094944 | 3300005341 | Bacteria | 1475 |
| 35 | Ga0070661_100310155 | 3300005344 | Bacteria | 1230 |
| 36 | Ga0070668_100000769 | 3300005347 | Bacteria | 22070 |
| 37 | Ga0070668_100008191 | 3300005347 | Bacteria | 7762 |
| 38 | Ga0070668_100019076 | 3300005347 | Bacteria | 5156 |
| 39 | Ga0070668_100038011 | 3300005347 | Bacteria | 3677 |
| 40 | Ga0070668_100069362 | 3300005347 | Bacteria | 2742 |
| 41 | Ga0070669_100003680 | 3300005353 | Bacteria | 11060 |
| 42 | Ga0070669_100020383 | 3300005353 | Bacteria | 4735 |
| 43 | Ga0070671_100012064 | 3300005355 | Bacteria | 6952 |
| 44 | Ga0070674_100000153 | 3300005356 | Bacteria | 32199 |
| 45 | Ga0070674_100003905 | 3300005356 | Bacteria | 8442 |
| 46 | Ga0070674_100132429 | 3300005356 | Bacteria | 1861 |
| 47 | Ga0070674_100172331 | 3300005356 | Bacteria | 1651 |
| 48 | Ga0070673_100036906 | 3300005364 | Bacteria | 3720 |
| 49 | Ga0070688_100006433 | 3300005365 | Bacteria | 6280 |
| 50 | Ga0070688_100011192 | 3300005365 | Bacteria | 4980 |
| 51 | Ga0070688_100063455 | 3300005365 | Bacteria | 2342 |
| 52 | Ga0070659_100024397 | 3300005366 | Bacteria | 4636 |
| 53 | Ga0070659_100037415 | 3300005366 | Bacteria | 3783 |
| 54 | Ga0070659_100317684 | 3300005366 | Bacteria | 1301 |
| 55 | Ga0070667_100000207 | 3300005367 | Bacteria | 69147 |
| 56 | Ga0070667_100001930 | 3300005367 | Bacteria | 18393 |
| 57 | Ga0070667_100008191 | 3300005367 | Bacteria | 8664 |
| 58 | Ga0070667_100047120 | 3300005367 | Bacteria | 3627 |
| 59 | Ga0070667_100133356 | 3300005367 | Bacteria | 2169 |
| 60 | Ga0070667_100531595 | 3300005367 | Bacteria | 1080 |
| 61 | Ga0070709_10015484 | 3300005434 | Bacteria | 4340 |
| 62 | Ga0070709_10019600 | 3300005434 | Bacteria | 3913 |
| 63 | Ga0070709_10020647 | 3300005434 | Bacteria | 3826 |
| 64 | Ga0070714_100077941 | 3300005435 | Bacteria | 2879 |
| 65 | Ga0070714_100404976 | 3300005435 | Bacteria | 1290 |
| 66 | Ga0070713_100191382 | 3300005436 | Bacteria | 1844 |
| 67 | Ga0070713_100495077 | 3300005436 | Bacteria | 1153 |
| 68 | Ga0070710_10002949 | 3300005437 | Bacteria | 8079 |
| 69 | Ga0070710_10005582 | 3300005437 | Bacteria | 5992 |
| 70 | Ga0070710_10017972 | 3300005437 | Bacteria | 3630 |
| 71 | Ga0070710_10038842 | 3300005437 | Bacteria | 2617 |
| 72 | Ga0070701_10009581 | 3300005438 | Bacteria | 4248 |
| 73 | Ga0070701_10026187 | 3300005438 | Bacteria | 2841 |
| 74 | Ga0070701_10095330 | 3300005438 | Bacteria | 1638 |
| 75 | Ga0070711_100000205 | 3300005439 | Bacteria | 31303 |
| 76 | Ga0070711_100006693 | 3300005439 | Bacteria | 6968 |
| 77 | Ga0070711_100008390 | 3300005439 | Bacteria | 6326 |
| 78 | Ga0070705_100008794 | 3300005440 | Bacteria | 5002 |
| 79 | Ga0070700_100000708 | 3300005441 | Bacteria | 16443 |
| 80 | Ga0070700_100001321 | 3300005441 | Bacteria | 12299 |
| 81 | Ga0070700_100063074 | 3300005441 | Bacteria | 2343 |
| 82 | Ga0070663_100010779 | 3300005455 | Bacteria | 5706 |
| 83 | Ga0070663_100011227 | 3300005455 | Bacteria | 5612 |
| 84 | Ga0070663_100212952 | 3300005455 | Bacteria | 1514 |
| 85 | Ga0070678_100004244 | 3300005456 | Bacteria | 8098 |
| 86 | Ga0070678_100007027 | 3300005456 | Bacteria | 6652 |
| 87 | Ga0070678_100023099 | 3300005456 | Bacteria | 4137 |
| 88 | Ga0070678_100229492 | 3300005456 | Bacteria | 1547 |
| 89 | Ga0070662_100005093 | 3300005457 | Bacteria | 8373 |
| 90 | Ga0070662_100015171 | 3300005457 | Bacteria | 5155 |
| 91 | Ga0070662_100034884 | 3300005457 | Bacteria | 3549 |
| 92 | Ga0070662_100291678 | 3300005457 | Bacteria | 1323 |
| 93 | Ga0068867_100010568 | 3300005459 | Bacteria | 6511 |
| 94 | Ga0068867_100013125 | 3300005459 | Bacteria | 5865 |
| 95 | Ga0070685_10007226 | 3300005466 | Bacteria | 5677 |
| 96 | Ga0070684_100139182 | 3300005535 | Bacteria | 2194 |
| 97 | Ga0068853_100009963 | 3300005539 | Bacteria | 7675 |
| 98 | Ga0068853_100016405 | 3300005539 | Bacteria | 6096 |
| 99 | Ga0070672_100147140 | 3300005543 | Bacteria | 1947 |
| 100 | Ga0070686_100047050 | 3300005544 | Bacteria | 2726 |
| 101 | Ga0070695_100090310 | 3300005545 | Bacteria | 2044 |
| 102 | Ga0070696_100004265 | 3300005546 | Bacteria | 9534 |
| 103 | Ga0070696_100173672 | 3300005546 | Bacteria | 1594 |
| 104 | Ga0070696_100279821 | 3300005546 | Bacteria | 1271 |
| 105 | Ga0070693_100014322 | 3300005547 | Bacteria | 4061 |
| 106 | Ga0070665_100012212 | 3300005548 | Bacteria | 8658 |
| 107 | Ga0070665_100025199 | 3300005548 | Bacteria | 5994 |
| 108 | Ga0070665_100027972 | 3300005548 | Bacteria | 5678 |
| 109 | Ga0070665_100146646 | 3300005548 | Bacteria | 2363 |
| 110 | Ga0070704_100011678 | 3300005549 | Bacteria | 5394 |
| 111 | Ga0070704_100049087 | 3300005549 | Bacteria | 2958 |
| 112 | Ga0070704_100157550 | 3300005549 | Bacteria | 1792 |
| 113 | Ga0068855_100198480 | 3300005563 | Bacteria | 2260 |
| 114 | Ga0068855_100455795 | 3300005563 | Bacteria | 1395 |
| 115 | Ga0068854_100000746 | 3300005578 | Bacteria | 19250 |
| 116 | Ga0068856_100258154 | 3300005614 | Bacteria | 1758 |
| 117 | Ga0070702_100001885 | 3300005615 | Bacteria | 8784 |
| 118 | Ga0070702_100208948 | 3300005615 | Bacteria | 1298 |
| 119 | Ga0068852_100056062 | 3300005616 | Bacteria | 3404 |
| 120 | Ga0068859_100002633 | 3300005617 | Bacteria | 18260 |
| 121 | Ga0068859_100009168 | 3300005617 | Bacteria | 9994 |
| 122 | Ga0068859_100035219 | 3300005617 | Bacteria | 5022 |
| 123 | Ga0068859_100179725 | 3300005617 | Bacteria | 2198 |
| 124 | Ga0068859_100358049 | 3300005617 | Bacteria | 1554 |
| 125 | Ga0068859_100746578 | 3300005617 | Bacteria | 1068 |
| 126 | Ga0068864_100424917 | 3300005618 | Bacteria | 1267 |
| 127 | Ga0068866_10003311 | 3300005718 | Bacteria | 6618 |
| 128 | Ga0068866_10034511 | 3300005718 | Bacteria | 2464 |
| 129 | Ga0068861_100006620 | 3300005719 | Bacteria | 7907 |
| 130 | Ga0068861_100017161 | 3300005719 | Bacteria | 5133 |
| 131 | Ga0068870_10009240 | 3300005840 | Bacteria | 4475 |
| 132 | Ga0068863_100001167 | 3300005841 | Bacteria | 26238 |
| 133 | Ga0068863_100008676 | 3300005841 | Bacteria | 9932 |
| 134 | Ga0068858_100002047 | 3300005842 | Bacteria | 20555 |
| 135 | Ga0068858_100011611 | 3300005842 | Bacteria | 8308 |
| 136 | Ga0068858_100012734 | 3300005842 | Bacteria | 7925 |
| 137 | Ga0068858_100181173 | 3300005842 | Bacteria | 1989 |
| 138 | Ga0068860_100000087 | 3300005843 | Bacteria | 158242 |
| 139 | Ga0068860_100012921 | 3300005843 | Bacteria | 8202 |
| 140 | Ga0068860_100038942 | 3300005843 | Bacteria | 4547 |
| 141 | Ga0068860_100262496 | 3300005843 | Bacteria | 1684 |
| 142 | Ga0068862_100000077 | 3300005844 | Bacteria | 116781 |
| 143 | Ga0068862_100011090 | 3300005844 | Bacteria | 7444 |
| 144 | Ga0068862_100024124 | 3300005844 | Bacteria | 5101 |
| 145 | Ga0068862_100433621 | 3300005844 | Bacteria | 1236 |
| 146 | Ga0081455_10155028 | 3300005937 | Bacteria | 1762 |
| 147 | Ga0081455_10171753 | 3300005937 | Bacteria | 1651 |
| 148 | Ga0070717_10559625 | 3300006028 | Bacteria | 1036 |
| 149 | Ga0070717_10659401 | 3300006028 | Bacteria | 950 |
| 150 | Ga0075365_10006497 | 3300006038 | Bacteria | 6438 |
| 151 | Ga0075365_10049895 | 3300006038 | Bacteria | 2759 |
| 152 | Ga0075365_10146170 | 3300006038 | Bacteria | 1643 |
| 153 | Ga0075365_10321614 | 3300006038 | Bacteria | 1089 |
| 154 | Ga0075363_100000752 | 3300006048 | Bacteria | 11078 |
| 155 | Ga0075363_100002418 | 3300006048 | Bacteria | 7622 |
| 156 | Ga0075363_100016716 | 3300006048 | Bacteria | 3628 |
| 157 | Ga0075363_100020840 | 3300006048 | Bacteria | 3293 |
| 158 | Ga0075363_100024351 | 3300006048 | Bacteria | 3076 |
| 159 | Ga0075363_100051117 | 3300006048 | Bacteria | 2203 |
| 160 | Ga0075363_100061962 | 3300006048 | Bacteria | 2017 |
| 161 | Ga0075363_100093528 | 3300006048 | Bacteria | 1657 |
| 162 | Ga0075363_100140687 | 3300006048 | Bacteria | 1358 |
| 163 | Ga0075364_10001726 | 3300006051 | Bacteria | 12028 |
| 164 | Ga0075364_10005298 | 3300006051 | Bacteria | 7486 |
| 165 | Ga0075364_10035728 | 3300006051 | Bacteria | 3212 |
| 166 | Ga0075364_10091945 | 3300006051 | Bacteria | 2014 |
| 167 | Ga0075364_10114698 | 3300006051 | Bacteria | 1800 |
| 168 | Ga0075364_10183699 | 3300006051 | Bacteria | 1416 |
| 169 | Ga0070715_10002894 | 3300006163 | Bacteria | 5357 |
| 170 | Ga0070715_10016219 | 3300006163 | Bacteria | 2795 |
| 171 | Ga0070715_10063506 | 3300006163 | Bacteria | 1628 |
| 172 | Ga0070715_10092639 | 3300006163 | Bacteria | 1394 |
| 173 | Ga0070716_100012068 | 3300006173 | Bacteria | 4367 |
| 174 | Ga0070716_100014443 | 3300006173 | Bacteria | 4044 |
| 175 | Ga0070716_100022695 | 3300006173 | Bacteria | 3319 |
| 176 | Ga0070716_100071206 | 3300006173 | Bacteria | 2043 |
| 177 | Ga0070712_100003140 | 3300006175 | Bacteria | 10176 |
| 178 | Ga0070712_100005319 | 3300006175 | Bacteria | 7968 |
| 179 | Ga0070712_100041669 | 3300006175 | Bacteria | 3153 |
| 180 | Ga0070712_100288142 | 3300006175 | Bacteria | 1325 |
| 181 | Ga0075362_10027884 | 3300006177 | Bacteria | 2421 |
| 182 | Ga0075367_10049963 | 3300006178 | Bacteria | 2467 |
| 183 | Ga0075367_10063204 | 3300006178 | Bacteria | 2213 |
| 184 | Ga0075367_10302944 | 3300006178 | Bacteria | 1006 |
| 185 | Ga0075369_10003028 | 3300006186 | Bacteria | 6076 |
| 186 | Ga0075369_10004827 | 3300006186 | Bacteria | 5015 |
| 187 | Ga0075369_10015255 | 3300006186 | Bacteria | 3081 |
| 188 | Ga0075369_10021231 | 3300006186 | Bacteria | 2665 |
| 189 | Ga0075369_10044584 | 3300006186 | Bacteria | 1906 |
| 190 | Ga0075369_10059967 | 3300006186 | Bacteria | 1658 |
| 191 | Ga0097621_100112477 | 3300006237 | Bacteria | 2302 |
