F482187

General Info

Members Datasets Scaffolds Average Seq Length
819 368 805 178

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0549699|Ga0495651_0549699_86_724
Length 192
Sequence MPFYYALVVATCFERLAELVVAKRNARWSFARGGVETGRGHYPAMVVLHTGLLAGCLVEPWAAGRSFVPRLGVPMLLVAVAAQGLRWWCIRTLGPRWNTRVIVVPGLPLVDGGPYRWFRHPNYVAVVAEGIALPLAGSAWITAVVFNVLNAVLLTVRLRCETAALAPARSSWPDPGSGGLVPDGAVPPAAAP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2643221613 Oerskovia sp. Root22 Isolate Unclassified
3 2643221679 Angustibacter sp. Root456 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221721 Oerskovia sp. Root918 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
9 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
10 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
11 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
12 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
13 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
14 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
15 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
56 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
59 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
60 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
103 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
221 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
222 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
231 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
232 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
233 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
239 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
245 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
246 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
247 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
252 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
281 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
282 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
302 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
303 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
304 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
305 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
306 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
307 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
308 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
326 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
327 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
328 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
345 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
355 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
360 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
361 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
362 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
363 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
367 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
368 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0.12
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.62
Nodule 0
Rhizoplane 7.94
Rhizosphere 81.93
Stem 0
Stem Tuber 0
