F482274

General Info

Members Datasets Scaffolds Average Seq Length
821 313 1642 136

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0848532|Ga0501068_0848532_41_466
Length 141
Sequence MGTVQGMPKVGDAATRAKTASSRDIELYTEITGDRNPLHYDAAAARGSVFGGLIVQGGITTGILNAIVAEELPGPGTVFLAMELKFVKAVYVGDTITGRVELTGVREDKPICTMAVTVRNQAGDLCLSGNATTYTAALVKD

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
203 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
204 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
207 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
212 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
213 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
216 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
220 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
223 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
230 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
231 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
291 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
292 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
296 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
301 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
302 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
303 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
304 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
305 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 1.1
Rhizosphere 98.29
Stem 0
Stem Tuber 0
Unclassified 20.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0848532 3300049584 Bacteria 600
2 SwRhRL2b_contig_3090340 2162886007 Bacteria 969
3 MRS1b_contig_7347823 2162886011 Unclassified 988
4 JGI24746J21847_1005903 3300001977 Bacteria 1904
5 JGI24746J21847_1018795 3300001977 Unclassified 977
6 JGI24742J22300_10037705 3300002244 Bacteria 856
7 Ga0065704_10107681 3300005289 Bacteria 2049
8 Ga0065704_10475771 3300005289 Unclassified 677
9 Ga0065712_10179213 3300005290 Bacteria 1202
10 Ga0065712_10309829 3300005290 Unclassified 845
11 Ga0065715_10017516 3300005293 Bacteria 2699
12 Ga0065715_10934425 3300005293 Unclassified 564
13 Ga0065707_10085184 3300005295 Bacteria 6378
14 Ga0065707_10280353 3300005295 Unclassified 1048
15 Ga0065707_10290541 3300005295 Unclassified 1026
16 Ga0065707_10953746 3300005295 Bacteria 551
17 Ga0070658_10816169 3300005327 Unclassified 810
18 Ga0070676_10016381 3300005328 Bacteria 4097
19 Ga0070676_10044388 3300005328 Unclassified 2587
20 Ga0070676_11056818 3300005328 Unclassified 612
21 Ga0070683_100022077 3300005329 Bacteria 5685
22 Ga0070683_100025311 3300005329 Bacteria 5328
23 Ga0070683_100111540 3300005329 Bacteria 2580
24 Ga0070690_100023916 3300005330 Bacteria 3753
25 Ga0070690_100546691 3300005330 Bacteria 873
26 Ga0070670_100139832 3300005331 Bacteria 2094
27 Ga0070670_100251587 3300005331 Bacteria 1539
28 Ga0070670_100718420 3300005331 Unclassified 899
29 Ga0070677_10005078 3300005333 Bacteria 4323
30 Ga0068869_100050215 3300005334 Unclassified 3023
31 Ga0068869_100198356 3300005334 Bacteria 1581
32 Ga0068869_100642302 3300005334 Bacteria 900
33 Ga0070666_10100761 3300005335 Bacteria 1990
34 Ga0070666_10191581 3300005335 Unclassified 1437
35 Ga0070680_100005979 3300005336 Bacteria 9231
36 Ga0070680_100100134 3300005336 Bacteria 2405
37 Ga0070680_100101289 3300005336 Bacteria 2391
38 Ga0070682_100099187 3300005337 Bacteria 1920
39 Ga0068868_100034062 3300005338 Bacteria 3930
40 Ga0068868_100324062 3300005338 Unclassified 1313
41 Ga0068868_101520780 3300005338 Bacteria 627
42 Ga0070660_100096997 3300005339 Bacteria 2332
43 Ga0070689_100072634 3300005340 Bacteria 2689
44 Ga0070689_100781988 3300005340 Bacteria 838
45 Ga0070691_10014882 3300005341 Unclassified 3571
46 Ga0070691_10066612 3300005341 Bacteria 1741
47 Ga0070691_10234061 3300005341 Bacteria 979
48 Ga0070687_100008622 3300005343 Bacteria 4328
49 Ga0070661_100007509 3300005344 Bacteria 7521
50 Ga0070661_100026282 3300005344 Bacteria 4186
51 Ga0070661_100431631 3300005344 Bacteria 1046
52 Ga0070661_100941603 3300005344 Bacteria 714
53 Ga0070668_100106234 3300005347 Bacteria 2230
54 Ga0070668_100107386 3300005347 Bacteria 2219
55 Ga0070668_101042892 3300005347 Bacteria 736
56 Ga0070669_100017310 3300005353 Bacteria 5141
57 Ga0070669_100058948 3300005353 Plasmid 2818
58 Ga0070669_100195133 3300005353 Unclassified 1590
59 Ga0070669_100309091 3300005353 Bacteria 1273
60 Ga0070669_100969604 3300005353 Unclassified 728
61 Ga0070669_101491412 3300005353 Bacteria 588
62 Ga0070675_100562422 3300005354 Unclassified 1032
63 Ga0070675_100869661 3300005354 Bacteria 825
64 Ga0070675_101275816 3300005354 Bacteria 677
65 Ga0070671_100207954 3300005355 Bacteria 1659
66 Ga0070674_100004735 3300005356 Bacteria 7791
67 Ga0070674_100006894 3300005356 Bacteria 6660
68 Ga0070674_100588467 3300005356 Bacteria 938
69 Ga0070673_100029315 3300005364 Unclassified 4103
70 Ga0070673_100100980 3300005364 Unclassified 2376
71 Ga0070688_100000962 3300005365 Bacteria 14417
72 Ga0070688_100056301 3300005365 Bacteria 2469
73 Ga0070688_101035351 3300005365 Bacteria 654
74 Ga0070688_101240837 3300005365 Bacteria 600
75 Ga0070659_100009099 3300005366 Bacteria 7285
76 Ga0070659_100345311 3300005366 Bacteria 1248
77 Ga0070667_100031981 3300005367 Bacteria 4387
78 Ga0070667_101177264 3300005367 Bacteria 717
79 Ga0070703_10058468 3300005406 Bacteria 1255
80 Ga0070703_10168449 3300005406 Bacteria 837
81 Ga0070709_10001469 3300005434 Bacteria 12722
82 Ga0070709_10387287 3300005434 Bacteria 1041
83 Ga0070714_100018344 3300005435 Bacteria 5683
84 Ga0070714_100223076 3300005435 Bacteria 1733
85 Ga0070713_100001501 3300005436 Bacteria 14883
86 Ga0070713_100501893 3300005436 Bacteria 1145
87 Ga0070701_10049952 3300005438 Bacteria 2164
88 Ga0070711_100000395 3300005439 Bacteria 22479
89 Ga0070711_100624640 3300005439 Unclassified 901
90 Ga0070705_100007996 3300005440 Bacteria 5227
91 Ga0070705_100063806 3300005440 Bacteria 2198
92 Ga0070705_100333440 3300005440 Bacteria 1100
93 Ga0070705_100701326 3300005440 Unclassified 795
94 Ga0070705_101943172 3300005440 Unclassified 501
95 Ga0070700_100558259 3300005441 Unclassified 891
96 Ga0070694_100004758 3300005444 Bacteria 8177
97 Ga0070694_100181736 3300005444 Bacteria 1556
98 Ga0070694_100260372 3300005444 Bacteria 1315
99 Ga0070694_100336162 3300005444 Bacteria 1166
100 Ga0070708_100002004 3300005445 Bacteria 15669
101 Ga0070708_100970972 3300005445 Bacteria 797
102 Ga0070708_100977370 3300005445 Unclassified 794
103 Ga0070708_101411936 3300005445 Unclassified 649
104 Ga0070708_101544986 3300005445 Bacteria 618
105 Ga0070678_100008983 3300005456 Bacteria 6019
106 Ga0070678_100242567 3300005456 Unclassified 1507
107 Ga0070678_100886985 3300005456 Unclassified 815
108 Ga0070678_101285479 3300005456 Unclassified 680
109 Ga0070662_100004071 3300005457 Bacteria 9188
110 Ga0070662_101510244 3300005457 Bacteria 579
111 Ga0070681_10000857 3300005458 Bacteria 25575
112 Ga0070681_10002670 3300005458 Bacteria 16378
113 Ga0070681_10268187 3300005458 Bacteria 1618
114 Ga0070681_10659412 3300005458 Unclassified 961
115 Ga0068867_100018446 3300005459 Bacteria 4960
116 Ga0068867_100271215 3300005459 Bacteria 1387
117 Ga0068867_100772484 3300005459 Bacteria 854
118 Ga0070685_10396735 3300005466 Bacteria 954
119 Ga0070707_100052251 3300005468 Bacteria 3918
120 Ga0070707_100074613 3300005468 Bacteria 3271
121 Ga0070707_102014512 3300005468 Bacteria 545
122 Ga0070698_100119735 3300005471 Bacteria 2593
123 Ga0070698_100190385 3300005471 Bacteria 1989
124 Ga0070698_100235724 3300005471 Bacteria 1763
125 Ga0070698_100399011 3300005471 Unclassified 1308
126 Ga0070698_101181702 3300005471 Bacteria 714
127 Ga0070698_101327485 3300005471 Bacteria 669
128 Ga0070699_100113259 3300005518 Bacteria 2383
129 Ga0070699_101878236 3300005518 Unclassified 548
130 Ga0070679_100000924 3300005530 Bacteria 25545