| 192 | Ga0097621_100136715 | 3300006237 | Bacteria | 2091 |
| 193 | Ga0075370_10000341 | 3300006353 | Bacteria | 16842 |
| 194 | Ga0075370_10006636 | 3300006353 | Bacteria | 5835 |
| 195 | Ga0075370_10042679 | 3300006353 | Bacteria | 2562 |
| 196 | Ga0075370_10097594 | 3300006353 | Bacteria | 1699 |
| 197 | Ga0075370_10099080 | 3300006353 | Bacteria | 1686 |
| 198 | Ga0075428_100007312 | 3300006844 | Bacteria | 12235 |
| 199 | Ga0075430_100033460 | 3300006846 | Bacteria | 4363 |
| 200 | Ga0068865_100003973 | 3300006881 | Bacteria | 8874 |
| 201 | Ga0068865_100004511 | 3300006881 | Bacteria | 8402 |
| 202 | Ga0068865_100065189 | 3300006881 | Bacteria | 2565 |
| 203 | Ga0097620_100002633 | 3300006931 | Bacteria | 18260 |
| 204 | Ga0097620_100009170 | 3300006931 | Bacteria | 9994 |
| 205 | Ga0097620_100035220 | 3300006931 | Bacteria | 5022 |
| 206 | Ga0097620_100179719 | 3300006931 | Bacteria | 2198 |
| 207 | Ga0097620_100358017 | 3300006931 | Bacteria | 1554 |
| 208 | Ga0097620_100746494 | 3300006931 | Bacteria | 1068 |
| 209 | Ga0099795_10018115 | 3300007788 | Bacteria | 2257 |
| 210 | Ga0105250_10059132 | 3300009092 | Bacteria | 1539 |
| 211 | Ga0111539_10058235 | 3300009094 | Bacteria | 4584 |
| 212 | Ga0105245_10010064 | 3300009098 | Bacteria | 8239 |
| 213 | Ga0105245_10011752 | 3300009098 | Bacteria | 7617 |
| 214 | Ga0105245_10058319 | 3300009098 | Bacteria | 3475 |
| 215 | Ga0105247_10000060 | 3300009101 | Bacteria | 127879 |
| 216 | Ga0105247_10003797 | 3300009101 | Bacteria | 9791 |
| 217 | Ga0105247_10014399 | 3300009101 | Bacteria | 4746 |
| 218 | Ga0105247_10107982 | 3300009101 | Bacteria | 1787 |
| 219 | Ga0114129_10018369 | 3300009147 | Bacteria | 9960 |
| 220 | Ga0105243_10001032 | 3300009148 | Bacteria | 25576 |
| 221 | Ga0105243_10004112 | 3300009148 | Bacteria | 11567 |
| 222 | Ga0105243_10004938 | 3300009148 | Bacteria | 10447 |
| 223 | Ga0105241_10019363 | 3300009174 | Bacteria | 5019 |
| 224 | Ga0105242_10007699 | 3300009176 | Bacteria | 8289 |
| 225 | Ga0105242_10015610 | 3300009176 | Bacteria | 5901 |
| 226 | Ga0105242_10229140 | 3300009176 | Bacteria | 1664 |
| 227 | Ga0105248_10000050 | 3300009177 | Bacteria | 152667 |
| 228 | Ga0105248_10006763 | 3300009177 | Bacteria | 12573 |
| 229 | Ga0105248_10014903 | 3300009177 | Bacteria | 8560 |
| 230 | Ga0105248_10016636 | 3300009177 | Bacteria | 8095 |
| 231 | Ga0105248_10289150 | 3300009177 | Bacteria | 1846 |
| 232 | Ga0105248_10672903 | 3300009177 | Bacteria | 1168 |
| 233 | Ga0105237_10000302 | 3300009545 | Bacteria | 68290 |
| 234 | Ga0105237_10005603 | 3300009545 | Bacteria | 14150 |
| 235 | Ga0105237_10024475 | 3300009545 | Bacteria | 6176 |
| 236 | Ga0105237_10037157 | 3300009545 | Bacteria | 4924 |
| 237 | Ga0105238_10398072 | 3300009551 | Bacteria | 1370 |
| 238 | Ga0105249_10000042 | 3300009553 | Bacteria | 195242 |
| 239 | Ga0105249_10008535 | 3300009553 | Bacteria | 8931 |
| 240 | Ga0105147_106159 | 3300009982 | Bacteria | 1014 |
| 241 | Ga0105239_10007547 | 3300010375 | Bacteria | 12474 |
| 242 | Ga0105239_10020122 | 3300010375 | Bacteria | 7363 |
| 243 | Ga0105239_10145429 | 3300010375 | Bacteria | 2643 |
| 244 | Ga0105239_10149605 | 3300010375 | Bacteria | 2605 |
| 245 | Ga0105246_10063161 | 3300011119 | Bacteria | 2582 |
| 246 | Ga0105246_10321212 | 3300011119 | Bacteria | 1258 |
| 247 | Ga0157369_10731401 | 3300013105 | Bacteria | 1018 |
| 248 | Ga0157374_10269811 | 3300013296 | Bacteria | 1677 |
| 249 | Ga0157374_10750967 | 3300013296 | Bacteria | 990 |
| 250 | Ga0157378_10009418 | 3300013297 | Bacteria | 8509 |
| 251 | Ga0157378_10020814 | 3300013297 | Bacteria | 5768 |
| 252 | Ga0163162_10036034 | 3300013306 | Bacteria | 4929 |
| 253 | Ga0163162_10056668 | 3300013306 | Bacteria | 3946 |
| 254 | Ga0163162_10135750 | 3300013306 | Bacteria | 2571 |
| 255 | Ga0163162_10235301 | 3300013306 | Bacteria | 1962 |
| 256 | Ga0163162_10431134 | 3300013306 | Bacteria | 1450 |
| 257 | Ga0157372_10017144 | 3300013307 | Bacteria | 7776 |
| 258 | Ga0157372_10027610 | 3300013307 | Bacteria | 6185 |
| 259 | Ga0157375_10001384 | 3300013308 | Bacteria | 20929 |
| 260 | Ga0157375_10009040 | 3300013308 | Bacteria | 8723 |
| 261 | Ga0163163_10041091 | 3300014325 | Bacteria | 4521 |
| 262 | Ga0163163_10171294 | 3300014325 | Bacteria | 2218 |
| 263 | Ga0157380_10005913 | 3300014326 | Bacteria | 8558 |
| 264 | Ga0157380_10036421 | 3300014326 | Bacteria | 3807 |
| 265 | Ga0157380_10174838 | 3300014326 | Bacteria | 1880 |
| 266 | Ga0157377_10003584 | 3300014745 | Bacteria | 7028 |
| 267 | Ga0157377_10004754 | 3300014745 | Bacteria | 6291 |
| 268 | Ga0157379_10014991 | 3300014968 | Bacteria | 6799 |
| 269 | Ga0157379_10015516 | 3300014968 | Bacteria | 6686 |
| 270 | Ga0157379_10057052 | 3300014968 | Bacteria | 3490 |
| 271 | Ga0157376_10175865 | 3300014969 | Bacteria | 1953 |
| 272 | Ga0163161_10004143 | 3300017792 | Bacteria | 10137 |
| 273 | Ga0163161_10019468 | 3300017792 | Bacteria | 4763 |
| 274 | Ga0163161_10056262 | 3300017792 | Bacteria | 2857 |
| 275 | Ga0163161_10409716 | 3300017792 | Bacteria | 1088 |
| 276 | Ga0213873_10001011 | 3300021358 | Bacteria | 4568 |
| 277 | Ga0213874_10015187 | 3300021377 | Bacteria | 2027 |
| 278 | Ga0213876_10001280 | 3300021384 | Bacteria | 15877 |
| 279 | Ga0213876_10012437 | 3300021384 | Bacteria | 4530 |
| 280 | Ga0213876_10014840 | 3300021384 | Bacteria | 4129 |
| 281 | Ga0213876_10016537 | 3300021384 | Bacteria | 3899 |
| 282 | Ga0213875_10009014 | 3300021388 | Bacteria | 5075 |
| 283 | Ga0213875_10013022 | 3300021388 | Bacteria | 4093 |
| 284 | Ga0213875_10013950 | 3300021388 | Bacteria | 3930 |
| 285 | Ga0209051_1001230 | 3300025303 | Bacteria | 23021 |
| 286 | Ga0209051_1004009 | 3300025303 | Bacteria | 9330 |
| 287 | Ga0209051_1012348 | 3300025303 | Bacteria | 4139 |
| 288 | Ga0209051_1023531 | 3300025303 | Bacteria | 2557 |
| 289 | Ga0207682_10079528 | 3300025893 | Bacteria | 1402 |
| 290 | Ga0207692_10005364 | 3300025898 | Bacteria | 5134 |
| 291 | Ga0207692_10013460 | 3300025898 | Bacteria | 3550 |
| 292 | Ga0207692_10092518 | 3300025898 | Bacteria | 1643 |
| 293 | Ga0207642_10010536 | 3300025899 | Bacteria | 3264 |
| 294 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 295 | Ga0207710_10005512 | 3300025900 | Bacteria | 5444 |
| 296 | Ga0207710_10011237 | 3300025900 | Bacteria | 3771 |
| 297 | Ga0207688_10000746 | 3300025901 | Bacteria | 16161 |
| 298 | Ga0207688_10003542 | 3300025901 | Bacteria | 8519 |
| 299 | Ga0207688_10003584 | 3300025901 | Bacteria | 8476 |
| 300 | Ga0207688_10008767 | 3300025901 | Bacteria | 5503 |
| 301 | Ga0207688_10055573 | 3300025901 | Bacteria | 2222 |
| 302 | Ga0207688_10111573 | 3300025901 | Bacteria | 1588 |
| 303 | Ga0207688_10191867 | 3300025901 | Bacteria | 1222 |
| 304 | Ga0207680_10274742 | 3300025903 | Bacteria | 1169 |
| 305 | Ga0207647_10018896 | 3300025904 | Bacteria | 4646 |
| 306 | Ga0207647_10037812 | 3300025904 | Bacteria | 3057 |
| 307 | Ga0207647_10108787 | 3300025904 | Bacteria | 1640 |
| 308 | Ga0207647_10161244 | 3300025904 | Bacteria | 1308 |
| 309 | Ga0207685_10022078 | 3300025905 | Bacteria | 2144 |
| 310 | Ga0207699_10007946 | 3300025906 | Bacteria | 5206 |
| 311 | Ga0207699_10176649 | 3300025906 | Bacteria | 1432 |
| 312 | Ga0207645_10015285 | 3300025907 | Bacteria | 5106 |
| 313 | Ga0207645_10165124 | 3300025907 | Bacteria | 1449 |
| 314 | Ga0207643_10028576 | 3300025908 | Bacteria | 3098 |
| 315 | Ga0207654_10185231 | 3300025911 | Bacteria | 1361 |
| 316 | Ga0207695_10429346 | 3300025913 | Bacteria | 1205 |
| 317 | Ga0207671_10020899 | 3300025914 | Bacteria | 4977 |
| 318 | Ga0207671_10045140 | 3300025914 | Bacteria | 3258 |
| 319 | Ga0207671_10177721 | 3300025914 | Bacteria | 1655 |
| 320 | Ga0207693_10001933 | 3300025915 | Bacteria | 18145 |
| 321 | Ga0207693_10009413 | 3300025915 | Bacteria | 7968 |
| 322 | Ga0207693_10018536 | 3300025915 | Bacteria | 5542 |
| 323 | Ga0207693_10132318 | 3300025915 | Bacteria | 1961 |
| 324 | Ga0207663_10009091 | 3300025916 | Bacteria | 5236 |
| 325 | Ga0207663_10012518 | 3300025916 | Bacteria | 4589 |
| 326 | Ga0207662_10031278 | 3300025918 | Bacteria | 3092 |
| 327 | Ga0207662_10056518 | 3300025918 | Bacteria | 2344 |
| 328 | Ga0207657_10097585 | 3300025919 | Bacteria | 2443 |
| 329 | Ga0207657_10196077 | 3300025919 | Bacteria | 1627 |
| 330 | Ga0207649_10338101 | 3300025920 | Bacteria | 1111 |
| 331 | Ga0207681_10001541 | 3300025923 | Bacteria | 14852 |
| 332 | Ga0207681_10071572 | 3300025923 | Bacteria | 2419 |
| 333 | Ga0207694_10051158 | 3300025924 | Bacteria | 3202 |
| 334 | Ga0207650_10357719 | 3300025925 | Bacteria | 1202 |
| 335 | Ga0207659_10219904 | 3300025926 | Bacteria | 1527 |
| 336 | Ga0207687_10009180 | 3300025927 | Bacteria | 6469 |
| 337 | Ga0207687_10009671 | 3300025927 | Bacteria | 6306 |
| 338 | Ga0207687_10023790 | 3300025927 | Bacteria | 4086 |
| 339 | Ga0207687_10064377 | 3300025927 | Bacteria | 2600 |
| 340 | Ga0207664_10208990 | 3300025929 | Bacteria | 1688 |
| 341 | Ga0207644_10020036 | 3300025931 | Bacteria | 4543 |
| 342 | Ga0207644_10172909 | 3300025931 | Bacteria | 1688 |
| 343 | Ga0207690_10013423 | 3300025932 | Bacteria | 4922 |
| 344 | Ga0207690_10017470 | 3300025932 | Bacteria | 4380 |
| 345 | Ga0207690_10222742 | 3300025932 | Bacteria | 1444 |
| 346 | Ga0207706_10001957 | 3300025933 | Bacteria | 20214 |
| 347 | Ga0207706_10018529 | 3300025933 | Bacteria | 6263 |
| 348 | Ga0207706_10039401 | 3300025933 | Bacteria | 4189 |
| 349 | Ga0207706_10173451 | 3300025933 | Bacteria | 1895 |
