F482245

General Info

Members Datasets Scaffolds Average Seq Length
821 318 1642 135

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100740046|Ga0070683_1007400462
Length 141
Sequence VAEHDHLTSPNLGGLDKFAFEPERVDKPWGHELIWSKTDHYAGKILFVRAGESLSLQFHKAKDEAWYVLEGRAQLELGEPGERMLNSEVVGPGAAFHFPPGTVHRVTAVEDTTIVEVSTPQLDDIVRLEDLYGRTEPSGSD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
98 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
99 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
100 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
101 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
178 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
182 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
209 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
210 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
214 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
263 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
264 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
265 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
298 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
299 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
300 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.12
Nodule 0
Rhizoplane 17.17
Rhizosphere 81.97
Stem 0
Stem Tuber 0
Unclassified 14.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100740046 3300005329 Bacteria 942
2 Ga0070683_100267063 3300005329 Bacteria 1627
3 Ga0070683_100545148 3300005329 Bacteria 1109
4 Ga0068869_100165973 3300005334 Bacteria 1722
5 Ga0068869_100726161 3300005334 Bacteria 849
6 Ga0070666_10702206 3300005335 Bacteria 742
7 Ga0070680_100026187 3300005336 Bacteria 4664
8 Ga0070682_100005210 3300005337 Bacteria 7234
9 Ga0070682_100548731 3300005337 Unclassified 904
10 Ga0070682_100932828 3300005337 Bacteria 716
11 Ga0070682_101163983 3300005337 Bacteria 649
12 Ga0068868_100074827 3300005338 Bacteria 2705
13 Ga0068868_100300824 3300005338 Bacteria 1362
14 Ga0068868_100383510 3300005338 Unclassified 1210
15 Ga0068868_100523675 3300005338 Bacteria 1041
16 Ga0068868_100828183 3300005338 Bacteria 837
17 Ga0070660_100103805 3300005339 Bacteria 2254
18 Ga0070660_100420244 3300005339 Unclassified 1107
19 Ga0070689_100689952 3300005340 Bacteria 891
20 Ga0070691_10047492 3300005341 Bacteria 2041
21 Ga0070691_10204642 3300005341 Bacteria 1038
22 Ga0070691_10289851 3300005341 Bacteria 891
23 Ga0070691_10521214 3300005341 Bacteria 690
24 Ga0070687_100637460 3300005343 Unclassified 737
25 Ga0070692_10139509 3300005345 Bacteria 1370
26 Ga0070668_100068975 3300005347 Bacteria 2750
27 Ga0070668_101412016 3300005347 Bacteria 635
28 Ga0070669_100640230 3300005353 Bacteria 894
29 Ga0070675_100968028 3300005354 Unclassified 781
30 Ga0070671_100095584 3300005355 Bacteria 2490
31 Ga0070671_100200560 3300005355 Bacteria 1692
32 Ga0070671_100869311 3300005355 Bacteria 787
33 Ga0070674_100007606 3300005356 Bacteria 6400
34 Ga0070673_100350713 3300005364 Bacteria 1310
35 Ga0070673_101651438 3300005364 Bacteria 606
36 Ga0070688_100072160 3300005365 Bacteria 2212
37 Ga0070688_101341827 3300005365 Unclassified 578
38 Ga0070659_100276336 3300005366 Bacteria 1397
39 Ga0070667_101445520 3300005367 Bacteria 645
40 Ga0070709_10050586 3300005434 Bacteria 2604
41 Ga0070709_10452534 3300005434 Bacteria 967
42 Ga0070714_100080421 3300005435 Bacteria 2836
43 Ga0070713_100011514 3300005436 Bacteria 6444
44 Ga0070710_10114169 3300005437 Bacteria 1626
45 Ga0070710_10637570 3300005437 Unclassified 745
46 Ga0070710_10874223 3300005437 Bacteria 647
47 Ga0070701_10106209 3300005438 Bacteria 1563
48 Ga0070701_10322630 3300005438 Bacteria 956
49 Ga0070711_100060550 3300005439 Bacteria 2632
50 Ga0070711_100380442 3300005439 Bacteria 1141
51 Ga0070711_100514497 3300005439 Bacteria 988
52 Ga0070705_100042483 3300005440 Bacteria 2599
53 Ga0070705_100146360 3300005440 Bacteria 1561
54 Ga0070705_100184003 3300005440 Unclassified 1418
55 Ga0070705_100216701 3300005440 Bacteria 1323
56 Ga0070705_100261861 3300005440 Bacteria 1220
57 Ga0070700_100418715 3300005441 Unclassified 1012
58 Ga0070700_100739729 3300005441 Bacteria 786
59 Ga0070700_100897090 3300005441 Unclassified 722
60 Ga0070694_100191909 3300005444 Bacteria 1517
61 Ga0070694_100776921 3300005444 Bacteria 784
62 Ga0070694_100915099 3300005444 Bacteria 725
63 Ga0070708_100109717 3300005445 Bacteria 2535
64 Ga0070708_100139491 3300005445 Bacteria 2248
65 Ga0070708_100216023 3300005445 Bacteria 1797
66 Ga0070708_100628602 3300005445 Bacteria 1012
67 Ga0070663_100033839 3300005455 Bacteria 3533
68 Ga0070663_100909260 3300005455 Bacteria 761
69 Ga0070678_100021829 3300005456 Bacteria 4230
70 Ga0070678_100026985 3300005456 Bacteria 3892
71 Ga0070678_100144236 3300005456 Bacteria 1909
72 Ga0070662_100389084 3300005457 Bacteria 1149
73 Ga0070681_10347884 3300005458 Bacteria 1392
74 Ga0070681_10453453 3300005458 Bacteria 1195
75 Ga0068867_100192196 3300005459 Bacteria 1629
76 Ga0068867_100285411 3300005459 Bacteria 1355
77 Ga0068867_100518198 3300005459 Unclassified 1028
78 Ga0070685_10233153 3300005466 Bacteria 1212
79 Ga0070685_10292794 3300005466 Bacteria 1094
80 Ga0070706_100077589 3300005467 Bacteria 3075
81 Ga0070706_100166775 3300005467 Bacteria 2056
82 Ga0070707_100002890 3300005468 Bacteria 16317
83 Ga0070698_100509332 3300005471 Bacteria 1142
84 Ga0070699_100016998 3300005518 Bacteria 6245
85 Ga0070699_100385253 3300005518 Unclassified 1266
86 Ga0070679_100717711 3300005530 Bacteria 942
87 Ga0070684_100089612 3300005535 Bacteria 2734
88 Ga0070684_100161823 3300005535 Unclassified 2031
89 Ga0070684_100683005 3300005535 Bacteria 957
90 Ga0070684_100735907 3300005535 Unclassified 920
91 Ga0070697_100444839 3300005536 Bacteria 1128
92 Ga0068853_100218045 3300005539 Bacteria 1741
93 Ga0070686_100035454 3300005544 Bacteria 3081
94 Ga0070686_100045168 3300005544 Bacteria 2773
95 Ga0070686_100070849 3300005544 Bacteria 2281
96 Ga0070686_100205071 3300005544 Bacteria 1416
97 Ga0070695_100182494 3300005545 Bacteria 1488
98 Ga0070695_100217772 3300005545 Bacteria 1374
99 Ga0070695_100554131 3300005545 Bacteria 896
100 Ga0070696_100126398 3300005546 Bacteria 1855
101 Ga0070696_100157189 3300005546 Bacteria 1673
102 Ga0070696_100577874 3300005546 Bacteria 903
103 Ga0070693_100026866 3300005547 Bacteria 3111
104 Ga0070693_100161451 3300005547 Unclassified 1427
105 Ga0070693_100318260 3300005547 Bacteria 1055
106 Ga0070693_100349395 3300005547 Bacteria 1012
107 Ga0070704_100039620 3300005549 Bacteria 3236
108 Ga0070704_100285193 3300005549 Bacteria 1370
109 Ga0070704_100285850 3300005549 Bacteria 1368
110 Ga0070704_100390691 3300005549 Bacteria 1185
111 Ga0070704_100749052 3300005549 Bacteria 870
112 Ga0068855_100079024 3300005563 Bacteria 3816
113 Ga0068855_100294188 3300005563 Bacteria 1799
114 Ga0068855_101092806 3300005563 Unclassified 834
115 Ga0068855_101297672 3300005563 Bacteria 754
116 Ga0070664_100527095 3300005564 Bacteria 1091
117 Ga0068857_102292237 3300005577 Bacteria 530
118 Ga0068854_100036423 3300005578 Bacteria 3449
119 Ga0068854_100253812 3300005578 Bacteria 1405
120 Ga0068856_100046077 3300005614 Bacteria 4295
121 Ga0068856_100126149 3300005614 Bacteria 2563
122 Ga0068856_100140385 3300005614 Bacteria 2423
123 Ga0068856_100237066 3300005614 Bacteria 1840
124 Ga0068856_100257029 3300005614 Unclassified 1762
125 Ga0068856_100299808 3300005614 Bacteria 1625
126 Ga0068856_100387265 3300005614 Bacteria 1418
127 Ga0068856_100697625 3300005614 Unclassified 1035
128 Ga0068856_100752188 3300005614 Unclassified 995
129 Ga0068856_100874608 3300005614 Bacteria 918
130 Ga0068856_101249032 3300005614 Bacteria 759
131 Ga0070702_100128029 3300005615 Bacteria 1600
132 Ga0070702_100427226 3300005615 Unclassified 955
133 Ga0070702_100503936 3300005615 Bacteria 890
134 Ga0070702_100509175 3300005615 Bacteria 886
135 Ga0070702_100883216 3300005615 Bacteria 698
136 Ga0070702_100929241 3300005615 Bacteria 683
137 Ga0068852_100076766 3300005616 Bacteria 2951
138 Ga0068852_100662116 3300005616 Unclassified 1052
139 Ga0068852_101892947 3300005616 Unclassified 619
140 Ga0068859_101105985 3300005617 Bacteria 872
141 Ga0068864_100006361 3300005618 Bacteria 9681
142 Ga0068866_10012779 3300005718 Bacteria 3665
143 Ga0068861_100071272 3300005719 Bacteria 2694
144 Ga0068861_100190489 3300005719 Bacteria 1714
145 Ga0068861_100698532 3300005719 Unclassified 942
146 Ga0068860_100541731 3300005843 Unclassified 1165
147 Ga0068860_100649269 3300005843 Bacteria 1063
148 Ga0068862_101544924 3300005844 Unclassified 670
149 Ga0081455_10010868 3300005937 Bacteria 9188
