F482297

General Info

Members Datasets Scaffolds Average Seq Length
822 340 1644 301

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10014527|Ga0075370_100145274
Length 328
Sequence MALMFGQCTREVDSSVCRMTRPLVSIPFTAVVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGGGRLVIVTSKGKDGVVAHFVEDLVLEGTLEARGKHLMLEKVRRAPALIKVESVVQAEPLGLGHAVSCVEPTLLPDEDAIAVLLPDDLVLPTGVLETMSKVRAKRGGSVLCAIEVSPTEISAYGVFDVATVPDAVNPNVMRVKGMVEKPKAEDAPSLYAAAGRYILDRAIFDALRRVSRGAGGEIQLTDAIAWLIDDGHPVHVVVHRGPRHDLGNPGGYLKAAVDFALERDDYGPELRRWLAKRLGLTTPDDVRRAG

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
113 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
179 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
290 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
291 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
292 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
293 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
294 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
302 2547132424 Nocardia nova SH22a Isolate Unclassified
303 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
304 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
305 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
306 2643221692 Nocardia sp. Root136 Isolate Unclassified
307 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
308 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
309 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
310 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
311 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
312 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
313 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
314 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
315 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
316 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
317 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
318 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
319 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
320 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
321 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
322 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
323 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
324 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
325 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
326 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
327 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
328 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
329 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
330 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
331 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
332 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
333 2922554459 Rhodococcus sp. 66b Isolate Unclassified
334 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
335 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
336 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
337 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
338 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
339 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
340 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0
Isolates 5.47

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 11.56
Nodule 0.12
Rhizoplane 11.44
Rhizosphere 65.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10014527 3300006353 Bacteria 4203
2 JGI24746J21847_1000249 3300001977 Bacteria 7535
3 JGI24746J21847_1001185 3300001977 Bacteria 4124
4 JGI24747J21853_1006288 3300001978 Bacteria 1119
5 JGI24743J22301_10015474 3300001991 Bacteria 1416
6 JGI24745J21846_1002583 3300002073 Bacteria 1856
7 JGI24749J21850_1011289 3300002076 Bacteria 1254
8 JGI24744J21845_10000863 3300002077 Bacteria 5724
9 JGI24744J21845_10002207 3300002077 Bacteria 3956
10 JGI24034J26672_10005997 3300002239 Bacteria 1750
11 JGI24742J22300_10010545 3300002244 Bacteria 1530
12 rootH2_10094652 3300003320 Bacteria 6243
13 Ga0055540_1000737 3300003792 Bacteria 22215
14 Ga0070676_10048429 3300005328 Bacteria 2485
15 Ga0070676_10202530 3300005328 Bacteria 1302
16 Ga0070683_100293629 3300005329 Bacteria 1546
17 Ga0070690_100026077 3300005330 Bacteria 3603
18 Ga0070670_100127278 3300005331 Bacteria 2199
19 Ga0070666_10037531 3300005335 Bacteria 3222
20 Ga0070666_10116468 3300005335 Bacteria 1851
21 Ga0070666_10121198 3300005335 Bacteria 1814
22 Ga0070666_10176264 3300005335 Bacteria 1499
23 Ga0070680_100248524 3300005336 Bacteria 1504
24 Ga0070682_100011980 3300005337 Bacteria 4962
25 Ga0070682_100032669 3300005337 Bacteria 3158
26 Ga0070682_100105755 3300005337 Bacteria 1866
27 Ga0068868_100005086 3300005338 Bacteria 9229
28 Ga0070660_100032332 3300005339 Bacteria 3936
29 Ga0070660_100336894 3300005339 Bacteria 1241
30 Ga0070689_100003641 3300005340 Bacteria 10282
31 Ga0070689_100004126 3300005340 Bacteria 9782
32 Ga0070691_10008508 3300005341 Bacteria 4697
33 Ga0070691_10009526 3300005341 Bacteria 4435
34 Ga0070691_10094944 3300005341 Bacteria 1475
35 Ga0070661_100310155 3300005344 Bacteria 1230
36 Ga0070668_100000769 3300005347 Bacteria 22070
37 Ga0070668_100008191 3300005347 Bacteria 7762
38 Ga0070668_100019076 3300005347 Bacteria 5156
39 Ga0070668_100038011 3300005347 Bacteria 3677
40 Ga0070668_100069362 3300005347 Bacteria 2742
41 Ga0070669_100003680 3300005353 Bacteria 11060
42 Ga0070669_100020383 3300005353 Bacteria 4735
43 Ga0070671_100012064 3300005355 Bacteria 6952
44 Ga0070674_100000153 3300005356 Bacteria 32199
45 Ga0070674_100003905 3300005356 Bacteria 8442
46 Ga0070674_100132429 3300005356 Bacteria 1861
47 Ga0070674_100172331 3300005356 Bacteria 1651
48 Ga0070673_100036906 3300005364 Bacteria 3720
49 Ga0070688_100006433 3300005365 Bacteria 6280
50 Ga0070688_100011192 3300005365 Bacteria 4980
51 Ga0070688_100063455 3300005365 Bacteria 2342
52 Ga0070659_100024397 3300005366 Bacteria 4636
53 Ga0070659_100037415 3300005366 Bacteria 3783
54 Ga0070659_100317684 3300005366 Bacteria 1301
55 Ga0070667_100000207 3300005367 Bacteria 69147
56 Ga0070667_100001930 3300005367 Bacteria 18393
57 Ga0070667_100008191 3300005367 Bacteria 8664
58 Ga0070667_100047120 3300005367 Bacteria 3627
59 Ga0070667_100133356 3300005367 Bacteria 2169
60 Ga0070667_100531595 3300005367 Bacteria 1080
61 Ga0070709_10015484 3300005434 Bacteria 4340
62 Ga0070709_10019600 3300005434 Bacteria 3913
63 Ga0070709_10020647 3300005434 Bacteria 3826
64 Ga0070714_100077941 3300005435 Bacteria 2879
65 Ga0070714_100404976 3300005435 Bacteria 1290
66 Ga0070713_100191382 3300005436 Bacteria 1844
67 Ga0070713_100495077 3300005436 Bacteria 1153
68 Ga0070710_10002949 3300005437 Bacteria 8079
69 Ga0070710_10005582 3300005437 Bacteria 5992
70 Ga0070710_10017972 3300005437 Bacteria 3630
71 Ga0070710_10038842 3300005437 Bacteria 2617
72 Ga0070701_10009581 3300005438 Bacteria 4248
73 Ga0070701_10026187 3300005438 Bacteria 2841
74 Ga0070701_10095330 3300005438 Bacteria 1638
75 Ga0070711_100000205 3300005439 Bacteria 31303
76 Ga0070711_100006693 3300005439 Bacteria 6968
77 Ga0070711_100008390 3300005439 Bacteria 6326
78 Ga0070705_100008794 3300005440 Bacteria 5002
79 Ga0070700_100000708 3300005441 Bacteria 16443
80 Ga0070700_100001321 3300005441 Bacteria 12299
81 Ga0070700_100063074 3300005441 Bacteria 2343
82 Ga0070663_100010779 3300005455 Bacteria 5706
83 Ga0070663_100011227 3300005455 Bacteria 5612
84 Ga0070663_100212952 3300005455 Bacteria 1514
85 Ga0070678_100004244 3300005456 Bacteria 8098
86 Ga0070678_100007027 3300005456 Bacteria 6652
87 Ga0070678_100023099 3300005456 Bacteria 4137
88 Ga0070678_100229492 3300005456 Bacteria 1547
89 Ga0070662_100005093 3300005457 Bacteria 8373
90 Ga0070662_100015171 3300005457 Bacteria 5155
91 Ga0070662_100034884 3300005457 Bacteria 3549
92 Ga0070662_100291678 3300005457 Bacteria 1323
93 Ga0068867_100010568 3300005459 Bacteria 6511
94 Ga0068867_100013125 3300005459 Bacteria 5865