131 Ga0070679_100007124 3300005530 Bacteria 10438
132 Ga0070679_100010037 3300005530 Bacteria 8968
133 Ga0070679_100023377 3300005530 Bacteria 6049
134 Ga0070684_100005166 3300005535 Bacteria 9981
135 Ga0070684_100005387 3300005535 Bacteria 9803
136 Ga0070684_100044553 3300005535 Bacteria 3838
137 Ga0070684_100095964 3300005535 Bacteria 2642
138 Ga0070684_100282863 3300005535 Bacteria 1520
139 Ga0070697_100135178 3300005536 Unclassified 2070
140 Ga0070697_100387765 3300005536 Bacteria 1211
141 Ga0068853_100244178 3300005539 Bacteria 1646
142 Ga0070672_100039084 3300005543 Bacteria 3632
143 Ga0070672_100554576 3300005543 Unclassified 998
144 Ga0070672_101966103 3300005543 Unclassified 526
145 Ga0070695_100009930 3300005545 Bacteria 5674
146 Ga0070695_100016981 3300005545 Bacteria 4413
147 Ga0070695_100091297 3300005545 Bacteria 2034
148 Ga0070696_100041120 3300005546 Bacteria 3193
149 Ga0070696_100096187 3300005546 Bacteria 2116
150 Ga0070693_100041763 3300005547 Bacteria 2582
151 Ga0070665_100474274 3300005548 Unclassified 1262
152 Ga0070665_101085792 3300005548 Bacteria 812
153 Ga0070704_100110008 3300005549 Bacteria 2095
154 Ga0070704_101761225 3300005549 Unclassified 573
155 Ga0070704_101956123 3300005549 Unclassified 544
156 Ga0068855_100089330 3300005563 Bacteria 3557
157 Ga0068855_100127202 3300005563 Bacteria 2912
158 Ga0068855_100339396 3300005563 Bacteria 1657
159 Ga0068855_100485257 3300005563 Bacteria 1345
160 Ga0068855_100788143 3300005563 Bacteria 1011
161 Ga0068855_101249569 3300005563 Bacteria 770
162 Ga0070664_100023271 3300005564 Bacteria 5116
163 Ga0070664_100135458 3300005564 Bacteria 2165
164 Ga0068857_100010501 3300005577 Bacteria 8048
165 Ga0068857_100034089 3300005577 Bacteria 4504
166 Ga0068857_100224213 3300005577 Bacteria 1718
167 Ga0068857_100461313 3300005577 Bacteria 1189
168 Ga0068854_100023851 3300005578 Bacteria 4181
169 Ga0068854_100070969 3300005578 Bacteria 2546
170 Ga0068856_100171932 3300005614 Bacteria 2179
171 Ga0068856_100221555 3300005614 Unclassified 1907
172 Ga0068856_100383410 3300005614 Unclassified 1425
173 Ga0068856_100384463 3300005614 Bacteria 1423
174 Ga0068856_100395308 3300005614 Bacteria 1402
175 Ga0068856_100668769 3300005614 Bacteria 1059
176 Ga0070702_100065981 3300005615 Unclassified 2121
177 Ga0070702_101572413 3300005615 Bacteria 543
178 Ga0068852_100202518 3300005616 Bacteria 1879
179 Ga0068852_100296547 3300005616 Bacteria 1563
180 Ga0068852_100721904 3300005616 Bacteria 1007
181 Ga0068852_102535176 3300005616 Bacteria 533
182 Ga0068859_100063067 3300005617 Bacteria 3736
183 Ga0068859_100102931 3300005617 Bacteria 2913
184 Ga0068859_100335684 3300005617 Bacteria 1606
185 Ga0068859_100339909 3300005617 Bacteria 1595
186 Ga0068859_100437093 3300005617 Bacteria 1405
187 Ga0068859_100637673 3300005617 Bacteria 1158
188 Ga0068859_101324515 3300005617 Bacteria 794
189 Ga0068864_100000808 3300005618 Bacteria 26308
190 Ga0068864_100055483 3300005618 Bacteria 3421
191 Ga0068864_100654107 3300005618 Bacteria 1023
192 Ga0068866_10000622 3300005718 Bacteria 16181
193 Ga0068861_100088044 3300005719 Bacteria 2444
194 Ga0068861_101480848 3300005719 Bacteria 665
195 Ga0068851_10039531 3300005834 Bacteria 2369
196 Ga0068870_10006745 3300005840 Bacteria 5086
197 Ga0068870_10008802 3300005840 Bacteria 4553
198 Ga0068870_10040468 3300005840 Bacteria 2417
199 Ga0068870_10242642 3300005840 Bacteria 1113
200 Ga0068863_100824988 3300005841 Bacteria 925
201 Ga0068863_100991921 3300005841 Unclassified 842
202 Ga0068858_100005538 3300005842 Bacteria 12362
203 Ga0068858_100028383 3300005842 Bacteria 5199
204 Ga0068858_100161843 3300005842 Unclassified 2107
205 Ga0068858_100437128 3300005842 Bacteria 1260
206 Ga0068860_100047100 3300005843 Bacteria 4109
207 Ga0068860_100048103 3300005843 Bacteria 4065
208 Ga0068860_100723234 3300005843 Bacteria 1006
209 Ga0068860_102424643 3300005843 Unclassified 545
210 Ga0068862_100081503 3300005844 Bacteria 2807
211 Ga0068862_100154147 3300005844 Bacteria 2047
212 Ga0068862_100159333 3300005844 Bacteria 2014
213 Ga0068862_100216817 3300005844 Bacteria 1731
214 Ga0068862_100746415 3300005844 Bacteria 952
215 Ga0068862_101218614 3300005844 Bacteria 752
216 Ga0068862_102160210 3300005844 Bacteria 568
217 Ga0070717_10009515 3300006028 Bacteria 7309
218 Ga0070715_10202067 3300006163 Bacteria 1010
219 Ga0097621_100083684 3300006237 Unclassified 2659
220 Ga0097621_100151740 3300006237 Bacteria 1987
221 Ga0097621_100168103 3300006237 Bacteria 1889
222 Ga0068871_100163873 3300006358 Bacteria 1902
223 Ga0068871_100164587 3300006358 Unclassified 1898
224 Ga0068871_102145162 3300006358 Bacteria 532
225 Ga0075428_100008283 3300006844 Bacteria 11525
226 Ga0075428_100026824 3300006844 Bacteria 6379
227 Ga0075428_100410673 3300006844 Bacteria 1451
228 Ga0075428_101426050 3300006844 Bacteria 726
229 Ga0075430_100004611 3300006846 Bacteria 11607
230 Ga0075430_100017467 3300006846 Bacteria 6111
231 Ga0075430_100125114 3300006846 Bacteria 2143
232 Ga0075430_100268252 3300006846 Unclassified 1413
233 Ga0075431_100016666 3300006847 Bacteria 7461
234 Ga0075431_100201898 3300006847 Bacteria 2034
235 Ga0075433_10004730 3300006852 Bacteria 10617
236 Ga0075433_10006512 3300006852 Bacteria 9239
237 Ga0075433_10119365 3300006852 Bacteria 2341
238 Ga0075433_10120871 3300006852 Bacteria 2326
239 Ga0075433_10129820 3300006852 Bacteria 2239
240 Ga0075433_10157465 3300006852 Bacteria 2021
241 Ga0075433_10180798 3300006852 Bacteria 1877
242 Ga0075433_10874776 3300006852 Unclassified 784
243 Ga0075434_100003938 3300006871 Bacteria 13303
244 Ga0075434_100015773 3300006871 Bacteria 7252
245 Ga0075434_100041599 3300006871 Bacteria 4553
246 Ga0075434_100054083 3300006871 Bacteria 3988
247 Ga0075434_100484624 3300006871 Unclassified 1258
248 Ga0075434_100585423 3300006871 Bacteria 1135
249 Ga0075434_100701851 3300006871 Bacteria 1029
250 Ga0075434_100745445 3300006871 Bacteria 996
251 Ga0075434_101313221 3300006871 Bacteria 734
252 Ga0075434_101320581 3300006871 Bacteria 732
253 Ga0075434_102333447 3300006871 Bacteria 538
254 Ga0075429_100038955 3300006880 Bacteria 4137
255 Ga0075429_100112926 3300006880 Bacteria 2374
256 Ga0075429_100115857 3300006880 Bacteria 2343
257 Ga0068865_100004039 3300006881 Bacteria 8814
258 Ga0068865_100991361 3300006881 Unclassified 735
259 Ga0075436_100017379 3300006914 Bacteria 4924
260 Ga0075436_100068509 3300006914 Bacteria 2451
261 Ga0075436_100259917 3300006914 Bacteria 1238
262 Ga0097620_100063070 3300006931 Bacteria 3736
263 Ga0097620_100102946 3300006931 Bacteria 2913
264 Ga0097620_100335697 3300006931 Bacteria 1606
265 Ga0097620_100339929 3300006931 Bacteria 1595
266 Ga0097620_100437121 3300006931 Bacteria 1405
267 Ga0097620_100637628 3300006931 Bacteria 1158
268 Ga0097620_101324480 3300006931 Bacteria 794
269 Ga0075435_100114545 3300007076 Bacteria 2244
270 Ga0075435_100496263 3300007076 Bacteria 1055
271 Ga0075435_100938945 3300007076 Bacteria 755
272 Ga0075435_101005875 3300007076 Bacteria 728
273 Ga0099794_10111313 3300007265 Bacteria 1372
274 Ga0105240_10046309 3300009093 Bacteria 5511
275 Ga0105240_10059528 3300009093 Bacteria 4766
276 Ga0105240_10191668 3300009093 Unclassified 2403
277 Ga0105240_10208317 3300009093 Bacteria 2286
278 Ga0105240_10397314 3300009093 Bacteria 1553
279 Ga0105240_11341500 3300009093 Bacteria 753
280 Ga0105240_11516081 3300009093 Bacteria 703
281 Ga0105240_11620829 3300009093 Bacteria 677
282 Ga0111539_10000538 3300009094 Bacteria 48180
283 Ga0111539_10179483 3300009094 Bacteria 2473
284 Ga0111539_11766176 3300009094 Unclassified 717
285 Ga0105245_10229926 3300009098 Unclassified 1793
286 Ga0105245_11116699 3300009098 Bacteria 835
287 Ga0105245_11764017 3300009098 Bacteria 672
288 Ga0105247_10029435 3300009101 Bacteria 3327
289 Ga0105247_10342378 3300009101 Unclassified 1049