| 350 | Ga0207686_10004236 | 3300025934 | Bacteria | 7685 |
| 351 | Ga0207686_10023126 | 3300025934 | Bacteria | 3586 |
| 352 | Ga0207686_10153847 | 3300025934 | Bacteria | 1604 |
| 353 | Ga0207709_10004934 | 3300025935 | Bacteria | 7636 |
| 354 | Ga0207709_10005610 | 3300025935 | Bacteria | 7096 |
| 355 | Ga0207709_10021313 | 3300025935 | Bacteria | 3668 |
| 356 | Ga0207670_10020714 | 3300025936 | Bacteria | 4045 |
| 357 | Ga0207670_10034022 | 3300025936 | Bacteria | 3289 |
| 358 | Ga0207670_10071936 | 3300025936 | Bacteria | 2393 |
| 359 | Ga0207669_10001689 | 3300025937 | Bacteria | 9388 |
| 360 | Ga0207669_10006346 | 3300025937 | Bacteria | 5395 |
| 361 | Ga0207704_10005939 | 3300025938 | Bacteria | 5658 |
| 362 | Ga0207704_10093701 | 3300025938 | Bacteria | 1981 |
| 363 | Ga0207665_10006415 | 3300025939 | Bacteria | 7804 |
| 364 | Ga0207665_10012936 | 3300025939 | Bacteria | 5489 |
| 365 | Ga0207665_10015671 | 3300025939 | Bacteria | 4975 |
| 366 | Ga0207665_10062620 | 3300025939 | Bacteria | 2525 |
| 367 | Ga0207711_10000339 | 3300025941 | Bacteria | 49741 |
| 368 | Ga0207711_10021885 | 3300025941 | Bacteria | 5341 |
| 369 | Ga0207711_10049582 | 3300025941 | Bacteria | 3594 |
| 370 | Ga0207711_10063300 | 3300025941 | Bacteria | 3193 |
| 371 | Ga0207711_10213700 | 3300025941 | Bacteria | 1762 |
| 372 | Ga0207689_10012468 | 3300025942 | Bacteria | 7262 |
| 373 | Ga0207689_10033145 | 3300025942 | Bacteria | 4292 |
| 374 | Ga0207661_10491307 | 3300025944 | Bacteria | 1121 |
| 375 | Ga0207661_10586827 | 3300025944 | Bacteria | 1022 |
| 376 | Ga0207667_10401802 | 3300025949 | Bacteria | 1395 |
| 377 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 378 | Ga0207712_10009714 | 3300025961 | Bacteria | 6098 |
| 379 | Ga0207712_10334766 | 3300025961 | Bacteria | 1253 |
| 380 | Ga0207668_10000526 | 3300025972 | Bacteria | 24008 |
| 381 | Ga0207668_10001279 | 3300025972 | Bacteria | 14992 |
| 382 | Ga0207668_10009108 | 3300025972 | Bacteria | 5934 |
| 383 | Ga0207640_10010313 | 3300025981 | Bacteria | 5259 |
| 384 | Ga0207640_10011395 | 3300025981 | Bacteria | 5034 |
| 385 | Ga0207658_10000175 | 3300025986 | Bacteria | 69284 |
| 386 | Ga0207658_10011032 | 3300025986 | Bacteria | 6151 |
| 387 | Ga0207658_10018649 | 3300025986 | Bacteria | 4796 |
| 388 | Ga0207658_10038923 | 3300025986 | Bacteria | 3429 |
| 389 | Ga0207658_10085989 | 3300025986 | Bacteria | 2423 |
| 390 | Ga0207677_10005669 | 3300026023 | Bacteria | 6792 |
| 391 | Ga0207677_10135233 | 3300026023 | Bacteria | 1878 |
| 392 | Ga0207677_10148186 | 3300026023 | Bacteria | 1806 |
| 393 | Ga0207703_10009089 | 3300026035 | Bacteria | 7823 |
| 394 | Ga0207703_10075278 | 3300026035 | Bacteria | 2797 |
| 395 | Ga0207703_10131800 | 3300026035 | Bacteria | 2159 |
| 396 | Ga0207703_10461819 | 3300026035 | Bacteria | 1187 |
| 397 | Ga0207703_10513535 | 3300026035 | Bacteria | 1126 |
| 398 | Ga0207639_10165138 | 3300026041 | Bacteria | 1869 |
| 399 | Ga0207639_10335125 | 3300026041 | Bacteria | 1347 |
| 400 | Ga0207639_10568979 | 3300026041 | Bacteria | 1042 |
| 401 | Ga0207678_10005752 | 3300026067 | Bacteria | 11060 |
| 402 | Ga0207678_10016047 | 3300026067 | Bacteria | 6578 |
| 403 | Ga0207678_10018037 | 3300026067 | Bacteria | 6201 |
| 404 | Ga0207678_10034154 | 3300026067 | Bacteria | 4430 |
| 405 | Ga0207678_10129877 | 3300026067 | Bacteria | 2149 |
| 406 | Ga0207678_10164706 | 3300026067 | Bacteria | 1893 |
| 407 | Ga0207708_10001762 | 3300026075 | Bacteria | 15990 |
| 408 | Ga0207708_10009825 | 3300026075 | Bacteria | 7100 |
| 409 | Ga0207708_10024354 | 3300026075 | Bacteria | 4578 |
| 410 | Ga0207708_10073915 | 3300026075 | Bacteria | 2613 |
| 411 | Ga0207702_10398547 | 3300026078 | Bacteria | 1327 |
| 412 | Ga0207641_10001173 | 3300026088 | Bacteria | 26309 |
| 413 | Ga0207641_10003476 | 3300026088 | Bacteria | 13956 |
| 414 | Ga0207648_10002525 | 3300026089 | Bacteria | 19642 |
| 415 | Ga0207648_10010554 | 3300026089 | Bacteria | 8742 |
| 416 | Ga0207648_10103195 | 3300026089 | Bacteria | 2500 |
| 417 | Ga0207648_10112699 | 3300026089 | Bacteria | 2388 |
| 418 | Ga0207676_10064592 | 3300026095 | Bacteria | 2912 |
| 419 | Ga0207676_10218230 | 3300026095 | Bacteria | 1697 |
| 420 | Ga0207675_100000896 | 3300026118 | Bacteria | 29755 |
| 421 | Ga0207675_100012618 | 3300026118 | Bacteria | 7894 |
| 422 | Ga0207675_100047816 | 3300026118 | Bacteria | 3993 |
| 423 | Ga0207683_10005892 | 3300026121 | Bacteria | 10507 |
| 424 | Ga0207683_10011339 | 3300026121 | Bacteria | 7605 |
| 425 | Ga0207683_10156785 | 3300026121 | Bacteria | 2057 |
| 426 | Ga0207698_10039194 | 3300026142 | Bacteria | 3508 |
| 427 | Ga0207698_10511760 | 3300026142 | Bacteria | 1170 |
| 428 | Ga0209813_10006814 | 3300027866 | Bacteria | 2831 |
| 429 | Ga0268266_10013715 | 3300028379 | Bacteria | 6979 |
| 430 | Ga0268266_10030900 | 3300028379 | Bacteria | 4548 |
| 431 | Ga0268266_10050887 | 3300028379 | Bacteria | 3555 |
| 432 | Ga0268266_10140353 | 3300028379 | Bacteria | 2168 |
| 433 | Ga0268266_10190455 | 3300028379 | Bacteria | 1872 |
| 434 | Ga0268265_10000014 | 3300028380 | Bacteria | 330186 |
| 435 | Ga0268265_10015013 | 3300028380 | Bacteria | 5289 |
| 436 | Ga0268265_10032394 | 3300028380 | Bacteria | 3787 |
| 437 | Ga0268265_10426619 | 3300028380 | Bacteria | 1232 |
| 438 | Ga0268264_10000150 | 3300028381 | Bacteria | 158263 |
| 439 | Ga0268264_10032743 | 3300028381 | Bacteria | 4265 |
| 440 | Ga0268264_10060598 | 3300028381 | Bacteria | 3172 |
| 441 | Ga0265327_10000018 | 3300031251 | Bacteria | 439197 |
| 442 | Ga0265327_10001055 | 3300031251 | Bacteria | 38529 |
| 443 | Ga0265327_10003531 | 3300031251 | Bacteria | 14813 |
| 444 | Ga0265327_10012159 | 3300031251 | Bacteria | 5840 |
| 445 | Ga0316579_10074046 | 3300031691 | Bacteria | 1617 |
| 446 | Ga0307405_10137382 | 3300031731 | Bacteria | 1699 |
| 447 | Ga0307413_10244730 | 3300031824 | Bacteria | 1327 |
| 448 | Ga0307413_10313428 | 3300031824 | Bacteria | 1195 |
| 449 | Ga0307410_10243739 | 3300031852 | Bacteria | 1394 |
| 450 | Ga0307409_100065472 | 3300031995 | Bacteria | 2860 |
| 451 | Ga0307416_100235983 | 3300032002 | Bacteria | 1768 |
| 452 | Ga0307416_100244308 | 3300032002 | Bacteria | 1742 |
| 453 | Ga0307415_100063623 | 3300032126 | Bacteria | 2564 |
| 454 | Ga0307415_100205265 | 3300032126 | Bacteria | 1567 |
| 455 | Ga0373961_0033577 | 3300035241 | Bacteria | 1446 |
| 456 | Ga0373931_0060774 | 3300035691 | Bacteria | 2035 |
| 457 | Ga0436364_0090210 | 3300037853 | Bacteria | 3782 |
| 458 | Ga0436364_0106048 | 3300037853 | Bacteria | 16222 |
| 459 | Ga0436364_0322663 | 3300037853 | Bacteria | 14033 |
| 460 | Ga0436364_1009898 | 3300037853 | Bacteria | 3993 |
| 461 | Ga0436364_1253766 | 3300037853 | Bacteria | 5106 |
| 462 | Ga0436365_0291752 | 3300039437 | Bacteria | 1626 |
| 463 | Ga0436365_0470752 | 3300039437 | Bacteria | 2356 |
| 464 | Ga0436365_0607060 | 3300039437 | Bacteria | 4780 |
| 465 | Ga0436365_0608503 | 3300039437 | Bacteria | 10612 |
| 466 | Ga0436365_0953566 | 3300039437 | Bacteria | 43397 |
| 467 | Ga0436365_1064965 | 3300039437 | Bacteria | 9165 |
| 468 | Ga0436365_1630628 | 3300039437 | Bacteria | 72743 |
| 469 | Ga0436365_1666956 | 3300039437 | Bacteria | 4991 |
| 470 | Ga0436363_1156190 | 3300039450 | Bacteria | 5094 |
| 471 | Ga0439461_0008453 | 3300041410 | Bacteria | 1845 |
| 472 | Ga0439466_0013017 | 3300041411 | Bacteria | 3051 |
| 473 | Ga0439466_0021832 | 3300041411 | Bacteria | 2264 |
| 474 | Ga0439465_0022215 | 3300041413 | Bacteria | 1992 |
| 475 | Ga0439465_0024775 | 3300041413 | Bacteria | 1891 |
| 476 | Ga0451789_0831621 | 3300041443 | Bacteria | 1808 |
| 477 | Ga0451793_0382371 | 3300041452 | Bacteria | 1560 |
| 478 | Ga0451795_0376464 | 3300041456 | Bacteria | 1180 |
| 479 | Ga0451841_0730527 | 3300041498 | Bacteria | 1270 |
| 480 | Ga0451853_0088204 | 3300041512 | Bacteria | 4713 |
| 481 | Ga0439431_0010521 | 3300041997 | Bacteria | 2100 |
| 482 | Ga0439431_0012523 | 3300041997 | Bacteria | 1950 |
| 483 | Ga0439442_020937 | 3300042002 | Bacteria | 1356 |
| 484 | Ga0439445_0007753 | 3300042004 | Bacteria | 2499 |
| 485 | Ga0439434_0007518 | 3300042435 | Bacteria | 3193 |
| 486 | Ga0439434_0015541 | 3300042435 | Bacteria | 2271 |
| 487 | Ga0466972_0005077 | 3300044658 | Bacteria | 6595 |
| 488 | Ga0466972_0011027 | 3300044658 | Bacteria | 4537 |
| 489 | Ga0466972_0020820 | 3300044658 | Bacteria | 3275 |
| 490 | Ga0466972_0080398 | 3300044658 | Bacteria | 1552 |
| 491 | Ga0466965_0003274 | 3300044683 | Bacteria | 7085 |
| 492 | Ga0466965_0005127 | 3300044683 | Bacteria | 5882 |
| 493 | Ga0466965_0032979 | 3300044683 | Bacteria | 2530 |
| 494 | Ga0466965_0048201 | 3300044683 | Bacteria | 2110 |
| 495 | Ga0466966_0014746 | 3300044684 | Bacteria | 5170 |
| 496 | Ga0466966_0017854 | 3300044684 | Bacteria | 4685 |
| 497 | Ga0466966_0019992 | 3300044684 | Bacteria | 4405 |
| 498 | Ga0466966_0030900 | 3300044684 | Bacteria | 3474 |
| 499 | Ga0466961_0024272 | 3300044693 | Bacteria | 3900 |
| 500 | Ga0466961_0086798 | 3300044693 | Bacteria | 1977 |
| 501 | Ga0466963_0057402 | 3300044694 | Bacteria | 2592 |
| 502 | Ga0466963_0064655 | 3300044694 | Bacteria | 2451 |
| 503 | Ga0466971_0009094 | 3300044719 | Bacteria | 4342 |
| 504 | Ga0466971_0026994 | 3300044719 | Bacteria | 2570 |
| 505 | Ga0466968_0001802 | 3300044735 | Bacteria | 7736 |
| 506 | Ga0466968_0018354 | 3300044735 | Bacteria | 2805 |
| 507 | Ga0466968_0021692 | 3300044735 | Bacteria | 2603 |
| 508 | Ga0466970_0029750 | 3300044765 | Bacteria | 2878 |