95 Ga0070685_10007226 3300005466 Bacteria 5677
96 Ga0070684_100139182 3300005535 Bacteria 2194
97 Ga0068853_100009963 3300005539 Bacteria 7675
98 Ga0068853_100016405 3300005539 Bacteria 6096
99 Ga0070672_100147140 3300005543 Bacteria 1947
100 Ga0070686_100047050 3300005544 Bacteria 2726
101 Ga0070695_100090310 3300005545 Bacteria 2044
102 Ga0070696_100004265 3300005546 Bacteria 9534
103 Ga0070696_100173672 3300005546 Bacteria 1594
104 Ga0070696_100279821 3300005546 Bacteria 1271
105 Ga0070693_100014322 3300005547 Bacteria 4061
106 Ga0070665_100012212 3300005548 Bacteria 8658
107 Ga0070665_100025199 3300005548 Bacteria 5994
108 Ga0070665_100027972 3300005548 Bacteria 5678
109 Ga0070665_100146646 3300005548 Bacteria 2363
110 Ga0070704_100011678 3300005549 Bacteria 5394
111 Ga0070704_100049087 3300005549 Bacteria 2958
112 Ga0070704_100157550 3300005549 Bacteria 1792
113 Ga0068855_100198480 3300005563 Bacteria 2260
114 Ga0068855_100455795 3300005563 Bacteria 1395
115 Ga0068854_100000746 3300005578 Bacteria 19250
116 Ga0068856_100258154 3300005614 Bacteria 1758
117 Ga0070702_100001885 3300005615 Bacteria 8784
118 Ga0070702_100208948 3300005615 Bacteria 1298
119 Ga0068852_100056062 3300005616 Bacteria 3404
120 Ga0068859_100002633 3300005617 Bacteria 18260
121 Ga0068859_100009168 3300005617 Bacteria 9994
122 Ga0068859_100035219 3300005617 Bacteria 5022
123 Ga0068859_100179725 3300005617 Bacteria 2198
124 Ga0068859_100358049 3300005617 Bacteria 1554
125 Ga0068859_100746578 3300005617 Bacteria 1068
126 Ga0068864_100424917 3300005618 Bacteria 1267
127 Ga0068866_10003311 3300005718 Bacteria 6618
128 Ga0068866_10034511 3300005718 Bacteria 2464
129 Ga0068861_100006620 3300005719 Bacteria 7907
130 Ga0068861_100017161 3300005719 Bacteria 5133
131 Ga0068870_10009240 3300005840 Bacteria 4475
132 Ga0068863_100001167 3300005841 Bacteria 26238
133 Ga0068863_100008676 3300005841 Bacteria 9932
134 Ga0068858_100002047 3300005842 Bacteria 20555
135 Ga0068858_100011611 3300005842 Bacteria 8308
136 Ga0068858_100012734 3300005842 Bacteria 7925
137 Ga0068858_100181173 3300005842 Bacteria 1989
138 Ga0068860_100000087 3300005843 Bacteria 158242
139 Ga0068860_100012921 3300005843 Bacteria 8202
140 Ga0068860_100038942 3300005843 Bacteria 4547
141 Ga0068860_100262496 3300005843 Bacteria 1684
142 Ga0068862_100000077 3300005844 Bacteria 116781
143 Ga0068862_100011090 3300005844 Bacteria 7444
144 Ga0068862_100024124 3300005844 Bacteria 5101
145 Ga0068862_100433621 3300005844 Bacteria 1236
146 Ga0081455_10155028 3300005937 Bacteria 1762
147 Ga0081455_10171753 3300005937 Bacteria 1651
148 Ga0070717_10559625 3300006028 Bacteria 1036
149 Ga0070717_10659401 3300006028 Bacteria 950
150 Ga0075365_10006497 3300006038 Bacteria 6438
151 Ga0075365_10049895 3300006038 Bacteria 2759
152 Ga0075365_10146170 3300006038 Bacteria 1643
153 Ga0075365_10321614 3300006038 Bacteria 1089
154 Ga0075363_100000752 3300006048 Bacteria 11078
155 Ga0075363_100002418 3300006048 Bacteria 7622
156 Ga0075363_100016716 3300006048 Bacteria 3628
157 Ga0075363_100020840 3300006048 Bacteria 3293
158 Ga0075363_100024351 3300006048 Bacteria 3076
159 Ga0075363_100051117 3300006048 Bacteria 2203
160 Ga0075363_100061962 3300006048 Bacteria 2017
161 Ga0075363_100093528 3300006048 Bacteria 1657
162 Ga0075363_100140687 3300006048 Bacteria 1358
163 Ga0075364_10001726 3300006051 Bacteria 12028
164 Ga0075364_10005298 3300006051 Bacteria 7486
165 Ga0075364_10035728 3300006051 Bacteria 3212
166 Ga0075364_10091945 3300006051 Bacteria 2014
167 Ga0075364_10114698 3300006051 Bacteria 1800
168 Ga0075364_10183699 3300006051 Bacteria 1416
169 Ga0070715_10002894 3300006163 Bacteria 5357
170 Ga0070715_10016219 3300006163 Bacteria 2795
171 Ga0070715_10063506 3300006163 Bacteria 1628
172 Ga0070715_10092639 3300006163 Bacteria 1394
173 Ga0070716_100012068 3300006173 Bacteria 4367
174 Ga0070716_100014443 3300006173 Bacteria 4044
175 Ga0070716_100022695 3300006173 Bacteria 3319
176 Ga0070716_100071206 3300006173 Bacteria 2043
177 Ga0070712_100003140 3300006175 Bacteria 10176
178 Ga0070712_100005319 3300006175 Bacteria 7968
179 Ga0070712_100041669 3300006175 Bacteria 3153
180 Ga0070712_100288142 3300006175 Bacteria 1325
181 Ga0075362_10027884 3300006177 Bacteria 2421
182 Ga0075367_10049963 3300006178 Bacteria 2467
183 Ga0075367_10063204 3300006178 Bacteria 2213
184 Ga0075367_10302944 3300006178 Bacteria 1006
185 Ga0075369_10003028 3300006186 Bacteria 6076
186 Ga0075369_10004827 3300006186 Bacteria 5015
187 Ga0075369_10015255 3300006186 Bacteria 3081
188 Ga0075369_10021231 3300006186 Bacteria 2665
189 Ga0075369_10044584 3300006186 Bacteria 1906
190 Ga0075369_10059967 3300006186 Bacteria 1658
191 Ga0097621_100112477 3300006237 Bacteria 2302
192 Ga0097621_100136715 3300006237 Bacteria 2091
193 Ga0075370_10000341 3300006353 Bacteria 16842
194 Ga0075370_10006636 3300006353 Bacteria 5835
195 Ga0075370_10042679 3300006353 Bacteria 2562
196 Ga0075370_10097594 3300006353 Bacteria 1699
197 Ga0075370_10099080 3300006353 Bacteria 1686
198 Ga0075428_100007312 3300006844 Bacteria 12235
199 Ga0075430_100033460 3300006846 Bacteria 4363
200 Ga0068865_100003973 3300006881 Bacteria 8874
201 Ga0068865_100004511 3300006881 Bacteria 8402
202 Ga0068865_100065189 3300006881 Bacteria 2565
203 Ga0097620_100002633 3300006931 Bacteria 18260
204 Ga0097620_100009170 3300006931 Bacteria 9994
205 Ga0097620_100035220 3300006931 Bacteria 5022
206 Ga0097620_100179719 3300006931 Bacteria 2198
207 Ga0097620_100358017 3300006931 Bacteria 1554
208 Ga0097620_100746494 3300006931 Bacteria 1068
209 Ga0099795_10018115 3300007788 Bacteria 2257
210 Ga0105250_10059132 3300009092 Bacteria 1539
211 Ga0111539_10058235 3300009094 Bacteria 4584
212 Ga0105245_10010064 3300009098 Bacteria 8239
213 Ga0105245_10011752 3300009098 Bacteria 7617
214 Ga0105245_10058319 3300009098 Bacteria 3475
215 Ga0105247_10000060 3300009101 Bacteria 127879
216 Ga0105247_10003797 3300009101 Bacteria 9791
217 Ga0105247_10014399 3300009101 Bacteria 4746
218 Ga0105247_10107982 3300009101 Bacteria 1787
219 Ga0114129_10018369 3300009147 Bacteria 9960
220 Ga0105243_10001032 3300009148 Bacteria 25576
221 Ga0105243_10004112 3300009148 Bacteria 11567
222 Ga0105243_10004938 3300009148 Bacteria 10447
223 Ga0105241_10019363 3300009174 Bacteria 5019
224 Ga0105242_10007699 3300009176 Bacteria 8289
225 Ga0105242_10015610 3300009176 Bacteria 5901
226 Ga0105242_10229140 3300009176 Bacteria 1664
227 Ga0105248_10000050 3300009177 Bacteria 152667
228 Ga0105248_10006763 3300009177 Bacteria 12573
229 Ga0105248_10014903 3300009177 Bacteria 8560
230 Ga0105248_10016636 3300009177 Bacteria 8095
231 Ga0105248_10289150 3300009177 Bacteria 1846
232 Ga0105248_10672903 3300009177 Bacteria 1168
233 Ga0105237_10000302 3300009545 Bacteria 68290
234 Ga0105237_10005603 3300009545 Bacteria 14150
235 Ga0105237_10024475 3300009545 Bacteria 6176
236 Ga0105237_10037157 3300009545 Bacteria 4924
237 Ga0105238_10398072 3300009551 Bacteria 1370
238 Ga0105249_10000042 3300009553 Bacteria 195242
239 Ga0105249_10008535 3300009553 Bacteria 8931
240 Ga0105147_106159 3300009982 Bacteria 1014
241 Ga0105239_10007547 3300010375 Bacteria 12474
242 Ga0105239_10020122 3300010375 Bacteria 7363
243 Ga0105239_10145429 3300010375 Bacteria 2643
244 Ga0105239_10149605 3300010375 Bacteria 2605
245 Ga0105246_10063161 3300011119 Bacteria 2582
246 Ga0105246_10321212 3300011119 Bacteria 1258
247 Ga0157369_10731401 3300013105 Bacteria 1018
248 Ga0157374_10269811 3300013296 Bacteria 1677
249 Ga0157374_10750967 3300013296 Bacteria 990
250 Ga0157378_10009418 3300013297 Bacteria 8509
251 Ga0157378_10020814 3300013297 Bacteria 5768
252 Ga0163162_10036034 3300013306 Bacteria 4929
253 Ga0163162_10056668 3300013306 Bacteria 3946
254 Ga0163162_10135750 3300013306 Bacteria 2571
255 Ga0163162_10235301 3300013306 Bacteria 1962
256 Ga0163162_10431134 3300013306 Bacteria 1450
257 Ga0157372_10017144 3300013307 Bacteria 7776
258 Ga0157372_10027610 3300013307 Bacteria 6185