150 Ga0081538_10013296 3300005981 Bacteria 6525
151 Ga0081538_10152030 3300005981 Unclassified 1046
152 Ga0081540_1002869 3300005983 Bacteria 13935
153 Ga0081540_1005145 3300005983 Bacteria 9794
154 Ga0081540_1005990 3300005983 Bacteria 8955
155 Ga0081540_1032816 3300005983 Bacteria 2828
156 Ga0070717_10182307 3300006028 Bacteria 1831
157 Ga0075432_10011677 3300006058 Bacteria 2984
158 Ga0075432_10433867 3300006058 Unclassified 573
159 Ga0070715_10003539 3300006163 Bacteria 4993
160 Ga0070716_100039912 3300006173 Bacteria 2608
161 Ga0070716_100176869 3300006173 Bacteria 1397
162 Ga0070712_100001448 3300006175 Bacteria 14472
163 Ga0070712_100167123 3300006175 Bacteria 1704
164 Ga0070712_100580089 3300006175 Unclassified 947
165 Ga0097621_100131929 3300006237 Bacteria 2127
166 Ga0068871_100052606 3300006358 Bacteria 3298
167 Ga0068871_100357099 3300006358 Bacteria 1294
168 Ga0068871_101616184 3300006358 Bacteria 614
169 Ga0075428_100114818 3300006844 Bacteria 2933
170 Ga0075428_100161542 3300006844 Bacteria 2432
171 Ga0075428_100200162 3300006844 Bacteria 2159
172 Ga0075428_100479860 3300006844 Bacteria 1331
173 Ga0075430_100204796 3300006846 Bacteria 1638
174 Ga0075431_100058228 3300006847 Bacteria 3986
175 Ga0075431_100168517 3300006847 Bacteria 2251
176 Ga0075433_10092243 3300006852 Bacteria 2679
177 Ga0075433_10139663 3300006852 Bacteria 2153
178 Ga0075434_100034001 3300006871 Bacteria 5032
179 Ga0075434_100149934 3300006871 Unclassified 2352
180 Ga0075434_101477584 3300006871 Bacteria 689
181 Ga0075429_100169058 3300006880 Bacteria 1915
182 Ga0068865_100617853 3300006881 Bacteria 918
183 Ga0068865_100694371 3300006881 Bacteria 869
184 Ga0075436_100022702 3300006914 Bacteria 4311
185 Ga0075436_100033630 3300006914 Bacteria 3534
186 Ga0097620_101105864 3300006931 Bacteria 872
187 Ga0075435_100062244 3300007076 Bacteria 3028
188 Ga0075435_100176245 3300007076 Bacteria 1805
189 Ga0075435_100259801 3300007076 Bacteria 1479
190 Ga0075435_100671315 3300007076 Unclassified 900
191 Ga0075435_101597206 3300007076 Bacteria 572
192 Ga0105250_10138900 3300009092 Bacteria 1006
193 Ga0105240_10840244 3300009093 Bacteria 992
194 Ga0111539_10118771 3300009094 Bacteria 3099
195 Ga0111539_10149472 3300009094 Bacteria 2734
196 Ga0111539_10199069 3300009094 Bacteria 2336
197 Ga0105245_10055857 3300009098 Bacteria 3548
198 Ga0105245_10102321 3300009098 Bacteria 2653
199 Ga0105245_10107226 3300009098 Bacteria 2593
200 Ga0105245_10203656 3300009098 Bacteria 1902
201 Ga0105245_10317102 3300009098 Bacteria 1535
202 Ga0105245_10443140 3300009098 Bacteria 1306
203 Ga0105245_10507900 3300009098 Bacteria 1222
204 Ga0105245_10525306 3300009098 Bacteria 1203
205 Ga0105245_10831924 3300009098 Bacteria 962
206 Ga0105245_11075154 3300009098 Bacteria 850
207 Ga0105245_11168189 3300009098 Unclassified 817
208 Ga0105245_11265635 3300009098 Bacteria 786
209 Ga0105245_12320505 3300009098 Bacteria 590
210 Ga0105247_10172440 3300009101 Unclassified 1439
211 Ga0114129_10075826 3300009147 Bacteria 4682
212 Ga0114129_10291610 3300009147 Bacteria 2177
213 Ga0114129_10478556 3300009147 Bacteria 1629
214 Ga0114129_13278393 3300009147 Unclassified 524
215 Ga0105243_10170512 3300009148 Bacteria 1884
216 Ga0105243_10247456 3300009148 Bacteria 1590
217 Ga0105243_10305771 3300009148 Bacteria 1443
218 Ga0105243_13077318 3300009148 Bacteria 505
219 Ga0105241_10058235 3300009174 Bacteria 2967
220 Ga0105241_10165411 3300009174 Bacteria 1822
221 Ga0105241_10614632 3300009174 Bacteria 983
222 Ga0105241_11530050 3300009174 Unclassified 643
223 Ga0105242_10107242 3300009176 Bacteria 2375
224 Ga0105242_11098762 3300009176 Bacteria 809
225 Ga0105242_11468929 3300009176 Bacteria 711
226 Ga0105248_10134958 3300009177 Bacteria 2784
227 Ga0105248_10284959 3300009177 Bacteria 1860
228 Ga0105237_10541140 3300009545 Bacteria 1171
229 Ga0105249_10100526 3300009553 Bacteria 2719
230 Ga0105249_10199156 3300009553 Bacteria 1959
231 Ga0105239_10002262 3300010375 Bacteria 24597
232 Ga0105239_10087483 3300010375 Bacteria 3435
233 Ga0105239_10348013 3300010375 Bacteria 1673
234 Ga0105239_10373952 3300010375 Bacteria 1611
235 Ga0105239_10379239 3300010375 Unclassified 1599
236 Ga0105239_10556642 3300010375 Unclassified 1306
237 Ga0105239_10888297 3300010375 Bacteria 1023
238 Ga0105246_10157419 3300011119 Bacteria 1727
239 Ga0105246_10359797 3300011119 Bacteria 1195
240 Ga0105246_11122104 3300011119 Bacteria 719
241 Ga0105246_12207574 3300011119 Unclassified 536
242 Ga0157344_1009418 3300012476 Bacteria 686
243 Ga0157318_1035160 3300012482 Bacteria 513
244 Ga0157313_1037265 3300012503 Unclassified 581
245 Ga0157342_1001550 3300012507 Bacteria 1729
246 Ga0157315_1001278 3300012508 Bacteria 1370
247 Ga0157316_1012217 3300012510 Unclassified 819
248 Ga0157373_10378629 3300013100 Bacteria 1012
249 Ga0157371_10249658 3300013102 Bacteria 1277
250 Ga0157371_10285615 3300013102 Bacteria 1192
251 Ga0157369_10479026 3300013105 Bacteria 1288
252 Ga0157369_11112337 3300013105 Bacteria 807
253 Ga0157374_10238811 3300013296 Bacteria 1787
254 Ga0157374_10365699 3300013296 Bacteria 1435
255 Ga0157374_10439528 3300013296 Unclassified 1305
256 Ga0157378_10293624 3300013297 Bacteria 1571
257 Ga0157378_11468937 3300013297 Unclassified 726
258 Ga0157378_11991827 3300013297 Bacteria 631
259 Ga0163162_10506311 3300013306 Bacteria 1338
260 Ga0163162_10660634 3300013306 Bacteria 1168
261 Ga0157372_10086115 3300013307 Bacteria 3565
262 Ga0157372_10443795 3300013307 Bacteria 1512
263 Ga0157375_10705261 3300013308 Bacteria 1163
264 Ga0157375_11178116 3300013308 Unclassified 898
265 Ga0157375_12413503 3300013308 Bacteria 627
266 Ga0157380_10622991 3300014326 Bacteria 1071
267 Ga0157380_11326568 3300014326 Bacteria 768
268 Ga0182008_10541319 3300014497 Unclassified 646
269 Ga0157377_10193828 3300014745 Bacteria 1286
270 Ga0157377_10240837 3300014745 Bacteria 1167
271 Ga0157377_10462584 3300014745 Bacteria 878
272 Ga0157377_10485947 3300014745 Bacteria 860
273 Ga0157379_10882668 3300014968 Bacteria 847
274 Ga0157379_11709785 3300014968 Bacteria 616
275 Ga0157376_10013794 3300014969 Bacteria 6041
276 Ga0157376_10468316 3300014969 Bacteria 1232
277 Ga0157376_11138719 3300014969 Unclassified 807
278 Ga0157376_12847151 3300014969 Bacteria 523
279 Ga0182005_1234199 3300015265 Bacteria 563
280 Ga0163161_10075444 3300017792 Bacteria 2474
281 Ga0163161_10162626 3300017792 Bacteria 1703
282 Ga0207653_10002267 3300025885 Bacteria 6130
283 Ga0207692_10034562 3300025898 Bacteria 2448
284 Ga0207692_10367199 3300025898 Bacteria 890
285 Ga0207642_10332470 3300025899 Bacteria 891
286 Ga0207642_10403976 3300025899 Bacteria 818
287 Ga0207688_10010459 3300025901 Bacteria 5049
288 Ga0207688_10145769 3300025901 Bacteria 1396
289 Ga0207688_10312358 3300025901 Unclassified 963
290 Ga0207680_10696563 3300025903 Bacteria 728
291 Ga0207685_10034862 3300025905 Bacteria 1832
292 Ga0207685_10176249 3300025905 Unclassified 988
293 Ga0207699_10024753 3300025906 Bacteria 3286
294 Ga0207699_10392304 3300025906 Bacteria 987
295 Ga0207699_10768194 3300025906 Bacteria 707
296 Ga0207684_10089332 3300025910 Bacteria 2625
297 Ga0207684_10271671 3300025910 Bacteria 1462
298 Ga0207684_10323725 3300025910 Bacteria 1328
299 Ga0207684_10332016 3300025910 Bacteria 1310
300 Ga0207654_10019978 3300025911 Bacteria 3544
301 Ga0207654_10085953 3300025911 Bacteria 1905
302 Ga0207654_10153424 3300025911 Bacteria 1481
303 Ga0207654_10438445 3300025911 Bacteria 914
304 Ga0207654_11326134 3300025911 Unclassified 525
305 Ga0207707_10164771 3300025912 Bacteria 1937
306 Ga0207695_11732908 3300025913 Bacteria 506
307 Ga0207671_10439711 3300025914 Bacteria 1038
308 Ga0207693_10003258 3300025915 Bacteria 13908
309 Ga0207693_10016686 3300025915 Bacteria 5865
310 Ga0207693_10023595 3300025915 Bacteria 4883
311 Ga0207693_10463445 3300025915 Unclassified 990
312 Ga0207693_10557737 3300025915 Bacteria 893
313 Ga0207663_10216561 3300025916 Bacteria 1391
314 Ga0207663_10406435 3300025916 Unclassified 1042
315 Ga0207663_10554707 3300025916 Bacteria 899
316 Ga0207663_11101640 3300025916 Bacteria 638
317 Ga0207660_10052797 3300025917 Bacteria 2895
318 Ga0207662_10062127 3300025918 Bacteria 2244
319 Ga0207662_10310224 3300025918 Bacteria 1051
320 Ga0207657_10274257 3300025919 Bacteria 1340
321 Ga0207657_10342606 3300025919 Bacteria 1179
322 Ga0207657_10560065 3300025919 Bacteria 893
323 Ga0207652_10654083 3300025921 Bacteria 940
324 Ga0207652_10712116 3300025921 Bacteria 895
325 Ga0207652_11240382 3300025921 Unclassified 648
326 Ga0207646_10005641 3300025922 Bacteria 13142
327 Ga0207646_10828848 3300025922 Bacteria 823
328 Ga0207646_10932616 3300025922 Bacteria 769
