F482245
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 821 | 318 | 1642 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100740046|Ga0070683_1007400462 |
| Length | 141 |
| Sequence | VAEHDHLTSPNLGGLDKFAFEPERVDKPWGHELIWSKTDHYAGKILFVRAGESLSLQFHKAKDEAWYVLEGRAQLELGEPGERMLNSEVVGPGAAFHFPPGTVHRVTAVEDTTIVEVSTPQLDDIVRLEDLYGRTEPSGSD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 98 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 99 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 100 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 101 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 102 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 182 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 206 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 209 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 210 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 214 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.12 |
| Nodule | 0 |
| Rhizoplane | 17.17 |
| Rhizosphere | 81.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100740046 | 3300005329 | Bacteria | 942 |
| 2 | Ga0070683_100267063 | 3300005329 | Bacteria | 1627 |
| 3 | Ga0070683_100545148 | 3300005329 | Bacteria | 1109 |
| 4 | Ga0068869_100165973 | 3300005334 | Bacteria | 1722 |
| 5 | Ga0068869_100726161 | 3300005334 | Bacteria | 849 |
| 6 | Ga0070666_10702206 | 3300005335 | Bacteria | 742 |
| 7 | Ga0070680_100026187 | 3300005336 | Bacteria | 4664 |
| 8 | Ga0070682_100005210 | 3300005337 | Bacteria | 7234 |
| 9 | Ga0070682_100548731 | 3300005337 | Unclassified | 904 |
| 10 | Ga0070682_100932828 | 3300005337 | Bacteria | 716 |
| 11 | Ga0070682_101163983 | 3300005337 | Bacteria | 649 |
| 12 | Ga0068868_100074827 | 3300005338 | Bacteria | 2705 |
| 13 | Ga0068868_100300824 | 3300005338 | Bacteria | 1362 |
| 14 | Ga0068868_100383510 | 3300005338 | Unclassified | 1210 |
| 15 | Ga0068868_100523675 | 3300005338 | Bacteria | 1041 |
| 16 | Ga0068868_100828183 | 3300005338 | Bacteria | 837 |
| 17 | Ga0070660_100103805 | 3300005339 | Bacteria | 2254 |
| 18 | Ga0070660_100420244 | 3300005339 | Unclassified | 1107 |
| 19 | Ga0070689_100689952 | 3300005340 | Bacteria | 891 |
| 20 | Ga0070691_10047492 | 3300005341 | Bacteria | 2041 |
| 21 | Ga0070691_10204642 | 3300005341 | Bacteria | 1038 |
| 22 | Ga0070691_10289851 | 3300005341 | Bacteria | 891 |
| 23 | Ga0070691_10521214 | 3300005341 | Bacteria | 690 |
| 24 | Ga0070687_100637460 | 3300005343 | Unclassified | 737 |
| 25 | Ga0070692_10139509 | 3300005345 | Bacteria | 1370 |
| 26 | Ga0070668_100068975 | 3300005347 | Bacteria | 2750 |
| 27 | Ga0070668_101412016 | 3300005347 | Bacteria | 635 |
| 28 | Ga0070669_100640230 | 3300005353 | Bacteria | 894 |
| 29 | Ga0070675_100968028 | 3300005354 | Unclassified | 781 |
| 30 | Ga0070671_100095584 | 3300005355 | Bacteria | 2490 |
| 31 | Ga0070671_100200560 | 3300005355 | Bacteria | 1692 |
| 32 | Ga0070671_100869311 | 3300005355 | Bacteria | 787 |
| 33 | Ga0070674_100007606 | 3300005356 | Bacteria | 6400 |
| 34 | Ga0070673_100350713 | 3300005364 | Bacteria | 1310 |
| 35 | Ga0070673_101651438 | 3300005364 | Bacteria | 606 |
| 36 | Ga0070688_100072160 | 3300005365 | Bacteria | 2212 |
| 37 | Ga0070688_101341827 | 3300005365 | Unclassified | 578 |
| 38 | Ga0070659_100276336 | 3300005366 | Bacteria | 1397 |
| 39 | Ga0070667_101445520 | 3300005367 | Bacteria | 645 |
| 40 | Ga0070709_10050586 | 3300005434 | Bacteria | 2604 |
| 41 | Ga0070709_10452534 | 3300005434 | Bacteria | 967 |
| 42 | Ga0070714_100080421 | 3300005435 | Bacteria | 2836 |
| 43 | Ga0070713_100011514 | 3300005436 | Bacteria | 6444 |
| 44 | Ga0070710_10114169 | 3300005437 | Bacteria | 1626 |
| 45 | Ga0070710_10637570 | 3300005437 | Unclassified | 745 |
| 46 | Ga0070710_10874223 | 3300005437 | Bacteria | 647 |
| 47 | Ga0070701_10106209 | 3300005438 | Bacteria | 1563 |
| 48 | Ga0070701_10322630 | 3300005438 | Bacteria | 956 |
| 49 | Ga0070711_100060550 | 3300005439 | Bacteria | 2632 |
| 50 | Ga0070711_100380442 | 3300005439 | Bacteria | 1141 |
| 51 | Ga0070711_100514497 | 3300005439 | Bacteria | 988 |
| 52 | Ga0070705_100042483 | 3300005440 | Bacteria | 2599 |
| 53 | Ga0070705_100146360 | 3300005440 | Bacteria | 1561 |
| 54 | Ga0070705_100184003 | 3300005440 | Unclassified | 1418 |
| 55 | Ga0070705_100216701 | 3300005440 | Bacteria | 1323 |
| 56 | Ga0070705_100261861 | 3300005440 | Bacteria | 1220 |
| 57 | Ga0070700_100418715 | 3300005441 | Unclassified | 1012 |
| 58 | Ga0070700_100739729 | 3300005441 | Bacteria | 786 |
| 59 | Ga0070700_100897090 | 3300005441 | Unclassified | 722 |
| 60 | Ga0070694_100191909 | 3300005444 | Bacteria | 1517 |
| 61 | Ga0070694_100776921 | 3300005444 | Bacteria | 784 |
| 62 | Ga0070694_100915099 | 3300005444 | Bacteria | 725 |
| 63 | Ga0070708_100109717 | 3300005445 | Bacteria | 2535 |
| 64 | Ga0070708_100139491 | 3300005445 | Bacteria | 2248 |
| 65 | Ga0070708_100216023 | 3300005445 | Bacteria | 1797 |
| 66 | Ga0070708_100628602 | 3300005445 | Bacteria | 1012 |
| 67 | Ga0070663_100033839 | 3300005455 | Bacteria | 3533 |
| 68 | Ga0070663_100909260 | 3300005455 | Bacteria | 761 |
| 69 | Ga0070678_100021829 | 3300005456 | Bacteria | 4230 |
| 70 | Ga0070678_100026985 | 3300005456 | Bacteria | 3892 |
| 71 | Ga0070678_100144236 | 3300005456 | Bacteria | 1909 |
| 72 | Ga0070662_100389084 | 3300005457 | Bacteria | 1149 |
| 73 | Ga0070681_10347884 | 3300005458 | Bacteria | 1392 |
| 74 | Ga0070681_10453453 | 3300005458 | Bacteria | 1195 |
| 75 | Ga0068867_100192196 | 3300005459 | Bacteria | 1629 |
| 76 | Ga0068867_100285411 | 3300005459 | Bacteria | 1355 |
| 77 | Ga0068867_100518198 | 3300005459 | Unclassified | 1028 |
| 78 | Ga0070685_10233153 | 3300005466 | Bacteria | 1212 |
| 79 | Ga0070685_10292794 | 3300005466 | Bacteria | 1094 |
| 80 | Ga0070706_100077589 | 3300005467 | Bacteria | 3075 |
| 81 | Ga0070706_100166775 | 3300005467 | Bacteria | 2056 |
| 82 | Ga0070707_100002890 | 3300005468 | Bacteria | 16317 |
| 83 | Ga0070698_100509332 | 3300005471 | Bacteria | 1142 |
| 84 | Ga0070699_100016998 | 3300005518 | Bacteria | 6245 |
| 85 | Ga0070699_100385253 | 3300005518 | Unclassified | 1266 |
| 86 | Ga0070679_100717711 | 3300005530 | Bacteria | 942 |
| 87 | Ga0070684_100089612 | 3300005535 | Bacteria | 2734 |
| 88 | Ga0070684_100161823 | 3300005535 | Unclassified | 2031 |
| 89 | Ga0070684_100683005 | 3300005535 | Bacteria | 957 |
| 90 | Ga0070684_100735907 | 3300005535 | Unclassified | 920 |
| 91 | Ga0070697_100444839 | 3300005536 | Bacteria | 1128 |
| 92 | Ga0068853_100218045 | 3300005539 | Bacteria | 1741 |
| 93 | Ga0070686_100035454 | 3300005544 | Bacteria | 3081 |
| 94 | Ga0070686_100045168 | 3300005544 | Bacteria | 2773 |
| 95 | Ga0070686_100070849 | 3300005544 | Bacteria | 2281 |
| 96 | Ga0070686_100205071 | 3300005544 | Bacteria | 1416 |
| 97 | Ga0070695_100182494 | 3300005545 | Bacteria | 1488 |
| 98 | Ga0070695_100217772 | 3300005545 | Bacteria | 1374 |
| 99 | Ga0070695_100554131 | 3300005545 | Bacteria | 896 |
| 100 | Ga0070696_100126398 | 3300005546 | Bacteria | 1855 |
| 101 | Ga0070696_100157189 | 3300005546 | Bacteria | 1673 |
| 102 | Ga0070696_100577874 | 3300005546 | Bacteria | 903 |
| 103 | Ga0070693_100026866 | 3300005547 | Bacteria | 3111 |
| 104 | Ga0070693_100161451 | 3300005547 | Unclassified | 1427 |
| 105 | Ga0070693_100318260 | 3300005547 | Bacteria | 1055 |
| 106 | Ga0070693_100349395 | 3300005547 | Bacteria | 1012 |
| 107 | Ga0070704_100039620 | 3300005549 | Bacteria | 3236 |
| 108 | Ga0070704_100285193 | 3300005549 | Bacteria | 1370 |
| 109 | Ga0070704_100285850 | 3300005549 | Bacteria | 1368 |
| 110 | Ga0070704_100390691 | 3300005549 | Bacteria | 1185 |
| 111 | Ga0070704_100749052 | 3300005549 | Bacteria | 870 |
| 112 | Ga0068855_100079024 | 3300005563 | Bacteria | 3816 |
| 113 | Ga0068855_100294188 | 3300005563 | Bacteria | 1799 |
| 114 | Ga0068855_101092806 | 3300005563 | Unclassified | 834 |
| 115 | Ga0068855_101297672 | 3300005563 | Bacteria | 754 |
| 116 | Ga0070664_100527095 | 3300005564 | Bacteria | 1091 |
| 117 | Ga0068857_102292237 | 3300005577 | Bacteria | 530 |
| 118 | Ga0068854_100036423 | 3300005578 | Bacteria | 3449 |
| 119 | Ga0068854_100253812 | 3300005578 | Bacteria | 1405 |
| 120 | Ga0068856_100046077 | 3300005614 | Bacteria | 4295 |
| 121 | Ga0068856_100126149 | 3300005614 | Bacteria | 2563 |
| 122 | Ga0068856_100140385 | 3300005614 | Bacteria | 2423 |
| 123 | Ga0068856_100237066 | 3300005614 | Bacteria | 1840 |
| 124 | Ga0068856_100257029 | 3300005614 | Unclassified | 1762 |
| 125 | Ga0068856_100299808 | 3300005614 | Bacteria | 1625 |
| 126 | Ga0068856_100387265 | 3300005614 | Bacteria | 1418 |
| 127 | Ga0068856_100697625 | 3300005614 | Unclassified | 1035 |
| 128 | Ga0068856_100752188 | 3300005614 | Unclassified | 995 |
| 129 | Ga0068856_100874608 | 3300005614 | Bacteria | 918 |
| 130 | Ga0068856_101249032 | 3300005614 | Bacteria | 759 |
| 131 | Ga0070702_100128029 | 3300005615 | Bacteria | 1600 |
| 132 | Ga0070702_100427226 | 3300005615 | Unclassified | 955 |
| 133 | Ga0070702_100503936 | 3300005615 | Bacteria | 890 |
| 134 | Ga0070702_100509175 | 3300005615 | Bacteria | 886 |
| 135 | Ga0070702_100883216 | 3300005615 | Bacteria | 698 |
| 136 | Ga0070702_100929241 | 3300005615 | Bacteria | 683 |
| 137 | Ga0068852_100076766 | 3300005616 | Bacteria | 2951 |
| 138 | Ga0068852_100662116 | 3300005616 | Unclassified | 1052 |
| 139 | Ga0068852_101892947 | 3300005616 | Unclassified | 619 |
| 140 | Ga0068859_101105985 | 3300005617 | Bacteria | 872 |
| 141 | Ga0068864_100006361 | 3300005618 | Bacteria | 9681 |
| 142 | Ga0068866_10012779 | 3300005718 | Bacteria | 3665 |
| 143 | Ga0068861_100071272 | 3300005719 | Bacteria | 2694 |
| 144 | Ga0068861_100190489 | 3300005719 | Bacteria | 1714 |
| 145 | Ga0068861_100698532 | 3300005719 | Unclassified | 942 |
| 146 | Ga0068860_100541731 | 3300005843 | Unclassified | 1165 |
| 147 | Ga0068860_100649269 | 3300005843 | Bacteria | 1063 |