259 Ga0157375_10001384 3300013308 Bacteria 20929
260 Ga0157375_10009040 3300013308 Bacteria 8723
261 Ga0163163_10041091 3300014325 Bacteria 4521
262 Ga0163163_10171294 3300014325 Bacteria 2218
263 Ga0157380_10005913 3300014326 Bacteria 8558
264 Ga0157380_10036421 3300014326 Bacteria 3807
265 Ga0157380_10174838 3300014326 Bacteria 1880
266 Ga0157377_10003584 3300014745 Bacteria 7028
267 Ga0157377_10004754 3300014745 Bacteria 6291
268 Ga0157379_10014991 3300014968 Bacteria 6799
269 Ga0157379_10015516 3300014968 Bacteria 6686
270 Ga0157379_10057052 3300014968 Bacteria 3490
271 Ga0157376_10175865 3300014969 Bacteria 1953
272 Ga0163161_10004143 3300017792 Bacteria 10137
273 Ga0163161_10019468 3300017792 Bacteria 4763
274 Ga0163161_10056262 3300017792 Bacteria 2857
275 Ga0163161_10409716 3300017792 Bacteria 1088
276 Ga0213873_10001011 3300021358 Bacteria 4568
277 Ga0213874_10015187 3300021377 Bacteria 2027
278 Ga0213876_10001280 3300021384 Bacteria 15877
279 Ga0213876_10012437 3300021384 Bacteria 4530
280 Ga0213876_10014840 3300021384 Bacteria 4129
281 Ga0213876_10016537 3300021384 Bacteria 3899
282 Ga0213875_10009014 3300021388 Bacteria 5075
283 Ga0213875_10013022 3300021388 Bacteria 4093
284 Ga0213875_10013950 3300021388 Bacteria 3930
285 Ga0209051_1001230 3300025303 Bacteria 23021
286 Ga0209051_1004009 3300025303 Bacteria 9330
287 Ga0209051_1012348 3300025303 Bacteria 4139
288 Ga0209051_1023531 3300025303 Bacteria 2557
289 Ga0207682_10079528 3300025893 Bacteria 1402
290 Ga0207692_10005364 3300025898 Bacteria 5134
291 Ga0207692_10013460 3300025898 Bacteria 3550
292 Ga0207692_10092518 3300025898 Bacteria 1643
293 Ga0207642_10010536 3300025899 Bacteria 3264
294 Ga0207710_10000010 3300025900 Bacteria 482087
295 Ga0207710_10005512 3300025900 Bacteria 5444
296 Ga0207710_10011237 3300025900 Bacteria 3771
297 Ga0207688_10000746 3300025901 Bacteria 16161
298 Ga0207688_10003542 3300025901 Bacteria 8519
299 Ga0207688_10003584 3300025901 Bacteria 8476
300 Ga0207688_10008767 3300025901 Bacteria 5503
301 Ga0207688_10055573 3300025901 Bacteria 2222
302 Ga0207688_10111573 3300025901 Bacteria 1588
303 Ga0207688_10191867 3300025901 Bacteria 1222
304 Ga0207680_10274742 3300025903 Bacteria 1169
305 Ga0207647_10018896 3300025904 Bacteria 4646
306 Ga0207647_10037812 3300025904 Bacteria 3057
307 Ga0207647_10108787 3300025904 Bacteria 1640
308 Ga0207647_10161244 3300025904 Bacteria 1308
309 Ga0207685_10022078 3300025905 Bacteria 2144
310 Ga0207699_10007946 3300025906 Bacteria 5206
311 Ga0207699_10176649 3300025906 Bacteria 1432
312 Ga0207645_10015285 3300025907 Bacteria 5106
313 Ga0207645_10165124 3300025907 Bacteria 1449
314 Ga0207643_10028576 3300025908 Bacteria 3098
315 Ga0207654_10185231 3300025911 Bacteria 1361
316 Ga0207695_10429346 3300025913 Bacteria 1205
317 Ga0207671_10020899 3300025914 Bacteria 4977
318 Ga0207671_10045140 3300025914 Bacteria 3258
319 Ga0207671_10177721 3300025914 Bacteria 1655
320 Ga0207693_10001933 3300025915 Bacteria 18145
321 Ga0207693_10009413 3300025915 Bacteria 7968
322 Ga0207693_10018536 3300025915 Bacteria 5542
323 Ga0207693_10132318 3300025915 Bacteria 1961
324 Ga0207663_10009091 3300025916 Bacteria 5236
325 Ga0207663_10012518 3300025916 Bacteria 4589
326 Ga0207662_10031278 3300025918 Bacteria 3092
327 Ga0207662_10056518 3300025918 Bacteria 2344
328 Ga0207657_10097585 3300025919 Bacteria 2443
329 Ga0207657_10196077 3300025919 Bacteria 1627
330 Ga0207649_10338101 3300025920 Bacteria 1111
331 Ga0207681_10001541 3300025923 Bacteria 14852
332 Ga0207681_10071572 3300025923 Bacteria 2419
333 Ga0207694_10051158 3300025924 Bacteria 3202
334 Ga0207650_10357719 3300025925 Bacteria 1202
335 Ga0207659_10219904 3300025926 Bacteria 1527
336 Ga0207687_10009180 3300025927 Bacteria 6469
337 Ga0207687_10009671 3300025927 Bacteria 6306
338 Ga0207687_10023790 3300025927 Bacteria 4086
339 Ga0207687_10064377 3300025927 Bacteria 2600
340 Ga0207664_10208990 3300025929 Bacteria 1688
341 Ga0207644_10020036 3300025931 Bacteria 4543
342 Ga0207644_10172909 3300025931 Bacteria 1688
343 Ga0207690_10013423 3300025932 Bacteria 4922
344 Ga0207690_10017470 3300025932 Bacteria 4380
345 Ga0207690_10222742 3300025932 Bacteria 1444
346 Ga0207706_10001957 3300025933 Bacteria 20214
347 Ga0207706_10018529 3300025933 Bacteria 6263
348 Ga0207706_10039401 3300025933 Bacteria 4189
349 Ga0207706_10173451 3300025933 Bacteria 1895
350 Ga0207686_10004236 3300025934 Bacteria 7685
351 Ga0207686_10023126 3300025934 Bacteria 3586
352 Ga0207686_10153847 3300025934 Bacteria 1604
353 Ga0207709_10004934 3300025935 Bacteria 7636
354 Ga0207709_10005610 3300025935 Bacteria 7096
355 Ga0207709_10021313 3300025935 Bacteria 3668
356 Ga0207670_10020714 3300025936 Bacteria 4045
357 Ga0207670_10034022 3300025936 Bacteria 3289
358 Ga0207670_10071936 3300025936 Bacteria 2393
359 Ga0207669_10001689 3300025937 Bacteria 9388
360 Ga0207669_10006346 3300025937 Bacteria 5395
361 Ga0207704_10005939 3300025938 Bacteria 5658
362 Ga0207704_10093701 3300025938 Bacteria 1981
363 Ga0207665_10006415 3300025939 Bacteria 7804
364 Ga0207665_10012936 3300025939 Bacteria 5489
365 Ga0207665_10015671 3300025939 Bacteria 4975
366 Ga0207665_10062620 3300025939 Bacteria 2525
367 Ga0207711_10000339 3300025941 Bacteria 49741
368 Ga0207711_10021885 3300025941 Bacteria 5341
369 Ga0207711_10049582 3300025941 Bacteria 3594
370 Ga0207711_10063300 3300025941 Bacteria 3193
371 Ga0207711_10213700 3300025941 Bacteria 1762
372 Ga0207689_10012468 3300025942 Bacteria 7262
373 Ga0207689_10033145 3300025942 Bacteria 4292
374 Ga0207661_10491307 3300025944 Bacteria 1121
375 Ga0207661_10586827 3300025944 Bacteria 1022
376 Ga0207667_10401802 3300025949 Bacteria 1395
377 Ga0207712_10000010 3300025961 Bacteria 455972
378 Ga0207712_10009714 3300025961 Bacteria 6098
379 Ga0207712_10334766 3300025961 Bacteria 1253
380 Ga0207668_10000526 3300025972 Bacteria 24008
381 Ga0207668_10001279 3300025972 Bacteria 14992
382 Ga0207668_10009108 3300025972 Bacteria 5934
383 Ga0207640_10010313 3300025981 Bacteria 5259
384 Ga0207640_10011395 3300025981 Bacteria 5034
385 Ga0207658_10000175 3300025986 Bacteria 69284
386 Ga0207658_10011032 3300025986 Bacteria 6151
387 Ga0207658_10018649 3300025986 Bacteria 4796
388 Ga0207658_10038923 3300025986 Bacteria 3429
389 Ga0207658_10085989 3300025986 Bacteria 2423
390 Ga0207677_10005669 3300026023 Bacteria 6792
391 Ga0207677_10135233 3300026023 Bacteria 1878
392 Ga0207677_10148186 3300026023 Bacteria 1806
393 Ga0207703_10009089 3300026035 Bacteria 7823
394 Ga0207703_10075278 3300026035 Bacteria 2797
395 Ga0207703_10131800 3300026035 Bacteria 2159
396 Ga0207703_10461819 3300026035 Bacteria 1187
397 Ga0207703_10513535 3300026035 Bacteria 1126
398 Ga0207639_10165138 3300026041 Bacteria 1869
399 Ga0207639_10335125 3300026041 Bacteria 1347
400 Ga0207639_10568979 3300026041 Bacteria 1042
401 Ga0207678_10005752 3300026067 Bacteria 11060
402 Ga0207678_10016047 3300026067 Bacteria 6578
403 Ga0207678_10018037 3300026067 Bacteria 6201
404 Ga0207678_10034154 3300026067 Bacteria 4430
405 Ga0207678_10129877 3300026067 Bacteria 2149
406 Ga0207678_10164706 3300026067 Bacteria 1893
407 Ga0207708_10001762 3300026075 Bacteria 15990
408 Ga0207708_10009825 3300026075 Bacteria 7100
409 Ga0207708_10024354 3300026075 Bacteria 4578
410 Ga0207708_10073915 3300026075 Bacteria 2613
411 Ga0207702_10398547 3300026078 Bacteria 1327
412 Ga0207641_10001173 3300026088 Bacteria 26309
413 Ga0207641_10003476 3300026088 Bacteria 13956
414 Ga0207648_10002525 3300026089 Bacteria 19642
415 Ga0207648_10010554 3300026089 Bacteria 8742
416 Ga0207648_10103195 3300026089 Bacteria 2500
417 Ga0207648_10112699 3300026089 Bacteria 2388
418 Ga0207676_10064592 3300026095 Bacteria 2912
419 Ga0207676_10218230 3300026095 Bacteria 1697
420 Ga0207675_100000896 3300026118 Bacteria 29755
421 Ga0207675_100012618 3300026118 Bacteria 7894
422 Ga0207675_100047816 3300026118 Bacteria 3993
423 Ga0207683_10005892 3300026121 Bacteria 10507