329 Ga0207681_10298433 3300025923 Bacteria 1274
330 Ga0207681_10734793 3300025923 Bacteria 822
331 Ga0207659_11329250 3300025926 Unclassified 617
332 Ga0207687_10008937 3300025927 Bacteria 6551
333 Ga0207687_10034193 3300025927 Bacteria 3451
334 Ga0207687_10081889 3300025927 Bacteria 2334
335 Ga0207687_10173663 3300025927 Unclassified 1664
336 Ga0207687_10184139 3300025927 Bacteria 1620
337 Ga0207687_10612232 3300025927 Unclassified 919
338 Ga0207687_10633164 3300025927 Bacteria 904
339 Ga0207687_11334270 3300025927 Bacteria 617
340 Ga0207687_11809894 3300025927 Bacteria 523
341 Ga0207700_10081985 3300025928 Bacteria 2521
342 Ga0207700_10541352 3300025928 Unclassified 1033
343 Ga0207700_10639192 3300025928 Bacteria 948
344 Ga0207664_10034046 3300025929 Bacteria 3920
345 Ga0207664_10498541 3300025929 Bacteria 1090
346 Ga0207664_10902345 3300025929 Bacteria 793
347 Ga0207644_10191243 3300025931 Bacteria 1609
348 Ga0207644_10203613 3300025931 Bacteria 1562
349 Ga0207644_10731854 3300025931 Unclassified 826
350 Ga0207644_10934569 3300025931 Bacteria 727
351 Ga0207690_10246339 3300025932 Bacteria 1378
352 Ga0207706_10006582 3300025933 Bacteria 10762
353 Ga0207706_10120049 3300025933 Bacteria 2311
354 Ga0207706_10124435 3300025933 Bacteria 2268
355 Ga0207706_10497796 3300025933 Unclassified 1052
356 Ga0207686_10077351 3300025934 Bacteria 2160
357 Ga0207686_10304448 3300025934 Unclassified 1185
358 Ga0207669_10031588 3300025937 Bacteria 2961
359 Ga0207669_10452570 3300025937 Unclassified 1018
360 Ga0207704_10209002 3300025938 Bacteria 1435
361 Ga0207704_11121996 3300025938 Bacteria 669
362 Ga0207665_10006431 3300025939 Bacteria 7794
363 Ga0207665_10202830 3300025939 Bacteria 1446
364 Ga0207691_11194161 3300025940 Bacteria 631
365 Ga0207711_10184795 3300025941 Bacteria 1897
366 Ga0207689_10274759 3300025942 Bacteria 1395
367 Ga0207689_10799655 3300025942 Bacteria 796
368 Ga0207661_10023679 3300025944 Bacteria 4643
369 Ga0207661_10169070 3300025944 Bacteria 1902
370 Ga0207661_10568464 3300025944 Bacteria 1039
371 Ga0207679_10642931 3300025945 Bacteria 959
372 Ga0207679_11136117 3300025945 Unclassified 717
373 Ga0207667_10563579 3300025949 Bacteria 1151
374 Ga0207667_10812749 3300025949 Bacteria 931
375 Ga0207651_10732150 3300025960 Bacteria 873
376 Ga0207651_11125852 3300025960 Bacteria 704
377 Ga0207712_10180922 3300025961 Bacteria 1656
378 Ga0207712_10259849 3300025961 Bacteria 1408
379 Ga0207668_10066832 3300025972 Bacteria 2550
380 Ga0207668_10083028 3300025972 Bacteria 2330
381 Ga0207668_10317316 3300025972 Bacteria 1292
382 Ga0207668_11077111 3300025972 Bacteria 720
383 Ga0207640_10417253 3300025981 Bacteria 1097
384 Ga0207640_10463062 3300025981 Bacteria 1048
385 Ga0207640_11528928 3300025981 Bacteria 600
386 Ga0207658_10816883 3300025986 Bacteria 847
387 Ga0207677_10021982 3300026023 Bacteria 3911
388 Ga0207677_10043802 3300026023 Bacteria 2978
389 Ga0207677_10121039 3300026023 Bacteria 1969
390 Ga0207677_10202825 3300026023 Bacteria 1578
391 Ga0207677_10450911 3300026023 Unclassified 1102
392 Ga0207677_10473254 3300026023 Bacteria 1078
393 Ga0207677_10977451 3300026023 Bacteria 767
394 Ga0207639_10586447 3300026041 Unclassified 1027
395 Ga0207678_10056600 3300026067 Bacteria 3375
396 Ga0207708_10089216 3300026075 Bacteria 2376
397 Ga0207708_10189280 3300026075 Unclassified 1637
398 Ga0207708_10399988 3300026075 Unclassified 1136
399 Ga0207708_10471574 3300026075 Bacteria 1048
400 Ga0207708_10491787 3300026075 Unclassified 1027
401 Ga0207702_10003331 3300026078 Bacteria 14752
402 Ga0207702_10025176 3300026078 Bacteria 4938
403 Ga0207702_10143483 3300026078 Bacteria 2164
404 Ga0207702_10232830 3300026078 Bacteria 1722
405 Ga0207702_10233389 3300026078 Bacteria 1720
406 Ga0207702_10495551 3300026078 Bacteria 1190
407 Ga0207702_10657008 3300026078 Bacteria 1031
408 Ga0207702_11763724 3300026078 Unclassified 611
409 Ga0207641_10795959 3300026088 Bacteria 935
410 Ga0207648_10233978 3300026089 Bacteria 1635
411 Ga0207648_10747930 3300026089 Bacteria 908
412 Ga0207676_10163075 3300026095 Bacteria 1933
413 Ga0207676_10206161 3300026095 Bacteria 1741
414 Ga0207675_100010489 3300026118 Bacteria 8680
415 Ga0207675_100051713 3300026118 Bacteria 3834
416 Ga0207675_100184215 3300026118 Bacteria 2001
417 Ga0207675_100261354 3300026118 Bacteria 1678
418 Ga0207683_10001564 3300026121 Bacteria 20602
419 Ga0207683_10015964 3300026121 Bacteria 6390
420 Ga0207683_10052737 3300026121 Bacteria 3564
421 Ga0207683_10109858 3300026121 Bacteria 2468
422 Ga0207683_10124400 3300026121 Bacteria 2317
423 Ga0207698_11706250 3300026142 Unclassified 645
424 Ga0207428_10028629 3300027907 Bacteria 4626
425 Ga0207428_10092776 3300027907 Bacteria 2343
426 Ga0268266_10408063 3300028379 Bacteria 1286
427 Ga0268265_10300699 3300028380 Bacteria 1445
428 Ga0268265_10676350 3300028380 Bacteria 995
429 Ga0268264_10141325 3300028381 Bacteria 2147
430 Ga0268264_11485199 3300028381 Unclassified 688
431 Ga0307406_10958572 3300031901 Bacteria 732
432 Ga0307409_100021055 3300031995 Bacteria 4462
433 Ga0307409_101251432 3300031995 Bacteria 766
434 Ga0373948_0003747 3300034817 Bacteria 2361
435 Ga0373948_0023525 3300034817 Bacteria 1196
436 Ga0373950_0013056 3300034818 Bacteria 1380
437 Ga0373959_0001309 3300034820 Bacteria 3986
438 Ga0373929_0016125 3300035085 Bacteria 1460
439 Ga0373944_0001746 3300035089 Bacteria 5490
440 Ga0373951_0033269 3300035091 Bacteria 1221
441 Ga0373952_0028850 3300035092 Bacteria 1219
442 Ga0373932_0002286 3300035112 Bacteria 4892
443 Ga0373939_0021651 3300035114 Bacteria 1762
444 Ga0373941_0004204 3300035115 Bacteria 3309
445 Ga0373941_0062465 3300035115 Bacteria 1216
446 Ga0373945_0021197 3300035116 Bacteria 2231
447 Ga0373960_0062071 3300035121 Unclassified 1136
448 Ga0373960_0130761 3300035121 Bacteria 842
449 Ga0373960_0244146 3300035121 Bacteria 650
450 Ga0373960_0297953 3300035121 Unclassified 599
451 Ga0373943_0012098 3300035170 Bacteria 3887
452 Ga0373943_0016415 3300035170 Bacteria 3376
453 Ga0373943_0091830 3300035170 Bacteria 1574
454 Ga0373946_0011220 3300035171 Bacteria 3337
455 Ga0373942_0003344 3300035207 Bacteria 3768
456 Ga0373961_0027354 3300035241 Bacteria 1565
457 Ga0373961_0151351 3300035241 Bacteria 791
458 Ga0373961_0235255 3300035241 Bacteria 658
459 Ga0373962_0001222 3300035242 Bacteria 6011
460 Ga0373962_0035842 3300035242 Bacteria 1379
461 Ga0373962_0136426 3300035242 Unclassified 794
462 Ga0373931_0005617 3300035691 Bacteria 5817
463 Ga0373931_0954803 3300035691 Unclassified 578
464 Ga0373935_0063069 3300035692 Bacteria 2375
465 Ga0373927_0112159 3300035695 Bacteria 1777
466 Ga0373947_0742237 3300035725 Bacteria 670
467 Ga0373947_1047789 3300035725 Bacteria 556
468 Ga0373937_1451342 3300036401 Bacteria 634
469 Ga0373925_0008644 3300037068 Bacteria 7419
470 Ga0373925_1617245 3300037068 Bacteria 529
471 Ga0395899_0013881 3300037312 Bacteria 6153
472 Ga0395899_0014669 3300037312 Bacteria 5980
473 Ga0395899_0020994 3300037312 Bacteria 4952
474 Ga0395899_0040840 3300037312 Bacteria 3468
475 Ga0395899_0135891 3300037312 Bacteria 1753
476 Ga0395899_0357429 3300037312 Bacteria 975
477 Ga0395900_0002868 3300037418 Bacteria 18789
478 Ga0395900_0007646 3300037418 Bacteria 11156
479 Ga0395900_0009226 3300037418 Bacteria 10115
480 Ga0395900_0009682 3300037418 Bacteria 9874
481 Ga0395900_0023295 3300037418 Bacteria 6337
482 Ga0395900_0055351 3300037418 Bacteria 4085
483 Ga0395900_0106826 3300037418 Bacteria 2875
484 Ga0395900_0398830 3300037418 Archaea 1340
485 Ga0395900_0544970 3300037418 Bacteria 1105
486 Ga0395900_0611361 3300037418 Bacteria 1029
487 Ga0395898_0005218 3300037466 Bacteria 14046
488 Ga0395898_0005707 3300037466 Bacteria 13412
489 Ga0395898_0019062 3300037466 Bacteria 6984
490 Ga0395898_0050276 3300037466 Bacteria 4081
491 Ga0395898_0152751 3300037466 Bacteria 2208
492 Ga0395898_0156190 3300037466 Bacteria 2182
493 Ga0395898_0242054 3300037466 Bacteria 1721
494 Ga0395898_0362724 3300037466 Bacteria 1381
495 Ga0395898_1114386 3300037466 Unclassified 722
496 Ga0395898_1302933 3300037466 Bacteria 656
497 Ga0395898_1833367 3300037466 Bacteria 527
498 Ga0395905_0004667 3300037471 Bacteria 14165
499 Ga0395905_0005067 3300037471 Bacteria 13558
500 Ga0395905_0013993 3300037471 Bacteria 7675
501 Ga0395905_0050733 3300037471 Bacteria 3886
502 Ga0395905_0371028 3300037471 Bacteria 1324
503 Ga0395905_0388259 3300037471 Bacteria 1290
504 Ga0395901_0001467 3300038443 Bacteria 24537
505 Ga0395901_0002218 3300038443 Bacteria 19814
506 Ga0395901_0004922 3300038443 Bacteria 13479
507 Ga0395901_0014011 3300038443 Bacteria 8159
508 Ga0395901_0068095 3300038443 Bacteria 3708