Unclassified 4.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11460553 2162886012 Bacteria 1050
2 JGI24736J21556_1031421 3300001904 Bacteria 820
3 JGI24747J21853_1001272 3300001978 Bacteria 1857
4 JGI24740J21852_10019352 3300001979 Bacteria 2399
5 JGI24739J22299_10004941 3300001989 Bacteria 5079
6 JGI24739J22299_10020750 3300001989 Bacteria 2345
7 JGI24737J22298_10011988 3300001990 Bacteria 2832
8 JGI24737J22298_10128887 3300001990 Bacteria 747
9 JGI24750J21931_1010170 3300002070 Bacteria 1222
10 JGI24745J21846_1002280 3300002073 Bacteria 1945
11 JGI24738J21930_10024878 3300002075 Bacteria 1231
12 JGI24749J21850_1001787 3300002076 Bacteria 3043
13 JGI24034J26672_10012218 3300002239 Bacteria 1292
14 JGI24751J29686_10021542 3300002459 Bacteria 1336
15 rootH2_10195207 3300003320 Bacteria 5915
16 Ga0006562J51391_1083609 3300003578 Bacteria 1010
17 Ga0065715_10170299 3300005293 Bacteria 1552
18 Ga0065707_10099990 3300005295 Bacteria 2964
19 Ga0070658_10000182 3300005327 Bacteria 55103
20 Ga0070676_10000569 3300005328 Bacteria 17905
21 Ga0070683_100002426 3300005329 Bacteria 14814
22 Ga0070683_100253818 3300005329 Bacteria 1673
23 Ga0070690_100000724 3300005330 Bacteria 16921
24 Ga0070670_100013501 3300005331 Bacteria 6997
25 Ga0070670_100147157 3300005331 Bacteria 2038
26 Ga0070677_10000089 3300005333 Bacteria 29502
27 Ga0068869_100000722 3300005334 Bacteria 18814
28 Ga0068869_100009208 3300005334 Bacteria 6397
29 Ga0070666_10006924 3300005335 Bacteria 6987
30 Ga0070666_10019805 3300005335 Bacteria 4346
31 Ga0070682_100012388 3300005337 Bacteria 4890
32 Ga0070682_101114089 3300005337 Bacteria 662
33 Ga0068868_100001079 3300005338 Bacteria 18679
34 Ga0068868_100154087 3300005338 Bacteria 1894
35 Ga0070660_100000514 3300005339 Bacteria 25808
36 Ga0070689_100001136 3300005340 Bacteria 16782
37 Ga0070689_100277565 3300005340 Bacteria 1389
38 Ga0070691_10021525 3300005341 Bacteria 2984
39 Ga0070691_10339571 3300005341 Bacteria 831
40 Ga0070687_100000027 3300005343 Bacteria 45546
41 Ga0070687_100034601 3300005343 Bacteria 2502
42 Ga0070687_100045218 3300005343 Bacteria 2247
43 Ga0070661_100001599 3300005344 Bacteria 15686
44 Ga0070661_100002829 3300005344 Bacteria 11925
45 Ga0070692_10001590 3300005345 Bacteria 8345
46 Ga0070692_10003754 3300005345 Bacteria 6243
47 Ga0070668_100000852 3300005347 Bacteria 21155
48 Ga0070668_100104767 3300005347 Bacteria 2245
49 Ga0070668_100167002 3300005347 Bacteria 1789
50 Ga0070668_100203259 3300005347 Bacteria 1627
51 Ga0070669_100000180 3300005353 Bacteria 55244
52 Ga0070675_100002254 3300005354 Bacteria 14301
53 Ga0070675_100039563 3300005354 Bacteria 3849
54 Ga0070671_100000129 3300005355 Bacteria 48602
55 Ga0070674_100001566 3300005356 Bacteria 12244
56 Ga0070674_100015749 3300005356 Bacteria 4728
57 Ga0070674_100082636 3300005356 Bacteria 2298
58 Ga0070674_100147910 3300005356 Bacteria 1770
59 Ga0070674_100802746 3300005356 Bacteria 813
60 Ga0070673_100000805 3300005364 Bacteria 17537
61 Ga0070673_100054937 3300005364 Bacteria 3136
62 Ga0070688_100000146 3300005365 Bacteria 38115
63 Ga0070688_100049376 3300005365 Bacteria 2618
64 Ga0070688_100590746 3300005365 Bacteria 849
65 Ga0070659_100000665 3300005366 Bacteria 24949