424 Ga0207683_10011339 3300026121 Bacteria 7605
425 Ga0207683_10156785 3300026121 Bacteria 2057
426 Ga0207698_10039194 3300026142 Bacteria 3508
427 Ga0207698_10511760 3300026142 Bacteria 1170
428 Ga0209813_10006814 3300027866 Bacteria 2831
429 Ga0268266_10013715 3300028379 Bacteria 6979
430 Ga0268266_10030900 3300028379 Bacteria 4548
431 Ga0268266_10050887 3300028379 Bacteria 3555
432 Ga0268266_10140353 3300028379 Bacteria 2168
433 Ga0268266_10190455 3300028379 Bacteria 1872
434 Ga0268265_10000014 3300028380 Bacteria 330186
435 Ga0268265_10015013 3300028380 Bacteria 5289
436 Ga0268265_10032394 3300028380 Bacteria 3787
437 Ga0268265_10426619 3300028380 Bacteria 1232
438 Ga0268264_10000150 3300028381 Bacteria 158263
439 Ga0268264_10032743 3300028381 Bacteria 4265
440 Ga0268264_10060598 3300028381 Bacteria 3172
441 Ga0265327_10000018 3300031251 Bacteria 439197
442 Ga0265327_10001055 3300031251 Bacteria 38529
443 Ga0265327_10003531 3300031251 Bacteria 14813
444 Ga0265327_10012159 3300031251 Bacteria 5840
445 Ga0316579_10074046 3300031691 Bacteria 1617
446 Ga0307405_10137382 3300031731 Bacteria 1699
447 Ga0307413_10244730 3300031824 Bacteria 1327
448 Ga0307413_10313428 3300031824 Bacteria 1195
449 Ga0307410_10243739 3300031852 Bacteria 1394
450 Ga0307409_100065472 3300031995 Bacteria 2860
451 Ga0307416_100235983 3300032002 Bacteria 1768
452 Ga0307416_100244308 3300032002 Bacteria 1742
453 Ga0307415_100063623 3300032126 Bacteria 2564
454 Ga0307415_100205265 3300032126 Bacteria 1567
455 Ga0373961_0033577 3300035241 Bacteria 1446
456 Ga0373931_0060774 3300035691 Bacteria 2035
457 Ga0436364_0090210 3300037853 Bacteria 3782
458 Ga0436364_0106048 3300037853 Bacteria 16222
459 Ga0436364_0322663 3300037853 Bacteria 14033
460 Ga0436364_1009898 3300037853 Bacteria 3993
461 Ga0436364_1253766 3300037853 Bacteria 5106
462 Ga0436365_0291752 3300039437 Bacteria 1626
463 Ga0436365_0470752 3300039437 Bacteria 2356
464 Ga0436365_0607060 3300039437 Bacteria 4780
465 Ga0436365_0608503 3300039437 Bacteria 10612
466 Ga0436365_0953566 3300039437 Bacteria 43397
467 Ga0436365_1064965 3300039437 Bacteria 9165
468 Ga0436365_1630628 3300039437 Bacteria 72743
469 Ga0436365_1666956 3300039437 Bacteria 4991
470 Ga0436363_1156190 3300039450 Bacteria 5094
471 Ga0439461_0008453 3300041410 Bacteria 1845
472 Ga0439466_0013017 3300041411 Bacteria 3051
473 Ga0439466_0021832 3300041411 Bacteria 2264
474 Ga0439465_0022215 3300041413 Bacteria 1992
475 Ga0439465_0024775 3300041413 Bacteria 1891
476 Ga0451789_0831621 3300041443 Bacteria 1808
477 Ga0451793_0382371 3300041452 Bacteria 1560
478 Ga0451795_0376464 3300041456 Bacteria 1180
479 Ga0451841_0730527 3300041498 Bacteria 1270
480 Ga0451853_0088204 3300041512 Bacteria 4713
481 Ga0439431_0010521 3300041997 Bacteria 2100
482 Ga0439431_0012523 3300041997 Bacteria 1950
483 Ga0439442_020937 3300042002 Bacteria 1356
484 Ga0439445_0007753 3300042004 Bacteria 2499
485 Ga0439434_0007518 3300042435 Bacteria 3193
486 Ga0439434_0015541 3300042435 Bacteria 2271
487 Ga0466972_0005077 3300044658 Bacteria 6595
488 Ga0466972_0011027 3300044658 Bacteria 4537
489 Ga0466972_0020820 3300044658 Bacteria 3275
490 Ga0466972_0080398 3300044658 Bacteria 1552
491 Ga0466965_0003274 3300044683 Bacteria 7085
492 Ga0466965_0005127 3300044683 Bacteria 5882
493 Ga0466965_0032979 3300044683 Bacteria 2530
494 Ga0466965_0048201 3300044683 Bacteria 2110
495 Ga0466966_0014746 3300044684 Bacteria 5170
496 Ga0466966_0017854 3300044684 Bacteria 4685
497 Ga0466966_0019992 3300044684 Bacteria 4405
498 Ga0466966_0030900 3300044684 Bacteria 3474
499 Ga0466961_0024272 3300044693 Bacteria 3900
500 Ga0466961_0086798 3300044693 Bacteria 1977
501 Ga0466963_0057402 3300044694 Bacteria 2592
502 Ga0466963_0064655 3300044694 Bacteria 2451
503 Ga0466971_0009094 3300044719 Bacteria 4342
504 Ga0466971_0026994 3300044719 Bacteria 2570
505 Ga0466968_0001802 3300044735 Bacteria 7736
506 Ga0466968_0018354 3300044735 Bacteria 2805
507 Ga0466968_0021692 3300044735 Bacteria 2603
508 Ga0466970_0029750 3300044765 Bacteria 2878
509 Ga0466957_0010746 3300044842 Bacteria 5263
510 Ga0466957_0016389 3300044842 Bacteria 4335
511 Ga0466957_0025854 3300044842 Bacteria 3480
512 Ga0466957_0038884 3300044842 Bacteria 2869
513 Ga0466957_0043901 3300044842 Bacteria 2708
514 Ga0466957_0301806 3300044842 Bacteria 1076
515 Ga0466960_0000265 3300044901 Bacteria 18060
516 Ga0466960_0006050 3300044901 Bacteria 4834
517 Ga0466960_0025835 3300044901 Bacteria 2661
518 Ga0466960_0074763 3300044901 Bacteria 1694
519 Ga0466960_0120531 3300044901 Bacteria 1373
520 Ga0466959_0009064 3300045049 Bacteria 7061
521 Ga0466959_0014716 3300045049 Bacteria 5694
522 Ga0466959_0017458 3300045049 Bacteria 5261
523 Ga0466959_0102514 3300045049 Bacteria 2048
524 Ga0466959_0106400 3300045049 Bacteria 2005
525 Ga0466958_0000197 3300045836 Bacteria 22237
526 Ga0466958_0010043 3300045836 Bacteria 5290
527 Ga0466958_0012112 3300045836 Bacteria 4876
528 Ga0466958_0174793 3300045836 Bacteria 1361
529 Ga0466958_0219982 3300045836 Bacteria 1211
530 Ga0466967_0005234 3300045976 Bacteria 8940
531 Ga0466967_0023084 3300045976 Bacteria 5092
532 Ga0466967_0029924 3300045976 Bacteria 4564
533 Ga0466967_0032663 3300045976 Bacteria 4397
534 Ga0466967_0078788 3300045976 Bacteria 2969
535 Ga0466967_0084546 3300045976 Bacteria 2871
536 Ga0466967_0159071 3300045976 Bacteria 2119
537 Ga0466967_0259794 3300045976 Bacteria 1661
538 Ga0466967_0905345 3300045976 Bacteria 877
539 Ga0495603_0045129 3300046455 Bacteria 2629
540 Ga0495590_0120021 3300046457 Bacteria 942
541 Ga0495629_0030982 3300046459 Bacteria 3789
542 Ga0495638_0001570 3300046460 Bacteria 20486
543 Ga0495638_0119431 3300046460 Bacteria 1559
544 Ga0495580_0091923 3300046472 Bacteria 2112
545 Ga0495662_0034109 3300046476 Bacteria 2458
546 Ga0495608_0102372 3300046511 Bacteria 1846
547 Ga0495648_0004296 3300046524 Bacteria 12210
548 Ga0495668_0001186 3300046616 Bacteria 26476
549 Ga0495668_0001258 3300046616 Bacteria 25252
550 Ga0495588_0044711 3300046674 Bacteria 2269
551 Ga0495671_0119363 3300046692 Bacteria 1287
552 Ga0495649_0146175 3300046694 Bacteria 1243
553 Ga0495581_0122321 3300047315 Bacteria 1515
554 Ga0495581_0144352 3300047315 Bacteria 1389
555 Ga0495674_0253921 3300047319 Bacteria 1446
556 Ga0495672_0010022 3300047320 Bacteria 6793
557 Ga0495672_0147042 3300047320 Bacteria 1225
558 Ga0495683_0002024 3300047323 Bacteria 12559
559 Ga0495673_0002913 3300047469 Bacteria 11603
560 Ga0495686_0012826 3300047472 Bacteria 5847
561 Ga0495626_0040203 3300048091 Bacteria 2210
562 Ga0496100_0001415 3300048903 Bacteria 11731
563 Ga0496100_0001824 3300048903 Bacteria 10643
564 Ga0496100_0003985 3300048903 Bacteria 7760
565 Ga0496100_0004691 3300048903 Bacteria 7284
566 Ga0496100_0009259 3300048903 Bacteria 5530
567 Ga0496100_0051433 3300048903 Bacteria 2675
568 Ga0496100_0129812 3300048903 Bacteria 1774
569 Ga0496100_0193463 3300048903 Bacteria 1478
570 Ga0496101_0000229 3300048904 Bacteria 41526
571 Ga0496101_0000963 3300048904 Bacteria 16982
572 Ga0496101_0002114 3300048904 Bacteria 12114
573 Ga0496101_0006448 3300048904 Bacteria 7549
574 Ga0496101_0007097 3300048904 Bacteria 7243
575 Ga0496101_0008554 3300048904 Bacteria 6690
576 Ga0496101_0033334 3300048904 Bacteria 3632
577 Ga0496101_0063664 3300048904 Bacteria 2685
578 Ga0496101_0076800 3300048904 Bacteria 2461
579 Ga0496102_0000006 3300048905 Bacteria 471494
580 Ga0496102_0000235 3300048905 Bacteria 72616
581 Ga0496102_0002862 3300048905 Bacteria 14654
582 Ga0496102_0011113 3300048905 Bacteria 7755
583 Ga0496102_0017361 3300048905 Bacteria 6304
584 Ga0496102_0024467 3300048905 Bacteria 5368
585 Ga0496102_0058555 3300048905 Bacteria 3520
586 Ga0496102_0081864 3300048905 Bacteria 2977
587 Ga0496102_0144463 3300048905 Bacteria 2232
588 Ga0496102_0182791 3300048905 Bacteria 1975
589 Ga0496103_0000006 3300048906 Bacteria 470539
590 Ga0496103_0000443 3300048906 Bacteria 35626