| 148 | Ga0068862_101544924 | 3300005844 | Unclassified | 670 |
| 149 | Ga0081455_10010868 | 3300005937 | Bacteria | 9188 |
| 150 | Ga0081538_10013296 | 3300005981 | Bacteria | 6525 |
| 151 | Ga0081538_10152030 | 3300005981 | Unclassified | 1046 |
| 152 | Ga0081540_1002869 | 3300005983 | Bacteria | 13935 |
| 153 | Ga0081540_1005145 | 3300005983 | Bacteria | 9794 |
| 154 | Ga0081540_1005990 | 3300005983 | Bacteria | 8955 |
| 155 | Ga0081540_1032816 | 3300005983 | Bacteria | 2828 |
| 156 | Ga0070717_10182307 | 3300006028 | Bacteria | 1831 |
| 157 | Ga0075432_10011677 | 3300006058 | Bacteria | 2984 |
| 158 | Ga0075432_10433867 | 3300006058 | Unclassified | 573 |
| 159 | Ga0070715_10003539 | 3300006163 | Bacteria | 4993 |
| 160 | Ga0070716_100039912 | 3300006173 | Bacteria | 2608 |
| 161 | Ga0070716_100176869 | 3300006173 | Bacteria | 1397 |
| 162 | Ga0070712_100001448 | 3300006175 | Bacteria | 14472 |
| 163 | Ga0070712_100167123 | 3300006175 | Bacteria | 1704 |
| 164 | Ga0070712_100580089 | 3300006175 | Unclassified | 947 |
| 165 | Ga0097621_100131929 | 3300006237 | Bacteria | 2127 |
| 166 | Ga0068871_100052606 | 3300006358 | Bacteria | 3298 |
| 167 | Ga0068871_100357099 | 3300006358 | Bacteria | 1294 |
| 168 | Ga0068871_101616184 | 3300006358 | Bacteria | 614 |
| 169 | Ga0075428_100114818 | 3300006844 | Bacteria | 2933 |
| 170 | Ga0075428_100161542 | 3300006844 | Bacteria | 2432 |
| 171 | Ga0075428_100200162 | 3300006844 | Bacteria | 2159 |
| 172 | Ga0075428_100479860 | 3300006844 | Bacteria | 1331 |
| 173 | Ga0075430_100204796 | 3300006846 | Bacteria | 1638 |
| 174 | Ga0075431_100058228 | 3300006847 | Bacteria | 3986 |
| 175 | Ga0075431_100168517 | 3300006847 | Bacteria | 2251 |
| 176 | Ga0075433_10092243 | 3300006852 | Bacteria | 2679 |
| 177 | Ga0075433_10139663 | 3300006852 | Bacteria | 2153 |
| 178 | Ga0075434_100034001 | 3300006871 | Bacteria | 5032 |
| 179 | Ga0075434_100149934 | 3300006871 | Unclassified | 2352 |
| 180 | Ga0075434_101477584 | 3300006871 | Bacteria | 689 |
| 181 | Ga0075429_100169058 | 3300006880 | Bacteria | 1915 |
| 182 | Ga0068865_100617853 | 3300006881 | Bacteria | 918 |
| 183 | Ga0068865_100694371 | 3300006881 | Bacteria | 869 |
| 184 | Ga0075436_100022702 | 3300006914 | Bacteria | 4311 |
| 185 | Ga0075436_100033630 | 3300006914 | Bacteria | 3534 |
| 186 | Ga0097620_101105864 | 3300006931 | Bacteria | 872 |
| 187 | Ga0075435_100062244 | 3300007076 | Bacteria | 3028 |
| 188 | Ga0075435_100176245 | 3300007076 | Bacteria | 1805 |
| 189 | Ga0075435_100259801 | 3300007076 | Bacteria | 1479 |
| 190 | Ga0075435_100671315 | 3300007076 | Unclassified | 900 |
| 191 | Ga0075435_101597206 | 3300007076 | Bacteria | 572 |
| 192 | Ga0105250_10138900 | 3300009092 | Bacteria | 1006 |
| 193 | Ga0105240_10840244 | 3300009093 | Bacteria | 992 |
| 194 | Ga0111539_10118771 | 3300009094 | Bacteria | 3099 |
| 195 | Ga0111539_10149472 | 3300009094 | Bacteria | 2734 |
| 196 | Ga0111539_10199069 | 3300009094 | Bacteria | 2336 |
| 197 | Ga0105245_10055857 | 3300009098 | Bacteria | 3548 |
| 198 | Ga0105245_10102321 | 3300009098 | Bacteria | 2653 |
| 199 | Ga0105245_10107226 | 3300009098 | Bacteria | 2593 |
| 200 | Ga0105245_10203656 | 3300009098 | Bacteria | 1902 |
| 201 | Ga0105245_10317102 | 3300009098 | Bacteria | 1535 |
| 202 | Ga0105245_10443140 | 3300009098 | Bacteria | 1306 |
| 203 | Ga0105245_10507900 | 3300009098 | Bacteria | 1222 |
| 204 | Ga0105245_10525306 | 3300009098 | Bacteria | 1203 |
| 205 | Ga0105245_10831924 | 3300009098 | Bacteria | 962 |
| 206 | Ga0105245_11075154 | 3300009098 | Bacteria | 850 |
| 207 | Ga0105245_11168189 | 3300009098 | Unclassified | 817 |
| 208 | Ga0105245_11265635 | 3300009098 | Bacteria | 786 |
| 209 | Ga0105245_12320505 | 3300009098 | Bacteria | 590 |
| 210 | Ga0105247_10172440 | 3300009101 | Unclassified | 1439 |
| 211 | Ga0114129_10075826 | 3300009147 | Bacteria | 4682 |
| 212 | Ga0114129_10291610 | 3300009147 | Bacteria | 2177 |
| 213 | Ga0114129_10478556 | 3300009147 | Bacteria | 1629 |
| 214 | Ga0114129_13278393 | 3300009147 | Unclassified | 524 |
| 215 | Ga0105243_10170512 | 3300009148 | Bacteria | 1884 |
| 216 | Ga0105243_10247456 | 3300009148 | Bacteria | 1590 |
| 217 | Ga0105243_10305771 | 3300009148 | Bacteria | 1443 |
| 218 | Ga0105243_13077318 | 3300009148 | Bacteria | 505 |
| 219 | Ga0105241_10058235 | 3300009174 | Bacteria | 2967 |
| 220 | Ga0105241_10165411 | 3300009174 | Bacteria | 1822 |
| 221 | Ga0105241_10614632 | 3300009174 | Bacteria | 983 |
| 222 | Ga0105241_11530050 | 3300009174 | Unclassified | 643 |
| 223 | Ga0105242_10107242 | 3300009176 | Bacteria | 2375 |
| 224 | Ga0105242_11098762 | 3300009176 | Bacteria | 809 |
| 225 | Ga0105242_11468929 | 3300009176 | Bacteria | 711 |
| 226 | Ga0105248_10134958 | 3300009177 | Bacteria | 2784 |
| 227 | Ga0105248_10284959 | 3300009177 | Bacteria | 1860 |
| 228 | Ga0105237_10541140 | 3300009545 | Bacteria | 1171 |
| 229 | Ga0105249_10100526 | 3300009553 | Bacteria | 2719 |
| 230 | Ga0105249_10199156 | 3300009553 | Bacteria | 1959 |
| 231 | Ga0105239_10002262 | 3300010375 | Bacteria | 24597 |
| 232 | Ga0105239_10087483 | 3300010375 | Bacteria | 3435 |
| 233 | Ga0105239_10348013 | 3300010375 | Bacteria | 1673 |
| 234 | Ga0105239_10373952 | 3300010375 | Bacteria | 1611 |
| 235 | Ga0105239_10379239 | 3300010375 | Unclassified | 1599 |
| 236 | Ga0105239_10556642 | 3300010375 | Unclassified | 1306 |
| 237 | Ga0105239_10888297 | 3300010375 | Bacteria | 1023 |
| 238 | Ga0105246_10157419 | 3300011119 | Bacteria | 1727 |
| 239 | Ga0105246_10359797 | 3300011119 | Bacteria | 1195 |
| 240 | Ga0105246_11122104 | 3300011119 | Bacteria | 719 |
| 241 | Ga0105246_12207574 | 3300011119 | Unclassified | 536 |
| 242 | Ga0157344_1009418 | 3300012476 | Bacteria | 686 |
| 243 | Ga0157318_1035160 | 3300012482 | Bacteria | 513 |
| 244 | Ga0157313_1037265 | 3300012503 | Unclassified | 581 |
| 245 | Ga0157342_1001550 | 3300012507 | Bacteria | 1729 |
| 246 | Ga0157315_1001278 | 3300012508 | Bacteria | 1370 |
| 247 | Ga0157316_1012217 | 3300012510 | Unclassified | 819 |
| 248 | Ga0157373_10378629 | 3300013100 | Bacteria | 1012 |
| 249 | Ga0157371_10249658 | 3300013102 | Bacteria | 1277 |
| 250 | Ga0157371_10285615 | 3300013102 | Bacteria | 1192 |
| 251 | Ga0157369_10479026 | 3300013105 | Bacteria | 1288 |
| 252 | Ga0157369_11112337 | 3300013105 | Bacteria | 807 |
| 253 | Ga0157374_10238811 | 3300013296 | Bacteria | 1787 |
| 254 | Ga0157374_10365699 | 3300013296 | Bacteria | 1435 |
| 255 | Ga0157374_10439528 | 3300013296 | Unclassified | 1305 |
| 256 | Ga0157378_10293624 | 3300013297 | Bacteria | 1571 |
| 257 | Ga0157378_11468937 | 3300013297 | Unclassified | 726 |
| 258 | Ga0157378_11991827 | 3300013297 | Bacteria | 631 |
| 259 | Ga0163162_10506311 | 3300013306 | Bacteria | 1338 |
| 260 | Ga0163162_10660634 | 3300013306 | Bacteria | 1168 |
| 261 | Ga0157372_10086115 | 3300013307 | Bacteria | 3565 |
| 262 | Ga0157372_10443795 | 3300013307 | Bacteria | 1512 |
| 263 | Ga0157375_10705261 | 3300013308 | Bacteria | 1163 |
| 264 | Ga0157375_11178116 | 3300013308 | Unclassified | 898 |
| 265 | Ga0157375_12413503 | 3300013308 | Bacteria | 627 |
| 266 | Ga0157380_10622991 | 3300014326 | Bacteria | 1071 |
| 267 | Ga0157380_11326568 | 3300014326 | Bacteria | 768 |
| 268 | Ga0182008_10541319 | 3300014497 | Unclassified | 646 |
| 269 | Ga0157377_10193828 | 3300014745 | Bacteria | 1286 |
| 270 | Ga0157377_10240837 | 3300014745 | Bacteria | 1167 |
| 271 | Ga0157377_10462584 | 3300014745 | Bacteria | 878 |
| 272 | Ga0157377_10485947 | 3300014745 | Bacteria | 860 |
| 273 | Ga0157379_10882668 | 3300014968 | Bacteria | 847 |
| 274 | Ga0157379_11709785 | 3300014968 | Bacteria | 616 |
| 275 | Ga0157376_10013794 | 3300014969 | Bacteria | 6041 |
| 276 | Ga0157376_10468316 | 3300014969 | Bacteria | 1232 |
| 277 | Ga0157376_11138719 | 3300014969 | Unclassified | 807 |
| 278 | Ga0157376_12847151 | 3300014969 | Bacteria | 523 |
| 279 | Ga0182005_1234199 | 3300015265 | Bacteria | 563 |
| 280 | Ga0163161_10075444 | 3300017792 | Bacteria | 2474 |
| 281 | Ga0163161_10162626 | 3300017792 | Bacteria | 1703 |
| 282 | Ga0207653_10002267 | 3300025885 | Bacteria | 6130 |
| 283 | Ga0207692_10034562 | 3300025898 | Bacteria | 2448 |
| 284 | Ga0207692_10367199 | 3300025898 | Bacteria | 890 |
| 285 | Ga0207642_10332470 | 3300025899 | Bacteria | 891 |
| 286 | Ga0207642_10403976 | 3300025899 | Bacteria | 818 |
| 287 | Ga0207688_10010459 | 3300025901 | Bacteria | 5049 |
| 288 | Ga0207688_10145769 | 3300025901 | Bacteria | 1396 |
| 289 | Ga0207688_10312358 | 3300025901 | Unclassified | 963 |
| 290 | Ga0207680_10696563 | 3300025903 | Bacteria | 728 |
| 291 | Ga0207685_10034862 | 3300025905 | Bacteria | 1832 |
| 292 | Ga0207685_10176249 | 3300025905 | Unclassified | 988 |
| 293 | Ga0207699_10024753 | 3300025906 | Bacteria | 3286 |
| 294 | Ga0207699_10392304 | 3300025906 | Bacteria | 987 |
| 295 | Ga0207699_10768194 | 3300025906 | Bacteria | 707 |
| 296 | Ga0207684_10089332 | 3300025910 | Bacteria | 2625 |
| 297 | Ga0207684_10271671 | 3300025910 | Bacteria | 1462 |
| 298 | Ga0207684_10323725 | 3300025910 | Bacteria | 1328 |
| 299 | Ga0207684_10332016 | 3300025910 | Bacteria | 1310 |
| 300 | Ga0207654_10019978 | 3300025911 | Bacteria | 3544 |
| 301 | Ga0207654_10085953 | 3300025911 | Bacteria | 1905 |
| 302 | Ga0207654_10153424 | 3300025911 | Bacteria | 1481 |
| 303 | Ga0207654_10438445 | 3300025911 | Bacteria | 914 |
| 304 | Ga0207654_11326134 | 3300025911 | Unclassified | 525 |
| 305 | Ga0207707_10164771 | 3300025912 | Bacteria | 1937 |
| 306 | Ga0207695_11732908 | 3300025913 | Bacteria | 506 |
| 307 | Ga0207671_10439711 | 3300025914 | Bacteria | 1038 |
| 308 | Ga0207693_10003258 | 3300025915 | Bacteria | 13908 |
| 309 | Ga0207693_10016686 | 3300025915 | Bacteria | 5865 |
| 310 | Ga0207693_10023595 | 3300025915 | Bacteria | 4883 |
| 311 | Ga0207693_10463445 | 3300025915 | Unclassified | 990 |
