F482244

General Info

Members Datasets Scaffolds Average Seq Length
821 568 502 210

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1000269|Ga0055540_100026924
Length 238
Sequence MRTPPCAAGFRPPPKPSGRIEKADTMNRIPFPDMKRPLIAILRGIRPDETESVVGALIDNGLTAIEIPLNSPEPFKSIEIAAKMGPPEVLIGAGTVLTVEAVDSLHAAGGTLLVTPNVEPEVIIRARQYGMVTMPGVFTPTEALAAARAGATGLKFFPASVLGPSGITAIRAILPPELTIAAVGGVSDKNFGDYTKAGIFAFGLGTSLYKPGMTAAEVAERAKATIYAYDAAIGSVSV

Samples

Sample ID Description Type Environment
1 2509276019 Ensifer aridi TW10 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
4 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
17 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
18 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
19 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
20 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516143018 Ensifer sp. BR816 Isolate Nodule
28 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
29 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
30 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
31 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
32 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
33 2519899620 Rhizobium sp. Pop5 Isolate Nodule
34 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
35 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
36 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
37 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
38 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
39 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
40 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
41 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
42 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
43 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
44 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
45 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
46 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
47 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
48 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
49 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
50 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
51 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
52 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
53 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
54 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
55 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
56 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
57 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
58 2643221568 Rhizobium sp. Root564 Isolate Unclassified
59 2643221599 Rhizobium sp. Root708 Isolate Unclassified
60 2643221607 Rhizobium sp. Root73 Isolate Unclassified
61 2643221618 Ensifer sp. Root231 Isolate Unclassified
62 2643221626 Ensifer sp. Root31 Isolate Unclassified
63 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
64 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
65 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
66 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
67 2643221655 Ensifer sp. Root1252 Isolate Unclassified
68 2643221659 Ensifer sp. Root127 Isolate Unclassified
69 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
70 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
71 2643221693 Rhizobium sp. Root491 Isolate Unclassified
72 2643221698 Ensifer sp. Root142 Isolate Unclassified
73 2643221712 Ensifer sp. Root258 Isolate Unclassified
74 2643221718 Rhizobium sp. Root268 Isolate Unclassified
75 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
76 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
77 2718217882 Rhizobium sp. N741 Isolate Nodule
78 2718217927 Rhizobium sp. N324 Isolate Nodule
79 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
80 2718218009 Rhizobium sp. N561 Isolate Nodule
81 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
82 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
83 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
84 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
85 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
86 2718218363 Rhizobium sp. N113 Isolate Nodule
87 2718218365 Rhizobium sp. N731 Isolate Nodule
88 2718218366 Rhizobium sp. N621 Isolate Nodule
89 2718218423 Rhizobium sp. N941 Isolate Nodule
90 2721755514 Rhizobium sp. N6212 Isolate Nodule
91 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
92 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
93 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
94 2721755809 Rhizobium sp. N541 Isolate Nodule
95 2721755810 Rhizobium sp. N871 Isolate Nodule
96 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
97 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
98 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
99 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
100 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
101 2728369365 Rhizobium sp. N1341 Isolate Nodule
102 2728369397 Rhizobium sp. N1314 Isolate Nodule
103 2738541293 Rhizobium sp. GV031 Isolate Unclassified
104 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
105 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
106 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
107 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
108 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
109 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
110 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
111 2791355256 Rhizobium sp. M10 Isolate Nodule
112 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
113 2791355260 Rhizobium sp. L9 Isolate Nodule
114 2791355261 Rhizobium sp. J15 Isolate Nodule
115 2791355262 Rhizobium sp. M1 Isolate Nodule
116 2791355263 Rhizobium chutanense C5 Isolate Nodule
117 2791355264 Rhizobium sp. S9 Isolate Nodule
118 2791355265 Rhizobium sp. H4 Isolate Nodule
119 2791355266 Rhizobium sp. L43 Isolate Nodule
120 2791355267 Rhizobium sp. L18 Isolate Nodule
121 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
122 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
123 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
124 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
125 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
126 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
127 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
128 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
129 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
130 2802429633 Rhizobium anhuiense J3 Isolate Nodule
131 2802429634 Rhizobium anhuiense S10 Isolate Nodule
132 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
133 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
134 2802429637 Rhizobium anhuiense C15 Isolate Nodule
135 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
136 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
137 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
138 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
139 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
140 2838048938 Rhizobium pisi 27/80 Isolate Nodule
141 2838061910 Rhizobium phaseoli L15 Isolate Nodule
142 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
143 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
144 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
145 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
146 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
147 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
148 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
149 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
150 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
151 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
152 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
153 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
154 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
155 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
156 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
157 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
158 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
159 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
160 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
161 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
162 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
163 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
164 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
165 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
166 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
167 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
168 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
169 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
170 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
171 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
172 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
173 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
174 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
175 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
176 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
177 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
178 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
179 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
180 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
181 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
182 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
183 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
184 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
185 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
186 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
187 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
188 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
189 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
190 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
191 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
192 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
193 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
194 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
195 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
196 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
197 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
198 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
199 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
200 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
201 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
202 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
203 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
204 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
205 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
206 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
207 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
208 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
209 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
210 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
211 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
212 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
213 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
214 2844163670 Ensifer sp. 1H6 Isolate Unclassified
215 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
216 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
217 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
218 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
219 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
220 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
221 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
222 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
223 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
224 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
225 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
226 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
227 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
228 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
229 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
230 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
231 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
232 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
233 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
234 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
235 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
236 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