290 Ga0114129_10044723 3300009147 Bacteria 6229
291 Ga0114129_10241115 3300009147 Bacteria 2430
292 Ga0114129_10311196 3300009147 Bacteria 2096
293 Ga0114129_10663598 3300009147 Bacteria 1344
294 Ga0114129_12262037 3300009147 Unclassified 653
295 Ga0105243_10146569 3300009148 Unclassified 2020
296 Ga0105243_10211014 3300009148 Bacteria 1710
297 Ga0105243_10538199 3300009148 Bacteria 1114
298 Ga0105241_10015144 3300009174 Bacteria 5648
299 Ga0105241_10341291 3300009174 Bacteria 1298
300 Ga0105241_11412751 3300009174 Bacteria 667
301 Ga0105242_10271682 3300009176 Bacteria 1536
302 Ga0105242_11566824 3300009176 Bacteria 691
303 Ga0105242_13237381 3300009176 Bacteria 506
304 Ga0105248_10015782 3300009177 Bacteria 8325
305 Ga0105248_10048596 3300009177 Bacteria 4759
306 Ga0105248_10358334 3300009177 Bacteria 1642
307 Ga0105248_10596299 3300009177 Bacteria 1247
308 Ga0105248_12247339 3300009177 Unclassified 621
309 Ga0105237_10453565 3300009545 Bacteria 1288
310 Ga0105237_11348473 3300009545 Unclassified 720
311 Ga0105237_11568470 3300009545 Bacteria 665
312 Ga0105237_12164916 3300009545 Unclassified 565
313 Ga0105237_12474661 3300009545 Bacteria 529
314 Ga0105238_10150008 3300009551 Bacteria 2306
315 Ga0105238_10370067 3300009551 Bacteria 1423
316 Ga0105238_11922225 3300009551 Unclassified 625
317 Ga0105249_10086258 3300009553 Bacteria 2927
318 Ga0105249_10117150 3300009553 Bacteria 2526
319 Ga0105249_10209614 3300009553 Unclassified 1912
320 Ga0105249_10316566 3300009553 Unclassified 1570
321 Ga0105249_10737523 3300009553 Bacteria 1047
322 Ga0105249_10801055 3300009553 Bacteria 1006
323 Ga0105249_10903643 3300009553 Bacteria 950
324 Ga0105239_10058947 3300010375 Bacteria 4214
325 Ga0105239_10296177 3300010375 Bacteria 1822
326 Ga0105239_11030392 3300010375 Bacteria 947
327 Ga0105246_10009650 3300011119 Bacteria 5948
328 Ga0105246_10026634 3300011119 Bacteria 3781
329 Ga0105246_10287913 3300011119 Bacteria 1321
330 Ga0105246_10959677 3300011119 Bacteria 771
331 Ga0157373_10006113 3300013100 Bacteria 9002
332 Ga0157373_10008139 3300013100 Bacteria 7798
333 Ga0157373_10592253 3300013100 Unclassified 807
334 Ga0157373_10610590 3300013100 Unclassified 794
335 Ga0157370_10036803 3300013104 Bacteria 4748
336 Ga0157370_10041048 3300013104 Bacteria 4466
337 Ga0157370_10082090 3300013104 Bacteria 3033
338 Ga0157370_10139785 3300013104 Unclassified 2256
339 Ga0157370_10343630 3300013104 Bacteria 1375
340 Ga0157370_10482976 3300013104 Unclassified 1138
341 Ga0157370_10532707 3300013104 Bacteria 1077
342 Ga0157370_11162709 3300013104 Bacteria 697
343 Ga0157369_10021262 3300013105 Bacteria 7257
344 Ga0157369_10022113 3300013105 Bacteria 7104
345 Ga0157369_10120701 3300013105 Unclassified 2782
346 Ga0157369_10262498 3300013105 Bacteria 1801
347 Ga0157369_10300046 3300013105 Bacteria 1671
348 Ga0157369_10371513 3300013105 Bacteria 1484
349 Ga0157369_10410123 3300013105 Bacteria 1405
350 Ga0157369_10600419 3300013105 Bacteria 1136
351 Ga0157369_12311297 3300013105 Unclassified 545
352 Ga0157374_10439314 3300013296 Bacteria 1305
353 Ga0157374_11246992 3300013296 Bacteria 765
354 Ga0157374_12528854 3300013296 Unclassified 541
355 Ga0157378_10032881 3300013297 Unclassified 4584
356 Ga0163162_10036256 3300013306 Bacteria 4914
357 Ga0163162_10102699 3300013306 Unclassified 2953
358 Ga0163162_12402203 3300013306 Unclassified 606
359 Ga0157372_10011579 3300013307 Bacteria 9385
360 Ga0157372_10012424 3300013307 Bacteria 9076
361 Ga0157372_10025733 3300013307 Bacteria 6401
362 Ga0157372_10044399 3300013307 Bacteria 4924
363 Ga0157372_10471837 3300013307 Bacteria 1463
364 Ga0157375_10091378 3300013308 Bacteria 3106
365 Ga0157375_10197222 3300013308 Bacteria 2168
366 Ga0157375_10498405 3300013308 Unclassified 1382
367 Ga0157375_10920548 3300013308 Bacteria 1017
368 Ga0163163_10229071 3300014325 Bacteria 1907
369 Ga0157380_10007796 3300014326 Bacteria 7619
370 Ga0157380_10014458 3300014326 Bacteria 5774
371 Ga0157380_10021654 3300014326 Bacteria 4825
372 Ga0157380_10105668 3300014326 Bacteria 2354
373 Ga0157380_10598207 3300014326 Unclassified 1090
374 Ga0157380_11668258 3300014326 Bacteria 694
375 Ga0182008_10458431 3300014497 Bacteria 694
376 Ga0157377_10260657 3300014745 Bacteria 1128
377 Ga0157379_10028104 3300014968 Bacteria 5006
378 Ga0157379_10067008 3300014968 Bacteria 3210
379 Ga0157376_10277619 3300014969 Bacteria 1577
380 Ga0157376_10428804 3300014969 Bacteria 1285
381 Ga0157376_10491124 3300014969 Bacteria 1205
382 Ga0163161_10005896 3300017792 Bacteria 8498
383 Ga0163161_10079041 3300017792 Bacteria 2418
384 Ga0163161_10715563 3300017792 Unclassified 835
385 Ga0163161_11179949 3300017792 Bacteria 661
386 Ga0206356_10206487 3300020070 Bacteria 1496
387 Ga0206353_10366391 3300020082 Bacteria 1790
388 Ga0213876_10254517 3300021384 Unclassified 933
389 Ga0207697_10001167 3300025315 Bacteria 14410
390 Ga0207656_10027037 3300025321 Bacteria 2344
391 Ga0207656_10028196 3300025321 Bacteria 2303
392 Ga0207653_10000528 3300025885 Bacteria 14414
393 Ga0207653_10039485 3300025885 Bacteria 1545
394 Ga0207653_10261613 3300025885 Unclassified 665
395 Ga0207682_10003279 3300025893 Bacteria 7078
396 Ga0207682_10019128 3300025893 Bacteria 2680
397 Ga0207642_10001495 3300025899 Bacteria 7208
398 Ga0207642_10664893 3300025899 Unclassified 654
399 Ga0207710_10137492 3300025900 Bacteria 1178
400 Ga0207688_10004841 3300025901 Bacteria 7331
401 Ga0207680_10068497 3300025903 Bacteria 2189
402 Ga0207680_10205043 3300025903 Bacteria 1346
403 Ga0207680_10263434 3300025903 Unclassified 1194
404 Ga0207647_10286326 3300025904 Bacteria 940
405 Ga0207685_10163786 3300025905 Unclassified 1017
406 Ga0207699_10021613 3300025906 Bacteria 3471
407 Ga0207699_10602461 3300025906 Bacteria 800
408 Ga0207645_10003863 3300025907 Bacteria 11211
409 Ga0207645_10011601 3300025907 Bacteria 6010
410 Ga0207643_10001455 3300025908 Bacteria 13577
411 Ga0207643_10008047 3300025908 Bacteria 5655
412 Ga0207643_10009672 3300025908 Bacteria 5177
413 Ga0207643_10081260 3300025908 Unclassified 1878
414 Ga0207643_10118306 3300025908 Bacteria 1567
415 Ga0207643_10127074 3300025908 Bacteria 1514
416 Ga0207684_10031113 3300025910 Bacteria 4542
417 Ga0207684_10457109 3300025910 Bacteria 1096
418 Ga0207684_10644718 3300025910 Unclassified 903
419 Ga0207654_10025951 3300025911 Bacteria 3167
420 Ga0207707_10019304 3300025912 Bacteria 5949
421 Ga0207707_10180764 3300025912 Bacteria 1841
422 Ga0207707_10270175 3300025912 Bacteria 1474
423 Ga0207707_10725595 3300025912 Bacteria 833
424 Ga0207707_10728274 3300025912 Bacteria 831
425 Ga0207707_10729336 3300025912 Bacteria 830
426 Ga0207695_10016423 3300025913 Bacteria 8662
427 Ga0207695_10021694 3300025913 Bacteria 7321
428 Ga0207695_10043911 3300025913 Bacteria 4759
429 Ga0207695_10056696 3300025913 Bacteria 4076
430 Ga0207695_10093519 3300025913 Bacteria 3015
431 Ga0207695_10177887 3300025913 Unclassified 2049
432 Ga0207695_10305110 3300025913 Bacteria 1483
433 Ga0207695_10351933 3300025913 Bacteria 1360
434 Ga0207671_10541336 3300025914 Unclassified 928
435 Ga0207671_10682758 3300025914 Bacteria 817
436 Ga0207660_10028143 3300025917 Bacteria 3843
437 Ga0207660_10068958 3300025917 Bacteria 2566
438 Ga0207660_10087225 3300025917 Bacteria 2305
439 Ga0207662_10009327 3300025918 Bacteria 5395
440 Ga0207662_10015377 3300025918 Bacteria 4306
441 Ga0207662_11116726 3300025918 Unclassified 560
442 Ga0207657_10104968 3300025919 Bacteria 2340
443 Ga0207657_10118678 3300025919 Bacteria 2177
444 Ga0207657_10453211 3300025919 Bacteria 1006
445 Ga0207649_10007168 3300025920 Bacteria 6060
446 Ga0207649_10080026 3300025920 Bacteria 2112
447 Ga0207649_10111178 3300025920 Bacteria 1831
448 Ga0207649_10258873 3300025920 Bacteria 1257
449 Ga0207649_10731697 3300025920 Bacteria 769
450 Ga0207652_10007095 3300025921 Bacteria 9027
451 Ga0207652_10177997 3300025921 Bacteria 1910