| 312 | Ga0207693_10557737 | 3300025915 | Bacteria | 893 |
| 313 | Ga0207663_10216561 | 3300025916 | Bacteria | 1391 |
| 314 | Ga0207663_10406435 | 3300025916 | Unclassified | 1042 |
| 315 | Ga0207663_10554707 | 3300025916 | Bacteria | 899 |
| 316 | Ga0207663_11101640 | 3300025916 | Bacteria | 638 |
| 317 | Ga0207660_10052797 | 3300025917 | Bacteria | 2895 |
| 318 | Ga0207662_10062127 | 3300025918 | Bacteria | 2244 |
| 319 | Ga0207662_10310224 | 3300025918 | Bacteria | 1051 |
| 320 | Ga0207657_10274257 | 3300025919 | Bacteria | 1340 |
| 321 | Ga0207657_10342606 | 3300025919 | Bacteria | 1179 |
| 322 | Ga0207657_10560065 | 3300025919 | Bacteria | 893 |
| 323 | Ga0207652_10654083 | 3300025921 | Bacteria | 940 |
| 324 | Ga0207652_10712116 | 3300025921 | Bacteria | 895 |
| 325 | Ga0207652_11240382 | 3300025921 | Unclassified | 648 |
| 326 | Ga0207646_10005641 | 3300025922 | Bacteria | 13142 |
| 327 | Ga0207646_10828848 | 3300025922 | Bacteria | 823 |
| 328 | Ga0207646_10932616 | 3300025922 | Bacteria | 769 |
| 329 | Ga0207681_10298433 | 3300025923 | Bacteria | 1274 |
| 330 | Ga0207681_10734793 | 3300025923 | Bacteria | 822 |
| 331 | Ga0207659_11329250 | 3300025926 | Unclassified | 617 |
| 332 | Ga0207687_10008937 | 3300025927 | Bacteria | 6551 |
| 333 | Ga0207687_10034193 | 3300025927 | Bacteria | 3451 |
| 334 | Ga0207687_10081889 | 3300025927 | Bacteria | 2334 |
| 335 | Ga0207687_10173663 | 3300025927 | Unclassified | 1664 |
| 336 | Ga0207687_10184139 | 3300025927 | Bacteria | 1620 |
| 337 | Ga0207687_10612232 | 3300025927 | Unclassified | 919 |
| 338 | Ga0207687_10633164 | 3300025927 | Bacteria | 904 |
| 339 | Ga0207687_11334270 | 3300025927 | Bacteria | 617 |
| 340 | Ga0207687_11809894 | 3300025927 | Bacteria | 523 |
| 341 | Ga0207700_10081985 | 3300025928 | Bacteria | 2521 |
| 342 | Ga0207700_10541352 | 3300025928 | Unclassified | 1033 |
| 343 | Ga0207700_10639192 | 3300025928 | Bacteria | 948 |
| 344 | Ga0207664_10034046 | 3300025929 | Bacteria | 3920 |
| 345 | Ga0207664_10498541 | 3300025929 | Bacteria | 1090 |
| 346 | Ga0207664_10902345 | 3300025929 | Bacteria | 793 |
| 347 | Ga0207644_10191243 | 3300025931 | Bacteria | 1609 |
| 348 | Ga0207644_10203613 | 3300025931 | Bacteria | 1562 |
| 349 | Ga0207644_10731854 | 3300025931 | Unclassified | 826 |
| 350 | Ga0207644_10934569 | 3300025931 | Bacteria | 727 |
| 351 | Ga0207690_10246339 | 3300025932 | Bacteria | 1378 |
| 352 | Ga0207706_10006582 | 3300025933 | Bacteria | 10762 |
| 353 | Ga0207706_10120049 | 3300025933 | Bacteria | 2311 |
| 354 | Ga0207706_10124435 | 3300025933 | Bacteria | 2268 |
| 355 | Ga0207706_10497796 | 3300025933 | Unclassified | 1052 |
| 356 | Ga0207686_10077351 | 3300025934 | Bacteria | 2160 |
| 357 | Ga0207686_10304448 | 3300025934 | Unclassified | 1185 |
| 358 | Ga0207669_10031588 | 3300025937 | Bacteria | 2961 |
| 359 | Ga0207669_10452570 | 3300025937 | Unclassified | 1018 |
| 360 | Ga0207704_10209002 | 3300025938 | Bacteria | 1435 |
| 361 | Ga0207704_11121996 | 3300025938 | Bacteria | 669 |
| 362 | Ga0207665_10006431 | 3300025939 | Bacteria | 7794 |
| 363 | Ga0207665_10202830 | 3300025939 | Bacteria | 1446 |
| 364 | Ga0207691_11194161 | 3300025940 | Bacteria | 631 |
| 365 | Ga0207711_10184795 | 3300025941 | Bacteria | 1897 |
| 366 | Ga0207689_10274759 | 3300025942 | Bacteria | 1395 |
| 367 | Ga0207689_10799655 | 3300025942 | Bacteria | 796 |
| 368 | Ga0207661_10023679 | 3300025944 | Bacteria | 4643 |
| 369 | Ga0207661_10169070 | 3300025944 | Bacteria | 1902 |
| 370 | Ga0207661_10568464 | 3300025944 | Bacteria | 1039 |
| 371 | Ga0207679_10642931 | 3300025945 | Bacteria | 959 |
| 372 | Ga0207679_11136117 | 3300025945 | Unclassified | 717 |
| 373 | Ga0207667_10563579 | 3300025949 | Bacteria | 1151 |
| 374 | Ga0207667_10812749 | 3300025949 | Bacteria | 931 |
| 375 | Ga0207651_10732150 | 3300025960 | Bacteria | 873 |
| 376 | Ga0207651_11125852 | 3300025960 | Bacteria | 704 |
| 377 | Ga0207712_10180922 | 3300025961 | Bacteria | 1656 |
| 378 | Ga0207712_10259849 | 3300025961 | Bacteria | 1408 |
| 379 | Ga0207668_10066832 | 3300025972 | Bacteria | 2550 |
| 380 | Ga0207668_10083028 | 3300025972 | Bacteria | 2330 |
| 381 | Ga0207668_10317316 | 3300025972 | Bacteria | 1292 |
| 382 | Ga0207668_11077111 | 3300025972 | Bacteria | 720 |
| 383 | Ga0207640_10417253 | 3300025981 | Bacteria | 1097 |
| 384 | Ga0207640_10463062 | 3300025981 | Bacteria | 1048 |
| 385 | Ga0207640_11528928 | 3300025981 | Bacteria | 600 |
| 386 | Ga0207658_10816883 | 3300025986 | Bacteria | 847 |
| 387 | Ga0207677_10021982 | 3300026023 | Bacteria | 3911 |
| 388 | Ga0207677_10043802 | 3300026023 | Bacteria | 2978 |
| 389 | Ga0207677_10121039 | 3300026023 | Bacteria | 1969 |
| 390 | Ga0207677_10202825 | 3300026023 | Bacteria | 1578 |
| 391 | Ga0207677_10450911 | 3300026023 | Unclassified | 1102 |
| 392 | Ga0207677_10473254 | 3300026023 | Bacteria | 1078 |
| 393 | Ga0207677_10977451 | 3300026023 | Bacteria | 767 |
| 394 | Ga0207639_10586447 | 3300026041 | Unclassified | 1027 |
| 395 | Ga0207678_10056600 | 3300026067 | Bacteria | 3375 |
| 396 | Ga0207708_10089216 | 3300026075 | Bacteria | 2376 |
| 397 | Ga0207708_10189280 | 3300026075 | Unclassified | 1637 |
| 398 | Ga0207708_10399988 | 3300026075 | Unclassified | 1136 |
| 399 | Ga0207708_10471574 | 3300026075 | Bacteria | 1048 |
| 400 | Ga0207708_10491787 | 3300026075 | Unclassified | 1027 |
| 401 | Ga0207702_10003331 | 3300026078 | Bacteria | 14752 |
| 402 | Ga0207702_10025176 | 3300026078 | Bacteria | 4938 |
| 403 | Ga0207702_10143483 | 3300026078 | Bacteria | 2164 |
| 404 | Ga0207702_10232830 | 3300026078 | Bacteria | 1722 |
| 405 | Ga0207702_10233389 | 3300026078 | Bacteria | 1720 |
| 406 | Ga0207702_10495551 | 3300026078 | Bacteria | 1190 |
| 407 | Ga0207702_10657008 | 3300026078 | Bacteria | 1031 |
| 408 | Ga0207702_11763724 | 3300026078 | Unclassified | 611 |
| 409 | Ga0207641_10795959 | 3300026088 | Bacteria | 935 |
| 410 | Ga0207648_10233978 | 3300026089 | Bacteria | 1635 |
| 411 | Ga0207648_10747930 | 3300026089 | Bacteria | 908 |
| 412 | Ga0207676_10163075 | 3300026095 | Bacteria | 1933 |
| 413 | Ga0207676_10206161 | 3300026095 | Bacteria | 1741 |
| 414 | Ga0207675_100010489 | 3300026118 | Bacteria | 8680 |
| 415 | Ga0207675_100051713 | 3300026118 | Bacteria | 3834 |
| 416 | Ga0207675_100184215 | 3300026118 | Bacteria | 2001 |
| 417 | Ga0207675_100261354 | 3300026118 | Bacteria | 1678 |
| 418 | Ga0207683_10001564 | 3300026121 | Bacteria | 20602 |
| 419 | Ga0207683_10015964 | 3300026121 | Bacteria | 6390 |
| 420 | Ga0207683_10052737 | 3300026121 | Bacteria | 3564 |
| 421 | Ga0207683_10109858 | 3300026121 | Bacteria | 2468 |
| 422 | Ga0207683_10124400 | 3300026121 | Bacteria | 2317 |
| 423 | Ga0207698_11706250 | 3300026142 | Unclassified | 645 |
| 424 | Ga0207428_10028629 | 3300027907 | Bacteria | 4626 |
| 425 | Ga0207428_10092776 | 3300027907 | Bacteria | 2343 |
| 426 | Ga0268266_10408063 | 3300028379 | Bacteria | 1286 |
| 427 | Ga0268265_10300699 | 3300028380 | Bacteria | 1445 |
| 428 | Ga0268265_10676350 | 3300028380 | Bacteria | 995 |
| 429 | Ga0268264_10141325 | 3300028381 | Bacteria | 2147 |
| 430 | Ga0268264_11485199 | 3300028381 | Unclassified | 688 |
| 431 | Ga0307406_10958572 | 3300031901 | Bacteria | 732 |
| 432 | Ga0307409_100021055 | 3300031995 | Bacteria | 4462 |
| 433 | Ga0307409_101251432 | 3300031995 | Bacteria | 766 |
| 434 | Ga0373948_0003747 | 3300034817 | Bacteria | 2361 |
| 435 | Ga0373948_0023525 | 3300034817 | Bacteria | 1196 |
| 436 | Ga0373950_0013056 | 3300034818 | Bacteria | 1380 |
| 437 | Ga0373959_0001309 | 3300034820 | Bacteria | 3986 |
| 438 | Ga0373929_0016125 | 3300035085 | Bacteria | 1460 |
| 439 | Ga0373944_0001746 | 3300035089 | Bacteria | 5490 |
| 440 | Ga0373951_0033269 | 3300035091 | Bacteria | 1221 |
| 441 | Ga0373952_0028850 | 3300035092 | Bacteria | 1219 |
| 442 | Ga0373932_0002286 | 3300035112 | Bacteria | 4892 |
| 443 | Ga0373939_0021651 | 3300035114 | Bacteria | 1762 |
| 444 | Ga0373941_0004204 | 3300035115 | Bacteria | 3309 |
| 445 | Ga0373941_0062465 | 3300035115 | Bacteria | 1216 |
| 446 | Ga0373945_0021197 | 3300035116 | Bacteria | 2231 |
| 447 | Ga0373960_0062071 | 3300035121 | Unclassified | 1136 |
| 448 | Ga0373960_0130761 | 3300035121 | Bacteria | 842 |
| 449 | Ga0373960_0244146 | 3300035121 | Bacteria | 650 |
| 450 | Ga0373960_0297953 | 3300035121 | Unclassified | 599 |
| 451 | Ga0373943_0012098 | 3300035170 | Bacteria | 3887 |
| 452 | Ga0373943_0016415 | 3300035170 | Bacteria | 3376 |
| 453 | Ga0373943_0091830 | 3300035170 | Bacteria | 1574 |
| 454 | Ga0373946_0011220 | 3300035171 | Bacteria | 3337 |
| 455 | Ga0373942_0003344 | 3300035207 | Bacteria | 3768 |
| 456 | Ga0373961_0027354 | 3300035241 | Bacteria | 1565 |
| 457 | Ga0373961_0151351 | 3300035241 | Bacteria | 791 |
| 458 | Ga0373961_0235255 | 3300035241 | Bacteria | 658 |
| 459 | Ga0373962_0001222 | 3300035242 | Bacteria | 6011 |
| 460 | Ga0373962_0035842 | 3300035242 | Bacteria | 1379 |
| 461 | Ga0373962_0136426 | 3300035242 | Unclassified | 794 |
| 462 | Ga0373931_0005617 | 3300035691 | Bacteria | 5817 |
| 463 | Ga0373931_0954803 | 3300035691 | Unclassified | 578 |
| 464 | Ga0373935_0063069 | 3300035692 | Bacteria | 2375 |
| 465 | Ga0373927_0112159 | 3300035695 | Bacteria | 1777 |
| 466 | Ga0373947_0742237 | 3300035725 | Bacteria | 670 |
| 467 | Ga0373947_1047789 | 3300035725 | Bacteria | 556 |
| 468 | Ga0373937_1451342 | 3300036401 | Bacteria | 634 |
| 469 | Ga0373925_0008644 | 3300037068 | Bacteria | 7419 |
| 470 | Ga0373925_1617245 | 3300037068 | Bacteria | 529 |
| 471 | Ga0395899_0013881 | 3300037312 | Bacteria | 6153 |
| 472 | Ga0395899_0014669 | 3300037312 | Bacteria | 5980 |
| 473 | Ga0395899_0020994 | 3300037312 | Bacteria | 4952 |
| 474 | Ga0395899_0040840 | 3300037312 | Bacteria | 3468 |
| 475 | Ga0395899_0135891 | 3300037312 | Bacteria | 1753 |
| 476 | Ga0395899_0357429 | 3300037312 | Bacteria | 975 |
| 477 | Ga0395900_0002868 | 3300037418 | Bacteria | 18789 |