237 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
238 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
239 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
240 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
241 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
242 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
243 2933599457 Rhizobium phaseoli M3 Isolate Nodule
244 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
245 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
246 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
247 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
248 2936381700 Rhizobium chutanense C16 Isolate Unclassified
249 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
250 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
251 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
252 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
253 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
254 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
255 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
256 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
257 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
258 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
259 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
260 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
261 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
262 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
263 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
264 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
265 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
266 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
267 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
268 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
269 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
270 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
271 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
272 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
273 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
274 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
275 2996887358 Rhizobium sp. R711 Isolate Nodule
276 2996893221 Rhizobium sp. R635 Isolate Nodule
277 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
278 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
279 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
280 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
281 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
282 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
283 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
284 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
285 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
286 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
287 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
288 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
289 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
290 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
291 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
292 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
293 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
294 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
295 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
296 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
297 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
298 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
299 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
300 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
301 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
302 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
303 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
304 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
305 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
306 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
307 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
308 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
309 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
310 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
311 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
312 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
313 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
314 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
315 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
316 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
317 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
318 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
319 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
320 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
321 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
322 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
323 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
324 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
325 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
326 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
327 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
328 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
329 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
330 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
331 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
332 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
333 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
334 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
335 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
336 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
337 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
338 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
339 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
340 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
341 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
342 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
343 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
344 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
345 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
346 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
347 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
348 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
351 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
352 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
354 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
356 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
359 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
375 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
376 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
378 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
379 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
380 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
381 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
382 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
383 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
384 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
385 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
386 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
387 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
388 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
389 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
390 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
391 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
392 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
393 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
394 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
395 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
396 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
397 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
398 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
399 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
400 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
401 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
402 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
403 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
404 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
405 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
406 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
407 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
408 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
409 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
410 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
411 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
412 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
413 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
414 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
415 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
416 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
417 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
418 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
419 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
420 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
421 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
422 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
423 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
424 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
425 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
426 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
427 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
428 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
429 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
430 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
431 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
432 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
433 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
436 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
437 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
438 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
439 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
440 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
441 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
442 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
443 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
444 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
445 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
446 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
447 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
448 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
449 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
450 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
451 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
452 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
453 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
454 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
455 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
456 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
457 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
458 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
459 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
460 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
461 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
462 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
463 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
464 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
465 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
466 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
467 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
468 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
469 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
474 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
479 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
483 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
484 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
485 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
486 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
487 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
488 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
489 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
490 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