| 509 | Ga0466957_0010746 | 3300044842 | Bacteria | 5263 |
| 510 | Ga0466957_0016389 | 3300044842 | Bacteria | 4335 |
| 511 | Ga0466957_0025854 | 3300044842 | Bacteria | 3480 |
| 512 | Ga0466957_0038884 | 3300044842 | Bacteria | 2869 |
| 513 | Ga0466957_0043901 | 3300044842 | Bacteria | 2708 |
| 514 | Ga0466957_0301806 | 3300044842 | Bacteria | 1076 |
| 515 | Ga0466960_0000265 | 3300044901 | Bacteria | 18060 |
| 516 | Ga0466960_0006050 | 3300044901 | Bacteria | 4834 |
| 517 | Ga0466960_0025835 | 3300044901 | Bacteria | 2661 |
| 518 | Ga0466960_0074763 | 3300044901 | Bacteria | 1694 |
| 519 | Ga0466960_0120531 | 3300044901 | Bacteria | 1373 |
| 520 | Ga0466959_0009064 | 3300045049 | Bacteria | 7061 |
| 521 | Ga0466959_0014716 | 3300045049 | Bacteria | 5694 |
| 522 | Ga0466959_0017458 | 3300045049 | Bacteria | 5261 |
| 523 | Ga0466959_0102514 | 3300045049 | Bacteria | 2048 |
| 524 | Ga0466959_0106400 | 3300045049 | Bacteria | 2005 |
| 525 | Ga0466958_0000197 | 3300045836 | Bacteria | 22237 |
| 526 | Ga0466958_0010043 | 3300045836 | Bacteria | 5290 |
| 527 | Ga0466958_0012112 | 3300045836 | Bacteria | 4876 |
| 528 | Ga0466958_0174793 | 3300045836 | Bacteria | 1361 |
| 529 | Ga0466958_0219982 | 3300045836 | Bacteria | 1211 |
| 530 | Ga0466967_0005234 | 3300045976 | Bacteria | 8940 |
| 531 | Ga0466967_0023084 | 3300045976 | Bacteria | 5092 |
| 532 | Ga0466967_0029924 | 3300045976 | Bacteria | 4564 |
| 533 | Ga0466967_0032663 | 3300045976 | Bacteria | 4397 |
| 534 | Ga0466967_0078788 | 3300045976 | Bacteria | 2969 |
| 535 | Ga0466967_0084546 | 3300045976 | Bacteria | 2871 |
| 536 | Ga0466967_0159071 | 3300045976 | Bacteria | 2119 |
| 537 | Ga0466967_0259794 | 3300045976 | Bacteria | 1661 |
| 538 | Ga0466967_0905345 | 3300045976 | Bacteria | 877 |
| 539 | Ga0495603_0045129 | 3300046455 | Bacteria | 2629 |
| 540 | Ga0495590_0120021 | 3300046457 | Bacteria | 942 |
| 541 | Ga0495629_0030982 | 3300046459 | Bacteria | 3789 |
| 542 | Ga0495638_0001570 | 3300046460 | Bacteria | 20486 |
| 543 | Ga0495638_0119431 | 3300046460 | Bacteria | 1559 |
| 544 | Ga0495580_0091923 | 3300046472 | Bacteria | 2112 |
| 545 | Ga0495662_0034109 | 3300046476 | Bacteria | 2458 |
| 546 | Ga0495608_0102372 | 3300046511 | Bacteria | 1846 |
| 547 | Ga0495648_0004296 | 3300046524 | Bacteria | 12210 |
| 548 | Ga0495668_0001186 | 3300046616 | Bacteria | 26476 |
| 549 | Ga0495668_0001258 | 3300046616 | Bacteria | 25252 |
| 550 | Ga0495588_0044711 | 3300046674 | Bacteria | 2269 |
| 551 | Ga0495671_0119363 | 3300046692 | Bacteria | 1287 |
| 552 | Ga0495649_0146175 | 3300046694 | Bacteria | 1243 |
| 553 | Ga0495581_0122321 | 3300047315 | Bacteria | 1515 |
| 554 | Ga0495581_0144352 | 3300047315 | Bacteria | 1389 |
| 555 | Ga0495674_0253921 | 3300047319 | Bacteria | 1446 |
| 556 | Ga0495672_0010022 | 3300047320 | Bacteria | 6793 |
| 557 | Ga0495672_0147042 | 3300047320 | Bacteria | 1225 |
| 558 | Ga0495683_0002024 | 3300047323 | Bacteria | 12559 |
| 559 | Ga0495673_0002913 | 3300047469 | Bacteria | 11603 |
| 560 | Ga0495686_0012826 | 3300047472 | Bacteria | 5847 |
| 561 | Ga0495626_0040203 | 3300048091 | Bacteria | 2210 |
| 562 | Ga0496100_0001415 | 3300048903 | Bacteria | 11731 |
| 563 | Ga0496100_0001824 | 3300048903 | Bacteria | 10643 |
| 564 | Ga0496100_0003985 | 3300048903 | Bacteria | 7760 |
| 565 | Ga0496100_0004691 | 3300048903 | Bacteria | 7284 |
| 566 | Ga0496100_0009259 | 3300048903 | Bacteria | 5530 |
| 567 | Ga0496100_0051433 | 3300048903 | Bacteria | 2675 |
| 568 | Ga0496100_0129812 | 3300048903 | Bacteria | 1774 |
| 569 | Ga0496100_0193463 | 3300048903 | Bacteria | 1478 |
| 570 | Ga0496101_0000229 | 3300048904 | Bacteria | 41526 |
| 571 | Ga0496101_0000963 | 3300048904 | Bacteria | 16982 |
| 572 | Ga0496101_0002114 | 3300048904 | Bacteria | 12114 |
| 573 | Ga0496101_0006448 | 3300048904 | Bacteria | 7549 |
| 574 | Ga0496101_0007097 | 3300048904 | Bacteria | 7243 |
| 575 | Ga0496101_0008554 | 3300048904 | Bacteria | 6690 |
| 576 | Ga0496101_0033334 | 3300048904 | Bacteria | 3632 |
| 577 | Ga0496101_0063664 | 3300048904 | Bacteria | 2685 |
| 578 | Ga0496101_0076800 | 3300048904 | Bacteria | 2461 |
| 579 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 580 | Ga0496102_0000235 | 3300048905 | Bacteria | 72616 |
| 581 | Ga0496102_0002862 | 3300048905 | Bacteria | 14654 |
| 582 | Ga0496102_0011113 | 3300048905 | Bacteria | 7755 |
| 583 | Ga0496102_0017361 | 3300048905 | Bacteria | 6304 |
| 584 | Ga0496102_0024467 | 3300048905 | Bacteria | 5368 |
| 585 | Ga0496102_0058555 | 3300048905 | Bacteria | 3520 |
| 586 | Ga0496102_0081864 | 3300048905 | Bacteria | 2977 |
| 587 | Ga0496102_0144463 | 3300048905 | Bacteria | 2232 |
| 588 | Ga0496102_0182791 | 3300048905 | Bacteria | 1975 |
| 589 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 590 | Ga0496103_0000443 | 3300048906 | Bacteria | 35626 |
| 591 | Ga0496103_0001156 | 3300048906 | Bacteria | 18210 |
| 592 | Ga0496103_0003079 | 3300048906 | Bacteria | 10250 |
| 593 | Ga0496103_0004904 | 3300048906 | Bacteria | 8079 |
| 594 | Ga0496103_0064551 | 3300048906 | Bacteria | 2282 |
| 595 | Ga0496103_0272210 | 3300048906 | Bacteria | 1089 |
| 596 | Ga0496104_0060473 | 3300048907 | Bacteria | 3589 |
| 597 | Ga0496104_0374138 | 3300048907 | Bacteria | 1337 |
| 598 | Ga0496105_0010203 | 3300048908 | Bacteria | 7382 |
| 599 | Ga0496105_0126134 | 3300048908 | Bacteria | 2110 |
| 600 | Ga0496105_0170006 | 3300048908 | Bacteria | 1787 |
| 601 | Ga0496106_0001616 | 3300048909 | Bacteria | 16934 |
| 602 | Ga0496106_0001655 | 3300048909 | Bacteria | 16718 |
| 603 | Ga0496106_0006301 | 3300048909 | Bacteria | 8784 |
| 604 | Ga0496106_0014740 | 3300048909 | Bacteria | 5779 |
| 605 | Ga0496106_0020218 | 3300048909 | Bacteria | 4939 |
| 606 | Ga0496106_0028370 | 3300048909 | Bacteria | 4169 |
| 607 | Ga0496106_0029602 | 3300048909 | Bacteria | 4082 |
| 608 | Ga0496106_0045427 | 3300048909 | Bacteria | 3299 |
| 609 | Ga0496106_0260290 | 3300048909 | Bacteria | 1388 |
| 610 | Ga0496107_0007986 | 3300048910 | Bacteria | 7304 |
| 611 | Ga0496107_0075485 | 3300048910 | Bacteria | 2454 |
| 612 | Ga0496107_0077249 | 3300048910 | Bacteria | 2425 |
| 613 | Ga0496107_0087704 | 3300048910 | Bacteria | 2271 |
| 614 | Ga0496107_0254941 | 3300048910 | Bacteria | 1305 |
| 615 | Ga0496108_0000222 | 3300048911 | Bacteria | 50962 |
| 616 | Ga0496108_0002078 | 3300048911 | Bacteria | 16016 |
| 617 | Ga0496108_0018950 | 3300048911 | Bacteria | 5643 |
| 618 | Ga0496108_0023890 | 3300048911 | Bacteria | 5032 |
| 619 | Ga0496108_0046469 | 3300048911 | Bacteria | 3627 |
| 620 | Ga0496108_0228848 | 3300048911 | Bacteria | 1616 |
| 621 | Ga0496108_0249161 | 3300048911 | Bacteria | 1545 |
| 622 | Ga0496109_0003500 | 3300048912 | Bacteria | 13117 |
| 623 | Ga0496109_0004447 | 3300048912 | Bacteria | 11707 |
| 624 | Ga0496109_0011117 | 3300048912 | Bacteria | 7720 |
| 625 | Ga0496109_0025692 | 3300048912 | Bacteria | 5249 |
| 626 | Ga0496109_0032560 | 3300048912 | Bacteria | 4686 |
| 627 | Ga0496109_0061059 | 3300048912 | Bacteria | 3445 |
| 628 | Ga0496110_0016452 | 3300048913 | Bacteria | 6176 |
| 629 | Ga0496110_0018791 | 3300048913 | Bacteria | 5803 |
| 630 | Ga0496110_0051859 | 3300048913 | Bacteria | 3605 |
| 631 | Ga0496110_0061402 | 3300048913 | Bacteria | 3317 |
| 632 | Ga0496110_0074895 | 3300048913 | Bacteria | 3007 |
| 633 | Ga0496111_0043312 | 3300048914 | Bacteria | 3235 |
| 634 | Ga0496112_0032517 | 3300048915 | Bacteria | 5066 |
| 635 | Ga0496112_0056866 | 3300048915 | Bacteria | 3851 |
| 636 | Ga0496112_0067467 | 3300048915 | Bacteria | 3531 |
| 637 | Ga0496112_0078541 | 3300048915 | Bacteria | 3264 |
| 638 | Ga0496112_0110099 | 3300048915 | Bacteria | 2724 |
| 639 | Ga0496112_0230986 | 3300048915 | Bacteria | 1804 |
| 640 | Ga0496112_0247951 | 3300048915 | Bacteria | 1733 |
| 641 | Ga0496112_0515079 | 3300048915 | Bacteria | 1131 |
| 642 | Ga0496113_0003042 | 3300048916 | Bacteria | 9934 |
| 643 | Ga0496113_0006617 | 3300048916 | Bacteria | 7370 |
| 644 | Ga0496114_0000153 | 3300048917 | Bacteria | 50028 |
| 645 | Ga0496114_0023001 | 3300048917 | Bacteria | 5080 |
| 646 | Ga0496114_0024447 | 3300048917 | Bacteria | 4932 |
| 647 | Ga0496114_0590628 | 3300048917 | Bacteria | 980 |
| 648 | Ga0496115_0006985 | 3300048918 | Bacteria | 8292 |
| 649 | Ga0496115_0007857 | 3300048918 | Bacteria | 7866 |
| 650 | Ga0496115_0016046 | 3300048918 | Bacteria | 5695 |
| 651 | Ga0496115_0145736 | 3300048918 | Bacteria | 1954 |
| 652 | Ga0496115_0481158 | 3300048918 | Bacteria | 1000 |
| 653 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 654 | Ga0496116_0005302 | 3300048919 | Bacteria | 12019 |
| 655 | Ga0496116_0008758 | 3300048919 | Bacteria | 8727 |
| 656 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 657 | Ga0496117_0000521 | 3300048920 | Bacteria | 63484 |
| 658 | Ga0496117_0013197 | 3300048920 | Bacteria | 7222 |
| 659 | Ga0496117_0102360 | 3300048920 | Bacteria | 1808 |
| 660 | Ga0496117_0155606 | 3300048920 | Bacteria | 1346 |
| 661 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 662 | Ga0496118_0000455 | 3300048921 | Bacteria | 67720 |
| 663 | Ga0496118_0000730 | 3300048921 | Bacteria | 53095 |
| 664 | Ga0496118_0022416 | 3300048921 | Bacteria | 5520 |
| 665 | Ga0496119_0000035 | 3300048922 | Bacteria | 217007 |
| 666 | Ga0496119_0009787 | 3300048922 | Bacteria | 8155 |
| 667 | Ga0496120_0000079 | 3300048923 | Bacteria | 160413 |
| 668 | Ga0496120_0009649 | 3300048923 | Bacteria | 6816 |
| 669 | Ga0496120_0019833 | 3300048923 | Bacteria | 4288 |