509 Ga0395901_0186855 3300038443 Bacteria 2173
510 Ga0395901_0444246 3300038443 Bacteria 1327
511 Ga0395901_0560752 3300038443 Bacteria 1156
512 Ga0395901_0688421 3300038443 Unclassified 1021
513 Ga0395901_0896028 3300038443 Bacteria 869
514 Ga0395901_1013852 3300038443 Bacteria 805
515 Ga0242420_049735 3300038996 Bacteria 817
516 Ga0451789_0844947 3300041443 Bacteria 774
517 Ga0451789_0956241 3300041443 Unclassified 566
518 Ga0451800_1214126 3300041459 Bacteria 1233
519 Ga0451835_0290872 3300041492 Unclassified 708
520 Ga0451845_0264688 3300041501 Bacteria 952
521 Ga0451849_0081608 3300041505 Bacteria 546
522 Ga0451853_0253187 3300041512 Bacteria 755
523 Ga0451853_0365477 3300041512 Bacteria 2172
524 Ga0451853_0483074 3300041512 Bacteria 1053
525 Ga0439448_0002532 3300042005 Bacteria 4983
526 Ga0439448_0091367 3300042005 Bacteria 1029
527 Ga0439451_103669 3300042009 Bacteria 575
528 Ga0439459_0002855 3300042438 Bacteria 2699
529 Ga0439459_0209576 3300042438 Bacteria 535
530 Ga0451577_0361510 3300042876 Bacteria 1317
531 Ga0466964_0009047 3300044706 Bacteria 3745
532 Ga0466968_0043202 3300044735 Bacteria 1907
533 Ga0466968_0054892 3300044735 Bacteria 1709
534 Ga0466968_0090875 3300044735 Bacteria 1352
535 Ga0466960_0060428 3300044901 Bacteria 1857
536 Ga0451576_0018528 3300045051 Bacteria 7628
537 Ga0451576_0344773 3300045051 Bacteria 1560
538 Ga0451576_0543359 3300045051 Unclassified 1221
539 Ga0451576_1924695 3300045051 Bacteria 610
540 Ga0466967_0000180 3300045976 Bacteria 26156
541 Ga0495603_0011814 3300046455 Bacteria 5284
542 Ga0495603_0054247 3300046455 Bacteria 2376
543 Ga0495603_0083994 3300046455 Unclassified 1865
544 Ga0495603_0227647 3300046455 Bacteria 1075
545 Ga0495629_0005704 3300046459 Bacteria 9296
546 Ga0495629_0347001 3300046459 Bacteria 1013
547 Ga0495629_0436116 3300046459 Unclassified 888
548 Ga0495641_0007540 3300046461 Bacteria 6776
549 Ga0495641_0011893 3300046461 Bacteria 4913
550 Ga0495641_0136373 3300046461 Bacteria 1096
551 Ga0495651_0237773 3300046462 Bacteria 1251
552 Ga0495580_0263158 3300046472 Bacteria 1179
553 Ga0495582_0248184 3300046473 Unclassified 1021
554 Ga0495605_0157707 3300046474 Bacteria 1009
555 Ga0495605_0298179 3300046474 Unclassified 682
556 Ga0495639_0090500 3300046475 Bacteria 1435
557 Ga0495639_0428555 3300046475 Bacteria 670
558 Ga0495639_0484877 3300046475 Unclassified 630
559 Ga0495662_0140959 3300046476 Unclassified 1187
560 Ga0495584_0218922 3300046491 Bacteria 968
561 Ga0495594_0030692 3300046499 Bacteria 2910
562 Ga0495594_0201424 3300046499 Unclassified 1135
563 Ga0495596_0148898 3300046500 Bacteria 909
564 Ga0495607_0060439 3300046501 Bacteria 2157
565 Ga0495607_0212593 3300046501 Bacteria 951
566 Ga0495616_0281572 3300046513 Bacteria 707
567 Ga0495630_1404652 3300046517 Unclassified 525
568 Ga0495631_0350996 3300046518 Unclassified 628
569 Ga0495637_0147700 3300046520 Bacteria 889
570 Ga0495637_0189056 3300046520 Unclassified 761
571 Ga0495644_0212447 3300046523 Bacteria 747
572 Ga0495663_0029066 3300046525 Bacteria 1630
573 Ga0495663_0105105 3300046525 Unclassified 934
574 Ga0495666_0010004 3300046526 Bacteria 4737
575 Ga0495642_0103560 3300046528 Bacteria 1213
576 Ga0495642_0217650 3300046528 Bacteria 834
577 Ga0495665_0363342 3300046531 Bacteria 736
578 Ga0495586_0144677 3300046535 Unclassified 1336
579 Ga0495586_0711902 3300046535 Unclassified 580
580 Ga0495609_0033263 3300046538 Bacteria 2341
581 Ga0495609_0224264 3300046538 Bacteria 780
582 Ga0495597_0345877 3300046542 Bacteria 571
583 Ga0495633_0275919 3300046558 Bacteria 765
584 Ga0495667_0108890 3300046559 Bacteria 1790
585 Ga0495656_0015141 3300046615 Bacteria 2906
586 Ga0495634_0114695 3300046642 Bacteria 1730
587 Ga0495634_0169244 3300046642 Bacteria 1374
588 Ga0495611_0071276 3300046648 Bacteria 1589
589 Ga0495611_0342379 3300046648 Bacteria 687
590 Ga0495635_0030577 3300046663 Bacteria 3742
591 Ga0495635_0382325 3300046663 Unclassified 937
592 Ga0495659_0073210 3300046664 Bacteria 1288
593 Ga0495659_0088517 3300046664 Bacteria 1186
594 Ga0495659_0092832 3300046664 Bacteria 1161
595 Ga0495659_0290684 3300046664 Unclassified 689
596 Ga0495588_0000593 3300046674 Bacteria 17177
597 Ga0495599_0439717 3300046678 Bacteria 773
598 Ga0495647_0207729 3300046681 Bacteria 861
599 Ga0495658_0031702 3300046683 Bacteria 2881
600 Ga0495658_0120186 3300046683 Bacteria 1588
601 Ga0495658_0168076 3300046683 Bacteria 1356
602 Ga0495613_0045348 3300046689 Bacteria 3252
603 Ga0495613_0243590 3300046689 Unclassified 1256
604 Ga0495624_0253259 3300046690 Bacteria 1065
605 Ga0495670_0242643 3300046691 Bacteria 959
606 Ga0495671_0122795 3300046692 Bacteria 1267
607 Ga0495671_0361278 3300046692 Bacteria 696
608 Ga0495589_0102170 3300046794 Bacteria 1387
609 Ga0495589_0217613 3300046794 Bacteria 898
610 Ga0495600_0451967 3300046809 Bacteria 794
611 Ga0495581_0117190 3300047315 Bacteria 1549
612 Ga0495581_0277175 3300047315 Bacteria 980
613 Ga0495581_0320446 3300047315 Unclassified 906
614 Ga0495581_0516794 3300047315 Bacteria 694
615 Ga0495604_0040543 3300047317 Bacteria 3656
616 Ga0495604_0426549 3300047317 Bacteria 870
617 Ga0495674_0185689 3300047319 Bacteria 1730
618 Ga0495676_0010464 3300047321 Bacteria 8412
619 Ga0495676_0197278 3300047321 Bacteria 1400
620 Ga0495676_0318250 3300047321 Bacteria 1046
621 Ga0495680_0013972 3300047322 Bacteria 6980
622 Ga0495680_0640816 3300047322 Bacteria 707
623 Ga0495685_190189 3300047447 Bacteria 660
624 Ga0495684_0013670 3300047471 Bacteria 6252
625 Ga0495593_0350724 3300047673 Bacteria 737
626 Ga0495614_0105460 3300048089 Bacteria 1235
627 Ga0495626_0032364 3300048091 Bacteria 2512
628 Ga0495626_0218781 3300048091 Bacteria 775
629 Ga0496100_0003214 3300048903 Bacteria 8481
630 Ga0496100_0090332 3300048903 Bacteria 2088
631 Ga0496100_0109615 3300048903 Bacteria 1915
632 Ga0496100_0121308 3300048903 Bacteria 1829
633 Ga0496100_0182097 3300048903 Bacteria 1520
634 Ga0496100_0344715 3300048903 Bacteria 1124
635 Ga0496100_0373406 3300048903 Bacteria 1082
636 Ga0496100_0562593 3300048903 Bacteria 883
637 Ga0496100_1304378 3300048903 Bacteria 573
638 Ga0496101_0044891 3300048904 Bacteria 3163
639 Ga0496101_0067083 3300048904 Bacteria 2619
640 Ga0496101_0135238 3300048904 Bacteria 1875
641 Ga0496101_0253793 3300048904 Bacteria 1371
642 Ga0496101_0275774 3300048904 Bacteria 1313
643 Ga0496101_0293443 3300048904 Bacteria 1272
644 Ga0496101_0318473 3300048904 Bacteria 1220
645 Ga0496101_0578447 3300048904 Bacteria 888
646 Ga0496101_1151200 3300048904 Bacteria 608
647 Ga0496102_0036741 3300048905 Bacteria 4414
648 Ga0496102_0066043 3300048905 Bacteria 3316
649 Ga0496102_0099542 3300048905 Bacteria 2699
650 Ga0496102_0116088 3300048905 Bacteria 2498
651 Ga0496102_0206405 3300048905 Bacteria 1852
652 Ga0496102_0322810 3300048905 Bacteria 1454
653 Ga0496102_0482285 3300048905 Bacteria 1161
654 Ga0496102_0646637 3300048905 Bacteria 981
655 Ga0496102_1622627 3300048905 Bacteria 565
656 Ga0496103_0010861 3300048906 Bacteria 5389
657 Ga0496103_0013718 3300048906 Bacteria 4808
658 Ga0496103_0137784 3300048906 Bacteria 1560
659 Ga0496103_0220419 3300048906 Bacteria 1220
660 Ga0496104_0000691 3300048907 Bacteria 29022
661 Ga0496104_0005998 3300048907 Bacteria 10647
662 Ga0496104_0008976 3300048907 Bacteria 8890
663 Ga0496104_0193589 3300048907 Bacteria 1945
664 Ga0496104_0254028 3300048907 Bacteria 1671
665 Ga0496104_0259501 3300048907 Unclassified 1651
666 Ga0496104_1286889 3300048907 Bacteria 634
667 Ga0496105_0000461 3300048908 Bacteria 26731
668 Ga0496105_0014720 3300048908 Bacteria 6227
669 Ga0496105_0054983 3300048908 Bacteria 3286
670 Ga0496105_0122136 3300048908 Bacteria 2147
671 Ga0496105_0171030 3300048908 Bacteria 1781
672 Ga0496105_0263449 3300048908 Bacteria 1393
673 Ga0496105_0293996 3300048908 Bacteria 1307
674 Ga0496105_0900060 3300048908 Unclassified 667
675 Ga0496105_0994269 3300048908 Bacteria 628
676 Ga0496106_0045031 3300048909 Bacteria 3313
677 Ga0496106_0065786 3300048909 Bacteria 2760
678 Ga0496106_0087472 3300048909 Bacteria 2401
679 Ga0496106_0180210 3300048909 Bacteria 1677
680 Ga0496106_0257953 3300048909 Unclassified 1395
681 Ga0496106_0340087 3300048909 Bacteria 1205
682 Ga0496106_0455624 3300048909 Unclassified 1027
683 Ga0496106_0694052 3300048909 Bacteria 811
684 Ga0496106_1127570 3300048909 Bacteria 614
685 Ga0496107_0010138 3300048910 Bacteria 6536
686 Ga0496107_0036610 3300048910 Bacteria 3519
687 Ga0496107_0046241 3300048910 Bacteria 3132
688 Ga0496107_0116422 3300048910 Bacteria 1967
689 Ga0496107_0155101 3300048910 Bacteria 1695
690 Ga0496107_0229192 3300048910 Bacteria 1382