66 Ga0070659_100210273 3300005366 Bacteria 1603
67 Ga0070659_100279038 3300005366 Bacteria 1390
68 Ga0070667_100004504 3300005367 Bacteria 11756
69 Ga0070667_100042097 3300005367 Bacteria 3832
70 Ga0070703_10013006 3300005406 Bacteria 2359
71 Ga0070709_10170486 3300005434 Bacteria 1520
72 Ga0070709_10376036 3300005434 Bacteria 1055
73 Ga0070714_100461014 3300005435 Bacteria 1208
74 Ga0070714_100544810 3300005435 Bacteria 1110
75 Ga0070713_100297184 3300005436 Bacteria 1486
76 Ga0070710_10031660 3300005437 Bacteria 2858
77 Ga0070710_10094810 3300005437 Bacteria 1767
78 Ga0070701_10000764 3300005438 Bacteria 11468
79 Ga0070701_10053918 3300005438 Bacteria 2095
80 Ga0070711_100009150 3300005439 Bacteria 6087
81 Ga0070711_100040182 3300005439 Bacteria 3153
82 Ga0070711_100173052 3300005439 Bacteria 1647
83 Ga0070705_100000359 3300005440 Bacteria 26757
84 Ga0070705_100366641 3300005440 Bacteria 1055
85 Ga0070700_100030853 3300005441 Bacteria 3207
86 Ga0070700_100085893 3300005441 Bacteria 2042
87 Ga0070663_100001822 3300005455 Bacteria 11864
88 Ga0070663_100067069 3300005455 Bacteria 2602
89 Ga0070678_100000484 3300005456 Bacteria 19006
90 Ga0070678_100015071 3300005456 Bacteria 4900
91 Ga0070678_100226417 3300005456 Bacteria 1557
92 Ga0070678_100252038 3300005456 Bacteria 1480
93 Ga0070678_100255369 3300005456 Bacteria 1471
94 Ga0070678_100566889 3300005456 Bacteria 1010
95 Ga0070662_100001061 3300005457 Bacteria 16791
96 Ga0070662_100178920 3300005457 Bacteria 1671
97 Ga0070681_10082039 3300005458 Bacteria 3180
98 Ga0068867_100001778 3300005459 Bacteria 14985
99 Ga0068867_100014530 3300005459 Bacteria 5580
100 Ga0068867_100173617 3300005459 Bacteria 1709
101 Ga0068867_100199365 3300005459 Bacteria 1602
102 Ga0070685_10000749 3300005466 Bacteria 17655
103 Ga0070685_10121005 3300005466 Bacteria 1625
104 Ga0070679_100035378 3300005530 Bacteria 4955
105 Ga0070684_100013533 3300005535 Bacteria 6582
106 Ga0070684_100020868 3300005535 Bacteria 5438
107 Ga0070684_100117504 3300005535 Bacteria 2390
108 Ga0070684_100290814 3300005535 Bacteria 1498
109 Ga0068853_100019372 3300005539 Bacteria 5641
110 Ga0068853_100088042 3300005539 Bacteria 2725
111 Ga0070672_100001357 3300005543 Bacteria 15113
112 Ga0070686_100017067 3300005544 Bacteria 4236
113 Ga0070696_100032755 3300005546 Bacteria 3567
114 Ga0070696_100190780 3300005546 Bacteria 1525
115 Ga0070693_100072408 3300005547 Bacteria 2033
116 Ga0070665_100202691 3300005548 Bacteria 1984
117 Ga0070665_100303175 3300005548 Bacteria 1600
118 Ga0070665_100489595 3300005548 Bacteria 1241
119 Ga0070704_100005137 3300005549 Bacteria 7606
120 Ga0070704_100039056 3300005549 Bacteria 3256
121 Ga0070704_100330317 3300005549 Bacteria 1280
122 Ga0068855_100000320 3300005563 Bacteria 59730
123 Ga0068855_100472536 3300005563 Bacteria 1366
124 Ga0070664_100001107 3300005564 Bacteria 21323
125 Ga0070664_100003364 3300005564 Bacteria 12931
126 Ga0068857_100001857 3300005577 Bacteria 17003
127 Ga0068857_100006286 3300005577 Bacteria 10161
128 Ga0068857_100022219 3300005577 Bacteria 5581
129 Ga0068854_100001176 3300005578 Bacteria 15687
130 Ga0068854_100053392 3300005578 Bacteria 2902
131 Ga0068854_100068024 3300005578 Bacteria 2597