452 Ga0207652_10841185 3300025921 Bacteria 813
453 Ga0207652_10970579 3300025921 Bacteria 748
454 Ga0207646_10001564 3300025922 Bacteria 28014
455 Ga0207646_10097986 3300025922 Bacteria 2627
456 Ga0207646_11126822 3300025922 Bacteria 690
457 Ga0207646_11663688 3300025922 Unclassified 549
458 Ga0207646_11739667 3300025922 Bacteria 535
459 Ga0207681_10068742 3300025923 Bacteria 2461
460 Ga0207681_10238544 3300025923 Unclassified 1414
461 Ga0207681_10460184 3300025923 Bacteria 1036
462 Ga0207681_10482698 3300025923 Bacteria 1012
463 Ga0207681_10570530 3300025923 Bacteria 933
464 Ga0207681_11292550 3300025923 Unclassified 613
465 Ga0207694_10044734 3300025924 Bacteria 3419
466 Ga0207694_10176592 3300025924 Bacteria 1731
467 Ga0207694_10432399 3300025924 Bacteria 1097
468 Ga0207694_10940635 3300025924 Unclassified 731
469 Ga0207650_10023723 3300025925 Unclassified 4356
470 Ga0207650_10095642 3300025925 Bacteria 2277
471 Ga0207650_10140751 3300025925 Bacteria 1896
472 Ga0207650_10232895 3300025925 Unclassified 1486
473 Ga0207650_10350029 3300025925 Unclassified 1215
474 Ga0207650_10515628 3300025925 Unclassified 1000
475 Ga0207659_10126749 3300025926 Bacteria 1964
476 Ga0207659_10395868 3300025926 Bacteria 1154
477 Ga0207659_10635235 3300025926 Unclassified 912
478 Ga0207687_10604142 3300025927 Bacteria 925
479 Ga0207700_10017897 3300025928 Bacteria 4744
480 Ga0207664_10236792 3300025929 Bacteria 1588
481 Ga0207664_10838424 3300025929 Bacteria 826
482 Ga0207664_10872239 3300025929 Unclassified 809
483 Ga0207644_11353542 3300025931 Unclassified 598
484 Ga0207690_10002601 3300025932 Bacteria 10886
485 Ga0207690_10591278 3300025932 Bacteria 905
486 Ga0207690_10732238 3300025932 Bacteria 814
487 Ga0207690_10976900 3300025932 Unclassified 704
488 Ga0207706_10000218 3300025933 Bacteria 62776
489 Ga0207706_10252509 3300025933 Bacteria 1540
490 Ga0207686_10002437 3300025934 Bacteria 10120
491 Ga0207686_10005688 3300025934 Bacteria 6684
492 Ga0207686_10626626 3300025934 Unclassified 849
493 Ga0207709_10015176 3300025935 Bacteria 4270
494 Ga0207709_10115993 3300025935 Bacteria 1800
495 Ga0207709_10363511 3300025935 Bacteria 1096
496 Ga0207670_10013106 3300025936 Unclassified 4878
497 Ga0207670_10183131 3300025936 Bacteria 1579
498 Ga0207670_10301509 3300025936 Unclassified 1255
499 Ga0207670_10387709 3300025936 Bacteria 1114
500 Ga0207670_10920000 3300025936 Unclassified 733
501 Ga0207669_10000933 3300025937 Bacteria 12357
502 Ga0207669_10041790 3300025937 Unclassified 2671
503 Ga0207669_10727899 3300025937 Unclassified 817
504 Ga0207704_10134275 3300025938 Unclassified 1720
505 Ga0207704_10363145 3300025938 Bacteria 1131
506 Ga0207665_10007638 3300025939 Bacteria 7138
507 Ga0207665_10355486 3300025939 Unclassified 1106
508 Ga0207691_10007060 3300025940 Bacteria 10835
509 Ga0207691_10030230 3300025940 Bacteria 5063
510 Ga0207691_10246920 3300025940 Bacteria 1542
511 Ga0207711_10051808 3300025941 Bacteria 3517
512 Ga0207711_10069994 3300025941 Bacteria 3042
513 Ga0207711_10124465 3300025941 Bacteria 2305
514 Ga0207711_10242612 3300025941 Bacteria 1652
515 Ga0207689_10005269 3300025942 Bacteria 11590
516 Ga0207689_10035162 3300025942 Plasmid 4162
517 Ga0207689_10084992 3300025942 Bacteria 2601
518 Ga0207689_10105432 3300025942 Unclassified 2316
519 Ga0207689_10549402 3300025942 Bacteria 970
520 Ga0207661_10062543 3300025944 Bacteria 3012
521 Ga0207661_10065614 3300025944 Bacteria 2947
522 Ga0207661_10082900 3300025944 Bacteria 2652
523 Ga0207661_10344541 3300025944 Unclassified 1343
524 Ga0207679_10006327 3300025945 Bacteria 7479
525 Ga0207679_10252834 3300025945 Bacteria 1499
526 Ga0207667_10207784 3300025949 Bacteria 2007
527 Ga0207667_10233112 3300025949 Bacteria 1885
528 Ga0207667_10368845 3300025949 Bacteria 1463
529 Ga0207667_10392228 3300025949 Bacteria 1414
530 Ga0207667_10992843 3300025949 Bacteria 827
531 Ga0207651_10014021 3300025960 Bacteria 4612
532 Ga0207712_10000775 3300025961 Bacteria 23829
533 Ga0207712_10002104 3300025961 Bacteria 13034
534 Ga0207712_10015131 3300025961 Bacteria 4972
535 Ga0207712_10062297 3300025961 Bacteria 2651
536 Ga0207712_10239722 3300025961 Bacteria 1460
537 Ga0207712_10294561 3300025961 Unclassified 1329
538 Ga0207712_10305393 3300025961 Bacteria 1308
539 Ga0207712_10625736 3300025961 Bacteria 933
540 Ga0207668_10295135 3300025972 Bacteria 1335
541 Ga0207640_10180218 3300025981 Bacteria 1583
542 Ga0207640_10252595 3300025981 Bacteria 1369
543 Ga0207640_10968394 3300025981 Bacteria 747
544 Ga0207658_10078354 3300025986 Bacteria 2525
545 Ga0207658_10646539 3300025986 Bacteria 953
546 Ga0207658_11204486 3300025986 Bacteria 692
547 Ga0207658_11469967 3300025986 Unclassified 623
548 Ga0207677_10590463 3300026023 Bacteria 973
549 Ga0207677_10843337 3300026023 Bacteria 823
550 Ga0207677_11400862 3300026023 Bacteria 644
551 Ga0207703_10052362 3300026035 Bacteria 3314
552 Ga0207703_10151765 3300026035 Unclassified 2021
553 Ga0207703_10419100 3300026035 Bacteria 1245
554 Ga0207703_10442667 3300026035 Bacteria 1212
555 Ga0207678_10013214 3300026067 Bacteria 7245
556 Ga0207708_10023908 3300026075 Bacteria 4621
557 Ga0207708_10162139 3300026075 Bacteria 1766
558 Ga0207708_10186525 3300026075 Bacteria 1649
559 Ga0207708_10348212 3300026075 Bacteria 1215
560 Ga0207708_10441859 3300026075 Bacteria 1082
561 Ga0207702_10072027 3300026078 Bacteria 2977
562 Ga0207702_10289200 3300026078 Bacteria 1552
563 Ga0207702_10309578 3300026078 Bacteria 1501
564 Ga0207702_10741570 3300026078 Unclassified 969
565 Ga0207702_11370257 3300026078 Bacteria 701
566 Ga0207702_11451523 3300026078 Unclassified 680
567 Ga0207641_10001235 3300026088 Bacteria 25590
568 Ga0207641_10011819 3300026088 Bacteria 7163
569 Ga0207641_10042331 3300026088 Bacteria 3820
570 Ga0207641_10321971 3300026088 Bacteria 1466
571 Ga0207648_10003314 3300026089 Bacteria 16910
572 Ga0207648_10028708 3300026089 Bacteria 4932
573 Ga0207648_10152251 3300026089 Bacteria 2041
574 Ga0207648_11080109 3300026089 Bacteria 752
575 Ga0207648_11166577 3300026089 Unclassified 723
576 Ga0207676_10026480 3300026095 Bacteria 4314
577 Ga0207676_10051603 3300026095 Bacteria 3211
578 Ga0207676_10203391 3300026095 Bacteria 1751
579 Ga0207676_10495504 3300026095 Unclassified 1159
580 Ga0207676_11090265 3300026095 Bacteria 789
581 Ga0207674_10001105 3300026116 Bacteria 35054
582 Ga0207674_10005320 3300026116 Bacteria 15315
583 Ga0207674_10093328 3300026116 Bacteria 2998
584 Ga0207674_10499006 3300026116 Bacteria 1176
585 Ga0207674_10804200 3300026116 Bacteria 907
586 Ga0207674_11218331 3300026116 Unclassified 722
587 Ga0207675_100009956 3300026118 Bacteria 8900
588 Ga0207675_100042433 3300026118 Bacteria 4247
589 Ga0207675_100141120 3300026118 Bacteria 2289
590 Ga0207675_100261617 3300026118 Unclassified 1677
591 Ga0207675_101125594 3300026118 Bacteria 805
592 Ga0207683_10072473 3300026121 Bacteria 3046
593 Ga0207683_10120221 3300026121 Bacteria 2357
594 Ga0207683_10601172 3300026121 Bacteria 1018
595 Ga0207698_10412916 3300026142 Bacteria 1293
596 Ga0207698_10453003 3300026142 Bacteria 1239
597 Ga0207698_11277820 3300026142 Bacteria 748
598 Ga0209588_1025967 3300027671 Bacteria 1857
599 Ga0207428_10000413 3300027907 Bacteria 53087
600 Ga0207428_10046079 3300027907 Bacteria 3508
601 Ga0207428_10432135 3300027907 Bacteria 961
602 Ga0207428_10633861 3300027907 Bacteria 768
603 Ga0268266_11174764 3300028379 Unclassified 742
604 Ga0268266_11189189 3300028379 Bacteria 737
605 Ga0268265_10043935 3300028380 Bacteria 3325
606 Ga0268265_10070052 3300028380 Bacteria 2726
607 Ga0268265_10125984 3300028380 Bacteria 2119
608 Ga0268265_10428404 3300028380 Unclassified 1230
609 Ga0268265_10700909 3300028380 Bacteria 978
610 Ga0268265_10761037 3300028380 Bacteria 941
611 Ga0268264_10025346 3300028381 Bacteria 4845
612 Ga0268264_10281833 3300028381 Bacteria 1557