| 478 | Ga0395900_0007646 | 3300037418 | Bacteria | 11156 |
| 479 | Ga0395900_0009226 | 3300037418 | Bacteria | 10115 |
| 480 | Ga0395900_0009682 | 3300037418 | Bacteria | 9874 |
| 481 | Ga0395900_0023295 | 3300037418 | Bacteria | 6337 |
| 482 | Ga0395900_0055351 | 3300037418 | Bacteria | 4085 |
| 483 | Ga0395900_0106826 | 3300037418 | Bacteria | 2875 |
| 484 | Ga0395900_0398830 | 3300037418 | Archaea | 1340 |
| 485 | Ga0395900_0544970 | 3300037418 | Bacteria | 1105 |
| 486 | Ga0395900_0611361 | 3300037418 | Bacteria | 1029 |
| 487 | Ga0395898_0005218 | 3300037466 | Bacteria | 14046 |
| 488 | Ga0395898_0005707 | 3300037466 | Bacteria | 13412 |
| 489 | Ga0395898_0019062 | 3300037466 | Bacteria | 6984 |
| 490 | Ga0395898_0050276 | 3300037466 | Bacteria | 4081 |
| 491 | Ga0395898_0152751 | 3300037466 | Bacteria | 2208 |
| 492 | Ga0395898_0156190 | 3300037466 | Bacteria | 2182 |
| 493 | Ga0395898_0242054 | 3300037466 | Bacteria | 1721 |
| 494 | Ga0395898_0362724 | 3300037466 | Bacteria | 1381 |
| 495 | Ga0395898_1114386 | 3300037466 | Unclassified | 722 |
| 496 | Ga0395898_1302933 | 3300037466 | Bacteria | 656 |
| 497 | Ga0395898_1833367 | 3300037466 | Bacteria | 527 |
| 498 | Ga0395905_0004667 | 3300037471 | Bacteria | 14165 |
| 499 | Ga0395905_0005067 | 3300037471 | Bacteria | 13558 |
| 500 | Ga0395905_0013993 | 3300037471 | Bacteria | 7675 |
| 501 | Ga0395905_0050733 | 3300037471 | Bacteria | 3886 |
| 502 | Ga0395905_0371028 | 3300037471 | Bacteria | 1324 |
| 503 | Ga0395905_0388259 | 3300037471 | Bacteria | 1290 |
| 504 | Ga0395901_0001467 | 3300038443 | Bacteria | 24537 |
| 505 | Ga0395901_0002218 | 3300038443 | Bacteria | 19814 |
| 506 | Ga0395901_0004922 | 3300038443 | Bacteria | 13479 |
| 507 | Ga0395901_0014011 | 3300038443 | Bacteria | 8159 |
| 508 | Ga0395901_0068095 | 3300038443 | Bacteria | 3708 |
| 509 | Ga0395901_0186855 | 3300038443 | Bacteria | 2173 |
| 510 | Ga0395901_0444246 | 3300038443 | Bacteria | 1327 |
| 511 | Ga0395901_0560752 | 3300038443 | Bacteria | 1156 |
| 512 | Ga0395901_0688421 | 3300038443 | Unclassified | 1021 |
| 513 | Ga0395901_0896028 | 3300038443 | Bacteria | 869 |
| 514 | Ga0395901_1013852 | 3300038443 | Bacteria | 805 |
| 515 | Ga0242420_049735 | 3300038996 | Bacteria | 817 |
| 516 | Ga0451789_0844947 | 3300041443 | Bacteria | 774 |
| 517 | Ga0451789_0956241 | 3300041443 | Unclassified | 566 |
| 518 | Ga0451800_1214126 | 3300041459 | Bacteria | 1233 |
| 519 | Ga0451835_0290872 | 3300041492 | Unclassified | 708 |
| 520 | Ga0451845_0264688 | 3300041501 | Bacteria | 952 |
| 521 | Ga0451849_0081608 | 3300041505 | Bacteria | 546 |
| 522 | Ga0451853_0253187 | 3300041512 | Bacteria | 755 |
| 523 | Ga0451853_0365477 | 3300041512 | Bacteria | 2172 |
| 524 | Ga0451853_0483074 | 3300041512 | Bacteria | 1053 |
| 525 | Ga0439448_0002532 | 3300042005 | Bacteria | 4983 |
| 526 | Ga0439448_0091367 | 3300042005 | Bacteria | 1029 |
| 527 | Ga0439451_103669 | 3300042009 | Bacteria | 575 |
| 528 | Ga0439459_0002855 | 3300042438 | Bacteria | 2699 |
| 529 | Ga0439459_0209576 | 3300042438 | Bacteria | 535 |
| 530 | Ga0451577_0361510 | 3300042876 | Bacteria | 1317 |
| 531 | Ga0466964_0009047 | 3300044706 | Bacteria | 3745 |
| 532 | Ga0466968_0043202 | 3300044735 | Bacteria | 1907 |
| 533 | Ga0466968_0054892 | 3300044735 | Bacteria | 1709 |
| 534 | Ga0466968_0090875 | 3300044735 | Bacteria | 1352 |
| 535 | Ga0466960_0060428 | 3300044901 | Bacteria | 1857 |
| 536 | Ga0451576_0018528 | 3300045051 | Bacteria | 7628 |
| 537 | Ga0451576_0344773 | 3300045051 | Bacteria | 1560 |
| 538 | Ga0451576_0543359 | 3300045051 | Unclassified | 1221 |
| 539 | Ga0451576_1924695 | 3300045051 | Bacteria | 610 |
| 540 | Ga0466967_0000180 | 3300045976 | Bacteria | 26156 |
| 541 | Ga0495603_0011814 | 3300046455 | Bacteria | 5284 |
| 542 | Ga0495603_0054247 | 3300046455 | Bacteria | 2376 |
| 543 | Ga0495603_0083994 | 3300046455 | Unclassified | 1865 |
| 544 | Ga0495603_0227647 | 3300046455 | Bacteria | 1075 |
| 545 | Ga0495629_0005704 | 3300046459 | Bacteria | 9296 |
| 546 | Ga0495629_0347001 | 3300046459 | Bacteria | 1013 |
| 547 | Ga0495629_0436116 | 3300046459 | Unclassified | 888 |
| 548 | Ga0495641_0007540 | 3300046461 | Bacteria | 6776 |
| 549 | Ga0495641_0011893 | 3300046461 | Bacteria | 4913 |
| 550 | Ga0495641_0136373 | 3300046461 | Bacteria | 1096 |
| 551 | Ga0495651_0237773 | 3300046462 | Bacteria | 1251 |
| 552 | Ga0495580_0263158 | 3300046472 | Bacteria | 1179 |
| 553 | Ga0495582_0248184 | 3300046473 | Unclassified | 1021 |
| 554 | Ga0495605_0157707 | 3300046474 | Bacteria | 1009 |
| 555 | Ga0495605_0298179 | 3300046474 | Unclassified | 682 |
| 556 | Ga0495639_0090500 | 3300046475 | Bacteria | 1435 |
| 557 | Ga0495639_0428555 | 3300046475 | Bacteria | 670 |
| 558 | Ga0495639_0484877 | 3300046475 | Unclassified | 630 |
| 559 | Ga0495662_0140959 | 3300046476 | Unclassified | 1187 |
| 560 | Ga0495584_0218922 | 3300046491 | Bacteria | 968 |
| 561 | Ga0495594_0030692 | 3300046499 | Bacteria | 2910 |
| 562 | Ga0495594_0201424 | 3300046499 | Unclassified | 1135 |
| 563 | Ga0495596_0148898 | 3300046500 | Bacteria | 909 |
| 564 | Ga0495607_0060439 | 3300046501 | Bacteria | 2157 |
| 565 | Ga0495607_0212593 | 3300046501 | Bacteria | 951 |
| 566 | Ga0495616_0281572 | 3300046513 | Bacteria | 707 |
| 567 | Ga0495630_1404652 | 3300046517 | Unclassified | 525 |
| 568 | Ga0495631_0350996 | 3300046518 | Unclassified | 628 |
| 569 | Ga0495637_0147700 | 3300046520 | Bacteria | 889 |
| 570 | Ga0495637_0189056 | 3300046520 | Unclassified | 761 |
| 571 | Ga0495644_0212447 | 3300046523 | Bacteria | 747 |
| 572 | Ga0495663_0029066 | 3300046525 | Bacteria | 1630 |
| 573 | Ga0495663_0105105 | 3300046525 | Unclassified | 934 |
| 574 | Ga0495666_0010004 | 3300046526 | Bacteria | 4737 |
| 575 | Ga0495642_0103560 | 3300046528 | Bacteria | 1213 |
| 576 | Ga0495642_0217650 | 3300046528 | Bacteria | 834 |
| 577 | Ga0495665_0363342 | 3300046531 | Bacteria | 736 |
| 578 | Ga0495586_0144677 | 3300046535 | Unclassified | 1336 |
| 579 | Ga0495586_0711902 | 3300046535 | Unclassified | 580 |
| 580 | Ga0495609_0033263 | 3300046538 | Bacteria | 2341 |
| 581 | Ga0495609_0224264 | 3300046538 | Bacteria | 780 |
| 582 | Ga0495597_0345877 | 3300046542 | Bacteria | 571 |
| 583 | Ga0495633_0275919 | 3300046558 | Bacteria | 765 |
| 584 | Ga0495667_0108890 | 3300046559 | Bacteria | 1790 |
| 585 | Ga0495656_0015141 | 3300046615 | Bacteria | 2906 |
| 586 | Ga0495634_0114695 | 3300046642 | Bacteria | 1730 |
| 587 | Ga0495634_0169244 | 3300046642 | Bacteria | 1374 |
| 588 | Ga0495611_0071276 | 3300046648 | Bacteria | 1589 |
| 589 | Ga0495611_0342379 | 3300046648 | Bacteria | 687 |
| 590 | Ga0495635_0030577 | 3300046663 | Bacteria | 3742 |
| 591 | Ga0495635_0382325 | 3300046663 | Unclassified | 937 |
| 592 | Ga0495659_0073210 | 3300046664 | Bacteria | 1288 |
| 593 | Ga0495659_0088517 | 3300046664 | Bacteria | 1186 |
| 594 | Ga0495659_0092832 | 3300046664 | Bacteria | 1161 |
| 595 | Ga0495659_0290684 | 3300046664 | Unclassified | 689 |
| 596 | Ga0495588_0000593 | 3300046674 | Bacteria | 17177 |
| 597 | Ga0495599_0439717 | 3300046678 | Bacteria | 773 |
| 598 | Ga0495647_0207729 | 3300046681 | Bacteria | 861 |
| 599 | Ga0495658_0031702 | 3300046683 | Bacteria | 2881 |
| 600 | Ga0495658_0120186 | 3300046683 | Bacteria | 1588 |
| 601 | Ga0495658_0168076 | 3300046683 | Bacteria | 1356 |
| 602 | Ga0495613_0045348 | 3300046689 | Bacteria | 3252 |
| 603 | Ga0495613_0243590 | 3300046689 | Unclassified | 1256 |
| 604 | Ga0495624_0253259 | 3300046690 | Bacteria | 1065 |
| 605 | Ga0495670_0242643 | 3300046691 | Bacteria | 959 |
| 606 | Ga0495671_0122795 | 3300046692 | Bacteria | 1267 |
| 607 | Ga0495671_0361278 | 3300046692 | Bacteria | 696 |
| 608 | Ga0495589_0102170 | 3300046794 | Bacteria | 1387 |
| 609 | Ga0495589_0217613 | 3300046794 | Bacteria | 898 |
| 610 | Ga0495600_0451967 | 3300046809 | Bacteria | 794 |
| 611 | Ga0495581_0117190 | 3300047315 | Bacteria | 1549 |
| 612 | Ga0495581_0277175 | 3300047315 | Bacteria | 980 |
| 613 | Ga0495581_0320446 | 3300047315 | Unclassified | 906 |
| 614 | Ga0495581_0516794 | 3300047315 | Bacteria | 694 |
| 615 | Ga0495604_0040543 | 3300047317 | Bacteria | 3656 |
| 616 | Ga0495604_0426549 | 3300047317 | Bacteria | 870 |
| 617 | Ga0495674_0185689 | 3300047319 | Bacteria | 1730 |
| 618 | Ga0495676_0010464 | 3300047321 | Bacteria | 8412 |
| 619 | Ga0495676_0197278 | 3300047321 | Bacteria | 1400 |
| 620 | Ga0495676_0318250 | 3300047321 | Bacteria | 1046 |
| 621 | Ga0495680_0013972 | 3300047322 | Bacteria | 6980 |
| 622 | Ga0495680_0640816 | 3300047322 | Bacteria | 707 |
| 623 | Ga0495685_190189 | 3300047447 | Bacteria | 660 |
| 624 | Ga0495684_0013670 | 3300047471 | Bacteria | 6252 |
| 625 | Ga0495593_0350724 | 3300047673 | Bacteria | 737 |
| 626 | Ga0495614_0105460 | 3300048089 | Bacteria | 1235 |
| 627 | Ga0495626_0032364 | 3300048091 | Bacteria | 2512 |
| 628 | Ga0495626_0218781 | 3300048091 | Bacteria | 775 |
| 629 | Ga0496100_0003214 | 3300048903 | Bacteria | 8481 |
| 630 | Ga0496100_0090332 | 3300048903 | Bacteria | 2088 |
| 631 | Ga0496100_0109615 | 3300048903 | Bacteria | 1915 |
| 632 | Ga0496100_0121308 | 3300048903 | Bacteria | 1829 |
| 633 | Ga0496100_0182097 | 3300048903 | Bacteria | 1520 |
| 634 | Ga0496100_0344715 | 3300048903 | Bacteria | 1124 |
| 635 | Ga0496100_0373406 | 3300048903 | Bacteria | 1082 |
| 636 | Ga0496100_0562593 | 3300048903 | Bacteria | 883 |
| 637 | Ga0496100_1304378 | 3300048903 | Bacteria | 573 |
| 638 | Ga0496101_0044891 | 3300048904 | Bacteria | 3163 |
| 639 | Ga0496101_0067083 | 3300048904 | Bacteria | 2619 |
| 640 | Ga0496101_0135238 | 3300048904 | Bacteria | 1875 |
| 641 | Ga0496101_0253793 | 3300048904 | Bacteria | 1371 |
| 642 | Ga0496101_0275774 | 3300048904 | Bacteria | 1313 |
| 643 | Ga0496101_0293443 | 3300048904 | Bacteria | 1272 |
| 644 | Ga0496101_0318473 | 3300048904 | Bacteria | 1220 |
| 645 | Ga0496101_0578447 | 3300048904 | Bacteria | 888 |