591 Ga0496103_0001156 3300048906 Bacteria 18210
592 Ga0496103_0003079 3300048906 Bacteria 10250
593 Ga0496103_0004904 3300048906 Bacteria 8079
594 Ga0496103_0064551 3300048906 Bacteria 2282
595 Ga0496103_0272210 3300048906 Bacteria 1089
596 Ga0496104_0060473 3300048907 Bacteria 3589
597 Ga0496104_0374138 3300048907 Bacteria 1337
598 Ga0496105_0010203 3300048908 Bacteria 7382
599 Ga0496105_0126134 3300048908 Bacteria 2110
600 Ga0496105_0170006 3300048908 Bacteria 1787
601 Ga0496106_0001616 3300048909 Bacteria 16934
602 Ga0496106_0001655 3300048909 Bacteria 16718
603 Ga0496106_0006301 3300048909 Bacteria 8784
604 Ga0496106_0014740 3300048909 Bacteria 5779
605 Ga0496106_0020218 3300048909 Bacteria 4939
606 Ga0496106_0028370 3300048909 Bacteria 4169
607 Ga0496106_0029602 3300048909 Bacteria 4082
608 Ga0496106_0045427 3300048909 Bacteria 3299
609 Ga0496106_0260290 3300048909 Bacteria 1388
610 Ga0496107_0007986 3300048910 Bacteria 7304
611 Ga0496107_0075485 3300048910 Bacteria 2454
612 Ga0496107_0077249 3300048910 Bacteria 2425
613 Ga0496107_0087704 3300048910 Bacteria 2271
614 Ga0496107_0254941 3300048910 Bacteria 1305
615 Ga0496108_0000222 3300048911 Bacteria 50962
616 Ga0496108_0002078 3300048911 Bacteria 16016
617 Ga0496108_0018950 3300048911 Bacteria 5643
618 Ga0496108_0023890 3300048911 Bacteria 5032
619 Ga0496108_0046469 3300048911 Bacteria 3627
620 Ga0496108_0228848 3300048911 Bacteria 1616
621 Ga0496108_0249161 3300048911 Bacteria 1545
622 Ga0496109_0003500 3300048912 Bacteria 13117
623 Ga0496109_0004447 3300048912 Bacteria 11707
624 Ga0496109_0011117 3300048912 Bacteria 7720
625 Ga0496109_0025692 3300048912 Bacteria 5249
626 Ga0496109_0032560 3300048912 Bacteria 4686
627 Ga0496109_0061059 3300048912 Bacteria 3445
628 Ga0496110_0016452 3300048913 Bacteria 6176
629 Ga0496110_0018791 3300048913 Bacteria 5803
630 Ga0496110_0051859 3300048913 Bacteria 3605
631 Ga0496110_0061402 3300048913 Bacteria 3317
632 Ga0496110_0074895 3300048913 Bacteria 3007
633 Ga0496111_0043312 3300048914 Bacteria 3235
634 Ga0496112_0032517 3300048915 Bacteria 5066
635 Ga0496112_0056866 3300048915 Bacteria 3851
636 Ga0496112_0067467 3300048915 Bacteria 3531
637 Ga0496112_0078541 3300048915 Bacteria 3264
638 Ga0496112_0110099 3300048915 Bacteria 2724
639 Ga0496112_0230986 3300048915 Bacteria 1804
640 Ga0496112_0247951 3300048915 Bacteria 1733
641 Ga0496112_0515079 3300048915 Bacteria 1131
642 Ga0496113_0003042 3300048916 Bacteria 9934
643 Ga0496113_0006617 3300048916 Bacteria 7370
644 Ga0496114_0000153 3300048917 Bacteria 50028
645 Ga0496114_0023001 3300048917 Bacteria 5080
646 Ga0496114_0024447 3300048917 Bacteria 4932
647 Ga0496114_0590628 3300048917 Bacteria 980
648 Ga0496115_0006985 3300048918 Bacteria 8292
649 Ga0496115_0007857 3300048918 Bacteria 7866
650 Ga0496115_0016046 3300048918 Bacteria 5695
651 Ga0496115_0145736 3300048918 Bacteria 1954
652 Ga0496115_0481158 3300048918 Bacteria 1000
653 Ga0496116_0000025 3300048919 Bacteria 470539
654 Ga0496116_0005302 3300048919 Bacteria 12019
655 Ga0496116_0008758 3300048919 Bacteria 8727
656 Ga0496117_0000006 3300048920 Bacteria 758420
657 Ga0496117_0000521 3300048920 Bacteria 63484
658 Ga0496117_0013197 3300048920 Bacteria 7222
659 Ga0496117_0102360 3300048920 Bacteria 1808
660 Ga0496117_0155606 3300048920 Bacteria 1346
661 Ga0496118_0000004 3300048921 Bacteria 758420
662 Ga0496118_0000455 3300048921 Bacteria 67720
663 Ga0496118_0000730 3300048921 Bacteria 53095
664 Ga0496118_0022416 3300048921 Bacteria 5520
665 Ga0496119_0000035 3300048922 Bacteria 217007
666 Ga0496119_0009787 3300048922 Bacteria 8155
667 Ga0496120_0000079 3300048923 Bacteria 160413
668 Ga0496120_0009649 3300048923 Bacteria 6816
669 Ga0496120_0019833 3300048923 Bacteria 4288
670 Ga0496121_0000004 3300048924 Bacteria 1139011
671 Ga0496121_0000090 3300048924 Bacteria 217920
672 Ga0496121_0175861 3300048924 Bacteria 1550
673 Ga0496122_0000805 3300048925 Bacteria 60172
674 Ga0496122_0003041 3300048925 Bacteria 22684
675 Ga0496123_0004493 3300048926 Bacteria 14614
676 Ga0496123_0012202 3300048926 Bacteria 7352
677 Ga0496123_0029986 3300048926 Bacteria 3991
678 Ga0496124_0000221 3300048927 Bacteria 110879
679 Ga0496125_0000003 3300048928 Bacteria 1189767
680 Ga0496125_0030577 3300048928 Bacteria 4814
681 Ga0496125_0105437 3300048928 Bacteria 2060
682 Ga0496125_0119559 3300048928 Bacteria 1884
683 Ga0496126_0000001 3300048929 Bacteria 1139011
684 Ga0496126_0004049 3300048929 Bacteria 17825
685 Ga0496126_0018195 3300048929 Bacteria 6972
686 Ga0496126_0026431 3300048929 Bacteria 5566
687 Ga0496126_0045421 3300048929 Bacteria 4037
688 Ga0501032_0014425 3300049569 Bacteria 5597
689 Ga0501032_0093439 3300049569 Bacteria 1994
690 Ga0501033_0331741 3300049570 Bacteria 1067
691 Ga0501034_0028270 3300049571 Bacteria 5705
692 Ga0501034_0035636 3300049571 Bacteria 5044
693 Ga0501034_0204194 3300049571 Bacteria 1933
694 Ga0501036_0001863 3300049572 Bacteria 16348
695 Ga0501036_0056555 3300049572 Bacteria 3324
696 Ga0501036_0076419 3300049572 Bacteria 2833
697 Ga0501037_0047879 3300049573 Bacteria 3132
698 Ga0501037_0057369 3300049573 Bacteria 2843
699 Ga0501039_0000771 3300049575 Bacteria 23004
700 Ga0501043_0000790 3300049579 Bacteria 28168
701 Ga0501046_0000382 3300049580 Bacteria 44315
702 Ga0501047_0002654 3300049581 Bacteria 17016
703 Ga0501047_0017356 3300049581 Bacteria 6893
704 Ga0501048_0040031 3300049582 Bacteria 3359
705 Ga0501067_0049893 3300049583 Bacteria 2319
706 Ga0501069_0026674 3300049585 Bacteria 3164
707 Ga0501069_0098520 3300049585 Bacteria 1658
708 Ga0501070_0001555 3300049586 Bacteria 20409
709 Ga0501070_0008775 3300049586 Bacteria 8547
710 Ga0501073_0144706 3300049589 Bacteria 1647
711 Ga0501077_0063642 3300049593 Bacteria 2340
712 Ga0501080_0134766 3300049742 Bacteria 2286
713 Ga0501080_0155187 3300049742 Bacteria 2115
714 Ga0501035_0007912 3300049822 Bacteria 9926
715 Ga0501035_0011908 3300049822 Bacteria 8049
716 Ga0501044_0001394 3300049823 Bacteria 28323
717 Ga0501044_0002938 3300049823 Bacteria 19390
718 Ga0501044_0018624 3300049823 Bacteria 7438
719 nmdc:mga03683_58615_c1 3300050489 Bacteria 1623
720 nmdc:mga03n38_10214_c1 3300050490 Bacteria 3445
721 nmdc:mga03n38_11440_c1 3300050490 Bacteria 3307
722 nmdc:mga03n38_17821_c1 3300050490 Bacteria 2789
723 nmdc:mga03n38_184540_c1 3300050490 Bacteria 1071
724 nmdc:mga03n38_23413_c1 3300050490 Bacteria 2512
725 nmdc:mga03n38_34752_c1 3300050490 Bacteria 2155
726 nmdc:mga03n38_52956_c1 3300050490 Bacteria 1818
727 nmdc:mga03n38_8139_c1 3300050490 Bacteria 3747
728 nmdc:mga03n38_98603_c1 3300050490 Bacteria 1406
729 nmdc:mga00v17_114846_c1 3300050491 Bacteria 1710
730 nmdc:mga00v17_1611_c1 3300050491 Bacteria 11784
731 nmdc:mga00v17_244358_c1 3300050491 Bacteria 1164
732 nmdc:mga00v17_29712_c1 3300050491 Bacteria 3209
733 nmdc:mga00v17_41855_c1 3300050491 Bacteria 2753
734 nmdc:mga00v17_7882_c1 3300050491 Bacteria 5713
735 nmdc:mga00v17_8457_c1 3300050491 Bacteria 5539
736 nmdc:mga00v17_95658_c1 3300050491 Bacteria 1870
737 nmdc:mga0yw44_14399_c1 3300050492 Bacteria 4200
738 nmdc:mga0yw44_14561_c1 3300050492 Bacteria 4180
739 nmdc:mga0yw44_224404_c1 3300050492 Bacteria 1246
740 nmdc:mga0yw44_224955_c1 3300050492 Bacteria 1244
741 nmdc:mga0yw44_6885_c1 3300050492 Bacteria 5537
742 nmdc:mga06z11_25107_c1 3300050494 Bacteria 2820
743 nmdc:mga06z11_270266_c1 3300050494 Bacteria 1005
744 nmdc:mga04h51_1888_c1 3300050495 Bacteria 3567
745 nmdc:mga07m45_127291_c1 3300050496 Bacteria 1473
746 nmdc:mga07m45_182642_c1 3300050496 Bacteria 1220
747 nmdc:mga07m45_18917_c1 3300050496 Bacteria 3726
748 nmdc:mga07m45_47330_c1 3300050496 Bacteria 2418
749 nmdc:mga07m45_47429_c2 3300050496 Bacteria 1673
750 nmdc:mga07m45_81459_c1 3300050496 Bacteria 1848
751 nmdc:mga07m45_94690_c1 3300050496 Bacteria 1359
752 nmdc:mga05p37_35429_c1 3300050507 Bacteria 6119
753 nmdc:mga0qj67_28952_c1 3300050509 Bacteria 4300
754 nmdc:mga08y16_44941_c1 3300050511 Bacteria 4628