491 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
492 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
493 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
494 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
495 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
496 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
497 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
498 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
499 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
500 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
501 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
502 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
503 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
504 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
505 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
506 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
507 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
508 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
509 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
510 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
511 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
512 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
513 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
514 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
515 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
516 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
517 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
518 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
519 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
520 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
521 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
522 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
523 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
524 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
525 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
526 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
527 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
528 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
529 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
531 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
532 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
533 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
534 8005258706 Rhizobium sp. R693 Isolate Nodule
535 8005275841 Rhizobium sp. N4311 Isolate Nodule
536 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
537 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
538 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
539 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
540 8005321885 Rhizobium sp. R72 Isolate Nodule
541 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
542 8005382845 Rhizobium sp. R634 Isolate Nodule
543 8005395548 Rhizobium sp. R339 Isolate Nodule
544 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
545 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
546 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
547 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
548 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
549 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
550 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
551 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
552 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
553 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
554 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
555 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
556 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
557 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
558 8018176218 Rhizobium sp. N122 Isolate Nodule
559 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
560 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
561 8024501048 Rhizobium sp. H4 Isolate Nodule
562 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
563 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
564 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
565 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
566 8056382006 Rhizobium croatiense 13T Isolate Nodule
567 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
568 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.02
Metatranscriptomes 0.12
Isolates 38.86

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 21.8
Nodule 28.5
Rhizoplane 0.61
Rhizosphere 30.33
Stem 0
Stem Tuber 0
Unclassified 18.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000532 3300002739 Bacteria 7661
2 JGI25152J39213_1000299 3300002773 Bacteria 32046
3 JGI25152J39213_1001759 3300002773 Bacteria 8832
4 JGI25152J39213_1001838 3300002773 Bacteria 8568
5 JGI25152J39213_1014590 3300002773 Bacteria 1586
6 JGI25152J39213_1015163 3300002773 Bacteria 1529
7 JGI25150J39212_1000042 3300002774 Bacteria 84513
8 JGI25150J39212_1008697 3300002774 Bacteria 1972
9 JGI25159J45721_1008847 3300002987 Bacteria 2722
10 JGI25151J46595_10000099 3300003187 Bacteria 117428
11 JGI25151J46595_10000707 3300003187 Bacteria 27959
12 JGI25151J46595_10003499 3300003187 Bacteria 8664
13 JGI25151J46595_10032015 3300003187 Bacteria 2044
14 JGI25153J46596_10000953 3300003215 Bacteria 17559
15 JGI25153J46596_10002035 3300003215 Bacteria 11908
16 JGI25153J46596_10004310 3300003215 Bacteria 7689
17 JGI25153J46596_10007321 3300003215 Bacteria 5450
18 rootL2_10020451 3300003322 Bacteria 4405
19 rootL2_10065129 3300003322 Bacteria 2522
20 rootL2_10065130 3300003322 Bacteria 1335
21 rootH1_10174251 3300003323 Bacteria 2694
22 JGI25160J50197_1003186 3300003354 Bacteria 7439
23 JGI25160J50197_1022454 3300003354 Bacteria 1849
24 JGI25161J50226_1000293 3300003374 Bacteria 28183
25 JGI25161J50226_1004591 3300003374 Bacteria 2857
26 Ga0055526_1001989 3300003771 Bacteria 14087
27 Ga0055526_1003021 3300003771 Bacteria 10969
28 Ga0055526_1009211 3300003771 Bacteria 4791
29 Ga0055526_1012755 3300003771 Bacteria 3630
30 Ga0055526_1012963 3300003771 Bacteria 3574
31 Ga0055524_1002648 3300003775 Bacteria 9094
32 Ga0055524_1004437 3300003775 Bacteria 6474
33 Ga0055524_1015335 3300003775 Bacteria 2798
34 Ga0055524_1026201 3300003775 Bacteria 1809
35 Ga0055524_1028568 3300003775 Bacteria 1668
36 Ga0055528_1000286 3300003790 Bacteria 43168
37 Ga0055528_1001823 3300003790 Bacteria 12159
38 Ga0055528_1002756 3300003790 Bacteria 9206
39 Ga0055528_1006555 3300003790 Bacteria 5272
40 Ga0055528_1019371 3300003790 Bacteria 2259
41 Ga0055540_1000269 3300003792 Bacteria 47006
42 Ga0055540_1001448 3300003792 Bacteria 14130
43 Ga0055540_1038019 3300003792 Bacteria 1057
44 Ga0055531_10045230 3300003794 Bacteria 1224
45 Ga0058692_1001729 3300003856 Bacteria 7785
46 Ga0055543_1000208 3300004625 Bacteria 47499
47 Ga0055543_1001693 3300004625 Bacteria 8325
48 Ga0065165_1007867 3300005262 Bacteria 5125
49 Ga0065165_1018080 3300005262 Bacteria 2569
50 Ga0070666_10267732 3300005335 Bacteria 1212
51 Ga0070668_100025317 3300005347 Bacteria 4498
52 Ga0070669_100342706 3300005353 Bacteria 1211
53 Ga0070671_100042243 3300005355 Bacteria 3790
54 Ga0070714_100021591 3300005435 Bacteria 5268
55 Ga0070713_100020692 3300005436 Bacteria 5049
56 Ga0070710_10024222 3300005437 Bacteria 3199
57 Ga0070711_100015289 3300005439 Bacteria 4858
58 Ga0070678_100862363 3300005456 Bacteria 826
59 Ga0070665_100186541 3300005548 Bacteria 2075
60 Ga0068859_100278881 3300005617 Bacteria 1764
61 Ga0068860_100410902 3300005843 Bacteria 1340
62 Ga0081539_10011176 3300005985 Bacteria 7150
63 Ga0070717_10311575 3300006028 Bacteria 1401
64 Ga0075365_10000590 3300006038 Bacteria 14156
65 Ga0075365_10040679 3300006038 Bacteria 3032
66 Ga0075365_10158017 3300006038 Bacteria 1578
67 Ga0075365_10286577 3300006038 Bacteria 1159
68 Ga0075368_10040949 3300006042 Bacteria 1819
69 Ga0075363_100029644 3300006048 Bacteria 2827
70 Ga0075363_100101560 3300006048 Bacteria 1592
71 Ga0075363_100203833 3300006048 Bacteria 1131
72 Ga0075363_100472514 3300006048 Bacteria 742
73 Ga0075364_10000081 3300006051 Bacteria 37644
74 Ga0070716_100016949 3300006173 Bacteria 3769
75 Ga0070712_100005269 3300006175 Bacteria 8001
76 Ga0075362_10001222 3300006177 Bacteria 8078
77 Ga0075362_10001794 3300006177 Bacteria 6998
78 Ga0075362_10002168 3300006177 Bacteria 6501
79 Ga0075367_10007948 3300006178 Bacteria 5467
80 Ga0075367_10181468 3300006178 Bacteria 1312
81 Ga0075369_10001312 3300006186 Bacteria 8467
82 Ga0075369_10013695 3300006186 Bacteria 3226
83 Ga0075369_10026203 3300006186 Bacteria 2429
84 Ga0075369_10143042 3300006186 Bacteria 1091
85 Ga0075366_10082440 3300006195 Bacteria 1921
86 Ga0075370_10119463 3300006353 Bacteria 1534
87 Ga0075370_10257790 3300006353 Bacteria 1034
88 Ga0097620_100278886 3300006931 Bacteria 1764
89 Ga0099826_10025839 3300006948 Bacteria 4345
90 Ga0105251_10009920 3300009011 Bacteria 5574
91 Ga0105243_10001440 3300009148 Bacteria 20945
92 Ga0105248_10122679 3300009177 Bacteria 2931
93 Ga0105249_10030167 3300009553 Bacteria 4900
94 Ga0123341_1000027 3300009765 Bacteria 69241
95 Ga0123341_1064623 3300009765 Bacteria 1717
96 Ga0123342_1013721 3300009766 Bacteria 8011
97 Ga0123342_1016781 3300009766 Bacteria 6279
98 Ga0105239_10943758 3300010375 Bacteria 991
99 Ga0105246_10212264 3300011119 Bacteria 1511
100 Ga0157326_1005241 3300012513 Bacteria 1367
101 Ga0157373_10007389 3300013100 Bacteria 8176
102 Ga0157371_10000058 3300013102 Bacteria 171756
103 Ga0157371_10018759 3300013102 Bacteria 5111
104 Ga0157370_10000030 3300013104 Bacteria 145571
105 Ga0163162_10057633 3300013306 Bacteria 3912
106 Ga0157380_10308008 3300014326 Bacteria 1462
107 Ga0213872_10097186 3300021361 Bacteria 1315
108 Ga0213871_10038850 3300021441 Bacteria 1272
109 Ga0209436_100077 3300025208 Bacteria 49473
110 Ga0207425_1000012 3300025245 Bacteria 528324
111 Ga0207425_1002173 3300025245 Bacteria 7154
112 Ga0207425_1002832 3300025245 Bacteria 5832
113 Ga0207425_1006197 3300025245 Bacteria 3301
114 Ga0209129_1000086 3300025258 Bacteria 181543
115 Ga0209129_1000407 3300025258 Bacteria 33939
116 Ga0209129_1000574 3300025258 Bacteria 25375
117 Ga0209129_1000606 3300025258 Bacteria 24232
118 Ga0209129_1002109 3300025258 Bacteria 10133
119 Ga0209129_1032671 3300025258 Bacteria 859
120 Ga0209233_1001659 3300025261 Bacteria 8673
121 Ga0209565_1032718 3300025263 Bacteria 1004
122 Ga0209455_1008764 3300025272 Bacteria 2716
123 Ga0209673_1000091 3300025273 Bacteria 201875
124 Ga0209673_1000122 3300025273 Bacteria 170443
125 Ga0209673_1001754 3300025273 Bacteria 18083
126 Ga0209673_1002472 3300025273 Bacteria 12778
127 Ga0209673_1002920 3300025273 Bacteria 10776
128 Ga0209673_1003306 3300025273 Bacteria 9657
129 Ga0209673_1007480 3300025273 Bacteria 5024
130 Ga0209673_1007894 3300025273 Bacteria 4814
131 Ga0209673_1021978 3300025273 Bacteria 2215
132 Ga0209673_1033014 3300025273 Bacteria 1585
133 Ga0209130_1000015 3300025284 Bacteria 409631
134 Ga0209130_1023599 3300025284 Bacteria 1354
135 Ga0209675_1012763 3300025291 Bacteria 2681
136 Ga0209676_1041644 3300025292 Bacteria 1281
137 Ga0209025_1000024 3300025294 Bacteria 528324
138 Ga0209025_1000549 3300025294 Bacteria 70203
139 Ga0209025_1002432 3300025294 Bacteria 19756
140 Ga0209025_1004013 3300025294 Bacteria 13191
141 Ga0209025_1012497 3300025294 Bacteria 5432
142 Ga0209025_1020562 3300025294 Bacteria 3603
143 Ga0209564_1000742 3300025295 Bacteria 46299
144 Ga0209564_1000956 3300025295 Bacteria 36719
145 Ga0209564_1002225 3300025295 Bacteria 16058
146 Ga0209564_1019755 3300025295 Bacteria 2503
147 Ga0209564_1023063 3300025295 Bacteria 2176
148 Ga0209564_1056802 3300025295 Bacteria 907
149 Ga0209758_1000046 3300025297 Bacteria 364931
150 Ga0209758_1000325 3300025297 Bacteria 91078
151 Ga0209758_1000943 3300025297 Bacteria 39158
152 Ga0209758_1003780 3300025297 Bacteria 13345
153 Ga0209758_1005148 3300025297 Bacteria 10299
154 Ga0209758_1022008 3300025297 Bacteria 2943
155 Ga0209758_1048725 3300025297 Bacteria 1503
156 Ga0209050_1005963 3300025298 Bacteria 7406
157 Ga0209256_1000858 3300025299 Bacteria 37944
158 Ga0209256_1002268 3300025299 Bacteria 16299
159 Ga0209256_1004834 3300025299 Bacteria 8159
160 Ga0209256_1020514 3300025299 Bacteria 2060
161 Ga0209256_1023043 3300025299 Bacteria 1867
162 Ga0209256_1049253 3300025299 Bacteria 1027
163 Ga0207426_1000063 3300025302 Bacteria 358920
164 Ga0207426_1000144 3300025302 Bacteria 191590
165 Ga0207426_1000457 3300025302 Bacteria 64140
166 Ga0209051_1000084 3300025303 Bacteria 190324
167 Ga0209051_1082600 3300025303 Bacteria 921
168 Ga0209257_1011040 3300025304 Bacteria 4430