| 646 | Ga0496101_1151200 | 3300048904 | Bacteria | 608 |
| 647 | Ga0496102_0036741 | 3300048905 | Bacteria | 4414 |
| 648 | Ga0496102_0066043 | 3300048905 | Bacteria | 3316 |
| 649 | Ga0496102_0099542 | 3300048905 | Bacteria | 2699 |
| 650 | Ga0496102_0116088 | 3300048905 | Bacteria | 2498 |
| 651 | Ga0496102_0206405 | 3300048905 | Bacteria | 1852 |
| 652 | Ga0496102_0322810 | 3300048905 | Bacteria | 1454 |
| 653 | Ga0496102_0482285 | 3300048905 | Bacteria | 1161 |
| 654 | Ga0496102_0646637 | 3300048905 | Bacteria | 981 |
| 655 | Ga0496102_1622627 | 3300048905 | Bacteria | 565 |
| 656 | Ga0496103_0010861 | 3300048906 | Bacteria | 5389 |
| 657 | Ga0496103_0013718 | 3300048906 | Bacteria | 4808 |
| 658 | Ga0496103_0137784 | 3300048906 | Bacteria | 1560 |
| 659 | Ga0496103_0220419 | 3300048906 | Bacteria | 1220 |
| 660 | Ga0496104_0000691 | 3300048907 | Bacteria | 29022 |
| 661 | Ga0496104_0005998 | 3300048907 | Bacteria | 10647 |
| 662 | Ga0496104_0008976 | 3300048907 | Bacteria | 8890 |
| 663 | Ga0496104_0193589 | 3300048907 | Bacteria | 1945 |
| 664 | Ga0496104_0254028 | 3300048907 | Bacteria | 1671 |
| 665 | Ga0496104_0259501 | 3300048907 | Unclassified | 1651 |
| 666 | Ga0496104_1286889 | 3300048907 | Bacteria | 634 |
| 667 | Ga0496105_0000461 | 3300048908 | Bacteria | 26731 |
| 668 | Ga0496105_0014720 | 3300048908 | Bacteria | 6227 |
| 669 | Ga0496105_0054983 | 3300048908 | Bacteria | 3286 |
| 670 | Ga0496105_0122136 | 3300048908 | Bacteria | 2147 |
| 671 | Ga0496105_0171030 | 3300048908 | Bacteria | 1781 |
| 672 | Ga0496105_0263449 | 3300048908 | Bacteria | 1393 |
| 673 | Ga0496105_0293996 | 3300048908 | Bacteria | 1307 |
| 674 | Ga0496105_0900060 | 3300048908 | Unclassified | 667 |
| 675 | Ga0496105_0994269 | 3300048908 | Bacteria | 628 |
| 676 | Ga0496106_0045031 | 3300048909 | Bacteria | 3313 |
| 677 | Ga0496106_0065786 | 3300048909 | Bacteria | 2760 |
| 678 | Ga0496106_0087472 | 3300048909 | Bacteria | 2401 |
| 679 | Ga0496106_0180210 | 3300048909 | Bacteria | 1677 |
| 680 | Ga0496106_0257953 | 3300048909 | Unclassified | 1395 |
| 681 | Ga0496106_0340087 | 3300048909 | Bacteria | 1205 |
| 682 | Ga0496106_0455624 | 3300048909 | Unclassified | 1027 |
| 683 | Ga0496106_0694052 | 3300048909 | Bacteria | 811 |
| 684 | Ga0496106_1127570 | 3300048909 | Bacteria | 614 |
| 685 | Ga0496107_0010138 | 3300048910 | Bacteria | 6536 |
| 686 | Ga0496107_0036610 | 3300048910 | Bacteria | 3519 |
| 687 | Ga0496107_0046241 | 3300048910 | Bacteria | 3132 |
| 688 | Ga0496107_0116422 | 3300048910 | Bacteria | 1967 |
| 689 | Ga0496107_0155101 | 3300048910 | Bacteria | 1695 |
| 690 | Ga0496107_0229192 | 3300048910 | Bacteria | 1382 |
| 691 | Ga0496107_0610129 | 3300048910 | Unclassified | 806 |
| 692 | Ga0496107_0672147 | 3300048910 | Bacteria | 763 |
| 693 | Ga0496107_1166180 | 3300048910 | Bacteria | 555 |
| 694 | Ga0496107_1316741 | 3300048910 | Bacteria | 516 |
| 695 | Ga0496108_0001323 | 3300048911 | Bacteria | 19467 |
| 696 | Ga0496108_0003915 | 3300048911 | Bacteria | 11958 |
| 697 | Ga0496108_0013726 | 3300048911 | Bacteria | 6610 |
| 698 | Ga0496108_0019667 | 3300048911 | Bacteria | 5546 |
| 699 | Ga0496108_0113185 | 3300048911 | Bacteria | 2322 |
| 700 | Ga0496108_0146967 | 3300048911 | Bacteria | 2032 |
| 701 | Ga0496108_0309214 | 3300048911 | Bacteria | 1377 |
| 702 | Ga0496108_0557691 | 3300048911 | Bacteria | 999 |
| 703 | Ga0496108_0575062 | 3300048911 | Bacteria | 982 |
| 704 | Ga0496109_0005477 | 3300048912 | Bacteria | 10621 |
| 705 | Ga0496109_0008325 | 3300048912 | Bacteria | 8805 |
| 706 | Ga0496109_0013188 | 3300048912 | Bacteria | 7153 |
| 707 | Ga0496109_0020970 | 3300048912 | Bacteria | 5776 |
| 708 | Ga0496109_0036998 | 3300048912 | Bacteria | 4408 |
| 709 | Ga0496109_0061986 | 3300048912 | Bacteria | 3419 |
| 710 | Ga0496109_0107413 | 3300048912 | Bacteria | 2592 |
| 711 | Ga0496109_0160241 | 3300048912 | Bacteria | 2108 |
| 712 | Ga0496109_0252778 | 3300048912 | Bacteria | 1660 |
| 713 | Ga0496109_0509487 | 3300048912 | Unclassified | 1136 |
| 714 | Ga0496109_0997128 | 3300048912 | Bacteria | 775 |
| 715 | Ga0496110_0006101 | 3300048913 | Bacteria | 9497 |
| 716 | Ga0496110_0009106 | 3300048913 | Bacteria | 8012 |
| 717 | Ga0496110_0011009 | 3300048913 | Bacteria | 7380 |
| 718 | Ga0496110_0040712 | 3300048913 | Bacteria | 4050 |
| 719 | Ga0496110_0070203 | 3300048913 | Bacteria | 3103 |
| 720 | Ga0496110_0111369 | 3300048913 | Bacteria | 2460 |
| 721 | Ga0496110_0139557 | 3300048913 | Bacteria | 2191 |
| 722 | Ga0496110_0290744 | 3300048913 | Bacteria | 1488 |
| 723 | Ga0496110_0734081 | 3300048913 | Bacteria | 890 |
| 724 | Ga0496111_0000629 | 3300048914 | Bacteria | 18610 |
| 725 | Ga0496111_0002084 | 3300048914 | Bacteria | 11925 |
| 726 | Ga0496111_0002905 | 3300048914 | Bacteria | 10468 |
| 727 | Ga0496111_0018597 | 3300048914 | Bacteria | 4815 |
| 728 | Ga0496111_0036912 | 3300048914 | Bacteria | 3495 |
| 729 | Ga0496111_0147026 | 3300048914 | Unclassified | 1747 |
| 730 | Ga0496111_0149147 | 3300048914 | Bacteria | 1734 |
| 731 | Ga0496111_0238613 | 3300048914 | Bacteria | 1350 |
| 732 | Ga0496111_0584639 | 3300048914 | Bacteria | 818 |
| 733 | Ga0496111_0677624 | 3300048914 | Unclassified | 751 |
| 734 | Ga0496111_0963173 | 3300048914 | Bacteria | 612 |
| 735 | Ga0496112_0040259 | 3300048915 | Bacteria | 4569 |
| 736 | Ga0496112_0049695 | 3300048915 | Bacteria | 4110 |
| 737 | Ga0496112_0123624 | 3300048915 | Bacteria | 2558 |
| 738 | Ga0496112_0151580 | 3300048915 | Bacteria | 2285 |
| 739 | Ga0496112_0290197 | 3300048915 | Unclassified | 1582 |
| 740 | Ga0496112_0519824 | 3300048915 | Bacteria | 1125 |
| 741 | Ga0496112_0676071 | 3300048915 | Bacteria | 961 |
| 742 | Ga0496113_0000482 | 3300048916 | Bacteria | 19590 |
| 743 | Ga0496113_0000824 | 3300048916 | Bacteria | 16158 |
| 744 | Ga0496113_0005833 | 3300048916 | Bacteria | 7727 |
| 745 | Ga0496113_0225871 | 3300048916 | Bacteria | 1493 |
| 746 | Ga0496113_0262375 | 3300048916 | Bacteria | 1380 |
| 747 | Ga0496113_0306786 | 3300048916 | Unclassified | 1271 |
| 748 | Ga0496113_0309067 | 3300048916 | Bacteria | 1266 |
| 749 | Ga0496113_0453870 | 3300048916 | Bacteria | 1030 |
| 750 | Ga0496113_0664084 | 3300048916 | Bacteria | 833 |
| 751 | Ga0496114_0026337 | 3300048917 | Bacteria | 4760 |
| 752 | Ga0496114_0037126 | 3300048917 | Bacteria | 4029 |
| 753 | Ga0496114_0055889 | 3300048917 | Bacteria | 3292 |
| 754 | Ga0496114_0062043 | 3300048917 | Bacteria | 3128 |
| 755 | Ga0496114_0088737 | 3300048917 | Bacteria | 2623 |
| 756 | Ga0496114_0164208 | 3300048917 | Bacteria | 1933 |
| 757 | Ga0496114_0304168 | 3300048917 | Bacteria | 1408 |
| 758 | Ga0496114_0358251 | 3300048917 | Bacteria | 1290 |
| 759 | Ga0496114_0389116 | 3300048917 | Bacteria | 1235 |
| 760 | Ga0496114_1012515 | 3300048917 | Bacteria | 714 |
| 761 | Ga0496115_0030776 | 3300048918 | Bacteria | 4224 |
| 762 | Ga0496115_0032205 | 3300048918 | Archaea | 4135 |
| 763 | Ga0496115_0117129 | 3300048918 | Bacteria | 2191 |
| 764 | Ga0496115_0127078 | 3300048918 | Bacteria | 2100 |
| 765 | Ga0496115_0382969 | 3300048918 | Unclassified | 1143 |
| 766 | Ga0496115_0603348 | 3300048918 | Unclassified | 872 |
| 767 | Ga0501033_0495019 | 3300049570 | Unclassified | 846 |
| 768 | Ga0501039_0237917 | 3300049575 | Unclassified | 1432 |
| 769 | Ga0501040_0101489 | 3300049576 | Bacteria | 2007 |
| 770 | Ga0501041_0135018 | 3300049577 | Unclassified | 1537 |
| 771 | Ga0501042_0976362 | 3300049578 | Bacteria | 617 |
| 772 | Ga0501067_0001435 | 3300049583 | Bacteria | 12943 |
| 773 | Ga0501067_0007672 | 3300049583 | Bacteria | 6000 |
| 774 | Ga0501069_0004440 | 3300049585 | Bacteria | 7247 |
| 775 | Ga0501070_0047802 | 3300049586 | Bacteria | 3555 |
| 776 | Ga0501075_0346910 | 3300049591 | Unclassified | 1131 |
| 777 | Ga0501076_0085801 | 3300049592 | Bacteria | 2530 |
| 778 | Ga0501077_0436717 | 3300049593 | Unclassified | 838 |
| 779 | Ga0501079_0029543 | 3300049741 | Bacteria | 4209 |
| 780 | Ga0501081_0506948 | 3300049743 | Unclassified | 899 |
| 781 | Ga0501081_1016398 | 3300049743 | Bacteria | 627 |
| 782 | Ga0501035_1106989 | 3300049822 | Bacteria | 618 |
| 783 | Ga0501045_0336982 | 3300049824 | Unclassified | 1122 |
| 784 | nmdc:mga00v17_92768_c1 | 3300050491 | Unclassified | 830 |
| 785 | nmdc:mga05p37_16222_c1 | 3300050507 | Bacteria | 8967 |
| 786 | nmdc:mga05p37_188115_c1 | 3300050507 | Bacteria | 2509 |
| 787 | nmdc:mga05p37_372818_c1 | 3300050507 | Bacteria | 1674 |
| 788 | nmdc:mga05p37_84240_c1 | 3300050507 | Bacteria | 3917 |
| 789 | nmdc:mga09592_154687_c1 | 3300050508 | Bacteria | 1979 |
| 790 | nmdc:mga0qj67_194801_c1 | 3300050509 | Bacteria | 1647 |
| 791 | nmdc:mga06r32_157906_c1 | 3300050510 | Bacteria | 2250 |
| 792 | nmdc:mga06r32_18439_c1 | 3300050510 | Bacteria | 6389 |
| 793 | nmdc:mga08y16_29200_c1 | 3300050511 | Bacteria | 5812 |
| 794 | nmdc:mga08y16_76524_c1 | 3300050511 | Bacteria | 3488 |
| 795 | nmdc:mga08y16_983868_c1 | 3300050511 | Unclassified | 825 |
| 796 | nmdc:mga0n895_1310287_c1 | 3300050512 | Unclassified | 695 |
| 797 | nmdc:mga0n895_144480_c1 | 3300050512 | Bacteria | 2408 |
| 798 | nmdc:mga0n895_1517041_c1 | 3300050512 | Unclassified | 636 |
| 799 | nmdc:mga0n895_40352_c1 | 3300050512 | Bacteria | 4534 |
| 800 | nmdc:mga0n895_613495_c1 | 3300050512 | Bacteria | 1089 |
| 801 | nmdc:mga0n895_63669_c1 | 3300050512 | Bacteria | 3647 |
| 802 | nmdc:mga0rr50_1491177_c1 | 3300050513 | Bacteria | 572 |
| 803 | nmdc:mga0rr50_212956_c1 | 3300050513 | Unclassified | 1593 |
| 804 | nmdc:mga0rr50_50390_c1 | 3300050513 | Bacteria | 3085 |
| 805 | nmdc:mga08x19_128239_c1 | 3300050514 | Unclassified | 1705 |
| 806 | nmdc:mga08x19_22358_c1 | 3300050514 | Bacteria | 3916 |
| 807 | nmdc:mga08x19_457420_c1 | 3300050514 | Bacteria | 899 |
| 808 | nmdc:mga08x19_47800_c1 | 3300050514 | Bacteria | 2740 |
| 809 | nmdc:mga08x19_57859_c1 | 3300050514 | Bacteria | 2507 |
| 810 | nmdc:mga0a205_102183_c1 | 3300050515 | Unclassified | 2766 |