| 670 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 671 | Ga0496121_0000090 | 3300048924 | Bacteria | 217920 |
| 672 | Ga0496121_0175861 | 3300048924 | Bacteria | 1550 |
| 673 | Ga0496122_0000805 | 3300048925 | Bacteria | 60172 |
| 674 | Ga0496122_0003041 | 3300048925 | Bacteria | 22684 |
| 675 | Ga0496123_0004493 | 3300048926 | Bacteria | 14614 |
| 676 | Ga0496123_0012202 | 3300048926 | Bacteria | 7352 |
| 677 | Ga0496123_0029986 | 3300048926 | Bacteria | 3991 |
| 678 | Ga0496124_0000221 | 3300048927 | Bacteria | 110879 |
| 679 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 680 | Ga0496125_0030577 | 3300048928 | Bacteria | 4814 |
| 681 | Ga0496125_0105437 | 3300048928 | Bacteria | 2060 |
| 682 | Ga0496125_0119559 | 3300048928 | Bacteria | 1884 |
| 683 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 684 | Ga0496126_0004049 | 3300048929 | Bacteria | 17825 |
| 685 | Ga0496126_0018195 | 3300048929 | Bacteria | 6972 |
| 686 | Ga0496126_0026431 | 3300048929 | Bacteria | 5566 |
| 687 | Ga0496126_0045421 | 3300048929 | Bacteria | 4037 |
| 688 | Ga0501032_0014425 | 3300049569 | Bacteria | 5597 |
| 689 | Ga0501032_0093439 | 3300049569 | Bacteria | 1994 |
| 690 | Ga0501033_0331741 | 3300049570 | Bacteria | 1067 |
| 691 | Ga0501034_0028270 | 3300049571 | Bacteria | 5705 |
| 692 | Ga0501034_0035636 | 3300049571 | Bacteria | 5044 |
| 693 | Ga0501034_0204194 | 3300049571 | Bacteria | 1933 |
| 694 | Ga0501036_0001863 | 3300049572 | Bacteria | 16348 |
| 695 | Ga0501036_0056555 | 3300049572 | Bacteria | 3324 |
| 696 | Ga0501036_0076419 | 3300049572 | Bacteria | 2833 |
| 697 | Ga0501037_0047879 | 3300049573 | Bacteria | 3132 |
| 698 | Ga0501037_0057369 | 3300049573 | Bacteria | 2843 |
| 699 | Ga0501039_0000771 | 3300049575 | Bacteria | 23004 |
| 700 | Ga0501043_0000790 | 3300049579 | Bacteria | 28168 |
| 701 | Ga0501046_0000382 | 3300049580 | Bacteria | 44315 |
| 702 | Ga0501047_0002654 | 3300049581 | Bacteria | 17016 |
| 703 | Ga0501047_0017356 | 3300049581 | Bacteria | 6893 |
| 704 | Ga0501048_0040031 | 3300049582 | Bacteria | 3359 |
| 705 | Ga0501067_0049893 | 3300049583 | Bacteria | 2319 |
| 706 | Ga0501069_0026674 | 3300049585 | Bacteria | 3164 |
| 707 | Ga0501069_0098520 | 3300049585 | Bacteria | 1658 |
| 708 | Ga0501070_0001555 | 3300049586 | Bacteria | 20409 |
| 709 | Ga0501070_0008775 | 3300049586 | Bacteria | 8547 |
| 710 | Ga0501073_0144706 | 3300049589 | Bacteria | 1647 |
| 711 | Ga0501077_0063642 | 3300049593 | Bacteria | 2340 |
| 712 | Ga0501080_0134766 | 3300049742 | Bacteria | 2286 |
| 713 | Ga0501080_0155187 | 3300049742 | Bacteria | 2115 |
| 714 | Ga0501035_0007912 | 3300049822 | Bacteria | 9926 |
| 715 | Ga0501035_0011908 | 3300049822 | Bacteria | 8049 |
| 716 | Ga0501044_0001394 | 3300049823 | Bacteria | 28323 |
| 717 | Ga0501044_0002938 | 3300049823 | Bacteria | 19390 |
| 718 | Ga0501044_0018624 | 3300049823 | Bacteria | 7438 |
| 719 | nmdc:mga03683_58615_c1 | 3300050489 | Bacteria | 1623 |
| 720 | nmdc:mga03n38_10214_c1 | 3300050490 | Bacteria | 3445 |
| 721 | nmdc:mga03n38_11440_c1 | 3300050490 | Bacteria | 3307 |
| 722 | nmdc:mga03n38_17821_c1 | 3300050490 | Bacteria | 2789 |
| 723 | nmdc:mga03n38_184540_c1 | 3300050490 | Bacteria | 1071 |
| 724 | nmdc:mga03n38_23413_c1 | 3300050490 | Bacteria | 2512 |
| 725 | nmdc:mga03n38_34752_c1 | 3300050490 | Bacteria | 2155 |
| 726 | nmdc:mga03n38_52956_c1 | 3300050490 | Bacteria | 1818 |
| 727 | nmdc:mga03n38_8139_c1 | 3300050490 | Bacteria | 3747 |
| 728 | nmdc:mga03n38_98603_c1 | 3300050490 | Bacteria | 1406 |
| 729 | nmdc:mga00v17_114846_c1 | 3300050491 | Bacteria | 1710 |
| 730 | nmdc:mga00v17_1611_c1 | 3300050491 | Bacteria | 11784 |
| 731 | nmdc:mga00v17_244358_c1 | 3300050491 | Bacteria | 1164 |
| 732 | nmdc:mga00v17_29712_c1 | 3300050491 | Bacteria | 3209 |
| 733 | nmdc:mga00v17_41855_c1 | 3300050491 | Bacteria | 2753 |
| 734 | nmdc:mga00v17_7882_c1 | 3300050491 | Bacteria | 5713 |
| 735 | nmdc:mga00v17_8457_c1 | 3300050491 | Bacteria | 5539 |
| 736 | nmdc:mga00v17_95658_c1 | 3300050491 | Bacteria | 1870 |
| 737 | nmdc:mga0yw44_14399_c1 | 3300050492 | Bacteria | 4200 |
| 738 | nmdc:mga0yw44_14561_c1 | 3300050492 | Bacteria | 4180 |
| 739 | nmdc:mga0yw44_224404_c1 | 3300050492 | Bacteria | 1246 |
| 740 | nmdc:mga0yw44_224955_c1 | 3300050492 | Bacteria | 1244 |
| 741 | nmdc:mga0yw44_6885_c1 | 3300050492 | Bacteria | 5537 |
| 742 | nmdc:mga06z11_25107_c1 | 3300050494 | Bacteria | 2820 |
| 743 | nmdc:mga06z11_270266_c1 | 3300050494 | Bacteria | 1005 |
| 744 | nmdc:mga04h51_1888_c1 | 3300050495 | Bacteria | 3567 |
| 745 | nmdc:mga07m45_127291_c1 | 3300050496 | Bacteria | 1473 |
| 746 | nmdc:mga07m45_182642_c1 | 3300050496 | Bacteria | 1220 |
| 747 | nmdc:mga07m45_18917_c1 | 3300050496 | Bacteria | 3726 |
| 748 | nmdc:mga07m45_47330_c1 | 3300050496 | Bacteria | 2418 |
| 749 | nmdc:mga07m45_47429_c2 | 3300050496 | Bacteria | 1673 |
| 750 | nmdc:mga07m45_81459_c1 | 3300050496 | Bacteria | 1848 |
| 751 | nmdc:mga07m45_94690_c1 | 3300050496 | Bacteria | 1359 |
| 752 | nmdc:mga05p37_35429_c1 | 3300050507 | Bacteria | 6119 |
| 753 | nmdc:mga0qj67_28952_c1 | 3300050509 | Bacteria | 4300 |
| 754 | nmdc:mga08y16_44941_c1 | 3300050511 | Bacteria | 4628 |
| 755 | nmdc:mga0sz30_17701_c1 | 3300050516 | Bacteria | 2844 |
| 756 | nmdc:mga0sz30_20679_c1 | 3300050516 | Bacteria | 2656 |
| 757 | nmdc:mga0sz30_48571_c1 | 3300050516 | Bacteria | 1795 |
| 758 | nmdc:mga0sz30_654_c2 | 3300050516 | Bacteria | 10386 |
| 759 | nmdc:mga0sz30_716_c1 | 3300050516 | Bacteria | 12200 |
| 760 | nmdc:mga0sz30_8193_c1 | 3300050516 | Bacteria | 3939 |
| 761 | Ga0500610_0001004 | 3300053079 | Bacteria | 9213 |
| 762 | Ga0500635_0009648 | 3300053080 | Bacteria | 2685 |
| 763 | Ga0500643_001666 | 3300053087 | Bacteria | 12380 |
| 764 | Ga0500646_0069051 | 3300053090 | Bacteria | 1056 |
| 765 | Ga0500641_0063303 | 3300053096 | Bacteria | 1544 |
| 766 | Ga0500641_0104360 | 3300053096 | Bacteria | 1217 |
| 767 | Ga0500642_0005874 | 3300053130 | Bacteria | 4000 |
| 768 | Ga0500652_000149 | 3300053131 | Bacteria | 26512 |
| 769 | Ga0500559_0033419 | 3300053136 | Bacteria | 2214 |
| 770 | Ga0500616_0003317 | 3300053153 | Bacteria | 12408 |
| 771 | Ga0500616_0067983 | 3300053153 | Bacteria | 1825 |
| 772 | Ga0500627_0001152 | 3300053158 | Bacteria | 7250 |
| 773 | Ga0500633_0066770 | 3300053160 | Bacteria | 1277 |
| 774 | Ga0500645_000412 | 3300053730 | Bacteria | 29924 |
| 775 | Ga0500645_019094 | 3300053730 | Bacteria | 2135 |
| 776 | Ga0466962_0009524 | 3300061719 | Bacteria | 4658 |
| 777 | Ga0466962_0013269 | 3300061719 | Bacteria | 3962 |
| 778 | 2523385106 | 2523231044 | Bacteria | 6434991 |
| 779 | 2548699028 | 2547132424 | Bacteria | 8348532 |
| 780 | 2548699266 | 2547132424 | Bacteria | 8348532 |
| 781 | 2552110701 | 2551306166 | Bacteria | 9731570 |
| 782 | 2566991590 | 2565956761 | Bacteria | 6601618 |
| 783 | 2566992135 | 2565956761 | Bacteria | 6601618 |
| 784 | 2644490599 | 2643221687 | Bacteria | 6500351 |
| 785 | 2644513928 | 2643221692 | Bacteria | 7282860 |
| 786 | 2644637000 | 2643221715 | Bacteria | 6671032 |
| 787 | 2738668319 | 2738541264 | Bacteria | 5935393 |
| 788 | 2738707027 | 2738541274 | Bacteria | 6909446 |
| 789 | 2738888006 | 2738541308 | Bacteria | 7020677 |
| 790 | 2738888324 | 2738541308 | Bacteria | 7020677 |
| 791 | 2739147389 | 2738541356 | Bacteria | 5935017 |
| 792 | 2739204184 | 2738543005 | Bacteria | 5278128 |
| 793 | 2739238173 | 2738543011 | Bacteria | 5731169 |
| 794 | 2739333731 | 2738543028 | Bacteria | 6917070 |
| 795 | 2739364818 | 2738543034 | Bacteria | 6084756 |
| 796 | 2744957276 | 2744054611 | Bacteria | 5611514 |
| 797 | 2753037780 | 2751185725 | Bacteria | 5740550 |
| 798 | 2753325648 | 2751185792 | Bacteria | 5739090 |
| 799 | 2842139231 | 2842134933 | Bacteria | 5847019 |
| 800 | 2842891154 | 2842888712 | Bacteria | 4279094 |
| 801 | 2889303295 | 2889300758 | Bacteria | 5690814 |
| 802 | 2902798637 | 2902792274 | Bacteria | 7270173 |
| 803 | 2902800514 | 2902799365 | Bacteria | 5419524 |
| 804 | 2902814847 | 2902810491 | Bacteria | 6794147 |
| 805 | 2902843243 | 2902837492 | Bacteria | 6697721 |
| 806 | 2904538043 | 2904535858 | Bacteria | 6308016 |
| 807 | 2904541112 | 2904535858 | Bacteria | 6308016 |
| 808 | 2904766540 | 2904765812 | Bacteria | 5369154 |
| 809 | 2904772708 | 2904770941 | Bacteria | 5580202 |
| 810 | 2908811499 | 2908811453 | Bacteria | 5478616 |
| 811 | 2919421024 | 2919420072 | Bacteria | 5390363 |
| 812 | 2919433218 | 2919432681 | Bacteria | 5390474 |
| 813 | 2919716985 | 2919713450 | Bacteria | 7431245 |
| 814 | 2922557227 | 2922554459 | Bacteria | 6683962 |
| 815 | 2922560755 | 2922554459 | Bacteria | 6683962 |
| 816 | 2928145071 | 2928142448 | Bacteria | 5288925 |
| 817 | 2929217502 | 2929212328 | Bacteria | 7708288 |
| 818 | 2932400448 | 2932398195 | Bacteria | 3847976 |
| 819 | 2939584760 | 2939582691 | Bacteria | 7088898 |
| 820 | 2939745816 | 2939743619 | Bacteria | 5762299 |
| 821 | 2974318529 | 2974315732 | Bacteria | 4602776 |
| 822 | 2984526740 | 2984523437 | Bacteria | 4508481 |
| 823 | Ga0075370_10014527 | |||
| 824 | JGI24746J21847_1000249 | |||
| 825 | JGI24746J21847_1001185 | |||
| 826 | JGI24747J21853_1006288 | |||
| 827 | JGI24743J22301_10015474 | |||
| 828 | JGI24745J21846_1002583 | |||
| 829 | JGI24749J21850_1011289 | |||
| 830 | JGI24744J21845_10000863 | |||
| 831 | JGI24744J21845_10002207 | |||
| 832 | JGI24034J26672_10005997 | |||
| 833 | JGI24742J22300_10010545 | |||
| 834 | rootH2_10094652 | |||
| 835 | Ga0055540_1000737 | |||