169 Ga0207692_10006926 3300025898 Bacteria 4620
170 Ga0207699_10013180 3300025906 Bacteria 4222
171 Ga0207693_10003692 3300025915 Bacteria 13058
172 Ga0207663_10007245 3300025916 Bacteria 5742
173 Ga0207700_10099504 3300025928 Bacteria 2315
174 Ga0207664_10014000 3300025929 Bacteria 5781
175 Ga0207644_10205183 3300025931 Bacteria 1556
176 Ga0207704_10223160 3300025938 Bacteria 1396
177 Ga0207665_10010746 3300025939 Bacteria 6011
178 Ga0207711_10688312 3300025941 Bacteria 954
179 Ga0207712_10158894 3300025961 Bacteria 1754
180 Ga0207668_10029728 3300025972 Bacteria 3584
181 Ga0207658_10611166 3300025986 Bacteria 980
182 Ga0209371_1001246 3300027312 Bacteria 18206
183 Ga0209813_10007036 3300027866 Bacteria 2794
184 Ga0268266_10005040 3300028379 Bacteria 12467
185 Ga0268266_10231567 3300028379 Bacteria 1702
186 Ga0268266_10750236 3300028379 Bacteria 942
187 Ga0307515_10037818 3300028794 Bacteria 7742
188 Ga0307515_10072614 3300028794 Bacteria 4639
189 Ga0307515_10161137 3300028794 Bacteria 2287
190 Ga0268256_1021460 3300030500 Bacteria 1716
191 Ga0307513_10054163 3300031456 Bacteria 4304
192 Ga0307405_10002002 3300031731 Bacteria 8826
193 Ga0307406_10318876 3300031901 Bacteria 1201
194 Ga0307412_10001263 3300031911 Bacteria 14197
195 Ga0307412_10434001 3300031911 Bacteria 1078
196 Ga0307409_100056265 3300031995 Bacteria 3041
197 Ga0307409_100057675 3300031995 Bacteria 3011
198 Ga0395900_0411792 3300037418 Bacteria 1314
199 Ga0395905_0000441 3300037471 Bacteria 58119
200 Ga0395905_0001982 3300037471 Bacteria 23399
201 Ga0436365_0254157 3300039437 Bacteria 1449
202 Ga0436365_0272981 3300039437 Bacteria 13867
203 Ga0436361_1102652 3300039447 Bacteria 995
204 Ga0436362_0031769 3300039453 Bacteria 3568
205 Ga0436362_0867338 3300039453 Bacteria 1196
206 Ga0439436_0005614 3300041404 Bacteria 3846
207 Ga0439438_047814 3300041405 Bacteria 1095
208 Ga0439447_031879 3300041407 Bacteria 1321
209 Ga0439466_0044779 3300041411 Bacteria 1465
210 Ga0439466_0056376 3300041411 Bacteria 1275
211 Ga0439466_0086615 3300041411 Bacteria 984
212 Ga0439465_0005465 3300041413 Bacteria 4057
213 Ga0439465_0012830 3300041413 Bacteria 2621
214 Ga0439465_0029327 3300041413 Bacteria 1747
215 Ga0451793_1814710 3300041452 Bacteria 2513
216 Ga0451807_1674064 3300041486 Bacteria 886
217 Ga0451833_0413439 3300041491 Bacteria 1632
218 Ga0451835_0522946 3300041492 Bacteria 773
219 Ga0451837_0908353 3300041494 Bacteria 1114
220 Ga0451839_1546199 3300041496 Bacteria 1382
221 Ga0451841_0381772 3300041498 Bacteria 2632
222 Ga0451845_0391110 3300041501 Bacteria 929
223 Ga0451847_0223729 3300041503 Bacteria 1873
224 Ga0451849_0803637 3300041505 Bacteria 1816
225 Ga0451851_1377737 3300041507 Bacteria 1387
226 Ga0451855_0110618 3300041511 Bacteria 800
227 Ga0451853_3313646 3300041512 Bacteria 3133
228 Ga0439445_0055085 3300042004 Bacteria 1079
229 Ga0439449_0052980 3300042007 Bacteria 1500
230 Ga0439462_0022829 3300042015 Bacteria 1638
231 Ga0439462_0034394 3300042015 Bacteria 1345
232 Ga0450923_081379 3300042125 Bacteria 729
233 Ga0439434_0122654 3300042435 Bacteria 848
234 Ga0450918_003636 3300042531 Bacteria 2853
235 Ga0466971_0193025 3300044719 Bacteria 960
236 Ga0466957_0059834 3300044842 Bacteria 2336
237 Ga0451576_1143663 3300045051 Bacteria 814
238 Ga0466958_0038294 3300045836 Bacteria 2877
239 Ga0495617_112134 3300046452 Bacteria 882
240 Ga0495627_090870 3300046453 Bacteria 878
241 Ga0495591_063521 3300046458 Bacteria 975
242 Ga0495638_0001215 3300046460 Bacteria 24561
243 Ga0495638_0029794 3300046460 Bacteria 3519
244 Ga0495638_0282593 3300046460 Bacteria 901
245 Ga0495650_0132313 3300046471 Bacteria 909
246 Ga0495605_0001185 3300046474 Bacteria 17342
247 Ga0495585_0001367 3300046492 Bacteria 19313
248 Ga0495585_0015286 3300046492 Bacteria 4460
249 Ga0495585_0056108 3300046492 Bacteria 2176
250 Ga0495607_0032217 3300046501 Bacteria 3202
251 Ga0495607_0056264 3300046501 Bacteria 2259
252 Ga0495607_0074039 3300046501 Bacteria 1891
253 Ga0495607_0164131 3300046501 Bacteria 1126
254 Ga0495583_0001517 3300046506 Bacteria 23050
255 Ga0495583_0011659 3300046506 Bacteria 5036
256 Ga0495583_0080103 3300046506 Bacteria 1420
257 Ga0495606_0030939 3300046507 Bacteria 3729
258 Ga0495606_0136016 3300046507 Bacteria 1455
259 Ga0495606_0215730 3300046507 Bacteria 1084
260 Ga0495606_0358204 3300046507 Bacteria 772
261 Ga0495610_0000975 3300046512 Bacteria 26429
262 Ga0495610_0077345 3300046512 Bacteria 1537
263 Ga0495610_0094707 3300046512 Bacteria 1347
264 Ga0495616_0032981 3300046513 Bacteria 2702
265 Ga0495620_0030129 3300046515 Bacteria 2502
266 Ga0495620_0056271 3300046515 Bacteria 1655
267 Ga0495620_0075407 3300046515 Bacteria 1372
268 Ga0495631_0000622 3300046518 Bacteria 23323
269 Ga0495632_0002976 3300046519 Bacteria 12398
270 Ga0495632_0011065 3300046519 Bacteria 5287
271 Ga0495632_0022267 3300046519 Bacteria 3398
272 Ga0495643_0016384 3300046522 Bacteria 4352
273 Ga0495643_0032625 3300046522 Bacteria 2889
274 Ga0495648_0046821 3300046524 Bacteria 2678
275 Ga0495654_0061374 3300046530 Bacteria 1805
276 Ga0495609_0020630 3300046538 Bacteria 3043
277 Ga0495609_0048957 3300046538 Bacteria 1887
278 Ga0495597_0009327 3300046542 Bacteria 4856
279 Ga0495633_0011727 3300046558 Bacteria 4706
280 Ga0495633_0118680 3300046558 Bacteria 1225
281 Ga0495668_0001429 3300046616 Bacteria 23122
282 Ga0495668_0036253 3300046616 Bacteria 2763
283 Ga0495668_0075704 3300046616 Bacteria 1848
284 Ga0495611_0045956 3300046648 Bacteria 1956
285 Ga0495625_0001674 3300046660 Bacteria 25895
286 Ga0495625_0050440 3300046660 Bacteria 2986
287 Ga0495625_0175674 3300046660 Bacteria 1427
288 Ga0495625_0196987 3300046660 Bacteria 1331
289 Ga0495625_0396546 3300046660 Bacteria 863
290 Ga0495625_0572631 3300046660 Bacteria 681
291 Ga0495661_0042229 3300046665 Bacteria 2812
292 Ga0495661_0134329 3300046665 Bacteria 1352
293 Ga0495588_0001462 3300046674 Bacteria 10139
294 Ga0495670_0315028 3300046691 Bacteria 839
295 Ga0495671_0012107 3300046692 Bacteria 4715
296 Ga0495671_0126502 3300046692 Bacteria 1246
297 Ga0495649_0006928 3300046694 Bacteria 7004
298 Ga0495649_0092932 3300046694 Bacteria 1606
299 Ga0495589_0080129 3300046794 Bacteria 1589
300 Ga0495660_0066667 3300046810 Bacteria 1919
301 Ga0495660_0113398 3300046810 Bacteria 1380
302 Ga0495636_0013749 3300047318 Bacteria 3213
303 Ga0495636_0095426 3300047318 Bacteria 1295
304 Ga0495687_080642 3300047443 Bacteria 1276
305 Ga0495673_0023350 3300047469 Bacteria 3010
306 Ga0495681_0018598 3300047470 Bacteria 3824
307 Ga0495681_0021238 3300047470 Bacteria 3502
308 Ga0495681_0121044 3300047470 Bacteria 1123
309 Ga0495686_0013801 3300047472 Bacteria 5597
310 Ga0495686_0063904 3300047472 Bacteria 2280
311 Ga0495626_0052540 3300048091 Bacteria 1878
312 Ga0496106_0003687 3300048909 Bacteria 11424
313 Ga0496107_0125386 3300048910 Bacteria 1893
314 Ga0496116_0000080 3300048919 Bacteria 224530
315 Ga0496116_0002774 3300048919 Bacteria 18003
316 Ga0496116_0011522 3300048919 Bacteria 7307
317 Ga0496116_0048828 3300048919 Bacteria 2836
318 Ga0496116_0087695 3300048919 Bacteria 1903
319 Ga0496116_0112302 3300048919 Bacteria 1597
320 Ga0496116_0309067 3300048919 Bacteria 747
321 Ga0496117_0000002 3300048920 Bacteria 2483758
322 Ga0496117_0009433 3300048920 Bacteria 9081
323 Ga0496117_0012672 3300048920 Bacteria 7408
324 Ga0496117_0050507 3300048920 Bacteria 2949
325 Ga0496117_0079586 3300048920 Bacteria 2158
326 Ga0496117_0180040 3300048920 Bacteria 1216
327 Ga0496118_0001656 3300048921 Bacteria 32720
328 Ga0496118_0002528 3300048921 Bacteria 24531
329 Ga0496118_0010583 3300048921 Bacteria 9116
330 Ga0496118_0030970 3300048921 Bacteria 4449
331 Ga0496118_0061601 3300048921 Bacteria 2777
332 Ga0496118_0095433 3300048921 Bacteria 2030
333 Ga0496119_0021053 3300048922 Bacteria 4728
334 Ga0496119_0063384 3300048922 Bacteria 2199
335 Ga0496119_0151937 3300048922 Bacteria 1240
336 Ga0496119_0187669 3300048922 Bacteria 1080
337 Ga0496120_0000021 3300048923 Bacteria 250966
338 Ga0496121_0000001 3300048924 Bacteria 1830318
339 Ga0496121_0000459 3300048924 Bacteria 80085
340 Ga0496121_0010824 3300048924 Bacteria 10207
341 Ga0496121_0012633 3300048924 Bacteria 9173
342 Ga0496121_0115399 3300048924 Bacteria 2039
343 Ga0496121_0148786 3300048924 Bacteria 1726
344 Ga0496121_0360905 3300048924 Bacteria 964
345 Ga0496121_0467769 3300048924 Bacteria 808
346 Ga0496122_0000001 3300048925 Bacteria 1827766
347 Ga0496122_0043269 3300048925 Bacteria 3530
348 Ga0496122_0055172 3300048925 Bacteria 2976
349 Ga0496122_0207660 3300048925 Bacteria 1138
350 Ga0496123_0000001 3300048926 Bacteria 1831497
351 Ga0496123_0012028 3300048926 Bacteria 7421
352 Ga0496123_0025199 3300048926 Bacteria 4491
353 Ga0496123_0039787 3300048926 Bacteria 3284
354 Ga0496123_0044158 3300048926 Bacteria 3051
355 Ga0496123_0048638 3300048926 Bacteria 2851
356 Ga0496123_0086518 3300048926 Bacteria 1879
357 Ga0496123_0105403 3300048926 Bacteria 1627
358 Ga0496123_0163252 3300048926 Bacteria 1185
359 Ga0496123_0259765 3300048926 Bacteria 852
360 Ga0496124_0000063 3300048927 Bacteria 229705
361 Ga0496124_0000592 3300048927 Bacteria 61048
362 Ga0496124_0001578 3300048927 Bacteria 32915
363 Ga0496124_0002394 3300048927 Bacteria 24664
364 Ga0496124_0010507 3300048927 Bacteria 9367
365 Ga0496124_0043993 3300048927 Bacteria 3835
366 Ga0496124_0083342 3300048927 Bacteria 2623
367 Ga0496124_0178157 3300048927 Bacteria 1638
368 Ga0496124_0178558 3300048927 Bacteria 1636
369 Ga0496124_0246599 3300048927 Bacteria 1324
370 Ga0496124_0252729 3300048927 Bacteria 1302
371 Ga0496124_0265211 3300048927 Bacteria 1261
372 Ga0496124_0318818 3300048927 Bacteria 1114
373 Ga0496124_0433014 3300048927 Bacteria 902
374 Ga0496124_0478837 3300048927 Bacteria 841
375 Ga0496124_0500010 3300048927 Bacteria 815
376 Ga0496125_0000001 3300048928 Bacteria 1766138
377 Ga0496125_0051668 3300048928 Bacteria 3387
378 Ga0496125_0056993 3300048928 Bacteria 3168
379 Ga0496125_0074630 3300048928 Bacteria 2628
380 Ga0496125_0184793 3300048928 Bacteria 1384
381 Ga0496125_0235428 3300048928 Bacteria 1167
382 Ga0496125_0249660 3300048928 Bacteria 1120
383 Ga0496126_0000438 3300048929 Bacteria 83060
384 Ga0496126_0008387 3300048929 Bacteria 11151
385 Ga0496126_0010242 3300048929 Bacteria 9854
386 Ga0496126_0034902 3300048929 Bacteria 4718
387 Ga0496126_0062612 3300048929 Bacteria 3337
388 Ga0496126_0099206 3300048929 Bacteria 2551
389 Ga0496126_0262838 3300048929 Bacteria 1434
390 Ga0495678_006164 3300049459 Bacteria 6431
391 Ga0495682_0012096 3300049460 Bacteria 3317
392 Ga0501031_0014310 3300049568 Bacteria 5159
393 Ga0501031_0019147 3300049568 Bacteria 4457
394 Ga0501031_0118429 3300049568 Bacteria 1730
395 Ga0501032_0001183 3300049569 Bacteria 20900
396 Ga0501033_0000171 3300049570 Bacteria 61888
397 Ga0501033_0000185 3300049570 Bacteria 59836
398 Ga0501033_0025214 3300049570 Bacteria 4480
399 Ga0501033_0152770 3300049570 Bacteria 1665
400 Ga0501033_0277323 3300049570 Bacteria 1184
401 Ga0501034_0201309 3300049571 Bacteria 1949
402 Ga0501036_0072284 3300049572 Bacteria 2916
403 Ga0501036_0319510 3300049572 Bacteria 1297
404 Ga0501037_0000089 3300049573 Bacteria 85102
405 Ga0501037_0204520 3300049573 Bacteria 1394
406 Ga0501038_0212838 3300049574 Bacteria 1545
407 Ga0501038_0338206 3300049574 Bacteria 1174
408 Ga0501038_0474092 3300049574 Bacteria 960
409 Ga0501039_0669593 3300049575 Bacteria 812
410 Ga0501040_0000155 3300049576 Bacteria 37853
411 Ga0501042_0012756 3300049578 Bacteria 5702
412 Ga0501043_0000007 3300049579 Bacteria 224595
413 Ga0501043_0026297 3300049579 Bacteria 4566
414 Ga0501043_0073365 3300049579 Bacteria 2688
415 Ga0501043_0545042 3300049579 Bacteria 862
416 Ga0501046_0080619 3300049580 Bacteria 2515
417 Ga0501047_0037983 3300049581 Bacteria 4658
418 Ga0501047_0065153 3300049581 Bacteria 3512
419 Ga0501048_0089675 3300049582 Bacteria 2169
420 Ga0501067_0011085 3300049583 Bacteria 4988
421 Ga0501069_0000001 3300049585 Bacteria 289100
422 Ga0501069_0024050 3300049585 Bacteria 3323
423 Ga0501070_0000789 3300049586 Bacteria 28809
424 Ga0501070_0001012 3300049586 Bacteria 25214
425 Ga0501070_0060282 3300049586 Bacteria 3145
426 Ga0501071_0003380 3300049587 Bacteria 9967
427 Ga0501073_0110904 3300049589 Bacteria 1903
428 Ga0501073_0601689 3300049589 Bacteria 759
429 Ga0501074_0000003 3300049590 Bacteria 116101
430 Ga0501074_0036374 3300049590 Bacteria 3566
431 Ga0501080_0000090 3300049742 Bacteria 61585
432 Ga0501080_0002221 3300049742 Bacteria 16875
433 Ga0501083_0000012 3300049744 Bacteria 178668
434 Ga0501083_0060895 3300049744 Bacteria 2521
435 Ga0501083_0163778 3300049744 Bacteria 1454
436 Ga0501280_003025 3300049776 Bacteria 2657
437 Ga0501282_010730 3300049778 Bacteria 984