| 811 | nmdc:mga0a205_198109_c1 | 3300050515 | Bacteria | 1899 |
| 812 | nmdc:mga0a205_330520_c1 | 3300050515 | Bacteria | 1394 |
| 813 | nmdc:mga0a205_509548_c1 | 3300050515 | Bacteria | 1060 |
| 814 | nmdc:mga0a205_548452_c1 | 3300050515 | Bacteria | 1011 |
| 815 | nmdc:mga0a205_82276_c1 | 3300050515 | Bacteria | 3110 |
| 816 | Ga0495612_0057879 | 3300053078 | Bacteria | 1601 |
| 817 | Ga0495619_0044323 | 3300053085 | Bacteria | 2920 |
| 818 | Ga0495619_0190221 | 3300053085 | Bacteria | 1420 |
| 819 | Ga0501084_0091319 | 3300054114 | Bacteria | 2557 |
| 820 | Ga0501082_0044537 | 3300060353 | Bacteria | 3827 |
| 821 | Ga0530510_0251173 | 3300061734 | Bacteria | 1318 |
| 822 | Ga0070683_100740046 | |||
| 823 | Ga0070683_100267063 | |||
| 824 | Ga0070683_100545148 | |||
| 825 | Ga0068869_100165973 | |||
| 826 | Ga0068869_100726161 | |||
| 827 | Ga0070666_10702206 | |||
| 828 | Ga0070680_100026187 | |||
| 829 | Ga0070682_100005210 | |||
| 830 | Ga0070682_100548731 | |||
| 831 | Ga0070682_100932828 | |||
| 832 | Ga0070682_101163983 | |||
| 833 | Ga0068868_100074827 | |||
| 834 | Ga0068868_100300824 | |||
| 835 | Ga0068868_100383510 | |||
| 836 | Ga0068868_100523675 | |||
| 837 | Ga0068868_100828183 | |||
| 838 | Ga0070660_100103805 | |||
| 839 | Ga0070660_100420244 | |||
| 840 | Ga0070689_100689952 | |||
| 841 | Ga0070691_10047492 | |||
| 842 | Ga0070691_10204642 | |||
| 843 | Ga0070691_10289851 | |||
| 844 | Ga0070691_10521214 | |||
| 845 | Ga0070687_100637460 | |||
| 846 | Ga0070692_10139509 | |||
| 847 | Ga0070668_100068975 | |||
| 848 | Ga0070668_101412016 | |||
| 849 | Ga0070669_100640230 | |||
| 850 | Ga0070675_100968028 | |||
| 851 | Ga0070671_100095584 | |||
| 852 | Ga0070671_100200560 | |||
| 853 | Ga0070671_100869311 | |||
| 854 | Ga0070674_100007606 | |||
| 855 | Ga0070673_100350713 | |||
| 856 | Ga0070673_101651438 | |||
| 857 | Ga0070688_100072160 | |||
| 858 | Ga0070688_101341827 | |||
| 859 | Ga0070659_100276336 | |||
| 860 | Ga0070667_101445520 | |||
| 861 | Ga0070709_10050586 | |||
| 862 | Ga0070709_10452534 | |||
| 863 | Ga0070714_100080421 | |||
| 864 | Ga0070713_100011514 | |||
| 865 | Ga0070710_10114169 | |||
| 866 | Ga0070710_10637570 | |||
| 867 | Ga0070710_10874223 | |||
| 868 | Ga0070701_10106209 | |||
| 869 | Ga0070701_10322630 | |||
| 870 | Ga0070711_100060550 | |||
| 871 | Ga0070711_100380442 | |||
| 872 | Ga0070711_100514497 | |||
| 873 | Ga0070705_100042483 | |||
| 874 | Ga0070705_100146360 | |||
| 875 | Ga0070705_100184003 | |||
| 876 | Ga0070705_100216701 | |||
| 877 | Ga0070705_100261861 | |||
| 878 | Ga0070700_100418715 | |||
| 879 | Ga0070700_100739729 | |||
| 880 | Ga0070700_100897090 | |||
| 881 | Ga0070694_100191909 | |||
| 882 | Ga0070694_100776921 | |||
| 883 | Ga0070694_100915099 | |||
| 884 | Ga0070708_100109717 | |||
| 885 | Ga0070708_100139491 | |||
| 886 | Ga0070708_100216023 | |||
| 887 | Ga0070708_100628602 | |||
| 888 | Ga0070663_100033839 | |||
| 889 | Ga0070663_100909260 | |||
| 890 | Ga0070678_100021829 | |||
| 891 | Ga0070678_100026985 | |||
| 892 | Ga0070678_100144236 | |||
| 893 | Ga0070662_100389084 | |||
| 894 | Ga0070681_10347884 | |||
| 895 | Ga0070681_10453453 | |||
| 896 | Ga0068867_100192196 | |||
| 897 | Ga0068867_100285411 | |||
| 898 | Ga0068867_100518198 | |||
| 899 | Ga0070685_10233153 | |||
| 900 | Ga0070685_10292794 | |||
| 901 | Ga0070706_100077589 | |||
| 902 | Ga0070706_100166775 | |||
| 903 | Ga0070707_100002890 | |||
| 904 | Ga0070698_100509332 | |||
| 905 | Ga0070699_100016998 | |||
| 906 | Ga0070699_100385253 | |||
| 907 | Ga0070679_100717711 | |||
| 908 | Ga0070684_100089612 | |||
| 909 | Ga0070684_100161823 | |||
| 910 | Ga0070684_100683005 | |||
| 911 | Ga0070684_100735907 | |||
| 912 | Ga0070697_100444839 | |||
| 913 | Ga0068853_100218045 | |||
| 914 | Ga0070686_100035454 | |||
| 915 | Ga0070686_100045168 | |||
| 916 | Ga0070686_100070849 | |||
| 917 | Ga0070686_100205071 | |||
| 918 | Ga0070695_100182494 | |||
| 919 | Ga0070695_100217772 | |||
| 920 | Ga0070695_100554131 | |||
| 921 | Ga0070696_100126398 | |||
| 922 | Ga0070696_100157189 | |||
| 923 | Ga0070696_100577874 | |||
| 924 | Ga0070693_100026866 | |||
| 925 | Ga0070693_100161451 | |||
| 926 | Ga0070693_100318260 | |||
| 927 | Ga0070693_100349395 | |||
| 928 | Ga0070704_100039620 | |||
| 929 | Ga0070704_100285193 | |||
| 930 | Ga0070704_100285850 | |||
| 931 | Ga0070704_100390691 | |||
| 932 | Ga0070704_100749052 | |||
| 933 | Ga0068855_100079024 | |||
| 934 | Ga0068855_100294188 | |||
| 935 | Ga0068855_101092806 | |||
| 936 | Ga0068855_101297672 | |||
| 937 | Ga0070664_100527095 | |||
| 938 | Ga0068857_102292237 | |||
| 939 | Ga0068854_100036423 | |||
| 940 | Ga0068854_100253812 | |||
| 941 | Ga0068856_100046077 | |||
| 942 | Ga0068856_100126149 | |||
| 943 | Ga0068856_100140385 | |||
| 944 | Ga0068856_100237066 | |||
| 945 | Ga0068856_100257029 | |||
| 946 | Ga0068856_100299808 | |||
| 947 | Ga0068856_100387265 | |||
| 948 | Ga0068856_100697625 | |||
| 949 | Ga0068856_100752188 | |||
| 950 | Ga0068856_100874608 | |||
| 951 | Ga0068856_101249032 | |||
| 952 | Ga0070702_100128029 | |||
| 953 | Ga0070702_100427226 | |||
| 954 | Ga0070702_100503936 | |||
| 955 | Ga0070702_100509175 | |||
| 956 | Ga0070702_100883216 | |||
| 957 | Ga0070702_100929241 | |||
| 958 | Ga0068852_100076766 | |||
| 959 | Ga0068852_100662116 | |||
| 960 | Ga0068852_101892947 | |||
| 961 | Ga0068859_101105985 | |||
| 962 | Ga0068864_100006361 | |||
| 963 | Ga0068866_10012779 | |||
| 964 | Ga0068861_100071272 | |||
| 965 | Ga0068861_100190489 | |||
| 966 | Ga0068861_100698532 | |||
| 967 | Ga0068860_100541731 | |||
| 968 | Ga0068860_100649269 | |||
| 969 | Ga0068862_101544924 | |||
| 970 | Ga0081455_10010868 | |||
| 971 | Ga0081538_10013296 | |||
| 972 | Ga0081538_10152030 | |||
| 973 | Ga0081540_1002869 | |||
| 974 | Ga0081540_1005145 | |||
| 975 | Ga0081540_1005990 | |||
| 976 | Ga0081540_1032816 | |||
| 977 | Ga0070717_10182307 | |||
| 978 | Ga0075432_10011677 | |||
| 979 | Ga0075432_10433867 | |||
| 980 | Ga0070715_10003539 | |||
| 981 | Ga0070716_100039912 | |||
| 982 | Ga0070716_100176869 | |||
| 983 | Ga0070712_100001448 | |||
| 984 | Ga0070712_100167123 | |||
| 985 | Ga0070712_100580089 | |||
| 986 | Ga0097621_100131929 | |||
| 987 | Ga0068871_100052606 | |||
| 988 | Ga0068871_100357099 | |||
| 989 | Ga0068871_101616184 | |||
| 990 | Ga0075428_100114818 | |||
| 991 | Ga0075428_100161542 | |||
| 992 | Ga0075428_100200162 | |||
| 993 | Ga0075428_100479860 | |||
| 994 | Ga0075430_100204796 | |||
| 995 | Ga0075431_100058228 | |||
| 996 | Ga0075431_100168517 | |||
| 997 | Ga0075433_10092243 | |||
| 998 | Ga0075433_10139663 | |||
| 999 | Ga0075434_100034001 | |||
| 1000 | Ga0075434_100149934 | |||
| 1001 | Ga0075434_101477584 | |||
| 1002 | Ga0075429_100169058 | |||
| 1003 | Ga0068865_100617853 | |||
| 1004 | Ga0068865_100694371 | |||
| 1005 | Ga0075436_100022702 | |||
| 1006 | Ga0075436_100033630 | |||
| 1007 | Ga0097620_101105864 | |||
| 1008 | Ga0075435_100062244 | |||
| 1009 | Ga0075435_100176245 | |||
| 1010 | Ga0075435_100259801 | |||
| 1011 | Ga0075435_100671315 | |||
| 1012 | Ga0075435_101597206 | |||
| 1013 | Ga0105250_10138900 | |||
| 1014 | Ga0105240_10840244 | |||
| 1015 | Ga0111539_10118771 | |||
| 1016 | Ga0111539_10149472 | |||
| 1017 | Ga0111539_10199069 | |||
| 1018 | Ga0105245_10055857 | |||
| 1019 | Ga0105245_10102321 | |||
| 1020 | Ga0105245_10107226 | |||
| 1021 | Ga0105245_10203656 | |||
| 1022 | Ga0105245_10317102 | |||
| 1023 | Ga0105245_10443140 | |||
| 1024 | Ga0105245_10507900 | |||
| 1025 | Ga0105245_10525306 | |||
| 1026 | Ga0105245_10831924 | |||
| 1027 | Ga0105245_11075154 | |||
| 1028 | Ga0105245_11168189 | |||
| 1029 | Ga0105245_11265635 | |||
| 1030 | Ga0105245_12320505 | |||
| 1031 | Ga0105247_10172440 | |||
| 1032 | Ga0114129_10075826 | |||
| 1033 | Ga0114129_10291610 | |||
| 1034 | Ga0114129_10478556 | |||
| 1035 | Ga0114129_13278393 | |||
| 1036 | Ga0105243_10170512 | |||
| 1037 | Ga0105243_10247456 | |||
| 1038 | Ga0105243_10305771 | |||
| 1039 | Ga0105243_13077318 | |||
| 1040 | Ga0105241_10058235 | |||
| 1041 | Ga0105241_10165411 | |||
| 1042 | Ga0105241_10614632 | |||
| 1043 | Ga0105241_11530050 | |||
| 1044 | Ga0105242_10107242 | |||
| 1045 | Ga0105242_11098762 | |||
| 1046 | Ga0105242_11468929 | |||
| 1047 | Ga0105248_10134958 | |||
| 1048 | Ga0105248_10284959 | |||
| 1049 | Ga0105237_10541140 | |||
| 1050 | Ga0105249_10100526 | |||
| 1051 | Ga0105249_10199156 | |||
| 1052 | Ga0105239_10002262 | |||
| 1053 | Ga0105239_10087483 | |||
| 1054 | Ga0105239_10348013 | |||
| 1055 | Ga0105239_10373952 | |||
| 1056 | Ga0105239_10379239 | |||
| 1057 | Ga0105239_10556642 | |||
| 1058 | Ga0105239_10888297 | |||
| 1059 | Ga0105246_10157419 | |||
| 1060 | Ga0105246_10359797 | |||
| 1061 | Ga0105246_11122104 | |||
| 1062 | Ga0105246_12207574 | |||
| 1063 | Ga0157344_1009418 | |||
| 1064 | Ga0157318_1035160 | |||
| 1065 | Ga0157313_1037265 | |||
| 1066 | Ga0157342_1001550 | |||
| 1067 | Ga0157315_1001278 | |||
| 1068 | Ga0157316_1012217 | |||
| 1069 | Ga0157373_10378629 | |||
| 1070 | Ga0157371_10249658 | |||
| 1071 | Ga0157371_10285615 | |||
| 1072 | Ga0157369_10479026 | |||
| 1073 | Ga0157369_11112337 | |||
| 1074 | Ga0157374_10238811 | |||
| 1075 | Ga0157374_10365699 | |||
| 1076 | Ga0157374_10439528 | |||
| 1077 | Ga0157378_10293624 | |||
| 1078 | Ga0157378_11468937 | |||
| 1079 | Ga0157378_11991827 | |||
| 1080 | Ga0163162_10506311 | |||
| 1081 | Ga0163162_10660634 | |||
| 1082 | Ga0157372_10086115 | |||
| 1083 | Ga0157372_10443795 | |||
| 1084 | Ga0157375_10705261 | |||
| 1085 | Ga0157375_11178116 | |||
| 1086 | Ga0157375_12413503 | |||
| 1087 | Ga0157380_10622991 | |||
| 1088 | Ga0157380_11326568 | |||
| 1089 | Ga0182008_10541319 | |||
| 1090 | Ga0157377_10193828 | |||
| 1091 | Ga0157377_10240837 | |||
| 1092 | Ga0157377_10462584 | |||
| 1093 | Ga0157377_10485947 | |||
| 1094 | Ga0157379_10882668 | |||