755 nmdc:mga0sz30_17701_c1 3300050516 Bacteria 2844
756 nmdc:mga0sz30_20679_c1 3300050516 Bacteria 2656
757 nmdc:mga0sz30_48571_c1 3300050516 Bacteria 1795
758 nmdc:mga0sz30_654_c2 3300050516 Bacteria 10386
759 nmdc:mga0sz30_716_c1 3300050516 Bacteria 12200
760 nmdc:mga0sz30_8193_c1 3300050516 Bacteria 3939
761 Ga0500610_0001004 3300053079 Bacteria 9213
762 Ga0500635_0009648 3300053080 Bacteria 2685
763 Ga0500643_001666 3300053087 Bacteria 12380
764 Ga0500646_0069051 3300053090 Bacteria 1056
765 Ga0500641_0063303 3300053096 Bacteria 1544
766 Ga0500641_0104360 3300053096 Bacteria 1217
767 Ga0500642_0005874 3300053130 Bacteria 4000
768 Ga0500652_000149 3300053131 Bacteria 26512
769 Ga0500559_0033419 3300053136 Bacteria 2214
770 Ga0500616_0003317 3300053153 Bacteria 12408
771 Ga0500616_0067983 3300053153 Bacteria 1825
772 Ga0500627_0001152 3300053158 Bacteria 7250
773 Ga0500633_0066770 3300053160 Bacteria 1277
774 Ga0500645_000412 3300053730 Bacteria 29924
775 Ga0500645_019094 3300053730 Bacteria 2135
776 Ga0466962_0009524 3300061719 Bacteria 4658
777 Ga0466962_0013269 3300061719 Bacteria 3962
778 2523385106 2523231044 Bacteria 6434991
779 2548699028 2547132424 Bacteria 8348532
780 2548699266 2547132424 Bacteria 8348532
781 2552110701 2551306166 Bacteria 9731570
782 2566991590 2565956761 Bacteria 6601618
783 2566992135 2565956761 Bacteria 6601618
784 2644490599 2643221687 Bacteria 6500351
785 2644513928 2643221692 Bacteria 7282860
786 2644637000 2643221715 Bacteria 6671032
787 2738668319 2738541264 Bacteria 5935393
788 2738707027 2738541274 Bacteria 6909446
789 2738888006 2738541308 Bacteria 7020677
790 2738888324 2738541308 Bacteria 7020677
791 2739147389 2738541356 Bacteria 5935017
792 2739204184 2738543005 Bacteria 5278128
793 2739238173 2738543011 Bacteria 5731169
794 2739333731 2738543028 Bacteria 6917070
795 2739364818 2738543034 Bacteria 6084756
796 2744957276 2744054611 Bacteria 5611514
797 2753037780 2751185725 Bacteria 5740550
798 2753325648 2751185792 Bacteria 5739090
799 2842139231 2842134933 Bacteria 5847019
800 2842891154 2842888712 Bacteria 4279094
801 2889303295 2889300758 Bacteria 5690814
802 2902798637 2902792274 Bacteria 7270173
803 2902800514 2902799365 Bacteria 5419524
804 2902814847 2902810491 Bacteria 6794147
805 2902843243 2902837492 Bacteria 6697721
806 2904538043 2904535858 Bacteria 6308016
807 2904541112 2904535858 Bacteria 6308016
808 2904766540 2904765812 Bacteria 5369154
809 2904772708 2904770941 Bacteria 5580202
810 2908811499 2908811453 Bacteria 5478616
811 2919421024 2919420072 Bacteria 5390363
812 2919433218 2919432681 Bacteria 5390474
813 2919716985 2919713450 Bacteria 7431245
814 2922557227 2922554459 Bacteria 6683962
815 2922560755 2922554459 Bacteria 6683962
816 2928145071 2928142448 Bacteria 5288925
817 2929217502 2929212328 Bacteria 7708288
818 2932400448 2932398195 Bacteria 3847976
819 2939584760 2939582691 Bacteria 7088898
820 2939745816 2939743619 Bacteria 5762299
821 2974318529 2974315732 Bacteria 4602776
822 2984526740 2984523437 Bacteria 4508481
823 Ga0075370_10014527
824 JGI24746J21847_1000249
825 JGI24746J21847_1001185
826 JGI24747J21853_1006288
827 JGI24743J22301_10015474
828 JGI24745J21846_1002583
829 JGI24749J21850_1011289
830 JGI24744J21845_10000863
831 JGI24744J21845_10002207
832 JGI24034J26672_10005997
833 JGI24742J22300_10010545
834 rootH2_10094652
835 Ga0055540_1000737
836 Ga0070676_10048429
837 Ga0070676_10202530
838 Ga0070683_100293629
839 Ga0070690_100026077
840 Ga0070670_100127278
841 Ga0070666_10037531
842 Ga0070666_10116468
843 Ga0070666_10121198
844 Ga0070666_10176264
845 Ga0070680_100248524
846 Ga0070682_100011980
847 Ga0070682_100032669
848 Ga0070682_100105755
849 Ga0068868_100005086
850 Ga0070660_100032332
851 Ga0070660_100336894
852 Ga0070689_100003641
853 Ga0070689_100004126
854 Ga0070691_10008508
855 Ga0070691_10009526
856 Ga0070691_10094944
857 Ga0070661_100310155
858 Ga0070668_100000769
859 Ga0070668_100008191
860 Ga0070668_100019076
861 Ga0070668_100038011
862 Ga0070668_100069362
863 Ga0070669_100003680
864 Ga0070669_100020383
865 Ga0070671_100012064
866 Ga0070674_100000153
867 Ga0070674_100003905
868 Ga0070674_100132429
869 Ga0070674_100172331
870 Ga0070673_100036906
871 Ga0070688_100006433
872 Ga0070688_100011192
873 Ga0070688_100063455
874 Ga0070659_100024397
875 Ga0070659_100037415
876 Ga0070659_100317684
877 Ga0070667_100000207
878 Ga0070667_100001930
879 Ga0070667_100008191
880 Ga0070667_100047120
881 Ga0070667_100133356
882 Ga0070667_100531595
883 Ga0070709_10015484
884 Ga0070709_10019600
885 Ga0070709_10020647
886 Ga0070714_100077941
887 Ga0070714_100404976
888 Ga0070713_100191382
889 Ga0070713_100495077
890 Ga0070710_10002949
891 Ga0070710_10005582
892 Ga0070710_10017972
893 Ga0070710_10038842
894 Ga0070701_10009581
895 Ga0070701_10026187
896 Ga0070701_10095330
897 Ga0070711_100000205
898 Ga0070711_100006693
899 Ga0070711_100008390
900 Ga0070705_100008794
901 Ga0070700_100000708
902 Ga0070700_100001321
903 Ga0070700_100063074
904 Ga0070663_100010779
905 Ga0070663_100011227
906 Ga0070663_100212952
907 Ga0070678_100004244
908 Ga0070678_100007027
909 Ga0070678_100023099
910 Ga0070678_100229492
911 Ga0070662_100005093
912 Ga0070662_100015171
913 Ga0070662_100034884
914 Ga0070662_100291678
915 Ga0068867_100010568
916 Ga0068867_100013125
917 Ga0070685_10007226
918 Ga0070684_100139182
919 Ga0068853_100009963
920 Ga0068853_100016405
921 Ga0070672_100147140
922 Ga0070686_100047050
923 Ga0070695_100090310
924 Ga0070696_100004265
925 Ga0070696_100173672
926 Ga0070696_100279821
927 Ga0070693_100014322
928 Ga0070665_100012212
929 Ga0070665_100025199
930 Ga0070665_100027972
931 Ga0070665_100146646
932 Ga0070704_100011678
933 Ga0070704_100049087
934 Ga0070704_100157550
935 Ga0068855_100198480
936 Ga0068855_100455795
937 Ga0068854_100000746
938 Ga0068856_100258154
939 Ga0070702_100001885
940 Ga0070702_100208948
941 Ga0068852_100056062
942 Ga0068859_100002633
943 Ga0068859_100009168
944 Ga0068859_100035219
945 Ga0068859_100179725
946 Ga0068859_100358049
947 Ga0068859_100746578
948 Ga0068864_100424917
949 Ga0068866_10003311
950 Ga0068866_10034511
951 Ga0068861_100006620
952 Ga0068861_100017161
953 Ga0068870_10009240
954 Ga0068863_100001167
955 Ga0068863_100008676
956 Ga0068858_100002047
957 Ga0068858_100011611
958 Ga0068858_100012734
959 Ga0068858_100181173
960 Ga0068860_100000087
961 Ga0068860_100012921
962 Ga0068860_100038942
963 Ga0068860_100262496
964 Ga0068862_100000077
965 Ga0068862_100011090
966 Ga0068862_100024124
967 Ga0068862_100433621
968 Ga0081455_10155028
969 Ga0081455_10171753
970 Ga0070717_10559625
971 Ga0070717_10659401
972 Ga0075365_10006497
973 Ga0075365_10049895
974 Ga0075365_10146170
975 Ga0075365_10321614
976 Ga0075363_100000752
977 Ga0075363_100002418
978 Ga0075363_100016716
979 Ga0075363_100020840
980 Ga0075363_100024351
981 Ga0075363_100051117
982 Ga0075363_100061962
983 Ga0075363_100093528
984 Ga0075363_100140687
985 Ga0075364_10001726
986 Ga0075364_10005298
987 Ga0075364_10035728
988 Ga0075364_10091945
989 Ga0075364_10114698
990 Ga0075364_10183699
991 Ga0070715_10002894
992 Ga0070715_10016219
993 Ga0070715_10063506
994 Ga0070715_10092639
995 Ga0070716_100012068
996 Ga0070716_100014443
997 Ga0070716_100022695
998 Ga0070716_100071206
999 Ga0070712_100003140
1000 Ga0070712_100005319
1001 Ga0070712_100041669
1002 Ga0070712_100288142
1003 Ga0075362_10027884
1004 Ga0075367_10049963
1005 Ga0075367_10063204
1006 Ga0075367_10302944
1007 Ga0075369_10003028
1008 Ga0075369_10004827
1009 Ga0075369_10015255
1010 Ga0075369_10021231
1011 Ga0075369_10044584
1012 Ga0075369_10059967
1013 Ga0097621_100112477
1014 Ga0097621_100136715
1015 Ga0075370_10000341
1016 Ga0075370_10006636
1017 Ga0075370_10042679
1018 Ga0075370_10097594
1019 Ga0075370_10099080
1020 Ga0075428_100007312
1021 Ga0075430_100033460
1022 Ga0068865_100003973
1023 Ga0068865_100004511
1024 Ga0068865_100065189
1025 Ga0097620_100002633
1026 Ga0097620_100009170