132 Ga0068854_100406884 3300005578 Bacteria 1127
133 Ga0068856_100065742 3300005614 Bacteria 3584
134 Ga0068856_100085158 3300005614 Bacteria 3140
135 Ga0070702_100014349 3300005615 Bacteria 4018
136 Ga0070702_100025003 3300005615 Bacteria 3194
137 Ga0070702_100090495 3300005615 Bacteria 1855
138 Ga0070702_100259467 3300005615 Bacteria 1182
139 Ga0068852_100000158 3300005616 Bacteria 45258
140 Ga0068852_100805061 3300005616 Bacteria 954
141 Ga0068852_101271339 3300005616 Bacteria 757
142 Ga0068859_100020605 3300005617 Bacteria 6616
143 Ga0068859_100042188 3300005617 Bacteria 4582
144 Ga0068864_100001189 3300005618 Bacteria 21646
145 Ga0068864_100100427 3300005618 Bacteria 2565
146 Ga0068866_10000414 3300005718 Bacteria 19861
147 Ga0068866_10017449 3300005718 Bacteria 3228
148 Ga0068866_10020552 3300005718 Bacteria 3027
149 Ga0068866_10040009 3300005718 Bacteria 2318
150 Ga0068866_10117038 3300005718 Bacteria 1496
151 Ga0068866_10777659 3300005718 Bacteria 663
152 Ga0068861_100000079 3300005719 Bacteria 46599
153 Ga0068861_100009494 3300005719 Bacteria 6719
154 Ga0068861_100152470 3300005719 Bacteria 1898
155 Ga0068851_10004904 3300005834 Bacteria 6063
156 Ga0068851_10100414 3300005834 Bacteria 1535
157 Ga0068870_10000320 3300005840 Bacteria 17840
158 Ga0068870_10005167 3300005840 Bacteria 5683
159 Ga0068870_10400233 3300005840 Bacteria 893
160 Ga0068863_100000361 3300005841 Bacteria 46280
161 Ga0068863_100071922 3300005841 Bacteria 3272
162 Ga0068858_100003786 3300005842 Bacteria 14955
163 Ga0068858_100019169 3300005842 Bacteria 6400
164 Ga0068858_100264096 3300005842 Bacteria 1637
165 Ga0068858_100572605 3300005842 Bacteria 1094
166 Ga0068860_100000571 3300005843 Bacteria 44338
167 Ga0068860_100017431 3300005843 Bacteria 6997
168 Ga0068860_100060696 3300005843 Bacteria 3593
169 Ga0068860_100064628 3300005843 Bacteria 3475
170 Ga0068862_100001958 3300005844 Bacteria 18679
171 Ga0068862_100082678 3300005844 Bacteria 2787
172 Ga0068862_100144824 3300005844 Bacteria 2111
173 Ga0068862_100155625 3300005844 Bacteria 2037
174 Ga0081540_1000073 3300005983 Bacteria 108893
175 Ga0081540_1000149 3300005983 Bacteria 72363
176 Ga0081540_1099026 3300005983 Bacteria 1261
177 Ga0075365_10084118 3300006038 Bacteria 2159
178 Ga0075365_10176126 3300006038 Bacteria 1494
179 Ga0075365_10481819 3300006038 Bacteria 876
180 Ga0075363_100015596 3300006048 Bacteria 3738
181 Ga0075363_100119192 3300006048 Bacteria 1472
182 Ga0075363_100451152 3300006048 Bacteria 760
183 Ga0075364_10028064 3300006051 Bacteria 3601
184 Ga0075364_10128574 3300006051 Bacteria 1699
185 Ga0075364_10249696 3300006051 Bacteria 1206
186 Ga0070715_10003349 3300006163 Bacteria 5079
187 Ga0070715_10007835 3300006163 Bacteria 3693
188 Ga0070715_10409521 3300006163 Bacteria 756
189 Ga0070716_100006523 3300006173 Bacteria 5704
190 Ga0070716_100008515 3300006173 Bacteria 5091
191 Ga0070716_100062805 3300006173 Bacteria 2155
192 Ga0070712_100007763 3300006175 Bacteria 6716
193 Ga0070712_100020521 3300006175 Bacteria 4324
194 Ga0070712_100099419 3300006175 Bacteria 2147
195 Ga0070712_100219196 3300006175 Bacteria 1505
196 Ga0075367_10023412 3300006178 Bacteria 3475