691 Ga0496107_0610129 3300048910 Unclassified 806
692 Ga0496107_0672147 3300048910 Bacteria 763
693 Ga0496107_1166180 3300048910 Bacteria 555
694 Ga0496107_1316741 3300048910 Bacteria 516
695 Ga0496108_0001323 3300048911 Bacteria 19467
696 Ga0496108_0003915 3300048911 Bacteria 11958
697 Ga0496108_0013726 3300048911 Bacteria 6610
698 Ga0496108_0019667 3300048911 Bacteria 5546
699 Ga0496108_0113185 3300048911 Bacteria 2322
700 Ga0496108_0146967 3300048911 Bacteria 2032
701 Ga0496108_0309214 3300048911 Bacteria 1377
702 Ga0496108_0557691 3300048911 Bacteria 999
703 Ga0496108_0575062 3300048911 Bacteria 982
704 Ga0496109_0005477 3300048912 Bacteria 10621
705 Ga0496109_0008325 3300048912 Bacteria 8805
706 Ga0496109_0013188 3300048912 Bacteria 7153
707 Ga0496109_0020970 3300048912 Bacteria 5776
708 Ga0496109_0036998 3300048912 Bacteria 4408
709 Ga0496109_0061986 3300048912 Bacteria 3419
710 Ga0496109_0107413 3300048912 Bacteria 2592
711 Ga0496109_0160241 3300048912 Bacteria 2108
712 Ga0496109_0252778 3300048912 Bacteria 1660
713 Ga0496109_0509487 3300048912 Unclassified 1136
714 Ga0496109_0997128 3300048912 Bacteria 775
715 Ga0496110_0006101 3300048913 Bacteria 9497
716 Ga0496110_0009106 3300048913 Bacteria 8012
717 Ga0496110_0011009 3300048913 Bacteria 7380
718 Ga0496110_0040712 3300048913 Bacteria 4050
719 Ga0496110_0070203 3300048913 Bacteria 3103
720 Ga0496110_0111369 3300048913 Bacteria 2460
721 Ga0496110_0139557 3300048913 Bacteria 2191
722 Ga0496110_0290744 3300048913 Bacteria 1488
723 Ga0496110_0734081 3300048913 Bacteria 890
724 Ga0496111_0000629 3300048914 Bacteria 18610
725 Ga0496111_0002084 3300048914 Bacteria 11925
726 Ga0496111_0002905 3300048914 Bacteria 10468
727 Ga0496111_0018597 3300048914 Bacteria 4815
728 Ga0496111_0036912 3300048914 Bacteria 3495
729 Ga0496111_0147026 3300048914 Unclassified 1747
730 Ga0496111_0149147 3300048914 Bacteria 1734
731 Ga0496111_0238613 3300048914 Bacteria 1350
732 Ga0496111_0584639 3300048914 Bacteria 818
733 Ga0496111_0677624 3300048914 Unclassified 751
734 Ga0496111_0963173 3300048914 Bacteria 612
735 Ga0496112_0040259 3300048915 Bacteria 4569
736 Ga0496112_0049695 3300048915 Bacteria 4110
737 Ga0496112_0123624 3300048915 Bacteria 2558
738 Ga0496112_0151580 3300048915 Bacteria 2285
739 Ga0496112_0290197 3300048915 Unclassified 1582
740 Ga0496112_0519824 3300048915 Bacteria 1125
741 Ga0496112_0676071 3300048915 Bacteria 961
742 Ga0496113_0000482 3300048916 Bacteria 19590
743 Ga0496113_0000824 3300048916 Bacteria 16158
744 Ga0496113_0005833 3300048916 Bacteria 7727
745 Ga0496113_0225871 3300048916 Bacteria 1493
746 Ga0496113_0262375 3300048916 Bacteria 1380
747 Ga0496113_0306786 3300048916 Unclassified 1271
748 Ga0496113_0309067 3300048916 Bacteria 1266
749 Ga0496113_0453870 3300048916 Bacteria 1030
750 Ga0496113_0664084 3300048916 Bacteria 833
751 Ga0496114_0026337 3300048917 Bacteria 4760
752 Ga0496114_0037126 3300048917 Bacteria 4029
753 Ga0496114_0055889 3300048917 Bacteria 3292
754 Ga0496114_0062043 3300048917 Bacteria 3128
755 Ga0496114_0088737 3300048917 Bacteria 2623
756 Ga0496114_0164208 3300048917 Bacteria 1933
757 Ga0496114_0304168 3300048917 Bacteria 1408
758 Ga0496114_0358251 3300048917 Bacteria 1290
759 Ga0496114_0389116 3300048917 Bacteria 1235
760 Ga0496114_1012515 3300048917 Bacteria 714
761 Ga0496115_0030776 3300048918 Bacteria 4224
762 Ga0496115_0032205 3300048918 Archaea 4135
763 Ga0496115_0117129 3300048918 Bacteria 2191
764 Ga0496115_0127078 3300048918 Bacteria 2100
765 Ga0496115_0382969 3300048918 Unclassified 1143
766 Ga0496115_0603348 3300048918 Unclassified 872
767 Ga0501033_0495019 3300049570 Unclassified 846
768 Ga0501039_0237917 3300049575 Unclassified 1432
769 Ga0501040_0101489 3300049576 Bacteria 2007
770 Ga0501041_0135018 3300049577 Unclassified 1537
771 Ga0501042_0976362 3300049578 Bacteria 617
772 Ga0501067_0001435 3300049583 Bacteria 12943
773 Ga0501067_0007672 3300049583 Bacteria 6000
774 Ga0501069_0004440 3300049585 Bacteria 7247
775 Ga0501070_0047802 3300049586 Bacteria 3555
776 Ga0501075_0346910 3300049591 Unclassified 1131
777 Ga0501076_0085801 3300049592 Bacteria 2530
778 Ga0501077_0436717 3300049593 Unclassified 838
779 Ga0501079_0029543 3300049741 Bacteria 4209
780 Ga0501081_0506948 3300049743 Unclassified 899
781 Ga0501081_1016398 3300049743 Bacteria 627
782 Ga0501035_1106989 3300049822 Bacteria 618
783 Ga0501045_0336982 3300049824 Unclassified 1122
784 nmdc:mga00v17_92768_c1 3300050491 Unclassified 830
785 nmdc:mga05p37_16222_c1 3300050507 Bacteria 8967
786 nmdc:mga05p37_188115_c1 3300050507 Bacteria 2509
787 nmdc:mga05p37_372818_c1 3300050507 Bacteria 1674
788 nmdc:mga05p37_84240_c1 3300050507 Bacteria 3917
789 nmdc:mga09592_154687_c1 3300050508 Bacteria 1979
790 nmdc:mga0qj67_194801_c1 3300050509 Bacteria 1647
791 nmdc:mga06r32_157906_c1 3300050510 Bacteria 2250
792 nmdc:mga06r32_18439_c1 3300050510 Bacteria 6389
793 nmdc:mga08y16_29200_c1 3300050511 Bacteria 5812
794 nmdc:mga08y16_76524_c1 3300050511 Bacteria 3488
795 nmdc:mga08y16_983868_c1 3300050511 Unclassified 825
796 nmdc:mga0n895_1310287_c1 3300050512 Unclassified 695
797 nmdc:mga0n895_144480_c1 3300050512 Bacteria 2408
798 nmdc:mga0n895_1517041_c1 3300050512 Unclassified 636
799 nmdc:mga0n895_40352_c1 3300050512 Bacteria 4534
800 nmdc:mga0n895_613495_c1 3300050512 Bacteria 1089
801 nmdc:mga0n895_63669_c1 3300050512 Bacteria 3647
802 nmdc:mga0rr50_1491177_c1 3300050513 Bacteria 572
803 nmdc:mga0rr50_212956_c1 3300050513 Unclassified 1593
804 nmdc:mga0rr50_50390_c1 3300050513 Bacteria 3085
805 nmdc:mga08x19_128239_c1 3300050514 Unclassified 1705
806 nmdc:mga08x19_22358_c1 3300050514 Bacteria 3916
807 nmdc:mga08x19_457420_c1 3300050514 Bacteria 899
808 nmdc:mga08x19_47800_c1 3300050514 Bacteria 2740
809 nmdc:mga08x19_57859_c1 3300050514 Bacteria 2507
810 nmdc:mga0a205_102183_c1 3300050515 Unclassified 2766
811 nmdc:mga0a205_198109_c1 3300050515 Bacteria 1899
812 nmdc:mga0a205_330520_c1 3300050515 Bacteria 1394
813 nmdc:mga0a205_509548_c1 3300050515 Bacteria 1060
814 nmdc:mga0a205_548452_c1 3300050515 Bacteria 1011
815 nmdc:mga0a205_82276_c1 3300050515 Bacteria 3110
816 Ga0495612_0057879 3300053078 Bacteria 1601
817 Ga0495619_0044323 3300053085 Bacteria 2920
818 Ga0495619_0190221 3300053085 Bacteria 1420
819 Ga0501084_0091319 3300054114 Bacteria 2557
820 Ga0501082_0044537 3300060353 Bacteria 3827
821 Ga0530510_0251173 3300061734 Bacteria 1318
822 Ga0070683_100740046
823 Ga0070683_100267063
824 Ga0070683_100545148
825 Ga0068869_100165973
826 Ga0068869_100726161
827 Ga0070666_10702206
828 Ga0070680_100026187
829 Ga0070682_100005210
830 Ga0070682_100548731
831 Ga0070682_100932828
832 Ga0070682_101163983
833 Ga0068868_100074827
834 Ga0068868_100300824
835 Ga0068868_100383510
836 Ga0068868_100523675
837 Ga0068868_100828183
838 Ga0070660_100103805
839 Ga0070660_100420244
840 Ga0070689_100689952
841 Ga0070691_10047492
842 Ga0070691_10204642
843 Ga0070691_10289851
844 Ga0070691_10521214
845 Ga0070687_100637460
846 Ga0070692_10139509
847 Ga0070668_100068975
848 Ga0070668_101412016
849 Ga0070669_100640230
850 Ga0070675_100968028
851 Ga0070671_100095584
852 Ga0070671_100200560
853 Ga0070671_100869311
854 Ga0070674_100007606
855 Ga0070673_100350713
856 Ga0070673_101651438
857 Ga0070688_100072160
858 Ga0070688_101341827
859 Ga0070659_100276336
860 Ga0070667_101445520
861 Ga0070709_10050586
862 Ga0070709_10452534
863 Ga0070714_100080421
864 Ga0070713_100011514
865 Ga0070710_10114169
866 Ga0070710_10637570
867 Ga0070710_10874223
868 Ga0070701_10106209
869 Ga0070701_10322630
870 Ga0070711_100060550
871 Ga0070711_100380442
872 Ga0070711_100514497
873 Ga0070705_100042483
874 Ga0070705_100146360
875 Ga0070705_100184003
876 Ga0070705_100216701
877 Ga0070705_100261861
878 Ga0070700_100418715
879 Ga0070700_100739729
880 Ga0070700_100897090
881 Ga0070694_100191909
882 Ga0070694_100776921
883 Ga0070694_100915099
884 Ga0070708_100109717
885 Ga0070708_100139491
886 Ga0070708_100216023
887 Ga0070708_100628602
888 Ga0070663_100033839
889 Ga0070663_100909260
890 Ga0070678_100021829
891 Ga0070678_100026985
892 Ga0070678_100144236
893 Ga0070662_100389084
894 Ga0070681_10347884
895 Ga0070681_10453453
896 Ga0068867_100192196
897 Ga0068867_100285411
898 Ga0068867_100518198
899 Ga0070685_10233153
900 Ga0070685_10292794
901 Ga0070706_100077589
902 Ga0070706_100166775
903 Ga0070707_100002890
904 Ga0070698_100509332
905 Ga0070699_100016998
906 Ga0070699_100385253
907 Ga0070679_100717711
908 Ga0070684_100089612
909 Ga0070684_100161823
910 Ga0070684_100683005
911 Ga0070684_100735907
912 Ga0070697_100444839
913 Ga0068853_100218045
914 Ga0070686_100035454