613 Ga0268264_10742538 3300028381 Bacteria 977
614 Ga0307405_11048789 3300031731 Unclassified 698
615 Ga0307410_10101259 3300031852 Bacteria 2065
616 Ga0307410_11558810 3300031852 Unclassified 583
617 Ga0307407_10567255 3300031903 Bacteria 841
618 Ga0307412_11635896 3300031911 Unclassified 589
619 Ga0307409_100707007 3300031995 Bacteria 1008
620 Ga0307416_100429599 3300032002 Bacteria 1368
621 Ga0307416_101420413 3300032002 Bacteria 800
622 Ga0307416_102338677 3300032002 Unclassified 634
623 Ga0307411_10370259 3300032005 Bacteria 1175
624 Ga0373928_0019043 3300035084 Bacteria 1429
625 Ga0373934_0025992 3300035086 Bacteria 2270
626 Ga0373939_0497241 3300035114 Bacteria 520
627 Ga0373941_0305631 3300035115 Bacteria 636
628 Ga0373945_0306214 3300035116 Bacteria 681
629 Ga0373945_0543322 3300035116 Unclassified 521
630 Ga0373953_0238492 3300035117 Bacteria 789
631 Ga0373943_0230162 3300035170 Unclassified 1035
632 Ga0373943_0245571 3300035170 Bacteria 1004
633 Ga0373955_0073794 3300035172 Bacteria 1913
634 Ga0316574_0087116 3300035398 Bacteria 1988
635 Ga0316574_0139357 3300035398 Bacteria 1562
636 Ga0373927_0033214 3300035695 Bacteria 3359
637 Ga0373933_0155748 3300035724 Unclassified 1449
638 Ga0373947_1062700 3300035725 Unclassified 552
639 Ga0373947_1236113 3300035725 Bacteria 509
640 Ga0373937_0106882 3300036401 Bacteria 2601
641 Ga0373937_0561838 3300036401 Bacteria 1084
642 Ga0316584_0732277 3300036712 Bacteria 676
643 Ga0373925_0008740 3300037068 Bacteria 7378
644 Ga0373925_0092136 3300037068 Bacteria 2318
645 Ga0395905_0171347 3300037471 Bacteria 2039
646 Ga0436365_0615410 3300039437 Unclassified 1030
647 Ga0436365_1265377 3300039437 Unclassified 687
648 Ga0439466_0224634 3300041411 Unclassified 570
649 Ga0451802_1169347 3300041460 Bacteria 536
650 Ga0451853_3447544 3300041512 Bacteria 915
651 Ga0439433_0003604 3300041999 Unclassified 3329
652 Ga0439441_014075 3300042001 Bacteria 1397
653 Ga0439462_0146830 3300042015 Unclassified 662
654 Ga0439434_0087992 3300042435 Bacteria 991
655 Ga0439435_0187600 3300042436 Unclassified 677
656 Ga0439444_0071870 3300042437 Bacteria 742
657 Ga0439464_0180592 3300042439 Bacteria 668
658 Ga0439464_0198468 3300042439 Bacteria 639
659 Ga0439464_0255048 3300042439 Bacteria 567
660 Ga0450918_046349 3300042531 Bacteria 787
661 Ga0450918_125916 3300042531 Bacteria 515
662 Ga0451577_0810891 3300042876 Bacteria 845
663 Ga0453683_0247526 3300044673 Bacteria 1136
664 Ga0453683_0622087 3300044673 Bacteria 705
665 Ga0466963_0037445 3300044694 Bacteria 3168
666 Ga0453684_0540312 3300044712 Bacteria 1285
667 Ga0466957_0110110 3300044842 Bacteria 1746
668 Ga0466957_0123233 3300044842 Bacteria 1654
669 Ga0451576_0012058 3300045051 Bacteria 9756
670 Ga0451576_0174738 3300045051 Unclassified 2242
671 Ga0451576_0240415 3300045051 Bacteria 1891
672 Ga0451576_0408910 3300045051 Unclassified 1423
673 Ga0451576_0484599 3300045051 Bacteria 1299
674 Ga0451576_0722391 3300045051 Bacteria 1046
675 Ga0466967_0084859 3300045976 Bacteria 2866
676 Ga0466967_1059398 3300045976 Bacteria 808
677 Ga0495592_0098553 3300046454 Bacteria 2086
678 Ga0495651_0006446 3300046462 Bacteria 8978
679 Ga0495580_0025669 3300046472 Bacteria 4306
680 Ga0495580_0269569 3300046472 Bacteria 1163
681 Ga0495582_0170945 3300046473 Bacteria 1237
682 Ga0495639_0717609 3300046475 Bacteria 517
683 Ga0495664_0034160 3300046477 Bacteria 2991
684 Ga0495594_0060961 3300046499 Bacteria 2087
685 Ga0495594_0100588 3300046499 Bacteria 1626
686 Ga0495628_0174963 3300046516 Unclassified 1626
687 Ga0495630_0029235 3300046517 Bacteria 4096
688 Ga0495666_0235260 3300046526 Bacteria 837
689 Ga0495652_0018170 3300046529 Bacteria 6275
690 Ga0495665_0680592 3300046531 Bacteria 511
691 Ga0495586_0033992 3300046535 Bacteria 2737
692 Ga0495587_0009958 3300046536 Bacteria 6068
693 Ga0495621_0124207 3300046539 Bacteria 1000
694 Ga0495621_0273706 3300046539 Bacteria 694
695 Ga0495645_0003822 3300046543 Bacteria 10242
696 Ga0495645_0157246 3300046543 Bacteria 1574
697 Ga0495622_0058709 3300046557 Unclassified 1782
698 Ga0495633_0135743 3300046558 Bacteria 1138
699 Ga0495667_0038543 3300046559 Bacteria 3182
700 Ga0495656_0272123 3300046615 Bacteria 861
701 Ga0495634_0732350 3300046642 Bacteria 567
702 Ga0495659_0365017 3300046664 Bacteria 619
703 Ga0495659_0524672 3300046664 Bacteria 521
704 Ga0495657_0335776 3300046675 Bacteria 896
705 Ga0495599_0047894 3300046678 Bacteria 2679
706 Ga0495623_0161334 3300046679 Bacteria 1317
707 Ga0495647_0264227 3300046681 Bacteria 769
708 Ga0495600_0006903 3300046809 Bacteria 6924
709 Ga0495600_0102040 3300046809 Bacteria 1870
710 Ga0495581_0282060 3300047315 Bacteria 971
711 Ga0495604_0575763 3300047317 Bacteria 724
712 Ga0495636_0540280 3300047318 Unclassified 566
713 Ga0495672_0003461 3300047320 Bacteria 13501
714 Ga0495684_0109941 3300047471 Bacteria 2081
715 Ga0495602_0327073 3300048088 Bacteria 1113
716 Ga0496100_1583314 3300048903 Bacteria 518
717 Ga0496102_0576392 3300048905 Bacteria 1048
718 Ga0496103_0619129 3300048906 Bacteria 689
719 Ga0496104_0535311 3300048907 Bacteria 1082
720 Ga0496106_0078456 3300048909 Unclassified 2534
721 Ga0496108_0835643 3300048911 Bacteria 793
722 Ga0496109_1981475 3300048912 Bacteria 514
723 Ga0496114_0309549 3300048917 Unclassified 1395
724 Ga0501032_0535554 3300049569 Bacteria 747
725 Ga0501039_0018331 3300049575 Bacteria 5372
726 Ga0501039_1187743 3300049575 Bacteria 590
727 Ga0501040_0362592 3300049576 Bacteria 1039
728 Ga0501040_1260270 3300049576 Bacteria 536
729 Ga0501042_0067436 3300049578 Unclassified 2558
730 Ga0501042_0362979 3300049578 Unclassified 1048
731 Ga0501043_0020312 3300049579 Bacteria 5211
732 Ga0501046_0684129 3300049580 Unclassified 724
733 Ga0501047_1200178 3300049581 Unclassified 572
734 Ga0501071_0065019 3300049587 Unclassified 2648
735 Ga0501071_0288847 3300049587 Bacteria 1242
736 Ga0501072_0185991 3300049588 Bacteria 1657
737 Ga0501074_0354091 3300049590 Unclassified 1042
738 Ga0501074_0644776 3300049590 Bacteria 748
739 Ga0501075_0947351 3300049591 Bacteria 654
740 Ga0501075_1349242 3300049591 Unclassified 540
741 Ga0501076_0174488 3300049592 Unclassified 1752
742 Ga0501076_0354472 3300049592 Unclassified 1205
743 Ga0501076_1290911 3300049592 Unclassified 600
744 Ga0501198_061380 3300049649 Bacteria 691
745 Ga0501235_227979 3300049669 Unclassified 514
746 Ga0501258_040272 3300049687 Bacteria 622
747 Ga0501079_0089327 3300049741 Bacteria 2386
748 Ga0501079_0296192 3300049741 Bacteria 1265
749 Ga0501081_0033223 3300049743 Bacteria 3504
750 Ga0501081_0512572 3300049743 Unclassified 894
751 Ga0501081_0879707 3300049743 Bacteria 675
752 Ga0501081_1191888 3300049743 Unclassified 577
753 Ga0501081_1223252 3300049743 Unclassified 569
754 Ga0501263_050209 3300049760 Bacteria 633
755 Ga0501264_026778 3300049761 Unclassified 643
756 Ga0501035_0114716 3300049822 Bacteria 2359
757 Ga0501044_0190159 3300049823 Bacteria 2016
758 Ga0501045_0060520 3300049824 Bacteria 2776
759 nmdc:mga05p37_1242900_c1 3300050507 Unclassified 765
760 nmdc:mga05p37_209039_c1 3300050507 Bacteria 2360
761 nmdc:mga05p37_358605_c1 3300050507 Bacteria 1715
762 nmdc:mga05p37_869252_c1 3300050507 Unclassified 977
763 nmdc:mga09592_297687_c1 3300050508 Bacteria 1399
764 nmdc:mga09592_37831_c1 3300050508 Bacteria 4049
765 nmdc:mga09592_66660_c1 3300050508 Bacteria 3052
766 nmdc:mga0qj67_1118289_c1 3300050509 Unclassified 615
767 nmdc:mga0qj67_181777_c1 3300050509 Bacteria 1708
768 nmdc:mga0qj67_33516_c1 3300050509 Bacteria 4008
769 nmdc:mga0qj67_400226_c1 3300050509 Unclassified 1108
770 nmdc:mga0qj67_430558_c1 3300050509 Bacteria 1063
771 nmdc:mga0qj67_55384_c1 3300050509 Bacteria 3142
772 nmdc:mga06r32_198310_c1 3300050510 Bacteria 1995
773 nmdc:mga06r32_273347_c1 3300050510 Bacteria 1677
774 nmdc:mga06r32_396366_c1 3300050510 Bacteria 1363
775 nmdc:mga06r32_77335_c1 3300050510 Bacteria 3232