| 1095 | Ga0157379_11709785 | |||
| 1096 | Ga0157376_10013794 | |||
| 1097 | Ga0157376_10468316 | |||
| 1098 | Ga0157376_11138719 | |||
| 1099 | Ga0157376_12847151 | |||
| 1100 | Ga0182005_1234199 | |||
| 1101 | Ga0163161_10075444 | |||
| 1102 | Ga0163161_10162626 | |||
| 1103 | Ga0207653_10002267 | |||
| 1104 | Ga0207692_10034562 | |||
| 1105 | Ga0207692_10367199 | |||
| 1106 | Ga0207642_10332470 | |||
| 1107 | Ga0207642_10403976 | |||
| 1108 | Ga0207688_10010459 | |||
| 1109 | Ga0207688_10145769 | |||
| 1110 | Ga0207688_10312358 | |||
| 1111 | Ga0207680_10696563 | |||
| 1112 | Ga0207685_10034862 | |||
| 1113 | Ga0207685_10176249 | |||
| 1114 | Ga0207699_10024753 | |||
| 1115 | Ga0207699_10392304 | |||
| 1116 | Ga0207699_10768194 | |||
| 1117 | Ga0207684_10089332 | |||
| 1118 | Ga0207684_10271671 | |||
| 1119 | Ga0207684_10323725 | |||
| 1120 | Ga0207684_10332016 | |||
| 1121 | Ga0207654_10019978 | |||
| 1122 | Ga0207654_10085953 | |||
| 1123 | Ga0207654_10153424 | |||
| 1124 | Ga0207654_10438445 | |||
| 1125 | Ga0207654_11326134 | |||
| 1126 | Ga0207707_10164771 | |||
| 1127 | Ga0207695_11732908 | |||
| 1128 | Ga0207671_10439711 | |||
| 1129 | Ga0207693_10003258 | |||
| 1130 | Ga0207693_10016686 | |||
| 1131 | Ga0207693_10023595 | |||
| 1132 | Ga0207693_10463445 | |||
| 1133 | Ga0207693_10557737 | |||
| 1134 | Ga0207663_10216561 | |||
| 1135 | Ga0207663_10406435 | |||
| 1136 | Ga0207663_10554707 | |||
| 1137 | Ga0207663_11101640 | |||
| 1138 | Ga0207660_10052797 | |||
| 1139 | Ga0207662_10062127 | |||
| 1140 | Ga0207662_10310224 | |||
| 1141 | Ga0207657_10274257 | |||
| 1142 | Ga0207657_10342606 | |||
| 1143 | Ga0207657_10560065 | |||
| 1144 | Ga0207652_10654083 | |||
| 1145 | Ga0207652_10712116 | |||
| 1146 | Ga0207652_11240382 | |||
| 1147 | Ga0207646_10005641 | |||
| 1148 | Ga0207646_10828848 | |||
| 1149 | Ga0207646_10932616 | |||
| 1150 | Ga0207681_10298433 | |||
| 1151 | Ga0207681_10734793 | |||
| 1152 | Ga0207659_11329250 | |||
| 1153 | Ga0207687_10008937 | |||
| 1154 | Ga0207687_10034193 | |||
| 1155 | Ga0207687_10081889 | |||
| 1156 | Ga0207687_10173663 | |||
| 1157 | Ga0207687_10184139 | |||
| 1158 | Ga0207687_10612232 | |||
| 1159 | Ga0207687_10633164 | |||
| 1160 | Ga0207687_11334270 | |||
| 1161 | Ga0207687_11809894 | |||
| 1162 | Ga0207700_10081985 | |||
| 1163 | Ga0207700_10541352 | |||
| 1164 | Ga0207700_10639192 | |||
| 1165 | Ga0207664_10034046 | |||
| 1166 | Ga0207664_10498541 | |||
| 1167 | Ga0207664_10902345 | |||
| 1168 | Ga0207644_10191243 | |||
| 1169 | Ga0207644_10203613 | |||
| 1170 | Ga0207644_10731854 | |||
| 1171 | Ga0207644_10934569 | |||
| 1172 | Ga0207690_10246339 | |||
| 1173 | Ga0207706_10006582 | |||
| 1174 | Ga0207706_10120049 | |||
| 1175 | Ga0207706_10124435 | |||
| 1176 | Ga0207706_10497796 | |||
| 1177 | Ga0207686_10077351 | |||
| 1178 | Ga0207686_10304448 | |||
| 1179 | Ga0207669_10031588 | |||
| 1180 | Ga0207669_10452570 | |||
| 1181 | Ga0207704_10209002 | |||
| 1182 | Ga0207704_11121996 | |||
| 1183 | Ga0207665_10006431 | |||
| 1184 | Ga0207665_10202830 | |||
| 1185 | Ga0207691_11194161 | |||
| 1186 | Ga0207711_10184795 | |||
| 1187 | Ga0207689_10274759 | |||
| 1188 | Ga0207689_10799655 | |||
| 1189 | Ga0207661_10023679 | |||
| 1190 | Ga0207661_10169070 | |||
| 1191 | Ga0207661_10568464 | |||
| 1192 | Ga0207679_10642931 | |||
| 1193 | Ga0207679_11136117 | |||
| 1194 | Ga0207667_10563579 | |||
| 1195 | Ga0207667_10812749 | |||
| 1196 | Ga0207651_10732150 | |||
| 1197 | Ga0207651_11125852 | |||
| 1198 | Ga0207712_10180922 | |||
| 1199 | Ga0207712_10259849 | |||
| 1200 | Ga0207668_10066832 | |||
| 1201 | Ga0207668_10083028 | |||
| 1202 | Ga0207668_10317316 | |||
| 1203 | Ga0207668_11077111 | |||
| 1204 | Ga0207640_10417253 | |||
| 1205 | Ga0207640_10463062 | |||
| 1206 | Ga0207640_11528928 | |||
| 1207 | Ga0207658_10816883 | |||
| 1208 | Ga0207677_10021982 | |||
| 1209 | Ga0207677_10043802 | |||
| 1210 | Ga0207677_10121039 | |||
| 1211 | Ga0207677_10202825 | |||
| 1212 | Ga0207677_10450911 | |||
| 1213 | Ga0207677_10473254 | |||
| 1214 | Ga0207677_10977451 | |||
| 1215 | Ga0207639_10586447 | |||
| 1216 | Ga0207678_10056600 | |||
| 1217 | Ga0207708_10089216 | |||
| 1218 | Ga0207708_10189280 | |||
| 1219 | Ga0207708_10399988 | |||
| 1220 | Ga0207708_10471574 | |||
| 1221 | Ga0207708_10491787 | |||
| 1222 | Ga0207702_10003331 | |||
| 1223 | Ga0207702_10025176 | |||
| 1224 | Ga0207702_10143483 | |||
| 1225 | Ga0207702_10232830 | |||
| 1226 | Ga0207702_10233389 | |||
| 1227 | Ga0207702_10495551 | |||
| 1228 | Ga0207702_10657008 | |||
| 1229 | Ga0207702_11763724 | |||
| 1230 | Ga0207641_10795959 | |||
| 1231 | Ga0207648_10233978 | |||
| 1232 | Ga0207648_10747930 | |||
| 1233 | Ga0207676_10163075 | |||
| 1234 | Ga0207676_10206161 | |||
| 1235 | Ga0207675_100010489 | |||
| 1236 | Ga0207675_100051713 | |||
| 1237 | Ga0207675_100184215 | |||
| 1238 | Ga0207675_100261354 | |||
| 1239 | Ga0207683_10001564 | |||
| 1240 | Ga0207683_10015964 | |||
| 1241 | Ga0207683_10052737 | |||
| 1242 | Ga0207683_10109858 | |||
| 1243 | Ga0207683_10124400 | |||
| 1244 | Ga0207698_11706250 | |||
| 1245 | Ga0207428_10028629 | |||
| 1246 | Ga0207428_10092776 | |||
| 1247 | Ga0268266_10408063 | |||
| 1248 | Ga0268265_10300699 | |||
| 1249 | Ga0268265_10676350 | |||
| 1250 | Ga0268264_10141325 | |||
| 1251 | Ga0268264_11485199 | |||
| 1252 | Ga0307406_10958572 | |||
| 1253 | Ga0307409_100021055 | |||
| 1254 | Ga0307409_101251432 | |||
| 1255 | Ga0373948_0003747 | |||
| 1256 | Ga0373948_0023525 | |||
| 1257 | Ga0373950_0013056 | |||
| 1258 | Ga0373959_0001309 | |||
| 1259 | Ga0373929_0016125 | |||
| 1260 | Ga0373944_0001746 | |||
| 1261 | Ga0373951_0033269 | |||
| 1262 | Ga0373952_0028850 | |||
| 1263 | Ga0373932_0002286 | |||
| 1264 | Ga0373939_0021651 | |||
| 1265 | Ga0373941_0004204 | |||
| 1266 | Ga0373941_0062465 | |||
| 1267 | Ga0373945_0021197 | |||
| 1268 | Ga0373960_0062071 | |||
| 1269 | Ga0373960_0130761 | |||
| 1270 | Ga0373960_0244146 | |||
| 1271 | Ga0373960_0297953 | |||
| 1272 | Ga0373943_0012098 | |||
| 1273 | Ga0373943_0016415 | |||
| 1274 | Ga0373943_0091830 | |||
| 1275 | Ga0373946_0011220 | |||
| 1276 | Ga0373942_0003344 | |||
| 1277 | Ga0373961_0027354 | |||
| 1278 | Ga0373961_0151351 | |||
| 1279 | Ga0373961_0235255 | |||
| 1280 | Ga0373962_0001222 | |||
| 1281 | Ga0373962_0035842 | |||
| 1282 | Ga0373962_0136426 | |||
| 1283 | Ga0373931_0005617 | |||
| 1284 | Ga0373931_0954803 | |||
| 1285 | Ga0373935_0063069 | |||
| 1286 | Ga0373927_0112159 | |||
| 1287 | Ga0373947_0742237 | |||
| 1288 | Ga0373947_1047789 | |||
| 1289 | Ga0373937_1451342 | |||
| 1290 | Ga0373925_0008644 | |||
| 1291 | Ga0373925_1617245 | |||
| 1292 | Ga0395899_0013881 | |||
| 1293 | Ga0395899_0014669 | |||
| 1294 | Ga0395899_0020994 | |||
| 1295 | Ga0395899_0040840 | |||
| 1296 | Ga0395899_0135891 | |||
| 1297 | Ga0395899_0357429 | |||
| 1298 | Ga0395900_0002868 | |||
| 1299 | Ga0395900_0007646 | |||
| 1300 | Ga0395900_0009226 | |||
| 1301 | Ga0395900_0009682 | |||
| 1302 | Ga0395900_0023295 | |||
| 1303 | Ga0395900_0055351 | |||
| 1304 | Ga0395900_0106826 | |||
| 1305 | Ga0395900_0398830 | |||
| 1306 | Ga0395900_0544970 | |||
| 1307 | Ga0395900_0611361 | |||
| 1308 | Ga0395898_0005218 | |||
| 1309 | Ga0395898_0005707 | |||
| 1310 | Ga0395898_0019062 | |||
| 1311 | Ga0395898_0050276 | |||
| 1312 | Ga0395898_0152751 | |||
| 1313 | Ga0395898_0156190 | |||
| 1314 | Ga0395898_0242054 | |||
| 1315 | Ga0395898_0362724 | |||
| 1316 | Ga0395898_1114386 | |||
| 1317 | Ga0395898_1302933 | |||
| 1318 | Ga0395898_1833367 | |||
| 1319 | Ga0395905_0004667 | |||
| 1320 | Ga0395905_0005067 | |||
| 1321 | Ga0395905_0013993 | |||
| 1322 | Ga0395905_0050733 | |||
| 1323 | Ga0395905_0371028 | |||
| 1324 | Ga0395905_0388259 | |||
| 1325 | Ga0395901_0001467 | |||
| 1326 | Ga0395901_0002218 | |||
| 1327 | Ga0395901_0004922 | |||
| 1328 | Ga0395901_0014011 | |||
| 1329 | Ga0395901_0068095 | |||
| 1330 | Ga0395901_0186855 | |||
| 1331 | Ga0395901_0444246 | |||
| 1332 | Ga0395901_0560752 | |||
| 1333 | Ga0395901_0688421 | |||
| 1334 | Ga0395901_0896028 | |||
| 1335 | Ga0395901_1013852 | |||
| 1336 | Ga0242420_049735 | |||
| 1337 | Ga0451789_0844947 | |||
| 1338 | Ga0451789_0956241 | |||
| 1339 | Ga0451800_1214126 | |||
| 1340 | Ga0451835_0290872 | |||
| 1341 | Ga0451845_0264688 | |||
| 1342 | Ga0451849_0081608 | |||
| 1343 | Ga0451853_0253187 | |||
| 1344 | Ga0451853_0365477 | |||
| 1345 | Ga0451853_0483074 | |||
| 1346 | Ga0439448_0002532 | |||
| 1347 | Ga0439448_0091367 | |||
| 1348 | Ga0439451_103669 | |||
| 1349 | Ga0439459_0002855 | |||
| 1350 | Ga0439459_0209576 | |||
| 1351 | Ga0451577_0361510 | |||
| 1352 | Ga0466964_0009047 | |||
| 1353 | Ga0466968_0043202 | |||
| 1354 | Ga0466968_0054892 | |||
| 1355 | Ga0466968_0090875 | |||
| 1356 | Ga0466960_0060428 | |||
| 1357 | Ga0451576_0018528 | |||
| 1358 | Ga0451576_0344773 | |||
| 1359 | Ga0451576_0543359 | |||
| 1360 | Ga0451576_1924695 | |||
| 1361 | Ga0466967_0000180 | |||
| 1362 | Ga0495603_0011814 | |||
| 1363 | Ga0495603_0054247 | |||
| 1364 | Ga0495603_0083994 | |||
| 1365 | Ga0495603_0227647 | |||
| 1366 | Ga0495629_0005704 | |||
| 1367 | Ga0495629_0347001 | |||
| 1368 | Ga0495629_0436116 | |||
| 1369 | Ga0495641_0007540 | |||
| 1370 | Ga0495641_0011893 | |||
| 1371 | Ga0495641_0136373 | |||
| 1372 | Ga0495651_0237773 | |||
| 1373 | Ga0495580_0263158 | |||
| 1374 | Ga0495582_0248184 | |||
| 1375 | Ga0495605_0157707 | |||
| 1376 | Ga0495605_0298179 | |||
| 1377 | Ga0495639_0090500 | |||
| 1378 | Ga0495639_0428555 | |||
| 1379 | Ga0495639_0484877 | |||
| 1380 | Ga0495662_0140959 | |||
| 1381 | Ga0495584_0218922 | |||
| 1382 | Ga0495594_0030692 | |||
| 1383 | Ga0495594_0201424 | |||
| 1384 | Ga0495596_0148898 | |||
| 1385 | Ga0495607_0060439 | |||
| 1386 | Ga0495607_0212593 | |||
| 1387 | Ga0495616_0281572 | |||
| 1388 | Ga0495630_1404652 | |||
| 1389 | Ga0495631_0350996 | |||
| 1390 | Ga0495637_0147700 | |||