438 Ga0501035_0000037 3300049822 Bacteria 160921
439 Ga0501035_0001616 3300049822 Bacteria 22785
440 Ga0501035_0003264 3300049822 Bacteria 15543
441 Ga0501035_0016445 3300049822 Bacteria 6823
442 Ga0501035_0097703 3300049822 Bacteria 2579
443 Ga0501044_0000018 3300049823 Bacteria 225885
444 Ga0501044_0021300 3300049823 Bacteria 6918
445 Ga0501044_0029725 3300049823 Bacteria 5761
446 Ga0501044_0070565 3300049823 Bacteria 3553
447 nmdc:mga03683_10785_c1 3300050489 Bacteria 3284
448 nmdc:mga03683_31278_c1 3300050489 Bacteria 2134
449 nmdc:mga03n38_25360_c1 3300050490 Bacteria 2434
450 nmdc:mga00v17_174629_c1 3300050491 Bacteria 1386
451 nmdc:mga00v17_76659_c1 3300050491 Bacteria 2080
452 nmdc:mga00v17_90_c1 3300050491 Bacteria 53278
453 nmdc:mga00v17_92_c1 3300050491 Bacteria 53037
454 nmdc:mga0yw44_160973_c1 3300050492 Bacteria 1469
455 nmdc:mga0yw44_19554_c1 3300050492 Bacteria 3738
456 nmdc:mga0yw44_312608_c1 3300050492 Bacteria 1054
457 nmdc:mga0yw44_35363_c1 3300050492 Bacteria 2422
458 nmdc:mga0k408_61949_c1 3300050493 Bacteria 2175
459 nmdc:mga06z11_4561_c1 3300050494 Bacteria 5460
460 nmdc:mga06z11_79836_c1 3300050494 Bacteria 1753
461 nmdc:mga04h51_7987_c1 3300050495 Bacteria 2817
462 nmdc:mga07m45_182062_c1 3300050496 Bacteria 1222
463 nmdc:mga07m45_227124_c1 3300050496 Bacteria 1086
464 nmdc:mga07m45_241236_c1 3300050496 Bacteria 1052
465 nmdc:mga07m45_397183_c1 3300050496 Bacteria 800
466 nmdc:mga0sz30_23850_c1 3300050516 Bacteria 2493
467 nmdc:mga0sz30_29292_c1 3300050516 Bacteria 2269
468 nmdc:mga0sz30_37143_c1 3300050516 Bacteria 2038
469 nmdc:mga0sz30_877_c1 3300050516 Bacteria 10830
470 Ga0500610_0085552 3300053079 Bacteria 1641
471 Ga0500643_050570 3300053087 Bacteria 1189
472 Ga0500644_0158168 3300053088 Bacteria 914
473 Ga0500646_0087540 3300053090 Bacteria 960
474 Ga0500560_008255 3300053107 Bacteria 2497
475 Ga0500569_007868 3300053109 Bacteria 2413
476 Ga0500572_002438 3300053111 Bacteria 4480
477 Ga0500594_0012074 3300053118 Bacteria 2028
478 Ga0500618_020406 3300053125 Bacteria 1622
479 Ga0500658_0016373 3300053134 Bacteria 2762
480 Ga0500559_0000610 3300053136 Bacteria 24302
481 Ga0500559_0002817 3300053136 Bacteria 8787
482 Ga0500561_0000144 3300053137 Bacteria 13489
483 Ga0500568_0000533 3300053139 Bacteria 28047
484 Ga0500568_0001961 3300053139 Bacteria 12579
485 Ga0500604_0004283 3300053151 Bacteria 3789
486 Ga0500604_0007193 3300053151 Bacteria 2947
487 Ga0500616_0001527 3300053153 Bacteria 21789
488 Ga0500616_0072565 3300053153 Bacteria 1749
489 Ga0500622_0000342 3300053156 Bacteria 45708
490 Ga0500624_001550 3300053157 Bacteria 3568
491 Ga0500624_041075 3300053157 Bacteria 831
492 Ga0500627_0082464 3300053158 Bacteria 1435
493 Ga0500633_0009080 3300053160 Bacteria 2596
494 Ga0500634_0040548 3300053161 Bacteria 2531
495 Ga0500636_0002054 3300053177 Bacteria 11102
496 Ga0500576_012388 3300053725 Bacteria 3806
497 Ga0500645_017487 3300053730 Bacteria 2247
498 Ga0500596_005567 3300053735 Bacteria 2201
499 Ga0501084_0573866 3300054114 Bacteria 953
500 Ga0587072_010252 3300059643 Bacteria 1511
501 Ga0501082_0004173 3300060353 Bacteria 12628
502 Ga0501082_0232386 3300060353 Bacteria 1605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_100057675 Ga0307409_1000576752 196
2 3300041404 Ga0439436_0005614 Ga0439436_0005614_2932_3564 196
3 3300041405 Ga0439438_047814 Ga0439438_047814_421_1053 196
4 3300041411 Ga0439466_0086615 Ga0439466_0086615_159_791 196
5 3300041413 Ga0439465_0005465 Ga0439465_0005465_2978_3610 196
6 3300042007 Ga0439449_0052980 Ga0439449_0052980_201_833 196
7 3300042125 Ga0450923_081379 Ga0450923_081379_10_717 196
8 3300042435 Ga0439434_0122654 Ga0439434_0122654_148_780 196
9 3300042531 Ga0450918_003636 Ga0450918_003636_286_918 196
10 3300046460 Ga0495638_0282593 Ga0495638_0282593_225_857 196
11 3300042015 Ga0439462_0022829 Ga0439462_0022829_696_1328 197
12 3300046660 Ga0495625_0396546 Ga0495625_0396546_12_644 197
13 3300053151 Ga0500604_0004283 Ga0500604_0004283_2022_2654 197
14 3300048927 Ga0496124_0000063 Ga0496124_0000063_20163_20792 198
15 iso_pu_bacteria 2643221689 2644497361 198
16 3300003771 Ga0055526_1012755 Ga0055526_10127552 202
17 3300003775 Ga0055524_1004437 Ga0055524_10044376 202
18 3300005262 Ga0065165_1018080 Ga0065165_10180802 202
19 3300011119 Ga0105246_10212264 Ga0105246_102122642 202
20 3300013102 Ga0157371_10018759 Ga0157371_100187592 202
21 3300013306 Ga0163162_10057633 Ga0163162_100576333 202
22 3300014326 Ga0157380_10308008 Ga0157380_103080082 202
23 3300025258 Ga0209129_1000407 Ga0209129_100040713 202
24 3300025294 Ga0209025_1002432 Ga0209025_100243216 202
25 3300025299 Ga0209256_1023043 Ga0209256_10230432 202
26 3300041494 Ga0451837_0908353 Ga0451837_0908353_486_1103 202
27 3300046507 Ga0495606_0358204 Ga0495606_0358204_19_627 202
28 3300046660 Ga0495625_0572631 Ga0495625_0572631_19_627 202
29 3300046674 Ga0495588_0001462 Ga0495588_0001462_5853_6461 202
30 3300046692 Ga0495671_0012107 Ga0495671_0012107_538_1146 202
31 3300047470 Ga0495681_0018598 Ga0495681_0018598_2915_3523 202
32 3300048910 Ga0496107_0125386 Ga0496107_0125386_10_618 202
33 3300048919 Ga0496116_0000080 Ga0496116_0000080_96469_97077 202
34 3300048921 Ga0496118_0095433 Ga0496118_0095433_734_1342 202
35 3300048922 Ga0496119_0151937 Ga0496119_0151937_29_637 202
36 3300048924 Ga0496121_0360905 Ga0496121_0360905_13_621 202
37 3300048925 Ga0496122_0207660 Ga0496122_0207660_490_1098 202
38 3300048926 Ga0496123_0044158 Ga0496123_0044158_701_1309 202
39 3300048926 Ga0496123_0048638 Ga0496123_0048638_1296_1904 202
40 3300048927 Ga0496124_0083342 Ga0496124_0083342_1851_2459 202
41 3300048927 Ga0496124_0178558 Ga0496124_0178558_305_913 202
42 3300048927 Ga0496124_0246599 Ga0496124_0246599_512_1120 202
43 3300048927 Ga0496124_0265211 Ga0496124_0265211_512_1120 202
44 3300048927 Ga0496124_0478837 Ga0496124_0478837_12_629 202
45 3300048929 Ga0496126_0008387 Ga0496126_0008387_5061_5669 202
46 3300050491 nmdc:mga00v17_92_c1 nmdc:mga00v17_92_c1_25483_26103 202
47 3300050496 nmdc:mga07m45_227124_c1 nmdc:mga07m45_227124_c1_262_870 202
48 3300053111 Ga0500572_002438 Ga0500572_002438_1721_2329 202
49 3300053136 Ga0500559_0002817 Ga0500559_0002817_7396_8028 202
50 3300053177 Ga0500636_0002054 Ga0500636_0002054_477_1085 202
51 iso_pu_bacteria 2537561587 2537874360 205
52 iso_pu_bacteria 2558860242 2559293961 205
53 iso_pu_bacteria 2599185210 2599603715 205
54 iso_pu_bacteria 2643221568 2643856266 205
55 iso_pu_bacteria 2643221693 2644519124 205
56 iso_pu_bacteria 2808606387 2808986263 205
57 iso_pu_bacteria 2838675328 2838677123 205
58 iso_pu_bacteria 2838714209 2838716010 205
59 iso_pu_bacteria 2838719591 2838720188 205
60 iso_pu_bacteria 2838724970 2838726763 205
61 iso_pu_bacteria 2841846520 2841847122 205
62 iso_pu_bacteria 2841859092 2841860345 205
63 iso_pu_bacteria 2842124991 2842126848 205
64 iso_pu_bacteria 2842130223 2842132016 205
65 iso_pu_bacteria 2842152218 2842152814 205
66 iso_pu_bacteria 2842170452 2842172255 205
67 iso_pu_bacteria 2842175837 2842176433 205
68 iso_pu_bacteria 2842187318 2842189119 205
69 iso_pu_bacteria 2842211629 2842213432 205
70 iso_pu_bacteria 2842224351 2842224950 205
71 iso_pu_bacteria 2842515876 2842517130 205
72 iso_pu_bacteria 2899792073 2899792412 205
73 iso_pu_bacteria 2904690495 2904696380 205
74 iso_pu_bacteria 2908756301 2908760834 205
75 iso_pu_bacteria 2919114240 2919116214 205
76 iso_pu_bacteria 2919166419 2919166967 205
77 iso_pu_bacteria 2926754445 2926757168 205
78 iso_pu_bacteria 2926760298 2926761386 205
79 iso_pu_bacteria 2929138655 2929139057 205
80 iso_pu_bacteria 2933006813 2933007459 205
81 iso_pu_bacteria 2933011516 2933012227 205
82 iso_pu_bacteria 2967664464 2967670725 205
83 iso_pu_bacteria 2978969890 2978973386 205
84 iso_pu_bacteria 2979095461 2979099286 205
85 iso_pu_bacteria 2984587000 2984591668 205
86 iso_pu_bacteria 8054460903 8054461384 205
87 iso_pu_bacteria 2509276019 2509374826 206
88 iso_pu_bacteria 2509276021 2509388299 206
89 iso_pu_bacteria 2509276033 2509443866 206
90 iso_pu_bacteria 2510065019 2510131602 206
91 iso_pu_bacteria 2510461076 2510897896 206
92 iso_pu_bacteria 2510917028 2511185582 206
93 iso_pu_bacteria 2510917030 2511194450 206
94 iso_pu_bacteria 2513237084 2513571180 206
95 iso_pu_bacteria 2513237085 2513579280 206
96 iso_pu_bacteria 2513237088 2513598540 206
97 iso_pu_bacteria 2513237089 2513606675 206
98 iso_pu_bacteria 2513237093 2513632275 206
99 iso_pu_bacteria 2513237103 2513711601 206
100 iso_pu_bacteria 2513237138 2513866363 206
101 iso_pu_bacteria 2513237141 2513889971 206
102 iso_pu_bacteria 2513237156 2513986131 206
103 iso_pu_bacteria 2513237159 2513999863 206
104 iso_pu_bacteria 2513237160 2514007547 206
105 iso_pu_bacteria 2513237162 2514020899 206
106 iso_pu_bacteria 2515075009 2515110524 206
107 iso_pu_bacteria 2515154113 2515636876 206
108 iso_pu_bacteria 2515154114 2515645280 206
109 iso_pu_bacteria 2515154116 2515659493 206
110 iso_pu_bacteria 2515154134 2515742970 206
111 iso_pu_bacteria 2516143018 2516208572 206
112 iso_pu_bacteria 2516653077 2517039226 206
113 iso_pu_bacteria 2516653085 2517079469 206
114 iso_pu_bacteria 2517093000 2517093415 206
115 iso_pu_bacteria 2517287029 2517405112 206
116 iso_pu_bacteria 2517487022 2517568785 206
117 iso_pu_bacteria 2529292951 2530647685 206
118 iso_pu_bacteria 2534681796 2535515206 206
119 iso_pu_bacteria 2558860100 2558863818 206
120 iso_pu_bacteria 2582581283 2585165122 206
121 iso_pu_bacteria 2582581294 2585203784 206
122 iso_pu_bacteria 2582581298 2585225754 206
123 iso_pu_bacteria 2582581299 2585229094 206
124 iso_pu_bacteria 2582581304 2585257088 206
125 iso_pu_bacteria 2582581306 2585266666 206
126 iso_pu_bacteria 2582581865 2585387682 206
127 iso_pu_bacteria 2582581866 2585394276 206
128 iso_pu_bacteria 2582581867 2585398442 206
129 iso_pu_bacteria 2585427526 2585528422 206
130 iso_pu_bacteria 2585427528 2585539815 206
131 iso_pu_bacteria 2585427529 2585547971 206
132 iso_pu_bacteria 2585427590 2585819411 206
133 iso_pu_bacteria 2585427593 2585837796 206
134 iso_pu_bacteria 2585427594 2585844532 206
135 iso_pu_bacteria 2615840624 2616295787 206
136 iso_pu_bacteria 2643221599 2644007456 206
137 iso_pu_bacteria 2643221607 2644047020 206
138 iso_pu_bacteria 2643221618 2644103068 206
139 iso_pu_bacteria 2643221626 2644152003 206
140 iso_pu_bacteria 2643221634 2644190708 206
141 iso_pu_bacteria 2643221636 2644203541 206
142 iso_pu_bacteria 2643221637 2644206580 206
143 iso_pu_bacteria 2643221643 2644241438 206
144 iso_pu_bacteria 2643221655 2644305995 206
145 iso_pu_bacteria 2643221659 2644330303 206
146 iso_pu_bacteria 2643221686 2644479809 206
147 iso_pu_bacteria 2643221698 2644542950 206
148 iso_pu_bacteria 2643221712 2644619054 206
149 iso_pu_bacteria 2643221718 2644650227 206
150 iso_pu_bacteria 2657244999 2657682006 206
151 iso_pu_bacteria 2690316117 2692317143 206
152 iso_pu_bacteria 2718217882 2719179683 206
153 iso_pu_bacteria 2718217927 2719384296 206
154 iso_pu_bacteria 2718217997 2719664033 206
155 iso_pu_bacteria 2718218009 2719730353 206
156 iso_pu_bacteria 2718218199 2720490452 206
157 iso_pu_bacteria 2718218232 2720611831 206
158 iso_pu_bacteria 2718218233 2720618686 206
159 iso_pu_bacteria 2718218235 2720630085 206
160 iso_pu_bacteria 2718218269 2720773780 206
161 iso_pu_bacteria 2718218363 2721145776 206
162 iso_pu_bacteria 2718218366 2721162655 206
163 iso_pu_bacteria 2718218423 2721398010 206
164 iso_pu_bacteria 2721755514 2722838825 206
165 iso_pu_bacteria 2721755556 2723025450 206
166 iso_pu_bacteria 2721755684 2723559033 206
167 iso_pu_bacteria 2721755685 2723565640 206
168 iso_pu_bacteria 2721755809 2724036820 206
169 iso_pu_bacteria 2721755810 2724043109 206
170 iso_pu_bacteria 2721755819 2724088387 206
171 iso_pu_bacteria 2721755822 2724102905 206
172 iso_pu_bacteria 2721755823 2724108770 206
173 iso_pu_bacteria 2724679232 2725950123 206
174 iso_pu_bacteria 2728369352 2730106386 206
175 iso_pu_bacteria 2728369365 2730162920 206
176 iso_pu_bacteria 2738541293 2738803716 206
177 iso_pu_bacteria 2738541333 2739034672 206
178 iso_pu_bacteria 2765235942 2766065580 206
179 iso_pu_bacteria 2791355091 2792622342 206
180 iso_pu_bacteria 2791355092 2792628092 206
181 iso_pu_bacteria 2791355253 2793281943 206
182 iso_pu_bacteria 2791355256 2793295099 206
183 iso_pu_bacteria 2791355259 2793315308 206
184 iso_pu_bacteria 2791355261 2793326035 206
185 iso_pu_bacteria 2791355262 2793332547 206
186 iso_pu_bacteria 2791355263 2793343215 206
187 iso_pu_bacteria 2791355264 2793350698 206
188 iso_pu_bacteria 2791355266 2793362648 206
189 iso_pu_bacteria 2791355267 2793364799 206
190 iso_pu_bacteria 2802428858 2802717427 206
191 iso_pu_bacteria 2802428859 2802723646 206