1027 Ga0097620_100035220
1028 Ga0097620_100179719
1029 Ga0097620_100358017
1030 Ga0097620_100746494
1031 Ga0099795_10018115
1032 Ga0105250_10059132
1033 Ga0111539_10058235
1034 Ga0105245_10010064
1035 Ga0105245_10011752
1036 Ga0105245_10058319
1037 Ga0105247_10000060
1038 Ga0105247_10003797
1039 Ga0105247_10014399
1040 Ga0105247_10107982
1041 Ga0114129_10018369
1042 Ga0105243_10001032
1043 Ga0105243_10004112
1044 Ga0105243_10004938
1045 Ga0105241_10019363
1046 Ga0105242_10007699
1047 Ga0105242_10015610
1048 Ga0105242_10229140
1049 Ga0105248_10000050
1050 Ga0105248_10006763
1051 Ga0105248_10014903
1052 Ga0105248_10016636
1053 Ga0105248_10289150
1054 Ga0105248_10672903
1055 Ga0105237_10000302
1056 Ga0105237_10005603
1057 Ga0105237_10024475
1058 Ga0105237_10037157
1059 Ga0105238_10398072
1060 Ga0105249_10000042
1061 Ga0105249_10008535
1062 Ga0105147_106159
1063 Ga0105239_10007547
1064 Ga0105239_10020122
1065 Ga0105239_10145429
1066 Ga0105239_10149605
1067 Ga0105246_10063161
1068 Ga0105246_10321212
1069 Ga0157369_10731401
1070 Ga0157374_10269811
1071 Ga0157374_10750967
1072 Ga0157378_10009418
1073 Ga0157378_10020814
1074 Ga0163162_10036034
1075 Ga0163162_10056668
1076 Ga0163162_10135750
1077 Ga0163162_10235301
1078 Ga0163162_10431134
1079 Ga0157372_10017144
1080 Ga0157372_10027610
1081 Ga0157375_10001384
1082 Ga0157375_10009040
1083 Ga0163163_10041091
1084 Ga0163163_10171294
1085 Ga0157380_10005913
1086 Ga0157380_10036421
1087 Ga0157380_10174838
1088 Ga0157377_10003584
1089 Ga0157377_10004754
1090 Ga0157379_10014991
1091 Ga0157379_10015516
1092 Ga0157379_10057052
1093 Ga0157376_10175865
1094 Ga0163161_10004143
1095 Ga0163161_10019468
1096 Ga0163161_10056262
1097 Ga0163161_10409716
1098 Ga0213873_10001011
1099 Ga0213874_10015187
1100 Ga0213876_10001280
1101 Ga0213876_10012437
1102 Ga0213876_10014840
1103 Ga0213876_10016537
1104 Ga0213875_10009014
1105 Ga0213875_10013022
1106 Ga0213875_10013950
1107 Ga0209051_1001230
1108 Ga0209051_1004009
1109 Ga0209051_1012348
1110 Ga0209051_1023531
1111 Ga0207682_10079528
1112 Ga0207692_10005364
1113 Ga0207692_10013460
1114 Ga0207692_10092518
1115 Ga0207642_10010536
1116 Ga0207710_10000010
1117 Ga0207710_10005512
1118 Ga0207710_10011237
1119 Ga0207688_10000746
1120 Ga0207688_10003542
1121 Ga0207688_10003584
1122 Ga0207688_10008767
1123 Ga0207688_10055573
1124 Ga0207688_10111573
1125 Ga0207688_10191867
1126 Ga0207680_10274742
1127 Ga0207647_10018896
1128 Ga0207647_10037812
1129 Ga0207647_10108787
1130 Ga0207647_10161244
1131 Ga0207685_10022078
1132 Ga0207699_10007946
1133 Ga0207699_10176649
1134 Ga0207645_10015285
1135 Ga0207645_10165124
1136 Ga0207643_10028576
1137 Ga0207654_10185231
1138 Ga0207695_10429346
1139 Ga0207671_10020899
1140 Ga0207671_10045140
1141 Ga0207671_10177721
1142 Ga0207693_10001933
1143 Ga0207693_10009413
1144 Ga0207693_10018536
1145 Ga0207693_10132318
1146 Ga0207663_10009091
1147 Ga0207663_10012518
1148 Ga0207662_10031278
1149 Ga0207662_10056518
1150 Ga0207657_10097585
1151 Ga0207657_10196077
1152 Ga0207649_10338101
1153 Ga0207681_10001541
1154 Ga0207681_10071572
1155 Ga0207694_10051158
1156 Ga0207650_10357719
1157 Ga0207659_10219904
1158 Ga0207687_10009180
1159 Ga0207687_10009671
1160 Ga0207687_10023790
1161 Ga0207687_10064377
1162 Ga0207664_10208990
1163 Ga0207644_10020036
1164 Ga0207644_10172909
1165 Ga0207690_10013423
1166 Ga0207690_10017470
1167 Ga0207690_10222742
1168 Ga0207706_10001957
1169 Ga0207706_10018529
1170 Ga0207706_10039401
1171 Ga0207706_10173451
1172 Ga0207686_10004236
1173 Ga0207686_10023126
1174 Ga0207686_10153847
1175 Ga0207709_10004934
1176 Ga0207709_10005610
1177 Ga0207709_10021313
1178 Ga0207670_10020714
1179 Ga0207670_10034022
1180 Ga0207670_10071936
1181 Ga0207669_10001689
1182 Ga0207669_10006346
1183 Ga0207704_10005939
1184 Ga0207704_10093701
1185 Ga0207665_10006415
1186 Ga0207665_10012936
1187 Ga0207665_10015671
1188 Ga0207665_10062620
1189 Ga0207711_10000339
1190 Ga0207711_10021885
1191 Ga0207711_10049582
1192 Ga0207711_10063300
1193 Ga0207711_10213700
1194 Ga0207689_10012468
1195 Ga0207689_10033145
1196 Ga0207661_10491307
1197 Ga0207661_10586827
1198 Ga0207667_10401802
1199 Ga0207712_10000010
1200 Ga0207712_10009714
1201 Ga0207712_10334766
1202 Ga0207668_10000526
1203 Ga0207668_10001279
1204 Ga0207668_10009108
1205 Ga0207640_10010313
1206 Ga0207640_10011395
1207 Ga0207658_10000175
1208 Ga0207658_10011032
1209 Ga0207658_10018649
1210 Ga0207658_10038923
1211 Ga0207658_10085989
1212 Ga0207677_10005669
1213 Ga0207677_10135233
1214 Ga0207677_10148186
1215 Ga0207703_10009089
1216 Ga0207703_10075278
1217 Ga0207703_10131800
1218 Ga0207703_10461819
1219 Ga0207703_10513535
1220 Ga0207639_10165138
1221 Ga0207639_10335125
1222 Ga0207639_10568979
1223 Ga0207678_10005752
1224 Ga0207678_10016047
1225 Ga0207678_10018037
1226 Ga0207678_10034154
1227 Ga0207678_10129877
1228 Ga0207678_10164706
1229 Ga0207708_10001762
1230 Ga0207708_10009825
1231 Ga0207708_10024354
1232 Ga0207708_10073915
1233 Ga0207702_10398547
1234 Ga0207641_10001173
1235 Ga0207641_10003476
1236 Ga0207648_10002525
1237 Ga0207648_10010554
1238 Ga0207648_10103195
1239 Ga0207648_10112699
1240 Ga0207676_10064592
1241 Ga0207676_10218230
1242 Ga0207675_100000896
1243 Ga0207675_100012618
1244 Ga0207675_100047816
1245 Ga0207683_10005892
1246 Ga0207683_10011339
1247 Ga0207683_10156785
1248 Ga0207698_10039194
1249 Ga0207698_10511760
1250 Ga0209813_10006814
1251 Ga0268266_10013715
1252 Ga0268266_10030900
1253 Ga0268266_10050887
1254 Ga0268266_10140353
1255 Ga0268266_10190455
1256 Ga0268265_10000014
1257 Ga0268265_10015013
1258 Ga0268265_10032394
1259 Ga0268265_10426619
1260 Ga0268264_10000150
1261 Ga0268264_10032743
1262 Ga0268264_10060598
1263 Ga0265327_10000018
1264 Ga0265327_10001055
1265 Ga0265327_10003531
1266 Ga0265327_10012159
1267 Ga0316579_10074046
1268 Ga0307405_10137382
1269 Ga0307413_10244730
1270 Ga0307413_10313428
1271 Ga0307410_10243739
1272 Ga0307409_100065472
1273 Ga0307416_100235983
1274 Ga0307416_100244308
1275 Ga0307415_100063623
1276 Ga0307415_100205265
1277 Ga0373961_0033577
1278 Ga0373931_0060774
1279 Ga0436364_0090210
1280 Ga0436364_0106048
1281 Ga0436364_0322663
1282 Ga0436364_1009898
1283 Ga0436364_1253766
1284 Ga0436365_0291752
1285 Ga0436365_0470752
1286 Ga0436365_0607060
1287 Ga0436365_0608503
1288 Ga0436365_0953566
1289 Ga0436365_1064965
1290 Ga0436365_1630628
1291 Ga0436365_1666956
1292 Ga0436363_1156190
1293 Ga0439461_0008453
1294 Ga0439466_0013017
1295 Ga0439466_0021832
1296 Ga0439465_0022215
1297 Ga0439465_0024775
1298 Ga0451789_0831621
1299 Ga0451793_0382371
1300 Ga0451795_0376464
1301 Ga0451841_0730527
1302 Ga0451853_0088204
1303 Ga0439431_0010521
1304 Ga0439431_0012523
1305 Ga0439442_020937
1306 Ga0439445_0007753
1307 Ga0439434_0007518
1308 Ga0439434_0015541
1309 Ga0466972_0005077
1310 Ga0466972_0011027
1311 Ga0466972_0020820
1312 Ga0466972_0080398
1313 Ga0466965_0003274
1314 Ga0466965_0005127
1315 Ga0466965_0032979
1316 Ga0466965_0048201
1317 Ga0466966_0014746
1318 Ga0466966_0017854
1319 Ga0466966_0019992
1320 Ga0466966_0030900
1321 Ga0466961_0024272
1322 Ga0466961_0086798
1323 Ga0466963_0057402
1324 Ga0466963_0064655
1325 Ga0466971_0009094
1326 Ga0466971_0026994
1327 Ga0466968_0001802
1328 Ga0466968_0018354
1329 Ga0466968_0021692
1330 Ga0466970_0029750
1331 Ga0466957_0010746
1332 Ga0466957_0016389
1333 Ga0466957_0025854
1334 Ga0466957_0038884
1335 Ga0466957_0043901
1336 Ga0466957_0301806
1337 Ga0466960_0000265
1338 Ga0466960_0006050
1339 Ga0466960_0025835
1340 Ga0466960_0074763
1341 Ga0466960_0120531
1342 Ga0466959_0009064
1343 Ga0466959_0014716
1344 Ga0466959_0017458
1345 Ga0466959_0102514
1346 Ga0466959_0106400
1347 Ga0466958_0000197
1348 Ga0466958_0010043
1349 Ga0466958_0012112
1350 Ga0466958_0174793
1351 Ga0466958_0219982
1352 Ga0466967_0005234
1353 Ga0466967_0023084
1354 Ga0466967_0029924
1355 Ga0466967_0032663
1356 Ga0466967_0078788
1357 Ga0466967_0084546
1358 Ga0466967_0159071
1359 Ga0466967_0259794
1360 Ga0466967_0905345
1361 Ga0495603_0045129