915 Ga0070686_100045168
916 Ga0070686_100070849
917 Ga0070686_100205071
918 Ga0070695_100182494
919 Ga0070695_100217772
920 Ga0070695_100554131
921 Ga0070696_100126398
922 Ga0070696_100157189
923 Ga0070696_100577874
924 Ga0070693_100026866
925 Ga0070693_100161451
926 Ga0070693_100318260
927 Ga0070693_100349395
928 Ga0070704_100039620
929 Ga0070704_100285193
930 Ga0070704_100285850
931 Ga0070704_100390691
932 Ga0070704_100749052
933 Ga0068855_100079024
934 Ga0068855_100294188
935 Ga0068855_101092806
936 Ga0068855_101297672
937 Ga0070664_100527095
938 Ga0068857_102292237
939 Ga0068854_100036423
940 Ga0068854_100253812
941 Ga0068856_100046077
942 Ga0068856_100126149
943 Ga0068856_100140385
944 Ga0068856_100237066
945 Ga0068856_100257029
946 Ga0068856_100299808
947 Ga0068856_100387265
948 Ga0068856_100697625
949 Ga0068856_100752188
950 Ga0068856_100874608
951 Ga0068856_101249032
952 Ga0070702_100128029
953 Ga0070702_100427226
954 Ga0070702_100503936
955 Ga0070702_100509175
956 Ga0070702_100883216
957 Ga0070702_100929241
958 Ga0068852_100076766
959 Ga0068852_100662116
960 Ga0068852_101892947
961 Ga0068859_101105985
962 Ga0068864_100006361
963 Ga0068866_10012779
964 Ga0068861_100071272
965 Ga0068861_100190489
966 Ga0068861_100698532
967 Ga0068860_100541731
968 Ga0068860_100649269
969 Ga0068862_101544924
970 Ga0081455_10010868
971 Ga0081538_10013296
972 Ga0081538_10152030
973 Ga0081540_1002869
974 Ga0081540_1005145
975 Ga0081540_1005990
976 Ga0081540_1032816
977 Ga0070717_10182307
978 Ga0075432_10011677
979 Ga0075432_10433867
980 Ga0070715_10003539
981 Ga0070716_100039912
982 Ga0070716_100176869
983 Ga0070712_100001448
984 Ga0070712_100167123
985 Ga0070712_100580089
986 Ga0097621_100131929
987 Ga0068871_100052606
988 Ga0068871_100357099
989 Ga0068871_101616184
990 Ga0075428_100114818
991 Ga0075428_100161542
992 Ga0075428_100200162
993 Ga0075428_100479860
994 Ga0075430_100204796
995 Ga0075431_100058228
996 Ga0075431_100168517
997 Ga0075433_10092243
998 Ga0075433_10139663
999 Ga0075434_100034001
1000 Ga0075434_100149934
1001 Ga0075434_101477584
1002 Ga0075429_100169058
1003 Ga0068865_100617853
1004 Ga0068865_100694371
1005 Ga0075436_100022702
1006 Ga0075436_100033630
1007 Ga0097620_101105864
1008 Ga0075435_100062244
1009 Ga0075435_100176245
1010 Ga0075435_100259801
1011 Ga0075435_100671315
1012 Ga0075435_101597206
1013 Ga0105250_10138900
1014 Ga0105240_10840244
1015 Ga0111539_10118771
1016 Ga0111539_10149472
1017 Ga0111539_10199069
1018 Ga0105245_10055857
1019 Ga0105245_10102321
1020 Ga0105245_10107226
1021 Ga0105245_10203656
1022 Ga0105245_10317102
1023 Ga0105245_10443140
1024 Ga0105245_10507900
1025 Ga0105245_10525306
1026 Ga0105245_10831924
1027 Ga0105245_11075154
1028 Ga0105245_11168189
1029 Ga0105245_11265635
1030 Ga0105245_12320505
1031 Ga0105247_10172440
1032 Ga0114129_10075826
1033 Ga0114129_10291610
1034 Ga0114129_10478556
1035 Ga0114129_13278393
1036 Ga0105243_10170512
1037 Ga0105243_10247456
1038 Ga0105243_10305771
1039 Ga0105243_13077318
1040 Ga0105241_10058235
1041 Ga0105241_10165411
1042 Ga0105241_10614632
1043 Ga0105241_11530050
1044 Ga0105242_10107242
1045 Ga0105242_11098762
1046 Ga0105242_11468929
1047 Ga0105248_10134958
1048 Ga0105248_10284959
1049 Ga0105237_10541140
1050 Ga0105249_10100526
1051 Ga0105249_10199156
1052 Ga0105239_10002262
1053 Ga0105239_10087483
1054 Ga0105239_10348013
1055 Ga0105239_10373952
1056 Ga0105239_10379239
1057 Ga0105239_10556642
1058 Ga0105239_10888297
1059 Ga0105246_10157419
1060 Ga0105246_10359797
1061 Ga0105246_11122104
1062 Ga0105246_12207574
1063 Ga0157344_1009418
1064 Ga0157318_1035160
1065 Ga0157313_1037265
1066 Ga0157342_1001550
1067 Ga0157315_1001278
1068 Ga0157316_1012217
1069 Ga0157373_10378629
1070 Ga0157371_10249658
1071 Ga0157371_10285615
1072 Ga0157369_10479026
1073 Ga0157369_11112337
1074 Ga0157374_10238811
1075 Ga0157374_10365699
1076 Ga0157374_10439528
1077 Ga0157378_10293624
1078 Ga0157378_11468937
1079 Ga0157378_11991827
1080 Ga0163162_10506311
1081 Ga0163162_10660634
1082 Ga0157372_10086115
1083 Ga0157372_10443795
1084 Ga0157375_10705261
1085 Ga0157375_11178116
1086 Ga0157375_12413503
1087 Ga0157380_10622991
1088 Ga0157380_11326568
1089 Ga0182008_10541319
1090 Ga0157377_10193828
1091 Ga0157377_10240837
1092 Ga0157377_10462584
1093 Ga0157377_10485947
1094 Ga0157379_10882668
1095 Ga0157379_11709785
1096 Ga0157376_10013794
1097 Ga0157376_10468316
1098 Ga0157376_11138719
1099 Ga0157376_12847151
1100 Ga0182005_1234199
1101 Ga0163161_10075444
1102 Ga0163161_10162626
1103 Ga0207653_10002267
1104 Ga0207692_10034562
1105 Ga0207692_10367199
1106 Ga0207642_10332470
1107 Ga0207642_10403976
1108 Ga0207688_10010459
1109 Ga0207688_10145769
1110 Ga0207688_10312358
1111 Ga0207680_10696563
1112 Ga0207685_10034862
1113 Ga0207685_10176249
1114 Ga0207699_10024753
1115 Ga0207699_10392304
1116 Ga0207699_10768194
1117 Ga0207684_10089332
1118 Ga0207684_10271671
1119 Ga0207684_10323725
1120 Ga0207684_10332016
1121 Ga0207654_10019978
1122 Ga0207654_10085953
1123 Ga0207654_10153424
1124 Ga0207654_10438445
1125 Ga0207654_11326134
1126 Ga0207707_10164771
1127 Ga0207695_11732908
1128 Ga0207671_10439711
1129 Ga0207693_10003258
1130 Ga0207693_10016686
1131 Ga0207693_10023595
1132 Ga0207693_10463445
1133 Ga0207693_10557737
1134 Ga0207663_10216561
1135 Ga0207663_10406435
1136 Ga0207663_10554707
1137 Ga0207663_11101640
1138 Ga0207660_10052797
1139 Ga0207662_10062127
1140 Ga0207662_10310224
1141 Ga0207657_10274257
1142 Ga0207657_10342606
1143 Ga0207657_10560065
1144 Ga0207652_10654083
1145 Ga0207652_10712116
1146 Ga0207652_11240382
1147 Ga0207646_10005641
1148 Ga0207646_10828848
1149 Ga0207646_10932616
1150 Ga0207681_10298433
1151 Ga0207681_10734793
1152 Ga0207659_11329250
1153 Ga0207687_10008937
1154 Ga0207687_10034193
1155 Ga0207687_10081889
1156 Ga0207687_10173663
1157 Ga0207687_10184139
1158 Ga0207687_10612232
1159 Ga0207687_10633164
1160 Ga0207687_11334270
1161 Ga0207687_11809894
1162 Ga0207700_10081985
1163 Ga0207700_10541352
1164 Ga0207700_10639192
1165 Ga0207664_10034046
1166 Ga0207664_10498541
1167 Ga0207664_10902345
1168 Ga0207644_10191243
1169 Ga0207644_10203613
1170 Ga0207644_10731854
1171 Ga0207644_10934569
1172 Ga0207690_10246339
1173 Ga0207706_10006582
1174 Ga0207706_10120049
1175 Ga0207706_10124435
1176 Ga0207706_10497796
1177 Ga0207686_10077351
1178 Ga0207686_10304448
1179 Ga0207669_10031588
1180 Ga0207669_10452570
1181 Ga0207704_10209002
1182 Ga0207704_11121996
1183 Ga0207665_10006431
1184 Ga0207665_10202830
1185 Ga0207691_11194161
1186 Ga0207711_10184795
1187 Ga0207689_10274759
1188 Ga0207689_10799655
1189 Ga0207661_10023679
1190 Ga0207661_10169070
1191 Ga0207661_10568464
1192 Ga0207679_10642931
1193 Ga0207679_11136117
1194 Ga0207667_10563579
1195 Ga0207667_10812749
1196 Ga0207651_10732150
1197 Ga0207651_11125852
1198 Ga0207712_10180922
1199 Ga0207712_10259849
1200 Ga0207668_10066832
1201 Ga0207668_10083028
1202 Ga0207668_10317316
1203 Ga0207668_11077111
1204 Ga0207640_10417253
1205 Ga0207640_10463062
1206 Ga0207640_11528928
1207 Ga0207658_10816883
1208 Ga0207677_10021982
1209 Ga0207677_10043802
1210 Ga0207677_10121039
1211 Ga0207677_10202825
1212 Ga0207677_10450911
1213 Ga0207677_10473254
1214 Ga0207677_10977451
1215 Ga0207639_10586447
1216 Ga0207678_10056600
1217 Ga0207708_10089216
1218 Ga0207708_10189280
1219 Ga0207708_10399988
1220 Ga0207708_10471574
1221 Ga0207708_10491787
1222 Ga0207702_10003331
1223 Ga0207702_10025176
1224 Ga0207702_10143483
1225 Ga0207702_10232830
1226 Ga0207702_10233389
1227 Ga0207702_10495551
1228 Ga0207702_10657008
1229 Ga0207702_11763724
1230 Ga0207641_10795959
1231 Ga0207648_10233978
1232 Ga0207648_10747930
1233 Ga0207676_10163075
1234 Ga0207676_10206161
1235 Ga0207675_100010489
1236 Ga0207675_100051713
1237 Ga0207675_100184215
1238 Ga0207675_100261354
1239 Ga0207683_10001564
1240 Ga0207683_10015964
1241 Ga0207683_10052737
1242 Ga0207683_10109858
1243 Ga0207683_10124400
1244 Ga0207698_11706250
1245 Ga0207428_10028629
1246 Ga0207428_10092776
1247 Ga0268266_10408063
1248 Ga0268265_10300699
1249 Ga0268265_10676350
1250 Ga0268264_10141325
1251 Ga0268264_11485199
1252 Ga0307406_10958572
1253 Ga0307409_100021055
1254 Ga0307409_101251432
1255 Ga0373948_0003747
1256 Ga0373948_0023525
1257 Ga0373950_0013056
1258 Ga0373959_0001309
1259 Ga0373929_0016125
1260 Ga0373944_0001746
1261 Ga0373951_0033269
1262 Ga0373952_0028850
1263 Ga0373932_0002286
1264 Ga0373939_0021651
1265 Ga0373941_0004204
1266 Ga0373941_0062465
1267 Ga0373945_0021197
1268 Ga0373960_0062071
1269 Ga0373960_0130761
1270 Ga0373960_0244146
1271 Ga0373960_0297953
1272 Ga0373943_0012098
1273 Ga0373943_0016415
1274 Ga0373943_0091830
1275 Ga0373946_0011220