192 iso_pu_bacteria 2802428860 2802730906 206
193 iso_pu_bacteria 2802428861 2802735912 206
194 iso_pu_bacteria 2802428862 2802743879 206
195 iso_pu_bacteria 2802428863 2802752904 206
196 iso_pu_bacteria 2802429268 2804751024 206
197 iso_pu_bacteria 2802429605 2805927468 206
198 iso_pu_bacteria 2802429606 2805932253 206
199 iso_pu_bacteria 2802429633 2806043971 206
200 iso_pu_bacteria 2802429634 2806052211 206
201 iso_pu_bacteria 2802429635 2806058512 206
202 iso_pu_bacteria 2802429636 2806067010 206
203 iso_pu_bacteria 2802429637 2806074753 206
204 iso_pu_bacteria 2838016132 2838022117 206
205 iso_pu_bacteria 2838022645 2838024526 206
206 iso_pu_bacteria 2838042994 2838047214 206
207 iso_pu_bacteria 2838048938 2838053923 206
208 iso_pu_bacteria 2838061910 2838066694 206
209 iso_pu_bacteria 2838068647 2838073750 206
210 iso_pu_bacteria 2838074704 2838075475 206
211 iso_pu_bacteria 2838668709 2838673180 206
212 iso_pu_bacteria 2838686498 2838692627 206
213 iso_pu_bacteria 2838701080 2838703982 206
214 iso_pu_bacteria 2838729681 2838732699 206
215 iso_pu_bacteria 2838742623 2838745594 206
216 iso_pu_bacteria 2841851746 2841855238 206
217 iso_pu_bacteria 2841864319 2841866689 206
218 iso_pu_bacteria 2842110456 2842112328 206
219 iso_pu_bacteria 2842146304 2842148226 206
220 iso_pu_bacteria 2842156927 2842161732 206
221 iso_pu_bacteria 2842163707 2842170131 206
222 iso_pu_bacteria 2842180545 2842185349 206
223 iso_pu_bacteria 2842192696 2842193020 206
224 iso_pu_bacteria 2842198810 2842200369 206
225 iso_pu_bacteria 2842205361 2842206815 206
226 iso_pu_bacteria 2842217011 2842218670 206
227 iso_pu_bacteria 2842229732 2842233287 206
228 iso_pu_bacteria 2842243621 2842248709 206
229 iso_pu_bacteria 2842250916 2842253292 206
230 iso_pu_bacteria 2842257432 2842261852 206
231 iso_pu_bacteria 2842264693 2842267326 206
232 iso_pu_bacteria 2842271015 2842277084 206
233 iso_pu_bacteria 2842278818 2842280492 206
234 iso_pu_bacteria 2842285085 2842289442 206
235 iso_pu_bacteria 2842304105 2842306359 206
236 iso_pu_bacteria 2842311132 2842312505 206
237 iso_pu_bacteria 2842317721 2842322538 206
238 iso_pu_bacteria 2842341865 2842342954 206
239 iso_pu_bacteria 2842363717 2842367320 206
240 iso_pu_bacteria 2842395702 2842401291 206
241 iso_pu_bacteria 2842402390 2842406790 206
242 iso_pu_bacteria 2842409023 2842413713 206
243 iso_pu_bacteria 2842415677 2842420324 206
244 iso_pu_bacteria 2842422224 2842427198 206
245 iso_pu_bacteria 2842428310 2842431422 206
246 iso_pu_bacteria 2842434925 2842437757 206
247 iso_pu_bacteria 2842441272 2842444572 206
248 iso_pu_bacteria 2842447887 2842450323 206
249 iso_pu_bacteria 2842462802 2842465600 206
250 iso_pu_bacteria 2842469257 2842472410 206
251 iso_pu_bacteria 2842489311 2842492341 206
252 iso_pu_bacteria 2842495871 2842500927 206
253 iso_pu_bacteria 2842521101 2842526436 206
254 iso_pu_bacteria 2844163670 2844170629 206
255 iso_pu_bacteria 2844454524 2844455853 206
256 iso_pu_bacteria 2847417321 2847417788 206
257 iso_pu_bacteria 2848992105 2848992632 206
258 iso_pu_bacteria 2850079185 2850080144 206
259 iso_pu_bacteria 2855872281 2855873186 206
260 iso_pu_bacteria 2857516855 2857522210 206
261 iso_pu_bacteria 2896384573 2896385420 206
262 iso_pu_bacteria 2915980308 2915982313 206
263 iso_pu_bacteria 2916061851 2916062649 206
264 iso_pu_bacteria 2919100787 2919101231 206
265 iso_pu_bacteria 2920760137 2920763211 206
266 iso_pu_bacteria 2921250672 2921250689 206
267 iso_pu_bacteria 2923556063 2923557303 206
268 iso_pu_bacteria 2933570622 2933573428 206
269 iso_pu_bacteria 2933586486 2933587657 206
270 iso_pu_bacteria 2933599457 2933604178 206
271 iso_pu_bacteria 2935901341 2935907770 206
272 iso_pu_bacteria 2936367885 2936368799 206
273 iso_pu_bacteria 2936375103 2936377123 206
274 iso_pu_bacteria 2936381700 2936387342 206
275 iso_pu_bacteria 2937029754 2937030134 206
276 iso_pu_bacteria 2937036028 2937037875 206
277 iso_pu_bacteria 2937078374 2937080209 206
278 iso_pu_bacteria 2937084907 2937086167 206
279 iso_pu_bacteria 2937113482 2937117002 206
280 iso_pu_bacteria 2957375807 2957377470 206
281 iso_pu_bacteria 2960591022 2960593703 206
282 iso_pu_bacteria 2960631154 2960632987 206
283 iso_pu_bacteria 2960680706 2960685576 206
284 iso_pu_bacteria 2960693952 2960695588 206
285 iso_pu_bacteria 2967686174 2967691828 206
286 iso_pu_bacteria 2967728569 2967729881 206
287 iso_pu_bacteria 2967742019 2967747654 206
288 iso_pu_bacteria 2970026789 2970032512 206
289 iso_pu_bacteria 2970122695 2970123793 206
290 iso_pu_bacteria 2970143518 2970145597 206
291 iso_pu_bacteria 2977530762 2977537619 206
292 iso_pu_bacteria 2977544691 2977549863 206
293 iso_pu_bacteria 2989349275 2989355402 206
294 iso_pu_bacteria 2989771324 2989774072 206
295 iso_pu_bacteria 2996887358 2996892075 206
296 iso_pu_bacteria 2996893221 2996893571 206
297 iso_pu_bacteria 3003930520 3003932205 206
298 iso_pu_bacteria 3005409236 3005411337 206
299 iso_pu_bacteria 3005445848 3005446286 206
300 iso_pu_bacteria 3005452660 3005452948 206
301 iso_pu_bacteria 639633055 639646797 206
302 iso_pu_bacteria 8003999396 8003999911 206
303 iso_pu_bacteria 8005258706 8005263599 206
304 iso_pu_bacteria 8005275841 8005279011 206
305 iso_pu_bacteria 8005282627 8005283698 206
306 iso_pu_bacteria 8005289223 8005291830 206
307 iso_pu_bacteria 8005301065 8005303965 206
308 iso_pu_bacteria 8005307578 8005308783 206
309 iso_pu_bacteria 8005321885 8005326602 206
310 iso_pu_bacteria 8005376324 8005377304 206
311 iso_pu_bacteria 8005382845 8005387174 206
312 iso_pu_bacteria 8005395548 8005401933 206
313 iso_pu_bacteria 8005430974 8005433048 206
314 iso_pu_bacteria 8005460587 8005461164 206
315 iso_pu_bacteria 8005497431 8005498774 206
316 iso_pu_bacteria 8005542996 8005543884 206
317 iso_pu_bacteria 8005556819 8005560765 206
318 iso_pu_bacteria 8005563573 8005569747 206
319 iso_pu_bacteria 8005570704 8005577048 206
320 iso_pu_bacteria 8005619151 8005619968 206
321 iso_pu_bacteria 8005626139 8005628567 206
322 iso_pu_bacteria 8005668836 8005670185 206
323 iso_pu_bacteria 8005688590 8005690391 206
324 iso_pu_bacteria 8005695170 8005700251 206
325 iso_pu_bacteria 8018127388 8018133245 206
326 iso_pu_bacteria 8018163183 8018167764 206
327 iso_pu_bacteria 8018176218 8018180194 206
328 iso_pu_bacteria 8023680758 8023684089 206
329 iso_pu_bacteria 8024479707 8024480420 206
330 iso_pu_bacteria 8024501048 8024503560 206
331 iso_pu_bacteria 8054558443 8054563076 206
332 iso_pu_bacteria 8056375014 8056375756 206
333 iso_pu_bacteria 8056875544 8056879731 206
334 iso_pu_bacteria 8057874678 8057881050 206
335 3300049568 Ga0501031_0118429 Ga0501031_0118429_640_1272 207
336 3300049571 Ga0501034_0201309 Ga0501034_0201309_796_1428 207
337 3300049572 Ga0501036_0319510 Ga0501036_0319510_214_846 207
338 3300049573 Ga0501037_0204520 Ga0501037_0204520_153_785 207
339 3300049574 Ga0501038_0338206 Ga0501038_0338206_474_1106 207
340 3300049575 Ga0501039_0669593 Ga0501039_0669593_92_724 207
341 3300049579 Ga0501043_0073365 Ga0501043_0073365_181_813 207
342 3300049580 Ga0501046_0080619 Ga0501046_0080619_632_1264 207
343 3300049581 Ga0501047_0065153 Ga0501047_0065153_1379_2011 207
344 3300049582 Ga0501048_0089675 Ga0501048_0089675_1164_1796 207
345 3300049744 Ga0501083_0163778 Ga0501083_0163778_608_1240 207
346 3300049822 Ga0501035_0097703 Ga0501035_0097703_1596_2228 207
347 3300049823 Ga0501044_0021300 Ga0501044_0021300_146_778 207
348 3300054114 Ga0501084_0573866 Ga0501084_0573866_115_738 207
349 iso_pu_bacteria 2513237144 2513907980 207
350 iso_pu_bacteria 2513237146 2513927637 207
351 iso_pu_bacteria 2599185170 2599419068 207
352 iso_pu_bacteria 2718218365 2721157308 207
353 iso_pu_bacteria 2728369397 2730296940 207
354 iso_pu_bacteria 2738543031 2739348340 207
355 iso_pu_bacteria 2791355094 2792638653 207
356 iso_pu_bacteria 2791355260 2793320167 207
357 iso_pu_bacteria 2791355265 2793353267 207
358 iso_pu_bacteria 2838035591 2838037245 207
359 iso_pu_bacteria 2838661181 2838663566 207
360 iso_pu_bacteria 2838680041 2838680713 207
361 iso_pu_bacteria 2838694306 2838695254 207
362 iso_pu_bacteria 2838707686 2838708630 207
363 iso_pu_bacteria 2842077413 2842080135 207
364 iso_pu_bacteria 2842118031 2842120755 207
365 iso_pu_bacteria 2842237096 2842238042 207
366 iso_pu_bacteria 2842291075 2842293795 207
367 iso_pu_bacteria 2842370503 2842371176 207
368 iso_pu_bacteria 2842377471 2842380191 207
369 iso_pu_bacteria 2842384541 2842387263 207
370 iso_pu_bacteria 2933016740 2933022363 207
371 iso_pu_bacteria 2935894831 2935895777 207
372 iso_pu_bacteria 8045864390 8045866991 207
373 iso_pu_bacteria 8056382006 8056386071 207
374 3300049576 Ga0501040_0000155 Ga0501040_0000155_34664_35302 208
375 3300049578 Ga0501042_0012756 Ga0501042_0012756_3147_3785 208
376 iso_pu_bacteria 2840764183 2840770409 208
377 iso_pu_bacteria 2928521798 2928525216 208
378 iso_pu_bacteria 2954011201 2954011242 208
379 iso_pu_bacteria 3002141150 3002145471 208
380 3300003323 rootH1_10174251 rootH1_101742514 209
381 3300003856 Ga0058692_1001729 Ga0058692_10017296 209
382 3300006042 Ga0075368_10040949 Ga0075368_100409492 209
383 3300006186 Ga0075369_10026203 Ga0075369_100262033 209
384 3300006186 Ga0075369_10143042 Ga0075369_101430422 209
385 3300006948 Ga0099826_10025839 Ga0099826_100258393 209
386 3300013102 Ga0157371_10000058 Ga0157371_10000058106 209
387 3300013104 Ga0157370_10000030 Ga0157370_10000030113 209
388 3300027312 Ga0209371_1001246 Ga0209371_100124610 209
389 3300027866 Ga0209813_10007036 Ga0209813_100070363 209
390 3300030500 Ga0268256_1021460 Ga0268256_10214602 209
391 3300031995 Ga0307409_100056265 Ga0307409_1000562653 209
392 3300041411 Ga0439466_0056376 Ga0439466_0056376_558_1187 209
393 3300046558 Ga0495633_0118680 Ga0495633_0118680_557_1186 209
394 3300048919 Ga0496116_0087695 Ga0496116_0087695_900_1532 209
395 3300048920 Ga0496117_0009433 Ga0496117_0009433_191_823 209
396 3300048921 Ga0496118_0061601 Ga0496118_0061601_1814_2446 209
397 3300048924 Ga0496121_0000001 Ga0496121_0000001_514642_515274 209
398 3300048926 Ga0496123_0086518 Ga0496123_0086518_330_962 209
399 3300048928 Ga0496125_0000001 Ga0496125_0000001_626724_627356 209
400 3300048929 Ga0496126_0062612 Ga0496126_0062612_1372_2004 209
401 3300048929 Ga0496126_0262838 Ga0496126_0262838_506_1138 209
402 3300049776 Ga0501280_003025 Ga0501280_003025_1452_2084 209
403 3300049778 Ga0501282_010730 Ga0501282_010730_298_930 209
404 3300050491 nmdc:mga00v17_174629_c1 nmdc:mga00v17_174629_c1_446_1078 209
405 3300050491 nmdc:mga00v17_76659_c1 nmdc:mga00v17_76659_c1_670_1299 209
406 3300050516 nmdc:mga0sz30_29292_c1 nmdc:mga0sz30_29292_c1_1616_2245 209
407 3300050516 nmdc:mga0sz30_37143_c1 nmdc:mga0sz30_37143_c1_973_1602 209
408 3300053107 Ga0500560_008255 Ga0500560_008255_44_673 209
409 3300053157 Ga0500624_001550 Ga0500624_001550_1831_2460 209
410 3300053157 Ga0500624_041075 Ga0500624_041075_120_749 209
411 3300053161 Ga0500634_0040548 Ga0500634_0040548_1705_2334 209
412 3300059643 Ga0587072_010252 Ga0587072_010252_257_886 209
413 3300002739 JGI25158J39367_1000532 JGI25158J39367_10005322 210
414 3300002773 JGI25152J39213_1000299 JGI25152J39213_100029913 210
415 3300002773 JGI25152J39213_1001759 JGI25152J39213_10017598 210
416 3300002773 JGI25152J39213_1001838 JGI25152J39213_10018384 210
417 3300002773 JGI25152J39213_1014590 JGI25152J39213_10145902 210
418 3300002773 JGI25152J39213_1015163 JGI25152J39213_10151632 210
419 3300002774 JGI25150J39212_1000042 JGI25150J39212_100004243 210
420 3300002774 JGI25150J39212_1008697 JGI25150J39212_10086972 210
421 3300002987 JGI25159J45721_1008847 JGI25159J45721_10088472 210
422 3300003187 JGI25151J46595_10000099 JGI25151J46595_1000009936 210
423 3300003187 JGI25151J46595_10000707 JGI25151J46595_1000070714 210
424 3300003187 JGI25151J46595_10003499 JGI25151J46595_100034996 210
425 3300003187 JGI25151J46595_10032015 JGI25151J46595_100320152 210
426 3300003215 JGI25153J46596_10000953 JGI25153J46596_1000095314 210
427 3300003215 JGI25153J46596_10002035 JGI25153J46596_100020355 210
428 3300003215 JGI25153J46596_10004310 JGI25153J46596_100043101 210
429 3300003215 JGI25153J46596_10007321 JGI25153J46596_100073215 210
430 3300003322 rootL2_10020451 rootL2_100204512 210
431 3300003322 rootL2_10065129 rootL2_100651292 210
432 3300003322 rootL2_10065130 rootL2_100651302 210
433 3300003354 JGI25160J50197_1003186 JGI25160J50197_10031862 210
434 3300003354 JGI25160J50197_1022454 JGI25160J50197_10224542 210
435 3300003374 JGI25161J50226_1000293 JGI25161J50226_10002933 210
436 3300003374 JGI25161J50226_1004591 JGI25161J50226_10045912 210
437 3300003771 Ga0055526_1001989 Ga0055526_100198912 210
438 3300003771 Ga0055526_1003021 Ga0055526_100302112 210