| 1391 | Ga0495637_0189056 | |||
| 1392 | Ga0495644_0212447 | |||
| 1393 | Ga0495663_0029066 | |||
| 1394 | Ga0495663_0105105 | |||
| 1395 | Ga0495666_0010004 | |||
| 1396 | Ga0495642_0103560 | |||
| 1397 | Ga0495642_0217650 | |||
| 1398 | Ga0495665_0363342 | |||
| 1399 | Ga0495586_0144677 | |||
| 1400 | Ga0495586_0711902 | |||
| 1401 | Ga0495609_0033263 | |||
| 1402 | Ga0495609_0224264 | |||
| 1403 | Ga0495597_0345877 | |||
| 1404 | Ga0495633_0275919 | |||
| 1405 | Ga0495667_0108890 | |||
| 1406 | Ga0495656_0015141 | |||
| 1407 | Ga0495634_0114695 | |||
| 1408 | Ga0495634_0169244 | |||
| 1409 | Ga0495611_0071276 | |||
| 1410 | Ga0495611_0342379 | |||
| 1411 | Ga0495635_0030577 | |||
| 1412 | Ga0495635_0382325 | |||
| 1413 | Ga0495659_0073210 | |||
| 1414 | Ga0495659_0088517 | |||
| 1415 | Ga0495659_0092832 | |||
| 1416 | Ga0495659_0290684 | |||
| 1417 | Ga0495588_0000593 | |||
| 1418 | Ga0495599_0439717 | |||
| 1419 | Ga0495647_0207729 | |||
| 1420 | Ga0495658_0031702 | |||
| 1421 | Ga0495658_0120186 | |||
| 1422 | Ga0495658_0168076 | |||
| 1423 | Ga0495613_0045348 | |||
| 1424 | Ga0495613_0243590 | |||
| 1425 | Ga0495624_0253259 | |||
| 1426 | Ga0495670_0242643 | |||
| 1427 | Ga0495671_0122795 | |||
| 1428 | Ga0495671_0361278 | |||
| 1429 | Ga0495589_0102170 | |||
| 1430 | Ga0495589_0217613 | |||
| 1431 | Ga0495600_0451967 | |||
| 1432 | Ga0495581_0117190 | |||
| 1433 | Ga0495581_0277175 | |||
| 1434 | Ga0495581_0320446 | |||
| 1435 | Ga0495581_0516794 | |||
| 1436 | Ga0495604_0040543 | |||
| 1437 | Ga0495604_0426549 | |||
| 1438 | Ga0495674_0185689 | |||
| 1439 | Ga0495676_0010464 | |||
| 1440 | Ga0495676_0197278 | |||
| 1441 | Ga0495676_0318250 | |||
| 1442 | Ga0495680_0013972 | |||
| 1443 | Ga0495680_0640816 | |||
| 1444 | Ga0495685_190189 | |||
| 1445 | Ga0495684_0013670 | |||
| 1446 | Ga0495593_0350724 | |||
| 1447 | Ga0495614_0105460 | |||
| 1448 | Ga0495626_0032364 | |||
| 1449 | Ga0495626_0218781 | |||
| 1450 | Ga0496100_0003214 | |||
| 1451 | Ga0496100_0090332 | |||
| 1452 | Ga0496100_0109615 | |||
| 1453 | Ga0496100_0121308 | |||
| 1454 | Ga0496100_0182097 | |||
| 1455 | Ga0496100_0344715 | |||
| 1456 | Ga0496100_0373406 | |||
| 1457 | Ga0496100_0562593 | |||
| 1458 | Ga0496100_1304378 | |||
| 1459 | Ga0496101_0044891 | |||
| 1460 | Ga0496101_0067083 | |||
| 1461 | Ga0496101_0135238 | |||
| 1462 | Ga0496101_0253793 | |||
| 1463 | Ga0496101_0275774 | |||
| 1464 | Ga0496101_0293443 | |||
| 1465 | Ga0496101_0318473 | |||
| 1466 | Ga0496101_0578447 | |||
| 1467 | Ga0496101_1151200 | |||
| 1468 | Ga0496102_0036741 | |||
| 1469 | Ga0496102_0066043 | |||
| 1470 | Ga0496102_0099542 | |||
| 1471 | Ga0496102_0116088 | |||
| 1472 | Ga0496102_0206405 | |||
| 1473 | Ga0496102_0322810 | |||
| 1474 | Ga0496102_0482285 | |||
| 1475 | Ga0496102_0646637 | |||
| 1476 | Ga0496102_1622627 | |||
| 1477 | Ga0496103_0010861 | |||
| 1478 | Ga0496103_0013718 | |||
| 1479 | Ga0496103_0137784 | |||
| 1480 | Ga0496103_0220419 | |||
| 1481 | Ga0496104_0000691 | |||
| 1482 | Ga0496104_0005998 | |||
| 1483 | Ga0496104_0008976 | |||
| 1484 | Ga0496104_0193589 | |||
| 1485 | Ga0496104_0254028 | |||
| 1486 | Ga0496104_0259501 | |||
| 1487 | Ga0496104_1286889 | |||
| 1488 | Ga0496105_0000461 | |||
| 1489 | Ga0496105_0014720 | |||
| 1490 | Ga0496105_0054983 | |||
| 1491 | Ga0496105_0122136 | |||
| 1492 | Ga0496105_0171030 | |||
| 1493 | Ga0496105_0263449 | |||
| 1494 | Ga0496105_0293996 | |||
| 1495 | Ga0496105_0900060 | |||
| 1496 | Ga0496105_0994269 | |||
| 1497 | Ga0496106_0045031 | |||
| 1498 | Ga0496106_0065786 | |||
| 1499 | Ga0496106_0087472 | |||
| 1500 | Ga0496106_0180210 | |||
| 1501 | Ga0496106_0257953 | |||
| 1502 | Ga0496106_0340087 | |||
| 1503 | Ga0496106_0455624 | |||
| 1504 | Ga0496106_0694052 | |||
| 1505 | Ga0496106_1127570 | |||
| 1506 | Ga0496107_0010138 | |||
| 1507 | Ga0496107_0036610 | |||
| 1508 | Ga0496107_0046241 | |||
| 1509 | Ga0496107_0116422 | |||
| 1510 | Ga0496107_0155101 | |||
| 1511 | Ga0496107_0229192 | |||
| 1512 | Ga0496107_0610129 | |||
| 1513 | Ga0496107_0672147 | |||
| 1514 | Ga0496107_1166180 | |||
| 1515 | Ga0496107_1316741 | |||
| 1516 | Ga0496108_0001323 | |||
| 1517 | Ga0496108_0003915 | |||
| 1518 | Ga0496108_0013726 | |||
| 1519 | Ga0496108_0019667 | |||
| 1520 | Ga0496108_0113185 | |||
| 1521 | Ga0496108_0146967 | |||
| 1522 | Ga0496108_0309214 | |||
| 1523 | Ga0496108_0557691 | |||
| 1524 | Ga0496108_0575062 | |||
| 1525 | Ga0496109_0005477 | |||
| 1526 | Ga0496109_0008325 | |||
| 1527 | Ga0496109_0013188 | |||
| 1528 | Ga0496109_0020970 | |||
| 1529 | Ga0496109_0036998 | |||
| 1530 | Ga0496109_0061986 | |||
| 1531 | Ga0496109_0107413 | |||
| 1532 | Ga0496109_0160241 | |||
| 1533 | Ga0496109_0252778 | |||
| 1534 | Ga0496109_0509487 | |||
| 1535 | Ga0496109_0997128 | |||
| 1536 | Ga0496110_0006101 | |||
| 1537 | Ga0496110_0009106 | |||
| 1538 | Ga0496110_0011009 | |||
| 1539 | Ga0496110_0040712 | |||
| 1540 | Ga0496110_0070203 | |||
| 1541 | Ga0496110_0111369 | |||
| 1542 | Ga0496110_0139557 | |||
| 1543 | Ga0496110_0290744 | |||
| 1544 | Ga0496110_0734081 | |||
| 1545 | Ga0496111_0000629 | |||
| 1546 | Ga0496111_0002084 | |||
| 1547 | Ga0496111_0002905 | |||
| 1548 | Ga0496111_0018597 | |||
| 1549 | Ga0496111_0036912 | |||
| 1550 | Ga0496111_0147026 | |||
| 1551 | Ga0496111_0149147 | |||
| 1552 | Ga0496111_0238613 | |||
| 1553 | Ga0496111_0584639 | |||
| 1554 | Ga0496111_0677624 | |||
| 1555 | Ga0496111_0963173 | |||
| 1556 | Ga0496112_0040259 | |||
| 1557 | Ga0496112_0049695 | |||
| 1558 | Ga0496112_0123624 | |||
| 1559 | Ga0496112_0151580 | |||
| 1560 | Ga0496112_0290197 | |||
| 1561 | Ga0496112_0519824 | |||
| 1562 | Ga0496112_0676071 | |||
| 1563 | Ga0496113_0000482 | |||
| 1564 | Ga0496113_0000824 | |||
| 1565 | Ga0496113_0005833 | |||
| 1566 | Ga0496113_0225871 | |||
| 1567 | Ga0496113_0262375 | |||
| 1568 | Ga0496113_0306786 | |||
| 1569 | Ga0496113_0309067 | |||
| 1570 | Ga0496113_0453870 | |||
| 1571 | Ga0496113_0664084 | |||
| 1572 | Ga0496114_0026337 | |||
| 1573 | Ga0496114_0037126 | |||
| 1574 | Ga0496114_0055889 | |||
| 1575 | Ga0496114_0062043 | |||
| 1576 | Ga0496114_0088737 | |||
| 1577 | Ga0496114_0164208 | |||
| 1578 | Ga0496114_0304168 | |||
| 1579 | Ga0496114_0358251 | |||
| 1580 | Ga0496114_0389116 | |||
| 1581 | Ga0496114_1012515 | |||
| 1582 | Ga0496115_0030776 | |||
| 1583 | Ga0496115_0032205 | |||
| 1584 | Ga0496115_0117129 | |||
| 1585 | Ga0496115_0127078 | |||
| 1586 | Ga0496115_0382969 | |||
| 1587 | Ga0496115_0603348 | |||
| 1588 | Ga0501033_0495019 | |||
| 1589 | Ga0501039_0237917 | |||
| 1590 | Ga0501040_0101489 | |||
| 1591 | Ga0501041_0135018 | |||
| 1592 | Ga0501042_0976362 | |||
| 1593 | Ga0501067_0001435 | |||
| 1594 | Ga0501067_0007672 | |||
| 1595 | Ga0501069_0004440 | |||
| 1596 | Ga0501070_0047802 | |||
| 1597 | Ga0501075_0346910 | |||
| 1598 | Ga0501076_0085801 | |||
| 1599 | Ga0501077_0436717 | |||
| 1600 | Ga0501079_0029543 | |||
| 1601 | Ga0501081_0506948 | |||
| 1602 | Ga0501081_1016398 | |||
| 1603 | Ga0501035_1106989 | |||
| 1604 | Ga0501045_0336982 | |||
| 1605 | nmdc:mga00v17_92768_c1 | |||
| 1606 | nmdc:mga05p37_16222_c1 | |||
| 1607 | nmdc:mga05p37_188115_c1 | |||
| 1608 | nmdc:mga05p37_372818_c1 | |||
| 1609 | nmdc:mga05p37_84240_c1 | |||
| 1610 | nmdc:mga09592_154687_c1 | |||
| 1611 | nmdc:mga0qj67_194801_c1 | |||
| 1612 | nmdc:mga06r32_157906_c1 | |||
| 1613 | nmdc:mga06r32_18439_c1 | |||
| 1614 | nmdc:mga08y16_29200_c1 | |||
| 1615 | nmdc:mga08y16_76524_c1 | |||
| 1616 | nmdc:mga08y16_983868_c1 | |||
| 1617 | nmdc:mga0n895_1310287_c1 | |||
| 1618 | nmdc:mga0n895_144480_c1 | |||
| 1619 | nmdc:mga0n895_1517041_c1 | |||
| 1620 | nmdc:mga0n895_40352_c1 | |||
| 1621 | nmdc:mga0n895_613495_c1 | |||
| 1622 | nmdc:mga0n895_63669_c1 | |||
| 1623 | nmdc:mga0rr50_1491177_c1 | |||
| 1624 | nmdc:mga0rr50_212956_c1 | |||
| 1625 | nmdc:mga0rr50_50390_c1 | |||
| 1626 | nmdc:mga08x19_128239_c1 | |||
| 1627 | nmdc:mga08x19_22358_c1 | |||
| 1628 | nmdc:mga08x19_457420_c1 | |||
| 1629 | nmdc:mga08x19_47800_c1 | |||
| 1630 | nmdc:mga08x19_57859_c1 | |||
| 1631 | nmdc:mga0a205_102183_c1 | |||
| 1632 | nmdc:mga0a205_198109_c1 | |||
| 1633 | nmdc:mga0a205_330520_c1 | |||
| 1634 | nmdc:mga0a205_509548_c1 | |||
| 1635 | nmdc:mga0a205_548452_c1 | |||
| 1636 | nmdc:mga0a205_82276_c1 | |||
| 1637 | Ga0495612_0057879 | |||
| 1638 | Ga0495619_0044323 | |||
| 1639 | Ga0495619_0190221 | |||
| 1640 | Ga0501084_0091319 | |||
| 1641 | Ga0501082_0044537 | |||
| 1642 | Ga0530510_0251173 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7chi-assembly1.cif.gz_A | crystal structure of pco5 | 0.8978 | 32 | 118 |
| 6sbp-assembly1.cif.gz_A | plant cysteine oxidase pco5 from arabidopsis thaliana | 0.8949 | 32 | 118 |
| 1juh-assembly2.cif.gz_D-2 | crystal structure of quercetin 2,3-dioxygenase | 0.8804 | 22 | 116 |
| 2phd-assembly1.cif.gz_C | crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans | 0.8725 | 36 | 121 |
| 7cxz-assembly1.cif.gz_A | crystal structure of pco2 | 0.8628 | 30 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53413_44_172_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8708 | 30 | 127 | 2.60.120.10 |
| af_Q55CL5_155_418_2.60.120.650 | Mainly Beta;Sandwich;Jelly Rolls;Cupin | 0.8707 | 41 | 117 | 2.60.120.650 |
| 2oa2A01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8656 | 32 | 118 | 2.60.120.10 |
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.861 | 27 | 127 | 2.60.120.10 |
| af_P24174_373_472_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.853 | 27 | 127 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5YPA6-F1-model_v4 | Cupin | 0.9649 | 22 | 128 |
|
| AF-A0A554J5D3-F1-model_v4 | Cupin | 0.9612 | 18 | 128 |
|
| AF-A0A2M8F5G2-F1-model_v4 | Cupin | 0.9583 | 17 | 131 |
GO:0005976
GO:0016779 |
| AF-A0A0G0AB51-F1-model_v4 | Cupin type-2 domain-containing protein | 0.958 | 21 | 127 |
|
| AF-A0A838NWA1-F1-model_v4 | Cupin | 0.9557 | 19 | 112 |
GO:0005976
GO:0016779 |