1276 Ga0373942_0003344
1277 Ga0373961_0027354
1278 Ga0373961_0151351
1279 Ga0373961_0235255
1280 Ga0373962_0001222
1281 Ga0373962_0035842
1282 Ga0373962_0136426
1283 Ga0373931_0005617
1284 Ga0373931_0954803
1285 Ga0373935_0063069
1286 Ga0373927_0112159
1287 Ga0373947_0742237
1288 Ga0373947_1047789
1289 Ga0373937_1451342
1290 Ga0373925_0008644
1291 Ga0373925_1617245
1292 Ga0395899_0013881
1293 Ga0395899_0014669
1294 Ga0395899_0020994
1295 Ga0395899_0040840
1296 Ga0395899_0135891
1297 Ga0395899_0357429
1298 Ga0395900_0002868
1299 Ga0395900_0007646
1300 Ga0395900_0009226
1301 Ga0395900_0009682
1302 Ga0395900_0023295
1303 Ga0395900_0055351
1304 Ga0395900_0106826
1305 Ga0395900_0398830
1306 Ga0395900_0544970
1307 Ga0395900_0611361
1308 Ga0395898_0005218
1309 Ga0395898_0005707
1310 Ga0395898_0019062
1311 Ga0395898_0050276
1312 Ga0395898_0152751
1313 Ga0395898_0156190
1314 Ga0395898_0242054
1315 Ga0395898_0362724
1316 Ga0395898_1114386
1317 Ga0395898_1302933
1318 Ga0395898_1833367
1319 Ga0395905_0004667
1320 Ga0395905_0005067
1321 Ga0395905_0013993
1322 Ga0395905_0050733
1323 Ga0395905_0371028
1324 Ga0395905_0388259
1325 Ga0395901_0001467
1326 Ga0395901_0002218
1327 Ga0395901_0004922
1328 Ga0395901_0014011
1329 Ga0395901_0068095
1330 Ga0395901_0186855
1331 Ga0395901_0444246
1332 Ga0395901_0560752
1333 Ga0395901_0688421
1334 Ga0395901_0896028
1335 Ga0395901_1013852
1336 Ga0242420_049735
1337 Ga0451789_0844947
1338 Ga0451789_0956241
1339 Ga0451800_1214126
1340 Ga0451835_0290872
1341 Ga0451845_0264688
1342 Ga0451849_0081608
1343 Ga0451853_0253187
1344 Ga0451853_0365477
1345 Ga0451853_0483074
1346 Ga0439448_0002532
1347 Ga0439448_0091367
1348 Ga0439451_103669
1349 Ga0439459_0002855
1350 Ga0439459_0209576
1351 Ga0451577_0361510
1352 Ga0466964_0009047
1353 Ga0466968_0043202
1354 Ga0466968_0054892
1355 Ga0466968_0090875
1356 Ga0466960_0060428
1357 Ga0451576_0018528
1358 Ga0451576_0344773
1359 Ga0451576_0543359
1360 Ga0451576_1924695
1361 Ga0466967_0000180
1362 Ga0495603_0011814
1363 Ga0495603_0054247
1364 Ga0495603_0083994
1365 Ga0495603_0227647
1366 Ga0495629_0005704
1367 Ga0495629_0347001
1368 Ga0495629_0436116
1369 Ga0495641_0007540
1370 Ga0495641_0011893
1371 Ga0495641_0136373
1372 Ga0495651_0237773
1373 Ga0495580_0263158
1374 Ga0495582_0248184
1375 Ga0495605_0157707
1376 Ga0495605_0298179
1377 Ga0495639_0090500
1378 Ga0495639_0428555
1379 Ga0495639_0484877
1380 Ga0495662_0140959
1381 Ga0495584_0218922
1382 Ga0495594_0030692
1383 Ga0495594_0201424
1384 Ga0495596_0148898
1385 Ga0495607_0060439
1386 Ga0495607_0212593
1387 Ga0495616_0281572
1388 Ga0495630_1404652
1389 Ga0495631_0350996
1390 Ga0495637_0147700
1391 Ga0495637_0189056
1392 Ga0495644_0212447
1393 Ga0495663_0029066
1394 Ga0495663_0105105
1395 Ga0495666_0010004
1396 Ga0495642_0103560
1397 Ga0495642_0217650
1398 Ga0495665_0363342
1399 Ga0495586_0144677
1400 Ga0495586_0711902
1401 Ga0495609_0033263
1402 Ga0495609_0224264
1403 Ga0495597_0345877
1404 Ga0495633_0275919
1405 Ga0495667_0108890
1406 Ga0495656_0015141
1407 Ga0495634_0114695
1408 Ga0495634_0169244
1409 Ga0495611_0071276
1410 Ga0495611_0342379
1411 Ga0495635_0030577
1412 Ga0495635_0382325
1413 Ga0495659_0073210
1414 Ga0495659_0088517
1415 Ga0495659_0092832
1416 Ga0495659_0290684
1417 Ga0495588_0000593
1418 Ga0495599_0439717
1419 Ga0495647_0207729
1420 Ga0495658_0031702
1421 Ga0495658_0120186
1422 Ga0495658_0168076
1423 Ga0495613_0045348
1424 Ga0495613_0243590
1425 Ga0495624_0253259
1426 Ga0495670_0242643
1427 Ga0495671_0122795
1428 Ga0495671_0361278
1429 Ga0495589_0102170
1430 Ga0495589_0217613
1431 Ga0495600_0451967
1432 Ga0495581_0117190
1433 Ga0495581_0277175
1434 Ga0495581_0320446
1435 Ga0495581_0516794
1436 Ga0495604_0040543
1437 Ga0495604_0426549
1438 Ga0495674_0185689
1439 Ga0495676_0010464
1440 Ga0495676_0197278
1441 Ga0495676_0318250
1442 Ga0495680_0013972
1443 Ga0495680_0640816
1444 Ga0495685_190189
1445 Ga0495684_0013670
1446 Ga0495593_0350724
1447 Ga0495614_0105460
1448 Ga0495626_0032364
1449 Ga0495626_0218781
1450 Ga0496100_0003214
1451 Ga0496100_0090332
1452 Ga0496100_0109615
1453 Ga0496100_0121308
1454 Ga0496100_0182097
1455 Ga0496100_0344715
1456 Ga0496100_0373406
1457 Ga0496100_0562593
1458 Ga0496100_1304378
1459 Ga0496101_0044891
1460 Ga0496101_0067083
1461 Ga0496101_0135238
1462 Ga0496101_0253793
1463 Ga0496101_0275774
1464 Ga0496101_0293443
1465 Ga0496101_0318473
1466 Ga0496101_0578447
1467 Ga0496101_1151200
1468 Ga0496102_0036741
1469 Ga0496102_0066043
1470 Ga0496102_0099542
1471 Ga0496102_0116088
1472 Ga0496102_0206405
1473 Ga0496102_0322810
1474 Ga0496102_0482285
1475 Ga0496102_0646637
1476 Ga0496102_1622627
1477 Ga0496103_0010861
1478 Ga0496103_0013718
1479 Ga0496103_0137784
1480 Ga0496103_0220419
1481 Ga0496104_0000691
1482 Ga0496104_0005998
1483 Ga0496104_0008976
1484 Ga0496104_0193589
1485 Ga0496104_0254028
1486 Ga0496104_0259501
1487 Ga0496104_1286889
1488 Ga0496105_0000461
1489 Ga0496105_0014720
1490 Ga0496105_0054983
1491 Ga0496105_0122136
1492 Ga0496105_0171030
1493 Ga0496105_0263449
1494 Ga0496105_0293996
1495 Ga0496105_0900060
1496 Ga0496105_0994269
1497 Ga0496106_0045031
1498 Ga0496106_0065786
1499 Ga0496106_0087472
1500 Ga0496106_0180210
1501 Ga0496106_0257953
1502 Ga0496106_0340087
1503 Ga0496106_0455624
1504 Ga0496106_0694052
1505 Ga0496106_1127570
1506 Ga0496107_0010138
1507 Ga0496107_0036610
1508 Ga0496107_0046241
1509 Ga0496107_0116422
1510 Ga0496107_0155101
1511 Ga0496107_0229192
1512 Ga0496107_0610129
1513 Ga0496107_0672147
1514 Ga0496107_1166180
1515 Ga0496107_1316741
1516 Ga0496108_0001323
1517 Ga0496108_0003915
1518 Ga0496108_0013726
1519 Ga0496108_0019667
1520 Ga0496108_0113185
1521 Ga0496108_0146967
1522 Ga0496108_0309214
1523 Ga0496108_0557691
1524 Ga0496108_0575062
1525 Ga0496109_0005477
1526 Ga0496109_0008325
1527 Ga0496109_0013188
1528 Ga0496109_0020970
1529 Ga0496109_0036998
1530 Ga0496109_0061986
1531 Ga0496109_0107413
1532 Ga0496109_0160241
1533 Ga0496109_0252778
1534 Ga0496109_0509487
1535 Ga0496109_0997128
1536 Ga0496110_0006101
1537 Ga0496110_0009106
1538 Ga0496110_0011009
1539 Ga0496110_0040712
1540 Ga0496110_0070203
1541 Ga0496110_0111369
1542 Ga0496110_0139557
1543 Ga0496110_0290744
1544 Ga0496110_0734081
1545 Ga0496111_0000629
1546 Ga0496111_0002084
1547 Ga0496111_0002905
1548 Ga0496111_0018597
1549 Ga0496111_0036912
1550 Ga0496111_0147026
1551 Ga0496111_0149147
1552 Ga0496111_0238613
1553 Ga0496111_0584639
1554 Ga0496111_0677624
1555 Ga0496111_0963173
1556 Ga0496112_0040259
1557 Ga0496112_0049695
1558 Ga0496112_0123624
1559 Ga0496112_0151580
1560 Ga0496112_0290197
1561 Ga0496112_0519824
1562 Ga0496112_0676071
1563 Ga0496113_0000482
1564 Ga0496113_0000824
1565 Ga0496113_0005833
1566 Ga0496113_0225871
1567 Ga0496113_0262375
1568 Ga0496113_0306786
1569 Ga0496113_0309067
1570 Ga0496113_0453870
1571 Ga0496113_0664084
1572 Ga0496114_0026337
1573 Ga0496114_0037126
1574 Ga0496114_0055889
1575 Ga0496114_0062043
1576 Ga0496114_0088737
1577 Ga0496114_0164208
1578 Ga0496114_0304168
1579 Ga0496114_0358251
1580 Ga0496114_0389116
1581 Ga0496114_1012515
1582 Ga0496115_0030776
1583 Ga0496115_0032205
1584 Ga0496115_0117129
1585 Ga0496115_0127078
1586 Ga0496115_0382969
1587 Ga0496115_0603348
1588 Ga0501033_0495019
1589 Ga0501039_0237917
1590 Ga0501040_0101489
1591 Ga0501041_0135018
1592 Ga0501042_0976362
1593 Ga0501067_0001435
1594 Ga0501067_0007672
1595 Ga0501069_0004440
1596 Ga0501070_0047802
1597 Ga0501075_0346910
1598 Ga0501076_0085801
1599 Ga0501077_0436717
1600 Ga0501079_0029543
1601 Ga0501081_0506948
1602 Ga0501081_1016398
1603 Ga0501035_1106989
1604 Ga0501045_0336982
1605 nmdc:mga00v17_92768_c1
1606 nmdc:mga05p37_16222_c1
1607 nmdc:mga05p37_188115_c1
1608 nmdc:mga05p37_372818_c1
1609 nmdc:mga05p37_84240_c1
1610 nmdc:mga09592_154687_c1
1611 nmdc:mga0qj67_194801_c1
1612 nmdc:mga06r32_157906_c1
1613 nmdc:mga06r32_18439_c1
1614 nmdc:mga08y16_29200_c1
1615 nmdc:mga08y16_76524_c1
1616 nmdc:mga08y16_983868_c1
1617 nmdc:mga0n895_1310287_c1
1618 nmdc:mga0n895_144480_c1
1619 nmdc:mga0n895_1517041_c1
1620 nmdc:mga0n895_40352_c1
1621 nmdc:mga0n895_613495_c1
1622 nmdc:mga0n895_63669_c1
1623 nmdc:mga0rr50_1491177_c1
1624 nmdc:mga0rr50_212956_c1
1625 nmdc:mga0rr50_50390_c1
1626 nmdc:mga08x19_128239_c1
1627 nmdc:mga08x19_22358_c1
1628 nmdc:mga08x19_457420_c1
1629 nmdc:mga08x19_47800_c1
1630 nmdc:mga08x19_57859_c1
1631 nmdc:mga0a205_102183_c1
1632 nmdc:mga0a205_198109_c1
1633 nmdc:mga0a205_330520_c1
1634 nmdc:mga0a205_509548_c1
1635 nmdc:mga0a205_548452_c1
1636 nmdc:mga0a205_82276_c1
1637 Ga0495612_0057879
1638 Ga0495619_0044323
1639 Ga0495619_0190221
1640 Ga0501084_0091319
1641 Ga0501082_0044537
1642 Ga0530510_0251173