439 3300003771 Ga0055526_1009211 Ga0055526_10092115 210
440 3300003771 Ga0055526_1012963 Ga0055526_10129632 210
441 3300003775 Ga0055524_1002648 Ga0055524_10026481 210
442 3300003775 Ga0055524_1015335 Ga0055524_10153352 210
443 3300003775 Ga0055524_1026201 Ga0055524_10262012 210
444 3300003775 Ga0055524_1028568 Ga0055524_10285682 210
445 3300003790 Ga0055528_1000286 Ga0055528_100028632 210
446 3300003790 Ga0055528_1001823 Ga0055528_100182313 210
447 3300003790 Ga0055528_1002756 Ga0055528_10027566 210
448 3300003790 Ga0055528_1006555 Ga0055528_10065554 210
449 3300003790 Ga0055528_1019371 Ga0055528_10193713 210
450 3300003792 Ga0055540_1000269 Ga0055540_100026924 210
451 3300003792 Ga0055540_1001448 Ga0055540_10014483 210
452 3300003792 Ga0055540_1038019 Ga0055540_10380192 210
453 3300003794 Ga0055531_10045230 Ga0055531_100452301 210
454 3300004625 Ga0055543_1000208 Ga0055543_100020845 210
455 3300004625 Ga0055543_1001693 Ga0055543_10016935 210
456 3300005262 Ga0065165_1007867 Ga0065165_10078673 210
457 3300005335 Ga0070666_10267732 Ga0070666_102677321 210
458 3300005347 Ga0070668_100025317 Ga0070668_1000253176 210
459 3300005353 Ga0070669_100342706 Ga0070669_1003427062 210
460 3300005355 Ga0070671_100042243 Ga0070671_1000422434 210
461 3300005435 Ga0070714_100021591 Ga0070714_1000215913 210
462 3300005436 Ga0070713_100020692 Ga0070713_1000206924 210
463 3300005437 Ga0070710_10024222 Ga0070710_100242223 210
464 3300005439 Ga0070711_100015289 Ga0070711_1000152893 210
465 3300005456 Ga0070678_100862363 Ga0070678_1008623631 210
466 3300005548 Ga0070665_100186541 Ga0070665_1001865412 210
467 3300005617 Ga0068859_100278881 Ga0068859_1002788812 210
468 3300005843 Ga0068860_100410902 Ga0068860_1004109022 210
469 3300005985 Ga0081539_10011176 Ga0081539_100111768 210
470 3300006028 Ga0070717_10311575 Ga0070717_103115752 210
471 3300006038 Ga0075365_10000590 Ga0075365_100005906 210
472 3300006038 Ga0075365_10040679 Ga0075365_100406792 210
473 3300006038 Ga0075365_10158017 Ga0075365_101580172 210
474 3300006038 Ga0075365_10286577 Ga0075365_102865772 210
475 3300006048 Ga0075363_100029644 Ga0075363_1000296444 210
476 3300006048 Ga0075363_100101560 Ga0075363_1001015602 210
477 3300006048 Ga0075363_100203833 Ga0075363_1002038331 210
478 3300006048 Ga0075363_100472514 Ga0075363_1004725141 210
479 3300006051 Ga0075364_10000081 Ga0075364_1000008130 210
480 3300006173 Ga0070716_100016949 Ga0070716_1000169492 210
481 3300006175 Ga0070712_100005269 Ga0070712_1000052693 210
482 3300006177 Ga0075362_10001222 Ga0075362_100012225 210
483 3300006177 Ga0075362_10001794 Ga0075362_100017945 210
484 3300006177 Ga0075362_10002168 Ga0075362_100021682 210
485 3300006178 Ga0075367_10007948 Ga0075367_100079482 210
486 3300006178 Ga0075367_10181468 Ga0075367_101814682 210
487 3300006186 Ga0075369_10001312 Ga0075369_1000131210 210
488 3300006186 Ga0075369_10013695 Ga0075369_100136952 210
489 3300006195 Ga0075366_10082440 Ga0075366_100824402 210
490 3300006353 Ga0075370_10119463 Ga0075370_101194632 210
491 3300006353 Ga0075370_10257790 Ga0075370_102577902 210
492 3300006931 Ga0097620_100278886 Ga0097620_1002788862 210
493 3300009011 Ga0105251_10009920 Ga0105251_100099205 210
494 3300009148 Ga0105243_10001440 Ga0105243_1000144018 210
495 3300009177 Ga0105248_10122679 Ga0105248_101226791 210
496 3300009553 Ga0105249_10030167 Ga0105249_100301675 210
497 3300009765 Ga0123341_1000027 Ga0123341_100002712 210
498 3300009765 Ga0123341_1064623 Ga0123341_10646232 210
499 3300009766 Ga0123342_1013721 Ga0123342_10137212 210
500 3300009766 Ga0123342_1016781 Ga0123342_10167813 210
501 3300010375 Ga0105239_10943758 Ga0105239_109437582 210
502 3300012513 Ga0157326_1005241 Ga0157326_10052412 210
503 3300013100 Ga0157373_10007389 Ga0157373_100073893 210
504 3300021361 Ga0213872_10097186 Ga0213872_100971861 210
505 3300021441 Ga0213871_10038850 Ga0213871_100388502 210
506 3300025208 Ga0209436_100077 Ga0209436_10007744 210
507 3300025245 Ga0207425_1000012 Ga0207425_1000012456 210
508 3300025245 Ga0207425_1002173 Ga0207425_10021735 210
509 3300025245 Ga0207425_1002832 Ga0207425_10028326 210
510 3300025245 Ga0207425_1006197 Ga0207425_10061973 210
511 3300025258 Ga0209129_1000086 Ga0209129_100008686 210
512 3300025258 Ga0209129_1000574 Ga0209129_100057411 210
513 3300025258 Ga0209129_1000606 Ga0209129_100060613 210
514 3300025258 Ga0209129_1002109 Ga0209129_10021098 210
515 3300025258 Ga0209129_1032671 Ga0209129_10326712 210
516 3300025261 Ga0209233_1001659 Ga0209233_10016595 210
517 3300025263 Ga0209565_1032718 Ga0209565_10327182 210
518 3300025272 Ga0209455_1008764 Ga0209455_10087642 210
519 3300025273 Ga0209673_1000091 Ga0209673_1000091121 210
520 3300025273 Ga0209673_1000122 Ga0209673_100012240 210
521 3300025273 Ga0209673_1001754 Ga0209673_100175415 210
522 3300025273 Ga0209673_1002472 Ga0209673_100247211 210
523 3300025273 Ga0209673_1002920 Ga0209673_10029206 210
524 3300025273 Ga0209673_1003306 Ga0209673_10033065 210
525 3300025273 Ga0209673_1007480 Ga0209673_10074803 210
526 3300025273 Ga0209673_1007894 Ga0209673_10078943 210
527 3300025273 Ga0209673_1021978 Ga0209673_10219783 210
528 3300025273 Ga0209673_1033014 Ga0209673_10330142 210
529 3300025284 Ga0209130_1000015 Ga0209130_1000015377 210
530 3300025284 Ga0209130_1023599 Ga0209130_10235992 210
531 3300025291 Ga0209675_1012763 Ga0209675_10127632 210
532 3300025292 Ga0209676_1041644 Ga0209676_10416442 210
533 3300025294 Ga0209025_1000024 Ga0209025_1000024456 210
534 3300025294 Ga0209025_1000549 Ga0209025_100054947 210
535 3300025294 Ga0209025_1004013 Ga0209025_100401313 210
536 3300025294 Ga0209025_1012497 Ga0209025_10124975 210
537 3300025294 Ga0209025_1020562 Ga0209025_10205622 210
538 3300025295 Ga0209564_1000742 Ga0209564_100074231 210
539 3300025295 Ga0209564_1000956 Ga0209564_100095613 210
540 3300025295 Ga0209564_1002225 Ga0209564_10022258 210
541 3300025295 Ga0209564_1019755 Ga0209564_10197552 210
542 3300025295 Ga0209564_1023063 Ga0209564_10230633 210
543 3300025295 Ga0209564_1056802 Ga0209564_10568021 210
544 3300025297 Ga0209758_1000046 Ga0209758_100004686 210
545 3300025297 Ga0209758_1000325 Ga0209758_100032559 210
546 3300025297 Ga0209758_1000943 Ga0209758_100094329 210
547 3300025297 Ga0209758_1003780 Ga0209758_100378012 210
548 3300025297 Ga0209758_1005148 Ga0209758_10051488 210
549 3300025297 Ga0209758_1022008 Ga0209758_10220082 210
550 3300025297 Ga0209758_1048725 Ga0209758_10487252 210
551 3300025298 Ga0209050_1005963 Ga0209050_10059636 210
552 3300025299 Ga0209256_1000858 Ga0209256_100085813 210
553 3300025299 Ga0209256_1002268 Ga0209256_10022684 210
554 3300025299 Ga0209256_1004834 Ga0209256_10048344 210
555 3300025299 Ga0209256_1020514 Ga0209256_10205142 210
556 3300025299 Ga0209256_1049253 Ga0209256_10492532 210
557 3300025302 Ga0207426_1000063 Ga0207426_100006396 210
558 3300025302 Ga0207426_1000144 Ga0207426_1000144147 210
559 3300025302 Ga0207426_1000457 Ga0207426_100045736 210
560 3300025303 Ga0209051_1000084 Ga0209051_100008412 210
561 3300025303 Ga0209051_1082600 Ga0209051_10826001 210
562 3300025304 Ga0209257_1011040 Ga0209257_10110402 210
563 3300025898 Ga0207692_10006926 Ga0207692_100069263 210
564 3300025906 Ga0207699_10013180 Ga0207699_100131803 210
565 3300025915 Ga0207693_10003692 Ga0207693_100036924 210
566 3300025916 Ga0207663_10007245 Ga0207663_100072454 210
567 3300025928 Ga0207700_10099504 Ga0207700_100995042 210
568 3300025929 Ga0207664_10014000 Ga0207664_100140005 210
569 3300025931 Ga0207644_10205183 Ga0207644_102051832 210
570 3300025938 Ga0207704_10223160 Ga0207704_102231602 210
571 3300025939 Ga0207665_10010746 Ga0207665_100107463 210
572 3300025941 Ga0207711_10688312 Ga0207711_106883122 210
573 3300025961 Ga0207712_10158894 Ga0207712_101588942 210
574 3300025972 Ga0207668_10029728 Ga0207668_100297284 210
575 3300025986 Ga0207658_10611166 Ga0207658_106111662 210
576 3300028379 Ga0268266_10005040 Ga0268266_100050405 210
577 3300028379 Ga0268266_10231567 Ga0268266_102315672 210
578 3300028379 Ga0268266_10750236 Ga0268266_107502361 210
579 3300028794 Ga0307515_10037818 Ga0307515_100378185 210
580 3300028794 Ga0307515_10072614 Ga0307515_100726144 210
581 3300028794 Ga0307515_10161137 Ga0307515_101611372 210
582 3300031456 Ga0307513_10054163 Ga0307513_100541635 210
583 3300031731 Ga0307405_10002002 Ga0307405_100020022 210
584 3300031901 Ga0307406_10318876 Ga0307406_103188762 210
585 3300031911 Ga0307412_10001263 Ga0307412_100012634 210
586 3300031911 Ga0307412_10434001 Ga0307412_104340012 210
587 3300037418 Ga0395900_0411792 Ga0395900_0411792_637_1269 210
588 3300037471 Ga0395905_0000441 Ga0395905_0000441_1613_2245 210
589 3300037471 Ga0395905_0001982 Ga0395905_0001982_3078_3710 210
590 3300039437 Ga0436365_0254157 Ga0436365_0254157_167_811 210
591 3300039437 Ga0436365_0272981 Ga0436365_0272981_7072_7734 210
592 3300039447 Ga0436361_1102652 Ga0436361_1102652_157_798 210
593 3300039453 Ga0436362_0031769 Ga0436362_0031769_305_967 210
594 3300039453 Ga0436362_0867338 Ga0436362_0867338_299_952 210
595 3300041407 Ga0439447_031879 Ga0439447_031879_349_990 210
596 3300041411 Ga0439466_0044779 Ga0439466_0044779_84_725 210
597 3300041413 Ga0439465_0012830 Ga0439465_0012830_673_1308 210
598 3300041413 Ga0439465_0029327 Ga0439465_0029327_85_720 210
599 3300041452 Ga0451793_1814710 Ga0451793_1814710_197_838 210
600 3300041486 Ga0451807_1674064 Ga0451807_1674064_167_808 210
601 3300041491 Ga0451833_0413439 Ga0451833_0413439_537_1178 210
602 3300041492 Ga0451835_0522946 Ga0451835_0522946_56_697 210
603 3300041496 Ga0451839_1546199 Ga0451839_1546199_65_706 210
604 3300041498 Ga0451841_0381772 Ga0451841_0381772_1452_2093 210
605 3300041501 Ga0451845_0391110 Ga0451845_0391110_105_746 210
606 3300041503 Ga0451847_0223729 Ga0451847_0223729_104_745 210
607 3300041505 Ga0451849_0803637 Ga0451849_0803637_403_1044 210
608 3300041507 Ga0451851_1377737 Ga0451851_1377737_104_745 210
609 3300041511 Ga0451855_0110618 Ga0451855_0110618_104_745 210
610 3300041512 Ga0451853_3313646 Ga0451853_3313646_2125_2766 210
611 3300042004 Ga0439445_0055085 Ga0439445_0055085_100_735 210
612 3300042015 Ga0439462_0034394 Ga0439462_0034394_111_746 210
613 3300044719 Ga0466971_0193025 Ga0466971_0193025_218_862 210
614 3300044842 Ga0466957_0059834 Ga0466957_0059834_827_1471 210
615 3300045051 Ga0451576_1143663 Ga0451576_1143663_111_755 210
616 3300045836 Ga0466958_0038294 Ga0466958_0038294_1532_2212 210
617 3300046452 Ga0495617_112134 Ga0495617_112134_146_778 210
618 3300046453 Ga0495627_090870 Ga0495627_090870_183_818 210
619 3300046458 Ga0495591_063521 Ga0495591_063521_179_811 210
620 3300046460 Ga0495638_0001215 Ga0495638_0001215_8736_9368 210
621 3300046460 Ga0495638_0029794 Ga0495638_0029794_1502_2143 210
622 3300046471 Ga0495650_0132313 Ga0495650_0132313_173_805 210
623 3300046474 Ga0495605_0001185 Ga0495605_0001185_5874_6506 210
624 3300046492 Ga0495585_0001367 Ga0495585_0001367_1348_1980 210
625 3300046492 Ga0495585_0015286 Ga0495585_0015286_2085_2717 210
626 3300046492 Ga0495585_0056108 Ga0495585_0056108_200_832 210
627 3300046501 Ga0495607_0032217 Ga0495607_0032217_215_847 210
628 3300046501 Ga0495607_0056264 Ga0495607_0056264_654_1286 210
629 3300046501 Ga0495607_0074039 Ga0495607_0074039_461_1102 210
630 3300046501 Ga0495607_0164131 Ga0495607_0164131_173_805 210
631 3300046506 Ga0495583_0001517 Ga0495583_0001517_14121_14753 210
632 3300046506 Ga0495583_0011659 Ga0495583_0011659_4086_4718 210
633 3300046506 Ga0495583_0080103 Ga0495583_0080103_661_1302 210
634 3300046507 Ga0495606_0030939 Ga0495606_0030939_958_1590 210
635 3300046507 Ga0495606_0136016 Ga0495606_0136016_153_794 210
636 3300046507 Ga0495606_0215730 Ga0495606_0215730_171_803 210
637 3300046512 Ga0495610_0000975 Ga0495610_0000975_15086_15718 210
638 3300046512 Ga0495610_0077345 Ga0495610_0077345_168_800 210
639 3300046512 Ga0495610_0094707 Ga0495610_0094707_108_749 210
640 3300046513 Ga0495616_0032981 Ga0495616_0032981_217_849 210
641 3300046515 Ga0495620_0030129 Ga0495620_0030129_1084_1725 210
642 3300046515 Ga0495620_0056271 Ga0495620_0056271_437_1069 210
643 3300046515 Ga0495620_0075407 Ga0495620_0075407_25_657 210
644 3300046518 Ga0495631_0000622 Ga0495631_0000622_11083_11715 210
645 3300046519 Ga0495632_0002976 Ga0495632_0002976_8416_9048 210
646 3300046519 Ga0495632_0011065 Ga0495632_0011065_956_1588 210
647 3300046519 Ga0495632_0022267 Ga0495632_0022267_1859_2500 210
648 3300046522 Ga0495643_0016384 Ga0495643_0016384_3437_4078 210
649 3300046522 Ga0495643_0032625 Ga0495643_0032625_457_1089 210
650 3300046524 Ga0495648_0046821 Ga0495648_0046821_911_1552 210
651 3300046530 Ga0495654_0061374 Ga0495654_0061374_1107_1739 210