776 nmdc:mga06r32_98488_c1 3300050510 Bacteria 2866
777 nmdc:mga08y16_170117_c1 3300050511 Bacteria 2263
778 nmdc:mga08y16_180873_c1 3300050511 Bacteria 2190
779 nmdc:mga08y16_189372_c1 3300050511 Bacteria 2134
780 nmdc:mga08y16_346951_c1 3300050511 Bacteria 1525
781 nmdc:mga08y16_734048_c1 3300050511 Bacteria 985
782 nmdc:mga08y16_805632_c1 3300050511 Bacteria 932
783 nmdc:mga08y16_8540_c1 3300050511 Bacteria 10729
784 nmdc:mga0n895_126690_c1 3300050512 Unclassified 2577
785 nmdc:mga0n895_1268511_c1 3300050512 Bacteria 709
786 nmdc:mga0n895_139421_c1 3300050512 Bacteria 2453
787 nmdc:mga0n895_18896_c1 3300050512 Bacteria 6391
788 nmdc:mga0n895_2066763_c1 3300050512 Bacteria 527
789 nmdc:mga0n895_26982_c1 3300050512 Bacteria 5449
790 nmdc:mga0n895_323155_c1 3300050512 Bacteria 1564
791 nmdc:mga0n895_3306_c1 3300050512 Bacteria 12944
792 nmdc:mga0n895_429_c1 3300050512 Bacteria 28206
793 nmdc:mga0n895_629469_c1 3300050512 Bacteria 1073
794 nmdc:mga0n895_79585_c1 3300050512 Bacteria 3264
795 nmdc:mga0rr50_564959_c1 3300050513 Bacteria 969
796 nmdc:mga0rr50_82415_c1 3300050513 Bacteria 2484
797 nmdc:mga0rr50_8697_c1 3300050513 Bacteria 6330
798 nmdc:mga08x19_101042_c1 3300050514 Unclassified 1914
799 nmdc:mga08x19_1182136_c1 3300050514 Bacteria 542
800 nmdc:mga08x19_156502_c1 3300050514 Bacteria 1546
801 nmdc:mga08x19_37004_c1 3300050514 Bacteria 3095
802 nmdc:mga0a205_1684_c1 3300050515 Bacteria 19076
803 nmdc:mga0a205_179418_c1 3300050515 Bacteria 2012
804 nmdc:mga0a205_222029_c1 3300050515 Bacteria 1775
805 nmdc:mga0a205_309780_c1 3300050515 Bacteria 1451
806 nmdc:mga0a205_417275_c1 3300050515 Bacteria 1204
807 nmdc:mga0a205_45241_c1 3300050515 Unclassified 4244
808 nmdc:mga0a205_574036_c1 3300050515 Bacteria 982
809 nmdc:mga0a205_5976_c1 3300050515 Bacteria 10970
810 nmdc:mga0a205_5997_c1 3300050515 Bacteria 10955
811 nmdc:mga0a205_700868_c1 3300050515 Bacteria 862
812 nmdc:mga0a205_728372_c1 3300050515 Unclassified 841
813 nmdc:mga0a205_8622_c1 3300050515 Bacteria 9277
814 Ga0495619_0094686 3300053085 Bacteria 2026
815 Ga0500596_069325 3300053735 Unclassified 600
816 Ga0501084_0210398 3300054114 Unclassified 1641
817 Ga0501084_1806343 3300054114 Bacteria 510
818 Ga0501082_0247904 3300060353 Unclassified 1550
819 Ga0501082_1283266 3300060353 Unclassified 640
820 Ga0530510_0195283 3300061734 Unclassified 1503
821 Ga0530510_0308051 3300061734 Bacteria 1186
822 Ga0501068_0848532
823 SwRhRL2b_contig_3090340
824 MRS1b_contig_7347823
825 JGI24746J21847_1005903
826 JGI24746J21847_1018795
827 JGI24742J22300_10037705
828 Ga0065704_10107681
829 Ga0065704_10475771
830 Ga0065712_10179213
831 Ga0065712_10309829
832 Ga0065715_10017516
833 Ga0065715_10934425
834 Ga0065707_10085184
835 Ga0065707_10280353
836 Ga0065707_10290541
837 Ga0065707_10953746
838 Ga0070658_10816169
839 Ga0070676_10016381
840 Ga0070676_10044388
841 Ga0070676_11056818
842 Ga0070683_100022077
843 Ga0070683_100025311
844 Ga0070683_100111540
845 Ga0070690_100023916
846 Ga0070690_100546691
847 Ga0070670_100139832
848 Ga0070670_100251587
849 Ga0070670_100718420
850 Ga0070677_10005078
851 Ga0068869_100050215
852 Ga0068869_100198356
853 Ga0068869_100642302
854 Ga0070666_10100761
855 Ga0070666_10191581
856 Ga0070680_100005979
857 Ga0070680_100100134
858 Ga0070680_100101289
859 Ga0070682_100099187
860 Ga0068868_100034062
861 Ga0068868_100324062
862 Ga0068868_101520780
863 Ga0070660_100096997
864 Ga0070689_100072634
865 Ga0070689_100781988
866 Ga0070691_10014882
867 Ga0070691_10066612
868 Ga0070691_10234061
869 Ga0070687_100008622
870 Ga0070661_100007509
871 Ga0070661_100026282
872 Ga0070661_100431631
873 Ga0070661_100941603
874 Ga0070668_100106234
875 Ga0070668_100107386
876 Ga0070668_101042892
877 Ga0070669_100017310
878 Ga0070669_100058948
879 Ga0070669_100195133
880 Ga0070669_100309091
881 Ga0070669_100969604
882 Ga0070669_101491412
883 Ga0070675_100562422
884 Ga0070675_100869661
885 Ga0070675_101275816
886 Ga0070671_100207954
887 Ga0070674_100004735
888 Ga0070674_100006894
889 Ga0070674_100588467
890 Ga0070673_100029315
891 Ga0070673_100100980
892 Ga0070688_100000962
893 Ga0070688_100056301
894 Ga0070688_101035351
895 Ga0070688_101240837
896 Ga0070659_100009099
897 Ga0070659_100345311
898 Ga0070667_100031981
899 Ga0070667_101177264
900 Ga0070703_10058468
901 Ga0070703_10168449
902 Ga0070709_10001469
903 Ga0070709_10387287
904 Ga0070714_100018344
905 Ga0070714_100223076
906 Ga0070713_100001501
907 Ga0070713_100501893
908 Ga0070701_10049952
909 Ga0070711_100000395
910 Ga0070711_100624640
911 Ga0070705_100007996
912 Ga0070705_100063806
913 Ga0070705_100333440
914 Ga0070705_100701326
915 Ga0070705_101943172
916 Ga0070700_100558259
917 Ga0070694_100004758
918 Ga0070694_100181736
919 Ga0070694_100260372
920 Ga0070694_100336162
921 Ga0070708_100002004
922 Ga0070708_100970972
923 Ga0070708_100977370
924 Ga0070708_101411936
925 Ga0070708_101544986
926 Ga0070678_100008983
927 Ga0070678_100242567
928 Ga0070678_100886985
929 Ga0070678_101285479
930 Ga0070662_100004071
931 Ga0070662_101510244
932 Ga0070681_10000857
933 Ga0070681_10002670
934 Ga0070681_10268187
935 Ga0070681_10659412
936 Ga0068867_100018446
937 Ga0068867_100271215
938 Ga0068867_100772484
939 Ga0070685_10396735
940 Ga0070707_100052251
941 Ga0070707_100074613
942 Ga0070707_102014512
943 Ga0070698_100119735
944 Ga0070698_100190385
945 Ga0070698_100235724
946 Ga0070698_100399011
947 Ga0070698_101181702
948 Ga0070698_101327485
949 Ga0070699_100113259
950 Ga0070699_101878236
951 Ga0070679_100000924
952 Ga0070679_100007124
953 Ga0070679_100010037
954 Ga0070679_100023377
955 Ga0070684_100005166
956 Ga0070684_100005387
957 Ga0070684_100044553
958 Ga0070684_100095964
959 Ga0070684_100282863
960 Ga0070697_100135178
961 Ga0070697_100387765
962 Ga0068853_100244178
963 Ga0070672_100039084
964 Ga0070672_100554576
965 Ga0070672_101966103
966 Ga0070695_100009930
967 Ga0070695_100016981
968 Ga0070695_100091297
969 Ga0070696_100041120
970 Ga0070696_100096187
971 Ga0070693_100041763
972 Ga0070665_100474274
973 Ga0070665_101085792
974 Ga0070704_100110008
975 Ga0070704_101761225
976 Ga0070704_101956123
977 Ga0068855_100089330
978 Ga0068855_100127202
979 Ga0068855_100339396
980 Ga0068855_100485257
981 Ga0068855_100788143
982 Ga0068855_101249569
983 Ga0070664_100023271
984 Ga0070664_100135458
985 Ga0068857_100010501
986 Ga0068857_100034089
987 Ga0068857_100224213
988 Ga0068857_100461313
989 Ga0068854_100023851
990 Ga0068854_100070969
991 Ga0068856_100171932
992 Ga0068856_100221555
993 Ga0068856_100383410
994 Ga0068856_100384463
995 Ga0068856_100395308
996 Ga0068856_100668769
997 Ga0070702_100065981
998 Ga0070702_101572413
999 Ga0068852_100202518
1000 Ga0068852_100296547
1001 Ga0068852_100721904
1002 Ga0068852_102535176
1003 Ga0068859_100063067
1004 Ga0068859_100102931
1005 Ga0068859_100335684
1006 Ga0068859_100339909
1007 Ga0068859_100437093
1008 Ga0068859_100637673
1009 Ga0068859_101324515
1010 Ga0068864_100000808
1011 Ga0068864_100055483
1012 Ga0068864_100654107
1013 Ga0068866_10000622
1014 Ga0068861_100088044
1015 Ga0068861_101480848
1016 Ga0068851_10039531
1017 Ga0068870_10006745
1018 Ga0068870_10008802
1019 Ga0068870_10040468
1020 Ga0068870_10242642
1021 Ga0068863_100824988
1022 Ga0068863_100991921
1023 Ga0068858_100005538
1024 Ga0068858_100028383
1025 Ga0068858_100161843
1026 Ga0068858_100437128
1027 Ga0068860_100047100
1028 Ga0068860_100048103
1029 Ga0068860_100723234
1030 Ga0068860_102424643
1031 Ga0068862_100081503
1032 Ga0068862_100154147
1033 Ga0068862_100159333
1034 Ga0068862_100216817
1035 Ga0068862_100746415
1036 Ga0068862_101218614
1037 Ga0068862_102160210
1038 Ga0070717_10009515
1039 Ga0070715_10202067
1040 Ga0097621_100083684
1041 Ga0097621_100151740
1042 Ga0097621_100168103
1043 Ga0068871_100163873
1044 Ga0068871_100164587
1045 Ga0068871_102145162
1046 Ga0075428_100008283
1047 Ga0075428_100026824