| 836 | Ga0070676_10048429 | |||
| 837 | Ga0070676_10202530 | |||
| 838 | Ga0070683_100293629 | |||
| 839 | Ga0070690_100026077 | |||
| 840 | Ga0070670_100127278 | |||
| 841 | Ga0070666_10037531 | |||
| 842 | Ga0070666_10116468 | |||
| 843 | Ga0070666_10121198 | |||
| 844 | Ga0070666_10176264 | |||
| 845 | Ga0070680_100248524 | |||
| 846 | Ga0070682_100011980 | |||
| 847 | Ga0070682_100032669 | |||
| 848 | Ga0070682_100105755 | |||
| 849 | Ga0068868_100005086 | |||
| 850 | Ga0070660_100032332 | |||
| 851 | Ga0070660_100336894 | |||
| 852 | Ga0070689_100003641 | |||
| 853 | Ga0070689_100004126 | |||
| 854 | Ga0070691_10008508 | |||
| 855 | Ga0070691_10009526 | |||
| 856 | Ga0070691_10094944 | |||
| 857 | Ga0070661_100310155 | |||
| 858 | Ga0070668_100000769 | |||
| 859 | Ga0070668_100008191 | |||
| 860 | Ga0070668_100019076 | |||
| 861 | Ga0070668_100038011 | |||
| 862 | Ga0070668_100069362 | |||
| 863 | Ga0070669_100003680 | |||
| 864 | Ga0070669_100020383 | |||
| 865 | Ga0070671_100012064 | |||
| 866 | Ga0070674_100000153 | |||
| 867 | Ga0070674_100003905 | |||
| 868 | Ga0070674_100132429 | |||
| 869 | Ga0070674_100172331 | |||
| 870 | Ga0070673_100036906 | |||
| 871 | Ga0070688_100006433 | |||
| 872 | Ga0070688_100011192 | |||
| 873 | Ga0070688_100063455 | |||
| 874 | Ga0070659_100024397 | |||
| 875 | Ga0070659_100037415 | |||
| 876 | Ga0070659_100317684 | |||
| 877 | Ga0070667_100000207 | |||
| 878 | Ga0070667_100001930 | |||
| 879 | Ga0070667_100008191 | |||
| 880 | Ga0070667_100047120 | |||
| 881 | Ga0070667_100133356 | |||
| 882 | Ga0070667_100531595 | |||
| 883 | Ga0070709_10015484 | |||
| 884 | Ga0070709_10019600 | |||
| 885 | Ga0070709_10020647 | |||
| 886 | Ga0070714_100077941 | |||
| 887 | Ga0070714_100404976 | |||
| 888 | Ga0070713_100191382 | |||
| 889 | Ga0070713_100495077 | |||
| 890 | Ga0070710_10002949 | |||
| 891 | Ga0070710_10005582 | |||
| 892 | Ga0070710_10017972 | |||
| 893 | Ga0070710_10038842 | |||
| 894 | Ga0070701_10009581 | |||
| 895 | Ga0070701_10026187 | |||
| 896 | Ga0070701_10095330 | |||
| 897 | Ga0070711_100000205 | |||
| 898 | Ga0070711_100006693 | |||
| 899 | Ga0070711_100008390 | |||
| 900 | Ga0070705_100008794 | |||
| 901 | Ga0070700_100000708 | |||
| 902 | Ga0070700_100001321 | |||
| 903 | Ga0070700_100063074 | |||
| 904 | Ga0070663_100010779 | |||
| 905 | Ga0070663_100011227 | |||
| 906 | Ga0070663_100212952 | |||
| 907 | Ga0070678_100004244 | |||
| 908 | Ga0070678_100007027 | |||
| 909 | Ga0070678_100023099 | |||
| 910 | Ga0070678_100229492 | |||
| 911 | Ga0070662_100005093 | |||
| 912 | Ga0070662_100015171 | |||
| 913 | Ga0070662_100034884 | |||
| 914 | Ga0070662_100291678 | |||
| 915 | Ga0068867_100010568 | |||
| 916 | Ga0068867_100013125 | |||
| 917 | Ga0070685_10007226 | |||
| 918 | Ga0070684_100139182 | |||
| 919 | Ga0068853_100009963 | |||
| 920 | Ga0068853_100016405 | |||
| 921 | Ga0070672_100147140 | |||
| 922 | Ga0070686_100047050 | |||
| 923 | Ga0070695_100090310 | |||
| 924 | Ga0070696_100004265 | |||
| 925 | Ga0070696_100173672 | |||
| 926 | Ga0070696_100279821 | |||
| 927 | Ga0070693_100014322 | |||
| 928 | Ga0070665_100012212 | |||
| 929 | Ga0070665_100025199 | |||
| 930 | Ga0070665_100027972 | |||
| 931 | Ga0070665_100146646 | |||
| 932 | Ga0070704_100011678 | |||
| 933 | Ga0070704_100049087 | |||
| 934 | Ga0070704_100157550 | |||
| 935 | Ga0068855_100198480 | |||
| 936 | Ga0068855_100455795 | |||
| 937 | Ga0068854_100000746 | |||
| 938 | Ga0068856_100258154 | |||
| 939 | Ga0070702_100001885 | |||
| 940 | Ga0070702_100208948 | |||
| 941 | Ga0068852_100056062 | |||
| 942 | Ga0068859_100002633 | |||
| 943 | Ga0068859_100009168 | |||
| 944 | Ga0068859_100035219 | |||
| 945 | Ga0068859_100179725 | |||
| 946 | Ga0068859_100358049 | |||
| 947 | Ga0068859_100746578 | |||
| 948 | Ga0068864_100424917 | |||
| 949 | Ga0068866_10003311 | |||
| 950 | Ga0068866_10034511 | |||
| 951 | Ga0068861_100006620 | |||
| 952 | Ga0068861_100017161 | |||
| 953 | Ga0068870_10009240 | |||
| 954 | Ga0068863_100001167 | |||
| 955 | Ga0068863_100008676 | |||
| 956 | Ga0068858_100002047 | |||
| 957 | Ga0068858_100011611 | |||
| 958 | Ga0068858_100012734 | |||
| 959 | Ga0068858_100181173 | |||
| 960 | Ga0068860_100000087 | |||
| 961 | Ga0068860_100012921 | |||
| 962 | Ga0068860_100038942 | |||
| 963 | Ga0068860_100262496 | |||
| 964 | Ga0068862_100000077 | |||
| 965 | Ga0068862_100011090 | |||
| 966 | Ga0068862_100024124 | |||
| 967 | Ga0068862_100433621 | |||
| 968 | Ga0081455_10155028 | |||
| 969 | Ga0081455_10171753 | |||
| 970 | Ga0070717_10559625 | |||
| 971 | Ga0070717_10659401 | |||
| 972 | Ga0075365_10006497 | |||
| 973 | Ga0075365_10049895 | |||
| 974 | Ga0075365_10146170 | |||
| 975 | Ga0075365_10321614 | |||
| 976 | Ga0075363_100000752 | |||
| 977 | Ga0075363_100002418 | |||
| 978 | Ga0075363_100016716 | |||
| 979 | Ga0075363_100020840 | |||
| 980 | Ga0075363_100024351 | |||
| 981 | Ga0075363_100051117 | |||
| 982 | Ga0075363_100061962 | |||
| 983 | Ga0075363_100093528 | |||
| 984 | Ga0075363_100140687 | |||
| 985 | Ga0075364_10001726 | |||
| 986 | Ga0075364_10005298 | |||
| 987 | Ga0075364_10035728 | |||
| 988 | Ga0075364_10091945 | |||
| 989 | Ga0075364_10114698 | |||
| 990 | Ga0075364_10183699 | |||
| 991 | Ga0070715_10002894 | |||
| 992 | Ga0070715_10016219 | |||
| 993 | Ga0070715_10063506 | |||
| 994 | Ga0070715_10092639 | |||
| 995 | Ga0070716_100012068 | |||
| 996 | Ga0070716_100014443 | |||
| 997 | Ga0070716_100022695 | |||
| 998 | Ga0070716_100071206 | |||
| 999 | Ga0070712_100003140 | |||
| 1000 | Ga0070712_100005319 | |||
| 1001 | Ga0070712_100041669 | |||
| 1002 | Ga0070712_100288142 | |||
| 1003 | Ga0075362_10027884 | |||
| 1004 | Ga0075367_10049963 | |||
| 1005 | Ga0075367_10063204 | |||
| 1006 | Ga0075367_10302944 | |||
| 1007 | Ga0075369_10003028 | |||
| 1008 | Ga0075369_10004827 | |||
| 1009 | Ga0075369_10015255 | |||
| 1010 | Ga0075369_10021231 | |||
| 1011 | Ga0075369_10044584 | |||
| 1012 | Ga0075369_10059967 | |||
| 1013 | Ga0097621_100112477 | |||
| 1014 | Ga0097621_100136715 | |||
| 1015 | Ga0075370_10000341 | |||
| 1016 | Ga0075370_10006636 | |||
| 1017 | Ga0075370_10042679 | |||
| 1018 | Ga0075370_10097594 | |||
| 1019 | Ga0075370_10099080 | |||
| 1020 | Ga0075428_100007312 | |||
| 1021 | Ga0075430_100033460 | |||
| 1022 | Ga0068865_100003973 | |||
| 1023 | Ga0068865_100004511 | |||
| 1024 | Ga0068865_100065189 | |||
| 1025 | Ga0097620_100002633 | |||
| 1026 | Ga0097620_100009170 | |||
| 1027 | Ga0097620_100035220 | |||
| 1028 | Ga0097620_100179719 | |||
| 1029 | Ga0097620_100358017 | |||
| 1030 | Ga0097620_100746494 | |||
| 1031 | Ga0099795_10018115 | |||
| 1032 | Ga0105250_10059132 | |||
| 1033 | Ga0111539_10058235 | |||
| 1034 | Ga0105245_10010064 | |||
| 1035 | Ga0105245_10011752 | |||
| 1036 | Ga0105245_10058319 | |||
| 1037 | Ga0105247_10000060 | |||
| 1038 | Ga0105247_10003797 | |||
| 1039 | Ga0105247_10014399 | |||
| 1040 | Ga0105247_10107982 | |||
| 1041 | Ga0114129_10018369 | |||
| 1042 | Ga0105243_10001032 | |||
| 1043 | Ga0105243_10004112 | |||
| 1044 | Ga0105243_10004938 | |||
| 1045 | Ga0105241_10019363 | |||
| 1046 | Ga0105242_10007699 | |||
| 1047 | Ga0105242_10015610 | |||
| 1048 | Ga0105242_10229140 | |||
| 1049 | Ga0105248_10000050 | |||
| 1050 | Ga0105248_10006763 | |||
| 1051 | Ga0105248_10014903 | |||
| 1052 | Ga0105248_10016636 | |||
| 1053 | Ga0105248_10289150 | |||
| 1054 | Ga0105248_10672903 | |||
| 1055 | Ga0105237_10000302 | |||
| 1056 | Ga0105237_10005603 | |||
| 1057 | Ga0105237_10024475 | |||
| 1058 | Ga0105237_10037157 | |||
| 1059 | Ga0105238_10398072 | |||
| 1060 | Ga0105249_10000042 | |||
| 1061 | Ga0105249_10008535 | |||
| 1062 | Ga0105147_106159 | |||
| 1063 | Ga0105239_10007547 | |||
| 1064 | Ga0105239_10020122 | |||
| 1065 | Ga0105239_10145429 | |||
| 1066 | Ga0105239_10149605 | |||
| 1067 | Ga0105246_10063161 | |||
| 1068 | Ga0105246_10321212 | |||
| 1069 | Ga0157369_10731401 | |||
| 1070 | Ga0157374_10269811 | |||
| 1071 | Ga0157374_10750967 | |||
| 1072 | Ga0157378_10009418 | |||
| 1073 | Ga0157378_10020814 | |||
| 1074 | Ga0163162_10036034 | |||
| 1075 | Ga0163162_10056668 | |||
| 1076 | Ga0163162_10135750 | |||
| 1077 | Ga0163162_10235301 | |||
| 1078 | Ga0163162_10431134 | |||
| 1079 | Ga0157372_10017144 | |||
| 1080 | Ga0157372_10027610 | |||
| 1081 | Ga0157375_10001384 | |||
| 1082 | Ga0157375_10009040 | |||
| 1083 | Ga0163163_10041091 | |||
| 1084 | Ga0163163_10171294 | |||
| 1085 | Ga0157380_10005913 | |||
| 1086 | Ga0157380_10036421 | |||
| 1087 | Ga0157380_10174838 | |||
| 1088 | Ga0157377_10003584 | |||
| 1089 | Ga0157377_10004754 | |||
| 1090 | Ga0157379_10014991 | |||
| 1091 | Ga0157379_10015516 | |||
| 1092 | Ga0157379_10057052 | |||
| 1093 | Ga0157376_10175865 | |||
| 1094 | Ga0163161_10004143 | |||
| 1095 | Ga0163161_10019468 | |||
| 1096 | Ga0163161_10056262 | |||
| 1097 | Ga0163161_10409716 | |||
| 1098 | Ga0213873_10001011 | |||
| 1099 | Ga0213874_10015187 | |||
| 1100 | Ga0213876_10001280 | |||
| 1101 | Ga0213876_10012437 | |||
| 1102 | Ga0213876_10014840 | |||
| 1103 | Ga0213876_10016537 | |||
| 1104 | Ga0213875_10009014 | |||
| 1105 | Ga0213875_10013022 | |||
| 1106 | Ga0213875_10013950 | |||
| 1107 | Ga0209051_1001230 | |||
| 1108 | Ga0209051_1004009 | |||
| 1109 | Ga0209051_1012348 | |||
| 1110 | Ga0209051_1023531 | |||
| 1111 | Ga0207682_10079528 | |||
| 1112 | Ga0207692_10005364 | |||
| 1113 | Ga0207692_10013460 | |||
| 1114 | Ga0207692_10092518 | |||
| 1115 | Ga0207642_10010536 | |||
| 1116 | Ga0207710_10000010 | |||