197 Ga0075369_10015734 3300006186 Bacteria 3041
198 Ga0075369_10037824 3300006186 Bacteria 2057
199 Ga0075369_10085246 3300006186 Bacteria 1405
200 Ga0075369_10172536 3300006186 Bacteria 994
201 Ga0075369_10174420 3300006186 Bacteria 988
202 Ga0075369_10296041 3300006186 Bacteria 755
203 Ga0097621_100001336 3300006237 Bacteria 16961
204 Ga0097621_100103784 3300006237 Bacteria 2395
205 Ga0075370_10068654 3300006353 Bacteria 2024
206 Ga0075370_10355257 3300006353 Bacteria 876
207 Ga0068871_100000398 3300006358 Bacteria 30329
208 Ga0068871_100035728 3300006358 Bacteria 3951
209 Ga0068871_100077582 3300006358 Bacteria 2746
210 Ga0075428_100189524 3300006844 Bacteria 2224
211 Ga0075429_100024137 3300006880 Bacteria 5274
212 Ga0075429_100811309 3300006880 Bacteria 819
213 Ga0068865_100010117 3300006881 Bacteria 5866
214 Ga0068865_100013937 3300006881 Bacteria 5098
215 Ga0068865_100022210 3300006881 Bacteria 4135
216 Ga0068865_100065613 3300006881 Bacteria 2558
217 Ga0068865_100529637 3300006881 Bacteria 986
218 Ga0097620_100020605 3300006931 Bacteria 6616
219 Ga0097620_100042189 3300006931 Bacteria 4582
220 Ga0097620_100116593 3300006931 Bacteria 2735
221 Ga0075435_100272641 3300007076 Bacteria 1443
222 Ga0105250_10051770 3300009092 Bacteria 1647
223 Ga0105250_10147845 3300009092 Bacteria 976
224 Ga0105240_10002584 3300009093 Bacteria 28996
225 Ga0111539_10529903 3300009094 Bacteria 1372
226 Ga0111539_11096885 3300009094 Bacteria 925
227 Ga0105245_10000137 3300009098 Bacteria 69634
228 Ga0105245_10352469 3300009098 Bacteria 1459
229 Ga0105245_10562407 3300009098 Bacteria 1163
230 Ga0105247_10000106 3300009101 Bacteria 87195
231 Ga0105247_10168466 3300009101 Bacteria 1455
232 Ga0105247_10288677 3300009101 Bacteria 1134
233 Ga0114129_10054328 3300009147 Bacteria 5615
234 Ga0105243_10004158 3300009148 Bacteria 11485
235 Ga0105243_10034369 3300009148 Bacteria 3924
236 Ga0105243_10159333 3300009148 Bacteria 1944
237 Ga0105243_10328869 3300009148 Bacteria 1395
238 Ga0105241_10002148 3300009174 Bacteria 14861
239 Ga0105241_10139258 3300009174 Bacteria 1974
240 Ga0105241_10201326 3300009174 Bacteria 1663
241 Ga0105242_10001041 3300009176 Bacteria 21756
242 Ga0105242_10035466 3300009176 Bacteria 4000
243 Ga0105242_10086989 3300009176 Bacteria 2623
244 Ga0105248_10001344 3300009177 Bacteria 27398
245 Ga0105237_10000599 3300009545 Bacteria 50226
246 Ga0105237_10002051 3300009545 Bacteria 25601
247 Ga0105237_10139611 3300009545 Bacteria 2417
248 Ga0105237_10222783 3300009545 Bacteria 1886
249 Ga0105237_10300729 3300009545 Bacteria 1608
250 Ga0105237_12174550 3300009545 Bacteria 564
251 Ga0105238_10000994 3300009551 Bacteria 28961
252 Ga0105238_10442471 3300009551 Bacteria 1296
253 Ga0105249_10000275 3300009553 Bacteria 54246
254 Ga0105249_10071738 3300009553 Bacteria 3201
255 Ga0105249_10079289 3300009553 Bacteria 3048
256 Ga0105249_10094239 3300009553 Bacteria 2806
257 Ga0105249_11229972 3300009553 Bacteria 820
258 Ga0105249_11368103 3300009553 Bacteria 780
259 Ga0105239_10003039 3300010375 Bacteria 20851
260 Ga0105239_10003587 3300010375 Bacteria 18952
261 Ga0105239_10101877 3300010375 Bacteria 3177
262 Ga0105239_10217076 3300010375 Bacteria 2144