1048 Ga0075428_100410673
1049 Ga0075428_101426050
1050 Ga0075430_100004611
1051 Ga0075430_100017467
1052 Ga0075430_100125114
1053 Ga0075430_100268252
1054 Ga0075431_100016666
1055 Ga0075431_100201898
1056 Ga0075433_10004730
1057 Ga0075433_10006512
1058 Ga0075433_10119365
1059 Ga0075433_10120871
1060 Ga0075433_10129820
1061 Ga0075433_10157465
1062 Ga0075433_10180798
1063 Ga0075433_10874776
1064 Ga0075434_100003938
1065 Ga0075434_100015773
1066 Ga0075434_100041599
1067 Ga0075434_100054083
1068 Ga0075434_100484624
1069 Ga0075434_100585423
1070 Ga0075434_100701851
1071 Ga0075434_100745445
1072 Ga0075434_101313221
1073 Ga0075434_101320581
1074 Ga0075434_102333447
1075 Ga0075429_100038955
1076 Ga0075429_100112926
1077 Ga0075429_100115857
1078 Ga0068865_100004039
1079 Ga0068865_100991361
1080 Ga0075436_100017379
1081 Ga0075436_100068509
1082 Ga0075436_100259917
1083 Ga0097620_100063070
1084 Ga0097620_100102946
1085 Ga0097620_100335697
1086 Ga0097620_100339929
1087 Ga0097620_100437121
1088 Ga0097620_100637628
1089 Ga0097620_101324480
1090 Ga0075435_100114545
1091 Ga0075435_100496263
1092 Ga0075435_100938945
1093 Ga0075435_101005875
1094 Ga0099794_10111313
1095 Ga0105240_10046309
1096 Ga0105240_10059528
1097 Ga0105240_10191668
1098 Ga0105240_10208317
1099 Ga0105240_10397314
1100 Ga0105240_11341500
1101 Ga0105240_11516081
1102 Ga0105240_11620829
1103 Ga0111539_10000538
1104 Ga0111539_10179483
1105 Ga0111539_11766176
1106 Ga0105245_10229926
1107 Ga0105245_11116699
1108 Ga0105245_11764017
1109 Ga0105247_10029435
1110 Ga0105247_10342378
1111 Ga0114129_10044723
1112 Ga0114129_10241115
1113 Ga0114129_10311196
1114 Ga0114129_10663598
1115 Ga0114129_12262037
1116 Ga0105243_10146569
1117 Ga0105243_10211014
1118 Ga0105243_10538199
1119 Ga0105241_10015144
1120 Ga0105241_10341291
1121 Ga0105241_11412751
1122 Ga0105242_10271682
1123 Ga0105242_11566824
1124 Ga0105242_13237381
1125 Ga0105248_10015782
1126 Ga0105248_10048596
1127 Ga0105248_10358334
1128 Ga0105248_10596299
1129 Ga0105248_12247339
1130 Ga0105237_10453565
1131 Ga0105237_11348473
1132 Ga0105237_11568470
1133 Ga0105237_12164916
1134 Ga0105237_12474661
1135 Ga0105238_10150008
1136 Ga0105238_10370067
1137 Ga0105238_11922225
1138 Ga0105249_10086258
1139 Ga0105249_10117150
1140 Ga0105249_10209614
1141 Ga0105249_10316566
1142 Ga0105249_10737523
1143 Ga0105249_10801055
1144 Ga0105249_10903643
1145 Ga0105239_10058947
1146 Ga0105239_10296177
1147 Ga0105239_11030392
1148 Ga0105246_10009650
1149 Ga0105246_10026634
1150 Ga0105246_10287913
1151 Ga0105246_10959677
1152 Ga0157373_10006113
1153 Ga0157373_10008139
1154 Ga0157373_10592253
1155 Ga0157373_10610590
1156 Ga0157370_10036803
1157 Ga0157370_10041048
1158 Ga0157370_10082090
1159 Ga0157370_10139785
1160 Ga0157370_10343630
1161 Ga0157370_10482976
1162 Ga0157370_10532707
1163 Ga0157370_11162709
1164 Ga0157369_10021262
1165 Ga0157369_10022113
1166 Ga0157369_10120701
1167 Ga0157369_10262498
1168 Ga0157369_10300046
1169 Ga0157369_10371513
1170 Ga0157369_10410123
1171 Ga0157369_10600419
1172 Ga0157369_12311297
1173 Ga0157374_10439314
1174 Ga0157374_11246992
1175 Ga0157374_12528854
1176 Ga0157378_10032881
1177 Ga0163162_10036256
1178 Ga0163162_10102699
1179 Ga0163162_12402203
1180 Ga0157372_10011579
1181 Ga0157372_10012424
1182 Ga0157372_10025733
1183 Ga0157372_10044399
1184 Ga0157372_10471837
1185 Ga0157375_10091378
1186 Ga0157375_10197222
1187 Ga0157375_10498405
1188 Ga0157375_10920548
1189 Ga0163163_10229071
1190 Ga0157380_10007796
1191 Ga0157380_10014458
1192 Ga0157380_10021654
1193 Ga0157380_10105668
1194 Ga0157380_10598207
1195 Ga0157380_11668258
1196 Ga0182008_10458431
1197 Ga0157377_10260657
1198 Ga0157379_10028104
1199 Ga0157379_10067008
1200 Ga0157376_10277619
1201 Ga0157376_10428804
1202 Ga0157376_10491124
1203 Ga0163161_10005896
1204 Ga0163161_10079041
1205 Ga0163161_10715563
1206 Ga0163161_11179949
1207 Ga0206356_10206487
1208 Ga0206353_10366391
1209 Ga0213876_10254517
1210 Ga0207697_10001167
1211 Ga0207656_10027037
1212 Ga0207656_10028196
1213 Ga0207653_10000528
1214 Ga0207653_10039485
1215 Ga0207653_10261613
1216 Ga0207682_10003279
1217 Ga0207682_10019128
1218 Ga0207642_10001495
1219 Ga0207642_10664893
1220 Ga0207710_10137492
1221 Ga0207688_10004841
1222 Ga0207680_10068497
1223 Ga0207680_10205043
1224 Ga0207680_10263434
1225 Ga0207647_10286326
1226 Ga0207685_10163786
1227 Ga0207699_10021613
1228 Ga0207699_10602461
1229 Ga0207645_10003863
1230 Ga0207645_10011601
1231 Ga0207643_10001455
1232 Ga0207643_10008047
1233 Ga0207643_10009672
1234 Ga0207643_10081260
1235 Ga0207643_10118306
1236 Ga0207643_10127074
1237 Ga0207684_10031113
1238 Ga0207684_10457109
1239 Ga0207684_10644718
1240 Ga0207654_10025951
1241 Ga0207707_10019304
1242 Ga0207707_10180764
1243 Ga0207707_10270175
1244 Ga0207707_10725595
1245 Ga0207707_10728274
1246 Ga0207707_10729336
1247 Ga0207695_10016423
1248 Ga0207695_10021694
1249 Ga0207695_10043911
1250 Ga0207695_10056696
1251 Ga0207695_10093519
1252 Ga0207695_10177887
1253 Ga0207695_10305110
1254 Ga0207695_10351933
1255 Ga0207671_10541336
1256 Ga0207671_10682758
1257 Ga0207660_10028143
1258 Ga0207660_10068958
1259 Ga0207660_10087225
1260 Ga0207662_10009327
1261 Ga0207662_10015377
1262 Ga0207662_11116726
1263 Ga0207657_10104968
1264 Ga0207657_10118678
1265 Ga0207657_10453211
1266 Ga0207649_10007168
1267 Ga0207649_10080026
1268 Ga0207649_10111178
1269 Ga0207649_10258873
1270 Ga0207649_10731697
1271 Ga0207652_10007095
1272 Ga0207652_10177997
1273 Ga0207652_10841185
1274 Ga0207652_10970579
1275 Ga0207646_10001564
1276 Ga0207646_10097986
1277 Ga0207646_11126822
1278 Ga0207646_11663688
1279 Ga0207646_11739667
1280 Ga0207681_10068742
1281 Ga0207681_10238544
1282 Ga0207681_10460184
1283 Ga0207681_10482698
1284 Ga0207681_10570530
1285 Ga0207681_11292550
1286 Ga0207694_10044734
1287 Ga0207694_10176592
1288 Ga0207694_10432399
1289 Ga0207694_10940635
1290 Ga0207650_10023723
1291 Ga0207650_10095642
1292 Ga0207650_10140751
1293 Ga0207650_10232895
1294 Ga0207650_10350029
1295 Ga0207650_10515628
1296 Ga0207659_10126749
1297 Ga0207659_10395868
1298 Ga0207659_10635235
1299 Ga0207687_10604142
1300 Ga0207700_10017897
1301 Ga0207664_10236792
1302 Ga0207664_10838424
1303 Ga0207664_10872239
1304 Ga0207644_11353542
1305 Ga0207690_10002601
1306 Ga0207690_10591278
1307 Ga0207690_10732238
1308 Ga0207690_10976900
1309 Ga0207706_10000218
1310 Ga0207706_10252509
1311 Ga0207686_10002437
1312 Ga0207686_10005688
1313 Ga0207686_10626626
1314 Ga0207709_10015176
1315 Ga0207709_10115993
1316 Ga0207709_10363511
1317 Ga0207670_10013106
1318 Ga0207670_10183131
1319 Ga0207670_10301509
1320 Ga0207670_10387709
1321 Ga0207670_10920000
1322 Ga0207669_10000933
1323 Ga0207669_10041790
1324 Ga0207669_10727899
1325 Ga0207704_10134275
1326 Ga0207704_10363145
1327 Ga0207665_10007638
1328 Ga0207665_10355486
1329 Ga0207691_10007060
1330 Ga0207691_10030230
1331 Ga0207691_10246920
1332 Ga0207711_10051808
1333 Ga0207711_10069994
1334 Ga0207711_10124465
1335 Ga0207711_10242612
1336 Ga0207689_10005269
1337 Ga0207689_10035162
1338 Ga0207689_10084992
1339 Ga0207689_10105432
1340 Ga0207689_10549402
1341 Ga0207661_10062543
1342 Ga0207661_10065614
1343 Ga0207661_10082900
1344 Ga0207661_10344541
1345 Ga0207679_10006327
1346 Ga0207679_10252834
1347 Ga0207667_10207784
1348 Ga0207667_10233112
1349 Ga0207667_10368845
1350 Ga0207667_10392228
1351 Ga0207667_10992843
1352 Ga0207651_10014021
1353 Ga0207712_10000775
1354 Ga0207712_10002104
1355 Ga0207712_10015131
1356 Ga0207712_10062297
1357 Ga0207712_10239722
1358 Ga0207712_10294561
1359 Ga0207712_10305393
1360 Ga0207712_10625736
1361 Ga0207668_10295135
1362 Ga0207640_10180218
1363 Ga0207640_10252595
1364 Ga0207640_10968394
1365 Ga0207658_10078354
1366 Ga0207658_10646539
1367 Ga0207658_11204486
1368 Ga0207658_11469967
1369 Ga0207677_10590463
1370 Ga0207677_10843337
1371 Ga0207677_11400862
1372 Ga0207703_10052362