1362 Ga0495590_0120021
1363 Ga0495629_0030982
1364 Ga0495638_0001570
1365 Ga0495638_0119431
1366 Ga0495580_0091923
1367 Ga0495662_0034109
1368 Ga0495608_0102372
1369 Ga0495648_0004296
1370 Ga0495668_0001186
1371 Ga0495668_0001258
1372 Ga0495588_0044711
1373 Ga0495671_0119363
1374 Ga0495649_0146175
1375 Ga0495581_0122321
1376 Ga0495581_0144352
1377 Ga0495674_0253921
1378 Ga0495672_0010022
1379 Ga0495672_0147042
1380 Ga0495683_0002024
1381 Ga0495673_0002913
1382 Ga0495686_0012826
1383 Ga0495626_0040203
1384 Ga0496100_0001415
1385 Ga0496100_0001824
1386 Ga0496100_0003985
1387 Ga0496100_0004691
1388 Ga0496100_0009259
1389 Ga0496100_0051433
1390 Ga0496100_0129812
1391 Ga0496100_0193463
1392 Ga0496101_0000229
1393 Ga0496101_0000963
1394 Ga0496101_0002114
1395 Ga0496101_0006448
1396 Ga0496101_0007097
1397 Ga0496101_0008554
1398 Ga0496101_0033334
1399 Ga0496101_0063664
1400 Ga0496101_0076800
1401 Ga0496102_0000006
1402 Ga0496102_0000235
1403 Ga0496102_0002862
1404 Ga0496102_0011113
1405 Ga0496102_0017361
1406 Ga0496102_0024467
1407 Ga0496102_0058555
1408 Ga0496102_0081864
1409 Ga0496102_0144463
1410 Ga0496102_0182791
1411 Ga0496103_0000006
1412 Ga0496103_0000443
1413 Ga0496103_0001156
1414 Ga0496103_0003079
1415 Ga0496103_0004904
1416 Ga0496103_0064551
1417 Ga0496103_0272210
1418 Ga0496104_0060473
1419 Ga0496104_0374138
1420 Ga0496105_0010203
1421 Ga0496105_0126134
1422 Ga0496105_0170006
1423 Ga0496106_0001616
1424 Ga0496106_0001655
1425 Ga0496106_0006301
1426 Ga0496106_0014740
1427 Ga0496106_0020218
1428 Ga0496106_0028370
1429 Ga0496106_0029602
1430 Ga0496106_0045427
1431 Ga0496106_0260290
1432 Ga0496107_0007986
1433 Ga0496107_0075485
1434 Ga0496107_0077249
1435 Ga0496107_0087704
1436 Ga0496107_0254941
1437 Ga0496108_0000222
1438 Ga0496108_0002078
1439 Ga0496108_0018950
1440 Ga0496108_0023890
1441 Ga0496108_0046469
1442 Ga0496108_0228848
1443 Ga0496108_0249161
1444 Ga0496109_0003500
1445 Ga0496109_0004447
1446 Ga0496109_0011117
1447 Ga0496109_0025692
1448 Ga0496109_0032560
1449 Ga0496109_0061059
1450 Ga0496110_0016452
1451 Ga0496110_0018791
1452 Ga0496110_0051859
1453 Ga0496110_0061402
1454 Ga0496110_0074895
1455 Ga0496111_0043312
1456 Ga0496112_0032517
1457 Ga0496112_0056866
1458 Ga0496112_0067467
1459 Ga0496112_0078541
1460 Ga0496112_0110099
1461 Ga0496112_0230986
1462 Ga0496112_0247951
1463 Ga0496112_0515079
1464 Ga0496113_0003042
1465 Ga0496113_0006617
1466 Ga0496114_0000153
1467 Ga0496114_0023001
1468 Ga0496114_0024447
1469 Ga0496114_0590628
1470 Ga0496115_0006985
1471 Ga0496115_0007857
1472 Ga0496115_0016046
1473 Ga0496115_0145736
1474 Ga0496115_0481158
1475 Ga0496116_0000025
1476 Ga0496116_0005302
1477 Ga0496116_0008758
1478 Ga0496117_0000006
1479 Ga0496117_0000521
1480 Ga0496117_0013197
1481 Ga0496117_0102360
1482 Ga0496117_0155606
1483 Ga0496118_0000004
1484 Ga0496118_0000455
1485 Ga0496118_0000730
1486 Ga0496118_0022416
1487 Ga0496119_0000035
1488 Ga0496119_0009787
1489 Ga0496120_0000079
1490 Ga0496120_0009649
1491 Ga0496120_0019833
1492 Ga0496121_0000004
1493 Ga0496121_0000090
1494 Ga0496121_0175861
1495 Ga0496122_0000805
1496 Ga0496122_0003041
1497 Ga0496123_0004493
1498 Ga0496123_0012202
1499 Ga0496123_0029986
1500 Ga0496124_0000221
1501 Ga0496125_0000003
1502 Ga0496125_0030577
1503 Ga0496125_0105437
1504 Ga0496125_0119559
1505 Ga0496126_0000001
1506 Ga0496126_0004049
1507 Ga0496126_0018195
1508 Ga0496126_0026431
1509 Ga0496126_0045421
1510 Ga0501032_0014425
1511 Ga0501032_0093439
1512 Ga0501033_0331741
1513 Ga0501034_0028270
1514 Ga0501034_0035636
1515 Ga0501034_0204194
1516 Ga0501036_0001863
1517 Ga0501036_0056555
1518 Ga0501036_0076419
1519 Ga0501037_0047879
1520 Ga0501037_0057369
1521 Ga0501039_0000771
1522 Ga0501043_0000790
1523 Ga0501046_0000382
1524 Ga0501047_0002654
1525 Ga0501047_0017356
1526 Ga0501048_0040031
1527 Ga0501067_0049893
1528 Ga0501069_0026674
1529 Ga0501069_0098520
1530 Ga0501070_0001555
1531 Ga0501070_0008775
1532 Ga0501073_0144706
1533 Ga0501077_0063642
1534 Ga0501080_0134766
1535 Ga0501080_0155187
1536 Ga0501035_0007912
1537 Ga0501035_0011908
1538 Ga0501044_0001394
1539 Ga0501044_0002938
1540 Ga0501044_0018624
1541 nmdc:mga03683_58615_c1
1542 nmdc:mga03n38_10214_c1
1543 nmdc:mga03n38_11440_c1
1544 nmdc:mga03n38_17821_c1
1545 nmdc:mga03n38_184540_c1
1546 nmdc:mga03n38_23413_c1
1547 nmdc:mga03n38_34752_c1
1548 nmdc:mga03n38_52956_c1
1549 nmdc:mga03n38_8139_c1
1550 nmdc:mga03n38_98603_c1
1551 nmdc:mga00v17_114846_c1
1552 nmdc:mga00v17_1611_c1
1553 nmdc:mga00v17_244358_c1
1554 nmdc:mga00v17_29712_c1
1555 nmdc:mga00v17_41855_c1
1556 nmdc:mga00v17_7882_c1
1557 nmdc:mga00v17_8457_c1
1558 nmdc:mga00v17_95658_c1
1559 nmdc:mga0yw44_14399_c1
1560 nmdc:mga0yw44_14561_c1
1561 nmdc:mga0yw44_224404_c1
1562 nmdc:mga0yw44_224955_c1
1563 nmdc:mga0yw44_6885_c1
1564 nmdc:mga06z11_25107_c1
1565 nmdc:mga06z11_270266_c1
1566 nmdc:mga04h51_1888_c1
1567 nmdc:mga07m45_127291_c1
1568 nmdc:mga07m45_182642_c1
1569 nmdc:mga07m45_18917_c1
1570 nmdc:mga07m45_47330_c1
1571 nmdc:mga07m45_47429_c2
1572 nmdc:mga07m45_81459_c1
1573 nmdc:mga07m45_94690_c1
1574 nmdc:mga05p37_35429_c1
1575 nmdc:mga0qj67_28952_c1
1576 nmdc:mga08y16_44941_c1
1577 nmdc:mga0sz30_17701_c1
1578 nmdc:mga0sz30_20679_c1
1579 nmdc:mga0sz30_48571_c1
1580 nmdc:mga0sz30_654_c2
1581 nmdc:mga0sz30_716_c1
1582 nmdc:mga0sz30_8193_c1
1583 Ga0500610_0001004
1584 Ga0500635_0009648
1585 Ga0500643_001666
1586 Ga0500646_0069051
1587 Ga0500641_0063303
1588 Ga0500641_0104360
1589 Ga0500642_0005874
1590 Ga0500652_000149
1591 Ga0500559_0033419
1592 Ga0500616_0003317
1593 Ga0500616_0067983
1594 Ga0500627_0001152
1595 Ga0500633_0066770
1596 Ga0500645_000412
1597 Ga0500645_019094
1598 Ga0466962_0009524
1599 Ga0466962_0013269
1600 2523385106
1601 2548699028
1602 2548699266
1603 2552110701
1604 2566991590
1605 2566992135
1606 2644490599
1607 2644513928
1608 2644637000
1609 2738668319
1610 2738707027
1611 2738888006
1612 2738888324
1613 2739147389
1614 2739204184
1615 2739238173
1616 2739333731
1617 2739364818
1618 2744957276
1619 2753037780
1620 2753325648
1621 2842139231
1622 2842891154
1623 2889303295
1624 2902798637
1625 2902800514
1626 2902814847
1627 2902843243
1628 2904538043
1629 2904541112
1630 2904766540
1631 2904772708
1632 2908811499
1633 2919421024
1634 2919433218
1635 2919716985
1636 2922557227
1637 2922560755
1638 2928145071
1639 2929217502
1640 2932400448
1641 2939584760
1642 2939745816
1643 2974318529
1644 2984526740

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

29

300

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b31-assembly1.cif.gz_B crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 0.8593 11 301
8b31-assembly1.cif.gz_A crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 0.8589 11 301
6ikz-assembly1.cif.gz_A udp-glucose pyrophosphorylase from acinetobacter baumanii 0.8573 10 296
6knj-assembly1.cif.gz_A utp-bound ugpase from acinetobacter baumannii 0.8565 10 296
5ve7-assembly1.cif.gz_A crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp 0.8554 10 294
ID Description Score Start End Superfamily
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8757 10 299 3.90.550.10
af_Q58730_1_282_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8641 10 299 3.90.550.10
2pa4A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8534 10 299 3.90.550.10
af_Q2G1T6_1_286_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8433 7 294 3.90.550.10
2pa4A00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8347 10 299 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A6I1IRH1-F1-model_v4 deleted 0.9479 113 261
AF-A0A6I1IRH1-F1-model_v4 deleted 0.9419 113 261
AF-X0XUV4-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9315 41 258 GO:0003983
GO:0006011
GO:0009058
AF-A0A2S8BQJ8-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.9278 46 303 GO:0003983
GO:0006011
GO:0009058
AF-X0XNF8-F1-model_v4 UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9) 0.923 47 299 GO:0003983
GO:0006011
GO:0009058

Map