263 Ga0105239_11203403 3300010375 Bacteria 873
264 Ga0105246_10006490 3300011119 Bacteria 7145
265 Ga0105246_10025541 3300011119 Bacteria 3851
266 Ga0105246_10079286 3300011119 Bacteria 2335
267 Ga0105246_10215227 3300011119 Bacteria 1502
268 Ga0157373_10005362 3300013100 Bacteria 9634
269 Ga0157371_10001570 3300013102 Bacteria 23478
270 Ga0157371_10857635 3300013102 Bacteria 687
271 Ga0157370_10206097 3300013104 Bacteria 1823
272 Ga0157369_10000816 3300013105 Bacteria 39816
273 Ga0157374_10002351 3300013296 Bacteria 15958
274 Ga0157374_10004568 3300013296 Bacteria 11613
275 Ga0157374_10932484 3300013296 Bacteria 886
276 Ga0157378_10001420 3300013297 Bacteria 21534
277 Ga0157378_10042343 3300013297 Bacteria 4042
278 Ga0163162_10000729 3300013306 Bacteria 30485
279 Ga0163162_10081460 3300013306 Bacteria 3307
280 Ga0163162_10213906 3300013306 Bacteria 2058
281 Ga0163162_10840999 3300013306 Bacteria 1033
282 Ga0157372_10000520 3300013307 Bacteria 42470
283 Ga0157372_10086249 3300013307 Bacteria 3562
284 Ga0157372_10290188 3300013307 Bacteria 1903
285 Ga0157375_10003665 3300013308 Bacteria 13330
286 Ga0157375_10078114 3300013308 Bacteria 3342
287 Ga0157375_10299855 3300013308 Bacteria 1771
288 Ga0157375_10359424 3300013308 Bacteria 1622
289 Ga0157375_10730200 3300013308 Bacteria 1143
290 Ga0163163_10009942 3300014325 Bacteria 8530
291 Ga0163163_10030863 3300014325 Bacteria 5168
292 Ga0163163_10315748 3300014325 Bacteria 1616
293 Ga0157380_10005423 3300014326 Bacteria 8909
294 Ga0157380_10266495 3300014326 Bacteria 1559
295 Ga0157380_10272752 3300014326 Bacteria 1543
296 Ga0157380_10541549 3300014326 Bacteria 1140
297 Ga0157380_10833528 3300014326 Bacteria 942
298 Ga0157377_10000281 3300014745 Bacteria 24418
299 Ga0157379_10000385 3300014968 Bacteria 35739
300 Ga0157379_10272539 3300014968 Bacteria 1539
301 Ga0157379_10624771 3300014968 Bacteria 1007
302 Ga0157376_10001076 3300014969 Bacteria 17890
303 Ga0157376_10016729 3300014969 Bacteria 5577
304 Ga0157376_10052557 3300014969 Bacteria 3388
305 Ga0157376_10194582 3300014969 Bacteria 1862
306 Ga0157376_10340628 3300014969 Bacteria 1432
307 Ga0157376_10527304 3300014969 Bacteria 1165
308 Ga0163161_10002375 3300017792 Bacteria 13484
309 Ga0163161_10222663 3300017792 Bacteria 1461
310 Ga0207697_10000433 3300025315 Bacteria 23583
311 Ga0207656_10000538 3300025321 Bacteria 12547
312 Ga0207696_1098850 3300025711 Bacteria 796
313 Ga0207653_10036117 3300025885 Bacteria 1609
314 Ga0207682_10000118 3300025893 Bacteria 36634
315 Ga0207692_10014881 3300025898 Bacteria 3410
316 Ga0207692_10016015 3300025898 Bacteria 3310
317 Ga0207692_10051617 3300025898 Bacteria 2086
318 Ga0207692_10109567 3300025898 Bacteria 1530
319 Ga0207642_10000709 3300025899 Bacteria 10306
320 Ga0207642_10005782 3300025899 Bacteria 4065
321 Ga0207642_10010405 3300025899 Bacteria 3277
322 Ga0207642_10018722 3300025899 Bacteria 2664
323 Ga0207642_10110326 3300025899 Bacteria 1399
324 Ga0207710_10003842 3300025900 Bacteria 6639
325 Ga0207688_10000174 3300025901 Bacteria 28429
326 Ga0207688_10003983 3300025901 Bacteria 8049
327 Ga0207688_10023517 3300025901 Bacteria 3375
328 Ga0207688_10073509 3300025901 Bacteria 1943