1373 Ga0207703_10151765
1374 Ga0207703_10419100
1375 Ga0207703_10442667
1376 Ga0207678_10013214
1377 Ga0207708_10023908
1378 Ga0207708_10162139
1379 Ga0207708_10186525
1380 Ga0207708_10348212
1381 Ga0207708_10441859
1382 Ga0207702_10072027
1383 Ga0207702_10289200
1384 Ga0207702_10309578
1385 Ga0207702_10741570
1386 Ga0207702_11370257
1387 Ga0207702_11451523
1388 Ga0207641_10001235
1389 Ga0207641_10011819
1390 Ga0207641_10042331
1391 Ga0207641_10321971
1392 Ga0207648_10003314
1393 Ga0207648_10028708
1394 Ga0207648_10152251
1395 Ga0207648_11080109
1396 Ga0207648_11166577
1397 Ga0207676_10026480
1398 Ga0207676_10051603
1399 Ga0207676_10203391
1400 Ga0207676_10495504
1401 Ga0207676_11090265
1402 Ga0207674_10001105
1403 Ga0207674_10005320
1404 Ga0207674_10093328
1405 Ga0207674_10499006
1406 Ga0207674_10804200
1407 Ga0207674_11218331
1408 Ga0207675_100009956
1409 Ga0207675_100042433
1410 Ga0207675_100141120
1411 Ga0207675_100261617
1412 Ga0207675_101125594
1413 Ga0207683_10072473
1414 Ga0207683_10120221
1415 Ga0207683_10601172
1416 Ga0207698_10412916
1417 Ga0207698_10453003
1418 Ga0207698_11277820
1419 Ga0209588_1025967
1420 Ga0207428_10000413
1421 Ga0207428_10046079
1422 Ga0207428_10432135
1423 Ga0207428_10633861
1424 Ga0268266_11174764
1425 Ga0268266_11189189
1426 Ga0268265_10043935
1427 Ga0268265_10070052
1428 Ga0268265_10125984
1429 Ga0268265_10428404
1430 Ga0268265_10700909
1431 Ga0268265_10761037
1432 Ga0268264_10025346
1433 Ga0268264_10281833
1434 Ga0268264_10742538
1435 Ga0307405_11048789
1436 Ga0307410_10101259
1437 Ga0307410_11558810
1438 Ga0307407_10567255
1439 Ga0307412_11635896
1440 Ga0307409_100707007
1441 Ga0307416_100429599
1442 Ga0307416_101420413
1443 Ga0307416_102338677
1444 Ga0307411_10370259
1445 Ga0373928_0019043
1446 Ga0373934_0025992
1447 Ga0373939_0497241
1448 Ga0373941_0305631
1449 Ga0373945_0306214
1450 Ga0373945_0543322
1451 Ga0373953_0238492
1452 Ga0373943_0230162
1453 Ga0373943_0245571
1454 Ga0373955_0073794
1455 Ga0316574_0087116
1456 Ga0316574_0139357
1457 Ga0373927_0033214
1458 Ga0373933_0155748
1459 Ga0373947_1062700
1460 Ga0373947_1236113
1461 Ga0373937_0106882
1462 Ga0373937_0561838
1463 Ga0316584_0732277
1464 Ga0373925_0008740
1465 Ga0373925_0092136
1466 Ga0395905_0171347
1467 Ga0436365_0615410
1468 Ga0436365_1265377
1469 Ga0439466_0224634
1470 Ga0451802_1169347
1471 Ga0451853_3447544
1472 Ga0439433_0003604
1473 Ga0439441_014075
1474 Ga0439462_0146830
1475 Ga0439434_0087992
1476 Ga0439435_0187600
1477 Ga0439444_0071870
1478 Ga0439464_0180592
1479 Ga0439464_0198468
1480 Ga0439464_0255048
1481 Ga0450918_046349
1482 Ga0450918_125916
1483 Ga0451577_0810891
1484 Ga0453683_0247526
1485 Ga0453683_0622087
1486 Ga0466963_0037445
1487 Ga0453684_0540312
1488 Ga0466957_0110110
1489 Ga0466957_0123233
1490 Ga0451576_0012058
1491 Ga0451576_0174738
1492 Ga0451576_0240415
1493 Ga0451576_0408910
1494 Ga0451576_0484599
1495 Ga0451576_0722391
1496 Ga0466967_0084859
1497 Ga0466967_1059398
1498 Ga0495592_0098553
1499 Ga0495651_0006446
1500 Ga0495580_0025669
1501 Ga0495580_0269569
1502 Ga0495582_0170945
1503 Ga0495639_0717609
1504 Ga0495664_0034160
1505 Ga0495594_0060961
1506 Ga0495594_0100588
1507 Ga0495628_0174963
1508 Ga0495630_0029235
1509 Ga0495666_0235260
1510 Ga0495652_0018170
1511 Ga0495665_0680592
1512 Ga0495586_0033992
1513 Ga0495587_0009958
1514 Ga0495621_0124207
1515 Ga0495621_0273706
1516 Ga0495645_0003822
1517 Ga0495645_0157246
1518 Ga0495622_0058709
1519 Ga0495633_0135743
1520 Ga0495667_0038543
1521 Ga0495656_0272123
1522 Ga0495634_0732350
1523 Ga0495659_0365017
1524 Ga0495659_0524672
1525 Ga0495657_0335776
1526 Ga0495599_0047894
1527 Ga0495623_0161334
1528 Ga0495647_0264227
1529 Ga0495600_0006903
1530 Ga0495600_0102040
1531 Ga0495581_0282060
1532 Ga0495604_0575763
1533 Ga0495636_0540280
1534 Ga0495672_0003461
1535 Ga0495684_0109941
1536 Ga0495602_0327073
1537 Ga0496100_1583314
1538 Ga0496102_0576392
1539 Ga0496103_0619129
1540 Ga0496104_0535311
1541 Ga0496106_0078456
1542 Ga0496108_0835643
1543 Ga0496109_1981475
1544 Ga0496114_0309549
1545 Ga0501032_0535554
1546 Ga0501039_0018331
1547 Ga0501039_1187743
1548 Ga0501040_0362592
1549 Ga0501040_1260270
1550 Ga0501042_0067436
1551 Ga0501042_0362979
1552 Ga0501043_0020312
1553 Ga0501046_0684129
1554 Ga0501047_1200178
1555 Ga0501071_0065019
1556 Ga0501071_0288847
1557 Ga0501072_0185991
1558 Ga0501074_0354091
1559 Ga0501074_0644776
1560 Ga0501075_0947351
1561 Ga0501075_1349242
1562 Ga0501076_0174488
1563 Ga0501076_0354472
1564 Ga0501076_1290911
1565 Ga0501198_061380
1566 Ga0501235_227979
1567 Ga0501258_040272
1568 Ga0501079_0089327
1569 Ga0501079_0296192
1570 Ga0501081_0033223
1571 Ga0501081_0512572
1572 Ga0501081_0879707
1573 Ga0501081_1191888
1574 Ga0501081_1223252
1575 Ga0501263_050209
1576 Ga0501264_026778
1577 Ga0501035_0114716
1578 Ga0501044_0190159
1579 Ga0501045_0060520
1580 nmdc:mga05p37_1242900_c1
1581 nmdc:mga05p37_209039_c1
1582 nmdc:mga05p37_358605_c1
1583 nmdc:mga05p37_869252_c1
1584 nmdc:mga09592_297687_c1
1585 nmdc:mga09592_37831_c1
1586 nmdc:mga09592_66660_c1
1587 nmdc:mga0qj67_1118289_c1
1588 nmdc:mga0qj67_181777_c1
1589 nmdc:mga0qj67_33516_c1
1590 nmdc:mga0qj67_400226_c1
1591 nmdc:mga0qj67_430558_c1
1592 nmdc:mga0qj67_55384_c1
1593 nmdc:mga06r32_198310_c1
1594 nmdc:mga06r32_273347_c1
1595 nmdc:mga06r32_396366_c1
1596 nmdc:mga06r32_77335_c1
1597 nmdc:mga06r32_98488_c1
1598 nmdc:mga08y16_170117_c1
1599 nmdc:mga08y16_180873_c1
1600 nmdc:mga08y16_189372_c1
1601 nmdc:mga08y16_346951_c1
1602 nmdc:mga08y16_734048_c1
1603 nmdc:mga08y16_805632_c1
1604 nmdc:mga08y16_8540_c1
1605 nmdc:mga0n895_126690_c1
1606 nmdc:mga0n895_1268511_c1
1607 nmdc:mga0n895_139421_c1
1608 nmdc:mga0n895_18896_c1
1609 nmdc:mga0n895_2066763_c1
1610 nmdc:mga0n895_26982_c1
1611 nmdc:mga0n895_323155_c1
1612 nmdc:mga0n895_3306_c1
1613 nmdc:mga0n895_429_c1
1614 nmdc:mga0n895_629469_c1
1615 nmdc:mga0n895_79585_c1
1616 nmdc:mga0rr50_564959_c1
1617 nmdc:mga0rr50_82415_c1
1618 nmdc:mga0rr50_8697_c1
1619 nmdc:mga08x19_101042_c1
1620 nmdc:mga08x19_1182136_c1
1621 nmdc:mga08x19_156502_c1
1622 nmdc:mga08x19_37004_c1
1623 nmdc:mga0a205_1684_c1
1624 nmdc:mga0a205_179418_c1
1625 nmdc:mga0a205_222029_c1
1626 nmdc:mga0a205_309780_c1
1627 nmdc:mga0a205_417275_c1
1628 nmdc:mga0a205_45241_c1
1629 nmdc:mga0a205_574036_c1
1630 nmdc:mga0a205_5976_c1
1631 nmdc:mga0a205_5997_c1
1632 nmdc:mga0a205_700868_c1
1633 nmdc:mga0a205_728372_c1
1634 nmdc:mga0a205_8622_c1
1635 Ga0495619_0094686
1636 Ga0500596_069325
1637 Ga0501084_0210398
1638 Ga0501084_1806343
1639 Ga0501082_0247904
1640 Ga0501082_1283266
1641 Ga0530510_0195283
1642 Ga0530510_0308051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

6

123

0.91

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

10

127

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.95 2 131
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.9364 1 131
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9294 2 131
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.9254 2 133
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8994 2 133
ID Description Score Start End Superfamily
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.965 1 132 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.95 2 131 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9364 1 131 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9294 2 131 3.10.129.10
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9254 2 133 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V7K448-F1-model_v4 Acyl dehydratase 1 3 134 GO:0006633
GO:0019171
AF-A0A2V6SY34-F1-model_v4 MaoC-like domain-containing protein 0.9935 3 134 GO:0006633
GO:0019171
AF-A0A2V6TUC0-F1-model_v4 Acyl dehydratase 0.9928 4 134 GO:0006633
GO:0019171
AF-A0A524J3D7-F1-model_v4 MaoC family dehydratase 0.9924 3 134 GO:0006633
GO:0019171
AF-A0A2V2SHK0-F1-model_v4 deleted 0.9912 3 134

Map