652 3300046538 Ga0495609_0020630 Ga0495609_0020630_1000_1632 210
653 3300046538 Ga0495609_0048957 Ga0495609_0048957_624_1265 210
654 3300046542 Ga0495597_0009327 Ga0495597_0009327_2839_3480 210
655 3300046558 Ga0495633_0011727 Ga0495633_0011727_3248_3889 210
656 3300046616 Ga0495668_0001429 Ga0495668_0001429_18355_18987 210
657 3300046616 Ga0495668_0036253 Ga0495668_0036253_461_1093 210
658 3300046616 Ga0495668_0075704 Ga0495668_0075704_870_1511 210
659 3300046648 Ga0495611_0045956 Ga0495611_0045956_222_854 210
660 3300046660 Ga0495625_0001674 Ga0495625_0001674_4972_5604 210
661 3300046660 Ga0495625_0050440 Ga0495625_0050440_945_1586 210
662 3300046660 Ga0495625_0175674 Ga0495625_0175674_150_782 210
663 3300046660 Ga0495625_0196987 Ga0495625_0196987_56_697 210
664 3300046665 Ga0495661_0042229 Ga0495661_0042229_990_1622 210
665 3300046665 Ga0495661_0134329 Ga0495661_0134329_179_820 210
666 3300046691 Ga0495670_0315028 Ga0495670_0315028_80_712 210
667 3300046692 Ga0495671_0126502 Ga0495671_0126502_291_932 210
668 3300046694 Ga0495649_0006928 Ga0495649_0006928_4890_5531 210
669 3300046694 Ga0495649_0092932 Ga0495649_0092932_864_1496 210
670 3300046794 Ga0495589_0080129 Ga0495589_0080129_20_661 210
671 3300046810 Ga0495660_0066667 Ga0495660_0066667_367_1008 210
672 3300046810 Ga0495660_0113398 Ga0495660_0113398_331_963 210
673 3300047318 Ga0495636_0013749 Ga0495636_0013749_1873_2514 210
674 3300047318 Ga0495636_0095426 Ga0495636_0095426_66_698 210
675 3300047443 Ga0495687_080642 Ga0495687_080642_528_1160 210
676 3300047469 Ga0495673_0023350 Ga0495673_0023350_1844_2476 210
677 3300047470 Ga0495681_0021238 Ga0495681_0021238_2721_3362 210
678 3300047470 Ga0495681_0121044 Ga0495681_0121044_203_835 210
679 3300047472 Ga0495686_0013801 Ga0495686_0013801_276_908 210
680 3300047472 Ga0495686_0063904 Ga0495686_0063904_541_1173 210
681 3300048091 Ga0495626_0052540 Ga0495626_0052540_742_1383 210
682 3300048909 Ga0496106_0003687 Ga0496106_0003687_4865_5497 210
683 3300048919 Ga0496116_0002774 Ga0496116_0002774_14607_15239 210
684 3300048919 Ga0496116_0011522 Ga0496116_0011522_961_1593 210
685 3300048919 Ga0496116_0048828 Ga0496116_0048828_1769_2401 210
686 3300048919 Ga0496116_0112302 Ga0496116_0112302_938_1570 210
687 3300048919 Ga0496116_0309067 Ga0496116_0309067_30_671 210
688 3300048920 Ga0496117_0000002 Ga0496117_0000002_1854444_1855142 210
689 3300048920 Ga0496117_0012672 Ga0496117_0012672_6272_6904 210
690 3300048920 Ga0496117_0050507 Ga0496117_0050507_1880_2524 210
691 3300048920 Ga0496117_0079586 Ga0496117_0079586_1196_1828 210
692 3300048920 Ga0496117_0180040 Ga0496117_0180040_112_744 210
693 3300048921 Ga0496118_0001656 Ga0496118_0001656_27379_28077 210
694 3300048921 Ga0496118_0002528 Ga0496118_0002528_863_1504 210
695 3300048921 Ga0496118_0010583 Ga0496118_0010583_6646_7278 210
696 3300048921 Ga0496118_0030970 Ga0496118_0030970_1560_2192 210
697 3300048922 Ga0496119_0021053 Ga0496119_0021053_1690_2388 210
698 3300048922 Ga0496119_0063384 Ga0496119_0063384_883_1527 210
699 3300048922 Ga0496119_0187669 Ga0496119_0187669_173_805 210
700 3300048923 Ga0496120_0000021 Ga0496120_0000021_211433_212131 210
701 3300048924 Ga0496121_0000459 Ga0496121_0000459_31770_32414 210
702 3300048924 Ga0496121_0010824 Ga0496121_0010824_2892_3536 210
703 3300048924 Ga0496121_0012633 Ga0496121_0012633_2765_3397 210
704 3300048924 Ga0496121_0115399 Ga0496121_0115399_1196_1840 210
705 3300048924 Ga0496121_0148786 Ga0496121_0148786_157_789 210
706 3300048924 Ga0496121_0467769 Ga0496121_0467769_76_714 210
707 3300048925 Ga0496122_0000001 Ga0496122_0000001_1225234_1225932 210
708 3300048925 Ga0496122_0043269 Ga0496122_0043269_100_732 210
709 3300048925 Ga0496122_0055172 Ga0496122_0055172_1242_1874 210
710 3300048926 Ga0496123_0000001 Ga0496123_0000001_1228965_1229663 210
711 3300048926 Ga0496123_0012028 Ga0496123_0012028_5777_6409 210
712 3300048926 Ga0496123_0025199 Ga0496123_0025199_403_1035 210
713 3300048926 Ga0496123_0039787 Ga0496123_0039787_1450_2082 210
714 3300048926 Ga0496123_0105403 Ga0496123_0105403_928_1560 210
715 3300048926 Ga0496123_0163252 Ga0496123_0163252_491_1123 210
716 3300048926 Ga0496123_0259765 Ga0496123_0259765_25_657 210
717 3300048927 Ga0496124_0000592 Ga0496124_0000592_37048_37686 210
718 3300048927 Ga0496124_0001578 Ga0496124_0001578_27305_28003 210
719 3300048927 Ga0496124_0002394 Ga0496124_0002394_13837_14469 210
720 3300048927 Ga0496124_0010507 Ga0496124_0010507_2688_3365 210
721 3300048927 Ga0496124_0043993 Ga0496124_0043993_163_795 210
722 3300048927 Ga0496124_0178157 Ga0496124_0178157_939_1571 210
723 3300048927 Ga0496124_0252729 Ga0496124_0252729_660_1292 210
724 3300048927 Ga0496124_0318818 Ga0496124_0318818_242_874 210
725 3300048927 Ga0496124_0433014 Ga0496124_0433014_49_681 210
726 3300048927 Ga0496124_0500010 Ga0496124_0500010_116_748 210
727 3300048928 Ga0496125_0051668 Ga0496125_0051668_16_648 210
728 3300048928 Ga0496125_0056993 Ga0496125_0056993_898_1530 210
729 3300048928 Ga0496125_0074630 Ga0496125_0074630_1113_1811 210
730 3300048928 Ga0496125_0184793 Ga0496125_0184793_233_865 210
731 3300048928 Ga0496125_0235428 Ga0496125_0235428_447_1079 210
732 3300048928 Ga0496125_0249660 Ga0496125_0249660_13_645 210
733 3300048929 Ga0496126_0000438 Ga0496126_0000438_59094_59732 210
734 3300048929 Ga0496126_0010242 Ga0496126_0010242_9186_9824 210
735 3300048929 Ga0496126_0034902 Ga0496126_0034902_336_968 210
736 3300048929 Ga0496126_0099206 Ga0496126_0099206_1816_2448 210
737 3300049459 Ga0495678_006164 Ga0495678_006164_2825_3457 210
738 3300049460 Ga0495682_0012096 Ga0495682_0012096_1751_2383 210
739 3300049568 Ga0501031_0014310 Ga0501031_0014310_2514_3158 210
740 3300049568 Ga0501031_0019147 Ga0501031_0019147_1979_2611 210
741 3300049569 Ga0501032_0001183 Ga0501032_0001183_16586_17230 210
742 3300049570 Ga0501033_0000171 Ga0501033_0000171_26467_27111 210
743 3300049570 Ga0501033_0000185 Ga0501033_0000185_25603_26247 210
744 3300049570 Ga0501033_0025214 Ga0501033_0025214_1782_2423 210
745 3300049570 Ga0501033_0152770 Ga0501033_0152770_164_796 210
746 3300049570 Ga0501033_0277323 Ga0501033_0277323_287_931 210
747 3300049572 Ga0501036_0072284 Ga0501036_0072284_385_1017 210
748 3300049573 Ga0501037_0000089 Ga0501037_0000089_61038_61682 210
749 3300049574 Ga0501038_0212838 Ga0501038_0212838_810_1442 210
750 3300049574 Ga0501038_0474092 Ga0501038_0474092_295_927 210
751 3300049579 Ga0501043_0000007 Ga0501043_0000007_149580_150224 210
752 3300049579 Ga0501043_0026297 Ga0501043_0026297_387_1028 210
753 3300049579 Ga0501043_0545042 Ga0501043_0545042_88_732 210
754 3300049581 Ga0501047_0037983 Ga0501047_0037983_3817_4458 210
755 3300049583 Ga0501067_0011085 Ga0501067_0011085_3823_4467 210
756 3300049585 Ga0501069_0000001 Ga0501069_0000001_244962_245606 210
757 3300049585 Ga0501069_0024050 Ga0501069_0024050_704_1345 210
758 3300049586 Ga0501070_0000789 Ga0501070_0000789_220_864 210
759 3300049586 Ga0501070_0001012 Ga0501070_0001012_14501_15142 210
760 3300049586 Ga0501070_0060282 Ga0501070_0060282_645_1289 210
761 3300049587 Ga0501071_0003380 Ga0501071_0003380_7983_8627 210
762 3300049589 Ga0501073_0110904 Ga0501073_0110904_1085_1717 210
763 3300049589 Ga0501073_0601689 Ga0501073_0601689_13_654 210
764 3300049590 Ga0501074_0000003 Ga0501074_0000003_24446_25090 210
765 3300049590 Ga0501074_0036374 Ga0501074_0036374_904_1545 210
766 3300049742 Ga0501080_0000090 Ga0501080_0000090_45884_46528 210
767 3300049742 Ga0501080_0002221 Ga0501080_0002221_16043_16684 210
768 3300049744 Ga0501083_0000012 Ga0501083_0000012_28288_28932 210
769 3300049744 Ga0501083_0060895 Ga0501083_0060895_329_961 210
770 3300049822 Ga0501035_0000037 Ga0501035_0000037_53824_54468 210
771 3300049822 Ga0501035_0001616 Ga0501035_0001616_21123_21764 210
772 3300049822 Ga0501035_0003264 Ga0501035_0003264_4628_5272 210
773 3300049822 Ga0501035_0016445 Ga0501035_0016445_1977_2621 210
774 3300049823 Ga0501044_0000018 Ga0501044_0000018_170725_171369 210
775 3300049823 Ga0501044_0029725 Ga0501044_0029725_4330_4971 210
776 3300049823 Ga0501044_0070565 Ga0501044_0070565_138_782 210
777 3300050489 nmdc:mga03683_10785_c1 nmdc:mga03683_10785_c1_1563_2204 210
778 3300050489 nmdc:mga03683_31278_c1 nmdc:mga03683_31278_c1_888_1523 210
779 3300050490 nmdc:mga03n38_25360_c1 nmdc:mga03n38_25360_c1_298_996 210
780 3300050491 nmdc:mga00v17_90_c1 nmdc:mga00v17_90_c1_15303_16001 210
781 3300050492 nmdc:mga0yw44_160973_c1 nmdc:mga0yw44_160973_c1_618_1262 210
782 3300050492 nmdc:mga0yw44_19554_c1 nmdc:mga0yw44_19554_c1_426_1124 210
783 3300050492 nmdc:mga0yw44_312608_c1 nmdc:mga0yw44_312608_c1_216_851 210
784 3300050492 nmdc:mga0yw44_35363_c1 nmdc:mga0yw44_35363_c1_414_1055 210
785 3300050493 nmdc:mga0k408_61949_c1 nmdc:mga0k408_61949_c1_1410_2051 210
786 3300050494 nmdc:mga06z11_4561_c1 nmdc:mga06z11_4561_c1_4471_5106 210
787 3300050494 nmdc:mga06z11_79836_c1 nmdc:mga06z11_79836_c1_99_797 210
788 3300050495 nmdc:mga04h51_7987_c1 nmdc:mga04h51_7987_c1_1306_2004 210
789 3300050496 nmdc:mga07m45_182062_c1 nmdc:mga07m45_182062_c1_161_802 210
790 3300050496 nmdc:mga07m45_241236_c1 nmdc:mga07m45_241236_c1_260_958 210
791 3300050496 nmdc:mga07m45_397183_c1 nmdc:mga07m45_397183_c1_126_767 210
792 3300050516 nmdc:mga0sz30_23850_c1 nmdc:mga0sz30_23850_c1_1331_1972 210
793 3300050516 nmdc:mga0sz30_877_c1 nmdc:mga0sz30_877_c1_10049_10684 210
794 3300053079 Ga0500610_0085552 Ga0500610_0085552_423_1055 210
795 3300053087 Ga0500643_050570 Ga0500643_050570_129_761 210
796 3300053088 Ga0500644_0158168 Ga0500644_0158168_30_662 210
797 3300053090 Ga0500646_0087540 Ga0500646_0087540_108_740 210
798 3300053109 Ga0500569_007868 Ga0500569_007868_478_1110 210
799 3300053118 Ga0500594_0012074 Ga0500594_0012074_1072_1704 210
800 3300053125 Ga0500618_020406 Ga0500618_020406_738_1370 210
801 3300053134 Ga0500658_0016373 Ga0500658_0016373_915_1547 210
802 3300053136 Ga0500559_0000610 Ga0500559_0000610_6320_6964 210
803 3300053137 Ga0500561_0000144 Ga0500561_0000144_6667_7365 210
804 3300053139 Ga0500568_0000533 Ga0500568_0000533_11106_11738 210
805 3300053139 Ga0500568_0001961 Ga0500568_0001961_4998_5630 210
806 3300053151 Ga0500604_0007193 Ga0500604_0007193_891_1523 210
807 3300053153 Ga0500616_0001527 Ga0500616_0001527_15407_16039 210
808 3300053153 Ga0500616_0072565 Ga0500616_0072565_1056_1697 210
809 3300053156 Ga0500622_0000342 Ga0500622_0000342_14766_15398 210
810 3300053158 Ga0500627_0082464 Ga0500627_0082464_406_1047 210
811 3300053160 Ga0500633_0009080 Ga0500633_0009080_1283_1915 210
812 3300053725 Ga0500576_012388 Ga0500576_012388_1780_2424 210
813 3300053730 Ga0500645_017487 Ga0500645_017487_162_794 210
814 3300053735 Ga0500596_005567 Ga0500596_005567_363_1007 210
815 3300060353 Ga0501082_0004173 Ga0501082_0004173_2454_3098 210
816 3300060353 Ga0501082_0232386 Ga0501082_0232386_842_1474 210
817 iso_pu_bacteria 2519899620 2520376714 210
818 iso_pu_bacteria 2554235003 2554246734 210
819 iso_pu_bacteria 2899845264 2899846680 210
820 iso_pu_bacteria 2970184632 2970190956 210
821 iso_pu_bacteria 650716007 650739151 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01081

Aldolase

KDPG and KHG aldolase

33

225

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qcc-assembly1.cif.gz_A structure of a cube-shaped, highly porous protein cage designed by fusing symmetric oligomeric domains 0.9724 9 207
2v81-assembly1.cif.gz_A native kdpgal structure 0.9711 8 210
2v81-assembly1.cif.gz_A native kdpgal structure 0.9527 8 210
1wa3-assembly2.cif.gz_F mechanism of the class i kdpg aldolase 0.923 10 206
8cus-assembly1.cif.gz_B accurate computational design of genetically encoded 3d protein crystals 0.9227 12 205
ID Description Score Start End Superfamily
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9678 8 210 3.20.20.70
2v81A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9539 8 210 3.20.20.70
1vlwB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9179 10 207 3.20.20.70
af_A0A1D6HW21_144_318_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8996 41 203 3.20.20.70
2wfbA00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Dinitrogenase iron-molybdenum cofactor biosynthesis domain 0.8843 75 110 3.30.420.130
ID Description Score Start End GO Terms
AF-A0A3E1BXT8-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9983 1 210 GO:0016829
AF-A0A7W9CX05-F1-model_v4 2-dehydro-3-deoxyphosphogalactonate aldolase (EC 4.1.2.21) 0.9981 1 210 GO:0008674
AF-A0A7Y2RAX8-F1-model_v4 2-dehydro-3-deoxy-6-phosphogalactonate aldolase 0.9973 1 209 GO:0016829
AF-A0A545ZL84-F1-model_v4 deleted 0.9958 1 210
AF-A0A7W4R5F5-F1-model_v4 deleted 0.9957 1 210

Feature Viewer

pLDDT pTM Quality
96.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map