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00190

Cupin_1

Cupin

37

124

0.89

PF07883

Cupin_2

Cupin domain

44

119

0.87

PF01050

MannoseP_isomer

Mannose-6-phosphate isomerase C-terminal

16

130

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7chi-assembly1.cif.gz_A crystal structure of pco5 0.8978 32 118
6sbp-assembly1.cif.gz_A plant cysteine oxidase pco5 from arabidopsis thaliana 0.8949 32 118
1juh-assembly2.cif.gz_D-2 crystal structure of quercetin 2,3-dioxygenase 0.8804 22 116
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8725 36 121
7cxz-assembly1.cif.gz_A crystal structure of pco2 0.8628 30 118
ID Description Score Start End Superfamily
af_O53413_44_172_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8708 30 127 2.60.120.10
af_Q55CL5_155_418_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.8707 41 117 2.60.120.650
2oa2A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8656 32 118 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.861 27 127 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.853 27 127 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2W5YPA6-F1-model_v4 Cupin 0.9649 22 128
AF-A0A554J5D3-F1-model_v4 Cupin 0.9612 18 128
AF-A0A2M8F5G2-F1-model_v4 Cupin 0.9583 17 131 GO:0005976
GO:0016779
AF-A0A0G0AB51-F1-model_v4 Cupin type-2 domain-containing protein 0.958 21 127
AF-A0A838NWA1-F1-model_v4 Cupin 0.9557 19 112 GO:0005976
GO:0016779

Map