329 Ga0207680_10000198 3300025903 Bacteria 29025
330 Ga0207680_10094552 3300025903 Bacteria 1908
331 Ga0207680_10130677 3300025903 Bacteria 1655
332 Ga0207647_10000568 3300025904 Bacteria 28920
333 Ga0207647_10011974 3300025904 Bacteria 6055
334 Ga0207685_10027666 3300025905 Bacteria 1987
335 Ga0207685_10062108 3300025905 Bacteria 1483
336 Ga0207699_10242716 3300025906 Bacteria 1238
337 Ga0207645_10000053 3300025907 Bacteria 83208
338 Ga0207643_10000013 3300025908 Bacteria 130464
339 Ga0207643_10002721 3300025908 Bacteria 9563
340 Ga0207705_10095065 3300025909 Bacteria 2186
341 Ga0207654_10000934 3300025911 Bacteria 16089
342 Ga0207654_10130538 3300025911 Bacteria 1590
343 Ga0207707_10390494 3300025912 Bacteria 1196
344 Ga0207695_10016806 3300025913 Bacteria 8543
345 Ga0207695_10350216 3300025913 Bacteria 1364
346 Ga0207671_10004398 3300025914 Bacteria 13507
347 Ga0207671_10008894 3300025914 Bacteria 8456
348 Ga0207671_10420685 3300025914 Bacteria 1063
349 Ga0207693_10005271 3300025915 Bacteria 10814
350 Ga0207693_10014044 3300025915 Bacteria 6448
351 Ga0207693_10350892 3300025915 Bacteria 1154
352 Ga0207663_10094398 3300025916 Bacteria 1993
353 Ga0207662_10000009 3300025918 Bacteria 95358
354 Ga0207662_10024801 3300025918 Bacteria 3451
355 Ga0207662_10180570 3300025918 Bacteria 1358
356 Ga0207657_10000042 3300025919 Bacteria 118735
357 Ga0207657_10373636 3300025919 Bacteria 1123
358 Ga0207649_10000765 3300025920 Bacteria 20907
359 Ga0207649_10001685 3300025920 Bacteria 12763
360 Ga0207652_10105629 3300025921 Bacteria 2492
361 Ga0207681_10000933 3300025923 Bacteria 19036
362 Ga0207681_10363182 3300025923 Bacteria 1162
363 Ga0207694_10009688 3300025924 Bacteria 7263
364 Ga0207694_10599830 3300025924 Bacteria 926
365 Ga0207650_10000245 3300025925 Bacteria 59462
366 Ga0207659_10000115 3300025926 Bacteria 46765
367 Ga0207687_10002436 3300025927 Bacteria 12637
368 Ga0207687_10027783 3300025927 Bacteria 3798
369 Ga0207687_10161602 3300025927 Bacteria 1720
370 Ga0207644_10000201 3300025931 Bacteria 42183
371 Ga0207644_10158060 3300025931 Bacteria 1760
372 Ga0207690_10001478 3300025932 Bacteria 14685
373 Ga0207690_10328697 3300025932 Bacteria 1203
374 Ga0207690_10920098 3300025932 Bacteria 726
375 Ga0207690_10972111 3300025932 Bacteria 706
376 Ga0207706_10000046 3300025933 Bacteria 119273
377 Ga0207706_10020804 3300025933 Bacteria 5893
378 Ga0207706_10055761 3300025933 Bacteria 3484
379 Ga0207706_10136331 3300025933 Bacteria 2159
380 Ga0207706_10254040 3300025933 Bacteria 1535
381 Ga0207686_10002723 3300025934 Bacteria 9582
382 Ga0207686_10047915 3300025934 Bacteria 2644
383 Ga0207686_10056753 3300025934 Bacteria 2463
384 Ga0207686_10071015 3300025934 Bacteria 2239
385 Ga0207709_10004072 3300025935 Bacteria 8507
386 Ga0207709_10183047 3300025935 Bacteria 1481
387 Ga0207709_10284984 3300025935 Bacteria 1222
388 Ga0207709_10299212 3300025935 Bacteria 1196
389 Ga0207670_10000295 3300025936 Bacteria 30013
390 Ga0207670_10115375 3300025936 Bacteria 1943
391 Ga0207669_10000636 3300025937 Bacteria 15145
392 Ga0207669_10102261 3300025937 Bacteria 1898
393 Ga0207669_10107688 3300025937 Bacteria 1859
394 Ga0207704_10000747 3300025938 Bacteria 14307