| 1117 | Ga0207710_10005512 | |||
| 1118 | Ga0207710_10011237 | |||
| 1119 | Ga0207688_10000746 | |||
| 1120 | Ga0207688_10003542 | |||
| 1121 | Ga0207688_10003584 | |||
| 1122 | Ga0207688_10008767 | |||
| 1123 | Ga0207688_10055573 | |||
| 1124 | Ga0207688_10111573 | |||
| 1125 | Ga0207688_10191867 | |||
| 1126 | Ga0207680_10274742 | |||
| 1127 | Ga0207647_10018896 | |||
| 1128 | Ga0207647_10037812 | |||
| 1129 | Ga0207647_10108787 | |||
| 1130 | Ga0207647_10161244 | |||
| 1131 | Ga0207685_10022078 | |||
| 1132 | Ga0207699_10007946 | |||
| 1133 | Ga0207699_10176649 | |||
| 1134 | Ga0207645_10015285 | |||
| 1135 | Ga0207645_10165124 | |||
| 1136 | Ga0207643_10028576 | |||
| 1137 | Ga0207654_10185231 | |||
| 1138 | Ga0207695_10429346 | |||
| 1139 | Ga0207671_10020899 | |||
| 1140 | Ga0207671_10045140 | |||
| 1141 | Ga0207671_10177721 | |||
| 1142 | Ga0207693_10001933 | |||
| 1143 | Ga0207693_10009413 | |||
| 1144 | Ga0207693_10018536 | |||
| 1145 | Ga0207693_10132318 | |||
| 1146 | Ga0207663_10009091 | |||
| 1147 | Ga0207663_10012518 | |||
| 1148 | Ga0207662_10031278 | |||
| 1149 | Ga0207662_10056518 | |||
| 1150 | Ga0207657_10097585 | |||
| 1151 | Ga0207657_10196077 | |||
| 1152 | Ga0207649_10338101 | |||
| 1153 | Ga0207681_10001541 | |||
| 1154 | Ga0207681_10071572 | |||
| 1155 | Ga0207694_10051158 | |||
| 1156 | Ga0207650_10357719 | |||
| 1157 | Ga0207659_10219904 | |||
| 1158 | Ga0207687_10009180 | |||
| 1159 | Ga0207687_10009671 | |||
| 1160 | Ga0207687_10023790 | |||
| 1161 | Ga0207687_10064377 | |||
| 1162 | Ga0207664_10208990 | |||
| 1163 | Ga0207644_10020036 | |||
| 1164 | Ga0207644_10172909 | |||
| 1165 | Ga0207690_10013423 | |||
| 1166 | Ga0207690_10017470 | |||
| 1167 | Ga0207690_10222742 | |||
| 1168 | Ga0207706_10001957 | |||
| 1169 | Ga0207706_10018529 | |||
| 1170 | Ga0207706_10039401 | |||
| 1171 | Ga0207706_10173451 | |||
| 1172 | Ga0207686_10004236 | |||
| 1173 | Ga0207686_10023126 | |||
| 1174 | Ga0207686_10153847 | |||
| 1175 | Ga0207709_10004934 | |||
| 1176 | Ga0207709_10005610 | |||
| 1177 | Ga0207709_10021313 | |||
| 1178 | Ga0207670_10020714 | |||
| 1179 | Ga0207670_10034022 | |||
| 1180 | Ga0207670_10071936 | |||
| 1181 | Ga0207669_10001689 | |||
| 1182 | Ga0207669_10006346 | |||
| 1183 | Ga0207704_10005939 | |||
| 1184 | Ga0207704_10093701 | |||
| 1185 | Ga0207665_10006415 | |||
| 1186 | Ga0207665_10012936 | |||
| 1187 | Ga0207665_10015671 | |||
| 1188 | Ga0207665_10062620 | |||
| 1189 | Ga0207711_10000339 | |||
| 1190 | Ga0207711_10021885 | |||
| 1191 | Ga0207711_10049582 | |||
| 1192 | Ga0207711_10063300 | |||
| 1193 | Ga0207711_10213700 | |||
| 1194 | Ga0207689_10012468 | |||
| 1195 | Ga0207689_10033145 | |||
| 1196 | Ga0207661_10491307 | |||
| 1197 | Ga0207661_10586827 | |||
| 1198 | Ga0207667_10401802 | |||
| 1199 | Ga0207712_10000010 | |||
| 1200 | Ga0207712_10009714 | |||
| 1201 | Ga0207712_10334766 | |||
| 1202 | Ga0207668_10000526 | |||
| 1203 | Ga0207668_10001279 | |||
| 1204 | Ga0207668_10009108 | |||
| 1205 | Ga0207640_10010313 | |||
| 1206 | Ga0207640_10011395 | |||
| 1207 | Ga0207658_10000175 | |||
| 1208 | Ga0207658_10011032 | |||
| 1209 | Ga0207658_10018649 | |||
| 1210 | Ga0207658_10038923 | |||
| 1211 | Ga0207658_10085989 | |||
| 1212 | Ga0207677_10005669 | |||
| 1213 | Ga0207677_10135233 | |||
| 1214 | Ga0207677_10148186 | |||
| 1215 | Ga0207703_10009089 | |||
| 1216 | Ga0207703_10075278 | |||
| 1217 | Ga0207703_10131800 | |||
| 1218 | Ga0207703_10461819 | |||
| 1219 | Ga0207703_10513535 | |||
| 1220 | Ga0207639_10165138 | |||
| 1221 | Ga0207639_10335125 | |||
| 1222 | Ga0207639_10568979 | |||
| 1223 | Ga0207678_10005752 | |||
| 1224 | Ga0207678_10016047 | |||
| 1225 | Ga0207678_10018037 | |||
| 1226 | Ga0207678_10034154 | |||
| 1227 | Ga0207678_10129877 | |||
| 1228 | Ga0207678_10164706 | |||
| 1229 | Ga0207708_10001762 | |||
| 1230 | Ga0207708_10009825 | |||
| 1231 | Ga0207708_10024354 | |||
| 1232 | Ga0207708_10073915 | |||
| 1233 | Ga0207702_10398547 | |||
| 1234 | Ga0207641_10001173 | |||
| 1235 | Ga0207641_10003476 | |||
| 1236 | Ga0207648_10002525 | |||
| 1237 | Ga0207648_10010554 | |||
| 1238 | Ga0207648_10103195 | |||
| 1239 | Ga0207648_10112699 | |||
| 1240 | Ga0207676_10064592 | |||
| 1241 | Ga0207676_10218230 | |||
| 1242 | Ga0207675_100000896 | |||
| 1243 | Ga0207675_100012618 | |||
| 1244 | Ga0207675_100047816 | |||
| 1245 | Ga0207683_10005892 | |||
| 1246 | Ga0207683_10011339 | |||
| 1247 | Ga0207683_10156785 | |||
| 1248 | Ga0207698_10039194 | |||
| 1249 | Ga0207698_10511760 | |||
| 1250 | Ga0209813_10006814 | |||
| 1251 | Ga0268266_10013715 | |||
| 1252 | Ga0268266_10030900 | |||
| 1253 | Ga0268266_10050887 | |||
| 1254 | Ga0268266_10140353 | |||
| 1255 | Ga0268266_10190455 | |||
| 1256 | Ga0268265_10000014 | |||
| 1257 | Ga0268265_10015013 | |||
| 1258 | Ga0268265_10032394 | |||
| 1259 | Ga0268265_10426619 | |||
| 1260 | Ga0268264_10000150 | |||
| 1261 | Ga0268264_10032743 | |||
| 1262 | Ga0268264_10060598 | |||
| 1263 | Ga0265327_10000018 | |||
| 1264 | Ga0265327_10001055 | |||
| 1265 | Ga0265327_10003531 | |||
| 1266 | Ga0265327_10012159 | |||
| 1267 | Ga0316579_10074046 | |||
| 1268 | Ga0307405_10137382 | |||
| 1269 | Ga0307413_10244730 | |||
| 1270 | Ga0307413_10313428 | |||
| 1271 | Ga0307410_10243739 | |||
| 1272 | Ga0307409_100065472 | |||
| 1273 | Ga0307416_100235983 | |||
| 1274 | Ga0307416_100244308 | |||
| 1275 | Ga0307415_100063623 | |||
| 1276 | Ga0307415_100205265 | |||
| 1277 | Ga0373961_0033577 | |||
| 1278 | Ga0373931_0060774 | |||
| 1279 | Ga0436364_0090210 | |||
| 1280 | Ga0436364_0106048 | |||
| 1281 | Ga0436364_0322663 | |||
| 1282 | Ga0436364_1009898 | |||
| 1283 | Ga0436364_1253766 | |||
| 1284 | Ga0436365_0291752 | |||
| 1285 | Ga0436365_0470752 | |||
| 1286 | Ga0436365_0607060 | |||
| 1287 | Ga0436365_0608503 | |||
| 1288 | Ga0436365_0953566 | |||
| 1289 | Ga0436365_1064965 | |||
| 1290 | Ga0436365_1630628 | |||
| 1291 | Ga0436365_1666956 | |||
| 1292 | Ga0436363_1156190 | |||
| 1293 | Ga0439461_0008453 | |||
| 1294 | Ga0439466_0013017 | |||
| 1295 | Ga0439466_0021832 | |||
| 1296 | Ga0439465_0022215 | |||
| 1297 | Ga0439465_0024775 | |||
| 1298 | Ga0451789_0831621 | |||
| 1299 | Ga0451793_0382371 | |||
| 1300 | Ga0451795_0376464 | |||
| 1301 | Ga0451841_0730527 | |||
| 1302 | Ga0451853_0088204 | |||
| 1303 | Ga0439431_0010521 | |||
| 1304 | Ga0439431_0012523 | |||
| 1305 | Ga0439442_020937 | |||
| 1306 | Ga0439445_0007753 | |||
| 1307 | Ga0439434_0007518 | |||
| 1308 | Ga0439434_0015541 | |||
| 1309 | Ga0466972_0005077 | |||
| 1310 | Ga0466972_0011027 | |||
| 1311 | Ga0466972_0020820 | |||
| 1312 | Ga0466972_0080398 | |||
| 1313 | Ga0466965_0003274 | |||
| 1314 | Ga0466965_0005127 | |||
| 1315 | Ga0466965_0032979 | |||
| 1316 | Ga0466965_0048201 | |||
| 1317 | Ga0466966_0014746 | |||
| 1318 | Ga0466966_0017854 | |||
| 1319 | Ga0466966_0019992 | |||
| 1320 | Ga0466966_0030900 | |||
| 1321 | Ga0466961_0024272 | |||
| 1322 | Ga0466961_0086798 | |||
| 1323 | Ga0466963_0057402 | |||
| 1324 | Ga0466963_0064655 | |||
| 1325 | Ga0466971_0009094 | |||
| 1326 | Ga0466971_0026994 | |||
| 1327 | Ga0466968_0001802 | |||
| 1328 | Ga0466968_0018354 | |||
| 1329 | Ga0466968_0021692 | |||
| 1330 | Ga0466970_0029750 | |||
| 1331 | Ga0466957_0010746 | |||
| 1332 | Ga0466957_0016389 | |||
| 1333 | Ga0466957_0025854 | |||
| 1334 | Ga0466957_0038884 | |||
| 1335 | Ga0466957_0043901 | |||
| 1336 | Ga0466957_0301806 | |||
| 1337 | Ga0466960_0000265 | |||
| 1338 | Ga0466960_0006050 | |||
| 1339 | Ga0466960_0025835 | |||
| 1340 | Ga0466960_0074763 | |||
| 1341 | Ga0466960_0120531 | |||
| 1342 | Ga0466959_0009064 | |||
| 1343 | Ga0466959_0014716 | |||
| 1344 | Ga0466959_0017458 | |||
| 1345 | Ga0466959_0102514 | |||
| 1346 | Ga0466959_0106400 | |||
| 1347 | Ga0466958_0000197 | |||
| 1348 | Ga0466958_0010043 | |||
| 1349 | Ga0466958_0012112 | |||
| 1350 | Ga0466958_0174793 | |||
| 1351 | Ga0466958_0219982 | |||
| 1352 | Ga0466967_0005234 | |||
| 1353 | Ga0466967_0023084 | |||
| 1354 | Ga0466967_0029924 | |||
| 1355 | Ga0466967_0032663 | |||
| 1356 | Ga0466967_0078788 | |||
| 1357 | Ga0466967_0084546 | |||
| 1358 | Ga0466967_0159071 | |||
| 1359 | Ga0466967_0259794 | |||
| 1360 | Ga0466967_0905345 | |||
| 1361 | Ga0495603_0045129 | |||
| 1362 | Ga0495590_0120021 | |||
| 1363 | Ga0495629_0030982 | |||
| 1364 | Ga0495638_0001570 | |||
| 1365 | Ga0495638_0119431 | |||
| 1366 | Ga0495580_0091923 | |||
| 1367 | Ga0495662_0034109 | |||
| 1368 | Ga0495608_0102372 | |||
| 1369 | Ga0495648_0004296 | |||
| 1370 | Ga0495668_0001186 | |||
| 1371 | Ga0495668_0001258 | |||
| 1372 | Ga0495588_0044711 | |||
| 1373 | Ga0495671_0119363 | |||
| 1374 | Ga0495649_0146175 | |||
| 1375 | Ga0495581_0122321 | |||
| 1376 | Ga0495581_0144352 | |||
| 1377 | Ga0495674_0253921 | |||
| 1378 | Ga0495672_0010022 | |||
| 1379 | Ga0495672_0147042 | |||
| 1380 | Ga0495683_0002024 | |||
| 1381 | Ga0495673_0002913 | |||
| 1382 | Ga0495686_0012826 | |||
| 1383 | Ga0495626_0040203 | |||
| 1384 | Ga0496100_0001415 | |||
| 1385 | Ga0496100_0001824 | |||
| 1386 | Ga0496100_0003985 | |||
| 1387 | Ga0496100_0004691 | |||
| 1388 | Ga0496100_0009259 | |||
| 1389 | Ga0496100_0051433 | |||
| 1390 | Ga0496100_0129812 | |||
| 1391 | Ga0496100_0193463 | |||
| 1392 | Ga0496101_0000229 | |||
| 1393 | Ga0496101_0000963 | |||
| 1394 | Ga0496101_0002114 | |||
| 1395 | Ga0496101_0006448 | |||
| 1396 | Ga0496101_0007097 | |||
| 1397 | Ga0496101_0008554 | |||
| 1398 | Ga0496101_0033334 | |||
| 1399 | Ga0496101_0063664 | |||
| 1400 | Ga0496101_0076800 | |||
| 1401 | Ga0496102_0000006 | |||
| 1402 | Ga0496102_0000235 | |||
| 1403 | Ga0496102_0002862 | |||
| 1404 | Ga0496102_0011113 | |||
| 1405 | Ga0496102_0017361 | |||
| 1406 | Ga0496102_0024467 | |||
| 1407 | Ga0496102_0058555 | |||
| 1408 | Ga0496102_0081864 | |||
| 1409 | Ga0496102_0144463 | |||
| 1410 | Ga0496102_0182791 | |||
| 1411 | Ga0496103_0000006 | |||
| 1412 | Ga0496103_0000443 | |||
| 1413 | Ga0496103_0001156 | |||
| 1414 | Ga0496103_0003079 | |||
| 1415 | Ga0496103_0004904 | |||
| 1416 | Ga0496103_0064551 | |||
| 1417 | Ga0496103_0272210 | |||
| 1418 | Ga0496104_0060473 | |||
| 1419 | Ga0496104_0374138 | |||
| 1420 | Ga0496105_0010203 | |||
| 1421 | Ga0496105_0126134 | |||
| 1422 | Ga0496105_0170006 | |||
| 1423 | Ga0496106_0001616 | |||
| 1424 | Ga0496106_0001655 | |||
| 1425 | Ga0496106_0006301 | |||
| 1426 | Ga0496106_0014740 | |||
| 1427 | Ga0496106_0020218 | |||
| 1428 | Ga0496106_0028370 | |||
| 1429 | Ga0496106_0029602 | |||
| 1430 | Ga0496106_0045427 | |||
| 1431 | Ga0496106_0260290 | |||
| 1432 | Ga0496107_0007986 | |||
| 1433 | Ga0496107_0075485 | |||
| 1434 | Ga0496107_0077249 | |||
| 1435 | Ga0496107_0087704 | |||
| 1436 | Ga0496107_0254941 | |||
| 1437 | Ga0496108_0000222 | |||
| 1438 | Ga0496108_0002078 | |||
| 1439 | Ga0496108_0018950 | |||
| 1440 | Ga0496108_0023890 | |||
| 1441 | Ga0496108_0046469 | |||
| 1442 | Ga0496108_0228848 | |||
| 1443 | Ga0496108_0249161 | |||
| 1444 | Ga0496109_0003500 | |||
| 1445 | Ga0496109_0004447 | |||
| 1446 | Ga0496109_0011117 | |||
| 1447 | Ga0496109_0025692 | |||
| 1448 | Ga0496109_0032560 | |||
| 1449 | Ga0496109_0061059 | |||
| 1450 | Ga0496110_0016452 | |||
| 1451 | Ga0496110_0018791 | |||
| 1452 | Ga0496110_0051859 | |||
| 1453 | Ga0496110_0061402 | |||
| 1454 | Ga0496110_0074895 | |||
| 1455 | Ga0496111_0043312 | |||
| 1456 | Ga0496112_0032517 | |||
| 1457 | Ga0496112_0056866 | |||
| 1458 | Ga0496112_0067467 | |||
| 1459 | Ga0496112_0078541 | |||
| 1460 | Ga0496112_0110099 | |||
| 1461 | Ga0496112_0230986 | |||
| 1462 | Ga0496112_0247951 | |||
| 1463 | Ga0496112_0515079 | |||
| 1464 | Ga0496113_0003042 | |||
| 1465 | Ga0496113_0006617 | |||
| 1466 | Ga0496114_0000153 | |||
| 1467 | Ga0496114_0023001 | |||
| 1468 | Ga0496114_0024447 | |||
| 1469 | Ga0496114_0590628 | |||
| 1470 | Ga0496115_0006985 | |||
| 1471 | Ga0496115_0007857 | |||
| 1472 | Ga0496115_0016046 | |||
| 1473 | Ga0496115_0145736 | |||
| 1474 | Ga0496115_0481158 | |||
| 1475 | Ga0496116_0000025 | |||
| 1476 | Ga0496116_0005302 | |||
| 1477 | Ga0496116_0008758 | |||
| 1478 | Ga0496117_0000006 | |||
| 1479 | Ga0496117_0000521 | |||
| 1480 | Ga0496117_0013197 | |||
| 1481 | Ga0496117_0102360 | |||
| 1482 | Ga0496117_0155606 | |||
| 1483 | Ga0496118_0000004 | |||
| 1484 | Ga0496118_0000455 | |||
| 1485 | Ga0496118_0000730 | |||
| 1486 | Ga0496118_0022416 | |||
| 1487 | Ga0496119_0000035 | |||
| 1488 | Ga0496119_0009787 | |||
| 1489 | Ga0496120_0000079 | |||
| 1490 | Ga0496120_0009649 | |||
| 1491 | Ga0496120_0019833 | |||
| 1492 | Ga0496121_0000004 | |||
| 1493 | Ga0496121_0000090 | |||
| 1494 | Ga0496121_0175861 | |||
| 1495 | Ga0496122_0000805 | |||
| 1496 | Ga0496122_0003041 | |||
| 1497 | Ga0496123_0004493 | |||
| 1498 | Ga0496123_0012202 | |||
| 1499 | Ga0496123_0029986 | |||
| 1500 | Ga0496124_0000221 | |||
| 1501 | Ga0496125_0000003 | |||
| 1502 | Ga0496125_0030577 | |||
| 1503 | Ga0496125_0105437 | |||
| 1504 | Ga0496125_0119559 | |||
| 1505 | Ga0496126_0000001 | |||
| 1506 | Ga0496126_0004049 | |||
| 1507 | Ga0496126_0018195 | |||
| 1508 | Ga0496126_0026431 | |||
| 1509 | Ga0496126_0045421 | |||
| 1510 | Ga0501032_0014425 | |||
| 1511 | Ga0501032_0093439 | |||
| 1512 | Ga0501033_0331741 | |||
| 1513 | Ga0501034_0028270 | |||
| 1514 | Ga0501034_0035636 | |||
| 1515 | Ga0501034_0204194 | |||
| 1516 | Ga0501036_0001863 | |||
| 1517 | Ga0501036_0056555 | |||
| 1518 | Ga0501036_0076419 | |||
| 1519 | Ga0501037_0047879 | |||
| 1520 | Ga0501037_0057369 | |||
| 1521 | Ga0501039_0000771 | |||
| 1522 | Ga0501043_0000790 | |||
| 1523 | Ga0501046_0000382 | |||
| 1524 | Ga0501047_0002654 | |||
| 1525 | Ga0501047_0017356 | |||
| 1526 | Ga0501048_0040031 | |||
| 1527 | Ga0501067_0049893 | |||
| 1528 | Ga0501069_0026674 | |||
| 1529 | Ga0501069_0098520 | |||
| 1530 | Ga0501070_0001555 | |||
| 1531 | Ga0501070_0008775 | |||
| 1532 | Ga0501073_0144706 | |||
| 1533 | Ga0501077_0063642 | |||
| 1534 | Ga0501080_0134766 | |||
| 1535 | Ga0501080_0155187 | |||
| 1536 | Ga0501035_0007912 | |||
| 1537 | Ga0501035_0011908 | |||
| 1538 | Ga0501044_0001394 | |||
| 1539 | Ga0501044_0002938 | |||
| 1540 | Ga0501044_0018624 | |||
| 1541 | nmdc:mga03683_58615_c1 | |||
| 1542 | nmdc:mga03n38_10214_c1 | |||
| 1543 | nmdc:mga03n38_11440_c1 | |||
| 1544 | nmdc:mga03n38_17821_c1 | |||
| 1545 | nmdc:mga03n38_184540_c1 | |||
| 1546 | nmdc:mga03n38_23413_c1 | |||
| 1547 | nmdc:mga03n38_34752_c1 | |||
| 1548 | nmdc:mga03n38_52956_c1 | |||
| 1549 | nmdc:mga03n38_8139_c1 | |||
| 1550 | nmdc:mga03n38_98603_c1 | |||
| 1551 | nmdc:mga00v17_114846_c1 | |||
| 1552 | nmdc:mga00v17_1611_c1 | |||
| 1553 | nmdc:mga00v17_244358_c1 | |||
| 1554 | nmdc:mga00v17_29712_c1 | |||
| 1555 | nmdc:mga00v17_41855_c1 | |||
| 1556 | nmdc:mga00v17_7882_c1 | |||
| 1557 | nmdc:mga00v17_8457_c1 | |||
| 1558 | nmdc:mga00v17_95658_c1 | |||
| 1559 | nmdc:mga0yw44_14399_c1 | |||
| 1560 | nmdc:mga0yw44_14561_c1 | |||
| 1561 | nmdc:mga0yw44_224404_c1 | |||
| 1562 | nmdc:mga0yw44_224955_c1 | |||
| 1563 | nmdc:mga0yw44_6885_c1 | |||
| 1564 | nmdc:mga06z11_25107_c1 | |||
| 1565 | nmdc:mga06z11_270266_c1 | |||
| 1566 | nmdc:mga04h51_1888_c1 | |||
| 1567 | nmdc:mga07m45_127291_c1 | |||
| 1568 | nmdc:mga07m45_182642_c1 | |||
| 1569 | nmdc:mga07m45_18917_c1 | |||
| 1570 | nmdc:mga07m45_47330_c1 | |||
| 1571 | nmdc:mga07m45_47429_c2 | |||
| 1572 | nmdc:mga07m45_81459_c1 | |||
| 1573 | nmdc:mga07m45_94690_c1 | |||
| 1574 | nmdc:mga05p37_35429_c1 | |||
| 1575 | nmdc:mga0qj67_28952_c1 | |||
| 1576 | nmdc:mga08y16_44941_c1 | |||
| 1577 | nmdc:mga0sz30_17701_c1 | |||
| 1578 | nmdc:mga0sz30_20679_c1 | |||
| 1579 | nmdc:mga0sz30_48571_c1 | |||
| 1580 | nmdc:mga0sz30_654_c2 | |||
| 1581 | nmdc:mga0sz30_716_c1 | |||
| 1582 | nmdc:mga0sz30_8193_c1 | |||
| 1583 | Ga0500610_0001004 | |||
| 1584 | Ga0500635_0009648 | |||
| 1585 | Ga0500643_001666 | |||
| 1586 | Ga0500646_0069051 | |||
| 1587 | Ga0500641_0063303 | |||
| 1588 | Ga0500641_0104360 | |||
| 1589 | Ga0500642_0005874 | |||
| 1590 | Ga0500652_000149 | |||
| 1591 | Ga0500559_0033419 | |||
| 1592 | Ga0500616_0003317 | |||
| 1593 | Ga0500616_0067983 | |||
| 1594 | Ga0500627_0001152 | |||
| 1595 | Ga0500633_0066770 | |||
| 1596 | Ga0500645_000412 | |||
| 1597 | Ga0500645_019094 | |||
| 1598 | Ga0466962_0009524 | |||
| 1599 | Ga0466962_0013269 | |||
| 1600 | 2523385106 | |||
| 1601 | 2548699028 | |||
| 1602 | 2548699266 | |||
| 1603 | 2552110701 | |||
| 1604 | 2566991590 | |||
| 1605 | 2566992135 | |||
| 1606 | 2644490599 | |||
| 1607 | 2644513928 | |||
| 1608 | 2644637000 | |||
| 1609 | 2738668319 | |||
| 1610 | 2738707027 | |||
| 1611 | 2738888006 | |||
| 1612 | 2738888324 | |||
| 1613 | 2739147389 | |||
| 1614 | 2739204184 | |||
| 1615 | 2739238173 | |||
| 1616 | 2739333731 | |||
| 1617 | 2739364818 | |||
| 1618 | 2744957276 | |||
| 1619 | 2753037780 | |||
| 1620 | 2753325648 | |||
| 1621 | 2842139231 | |||
| 1622 | 2842891154 | |||
| 1623 | 2889303295 | |||
| 1624 | 2902798637 | |||
| 1625 | 2902800514 | |||
| 1626 | 2902814847 | |||
| 1627 | 2902843243 | |||
| 1628 | 2904538043 | |||
| 1629 | 2904541112 | |||
| 1630 | 2904766540 | |||
| 1631 | 2904772708 | |||
| 1632 | 2908811499 | |||
| 1633 | 2919421024 | |||
| 1634 | 2919433218 | |||
| 1635 | 2919716985 | |||
| 1636 | 2922557227 | |||
| 1637 | 2922560755 | |||
| 1638 | 2928145071 | |||
| 1639 | 2929217502 | |||
| 1640 | 2932400448 | |||
| 1641 | 2939584760 | |||
| 1642 | 2939745816 | |||
| 1643 | 2974318529 | |||
| 1644 | 2984526740 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b31-assembly1.cif.gz_B | crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 | 0.8593 | 11 | 301 |
| 8b31-assembly1.cif.gz_A | crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 | 0.8589 | 11 | 301 |
| 6ikz-assembly1.cif.gz_A | udp-glucose pyrophosphorylase from acinetobacter baumanii | 0.8573 | 10 | 296 |
| 6knj-assembly1.cif.gz_A | utp-bound ugpase from acinetobacter baumannii | 0.8565 | 10 | 296 |
| 5ve7-assembly1.cif.gz_A | crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp | 0.8554 | 10 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8757 | 10 | 299 | 3.90.550.10 |
| af_Q58730_1_282_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8641 | 10 | 299 | 3.90.550.10 |
| 2pa4A00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8534 | 10 | 299 | 3.90.550.10 |
| af_Q2G1T6_1_286_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8433 | 7 | 294 | 3.90.550.10 |
| 2pa4A00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8347 | 10 | 299 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I1IRH1-F1-model_v4 | deleted | 0.9479 | 113 | 261 |
|
| AF-A0A6I1IRH1-F1-model_v4 | deleted | 0.9419 | 113 | 261 |
|
| AF-X0XUV4-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9315 | 41 | 258 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-A0A2S8BQJ8-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.9278 | 46 | 303 |
GO:0003983
GO:0006011 GO:0009058 |
| AF-X0XNF8-F1-model_v4 | UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) | 0.923 | 47 | 299 |
GO:0003983
GO:0006011 GO:0009058 |