395 Ga0207704_10130090 3300025938 Bacteria 1741
396 Ga0207665_10010565 3300025939 Bacteria 6064
397 Ga0207665_10021889 3300025939 Bacteria 4204
398 Ga0207665_10061042 3300025939 Bacteria 2554
399 Ga0207691_10000314 3300025940 Bacteria 48335
400 Ga0207691_10005262 3300025940 Bacteria 12490
401 Ga0207691_10068947 3300025940 Bacteria 3195
402 Ga0207711_10000234 3300025941 Bacteria 59526
403 Ga0207711_10200480 3300025941 Bacteria 1821
404 Ga0207689_10000071 3300025942 Bacteria 82580
405 Ga0207689_10009642 3300025942 Bacteria 8325
406 Ga0207689_10145791 3300025942 Bacteria 1950
407 Ga0207661_10005312 3300025944 Bacteria 9068
408 Ga0207679_10000111 3300025945 Bacteria 66057
409 Ga0207679_10000530 3300025945 Bacteria 25785
410 Ga0207667_10003794 3300025949 Bacteria 18600
411 Ga0207667_10362361 3300025949 Bacteria 1478
412 Ga0207651_10000270 3300025960 Bacteria 22154
413 Ga0207651_10005041 3300025960 Bacteria 6734
414 Ga0207651_10042064 3300025960 Bacteria 3038
415 Ga0207651_10514744 3300025960 Bacteria 1036
416 Ga0207712_10000329 3300025961 Bacteria 43533
417 Ga0207712_10652502 3300025961 Bacteria 915
418 Ga0207712_10918365 3300025961 Bacteria 774
419 Ga0207668_10003034 3300025972 Bacteria 9843
420 Ga0207668_10052992 3300025972 Bacteria 2810
421 Ga0207668_10067809 3300025972 Bacteria 2534
422 Ga0207668_10278841 3300025972 Bacteria 1370
423 Ga0207668_10503883 3300025972 Bacteria 1042
424 Ga0207640_10002320 3300025981 Bacteria 10226
425 Ga0207640_10033664 3300025981 Bacteria 3191
426 Ga0207640_10388004 3300025981 Bacteria 1134
427 Ga0207658_10000980 3300025986 Bacteria 23563
428 Ga0207658_10096480 3300025986 Bacteria 2306
429 Ga0207658_10267197 3300025986 Bacteria 1460
430 Ga0207658_10281707 3300025986 Bacteria 1425
431 Ga0207677_10000181 3300026023 Bacteria 50309
432 Ga0207677_10023893 3300026023 Bacteria 3785
433 Ga0207677_10058521 3300026023 Bacteria 2654
434 Ga0207677_10170444 3300026023 Bacteria 1701
435 Ga0207703_10001550 3300026035 Bacteria 20837
436 Ga0207703_10043847 3300026035 Bacteria 3592
437 Ga0207703_10076887 3300026035 Bacteria 2770
438 Ga0207703_10336047 3300026035 Bacteria 1387
439 Ga0207703_10478035 3300026035 Bacteria 1167
440 Ga0207639_10014494 3300026041 Bacteria 5546
441 Ga0207678_10000430 3300026067 Bacteria 38062
442 Ga0207678_10016962 3300026067 Bacteria 6395
443 Ga0207678_10107147 3300026067 Bacteria 2384
444 Ga0207678_10554867 3300026067 Bacteria 1005
445 Ga0207708_10001377 3300026075 Bacteria 18288
446 Ga0207708_10014636 3300026075 Bacteria 5871
447 Ga0207708_10136029 3300026075 Bacteria 1925
448 Ga0207702_10000881 3300026078 Bacteria 31236
449 Ga0207641_10000652 3300026088 Bacteria 37792
450 Ga0207641_10347435 3300026088 Bacteria 1413
451 Ga0207648_10000302 3300026089 Bacteria 53741
452 Ga0207648_10003123 3300026089 Bacteria 17493
453 Ga0207648_10031437 3300026089 Bacteria 4694
454 Ga0207648_10184706 3300026089 Bacteria 1846
455 Ga0207676_10000642 3300026095 Bacteria 28097
456 Ga0207676_10055890 3300026095 Bacteria 3101
457 Ga0207674_10001952 3300026116 Bacteria 26135
458 Ga0207674_10033236 3300026116 Bacteria 5402
459 Ga0207674_10565351 3300026116 Bacteria 1098
460 Ga0207675_100000165 3300026118 Bacteria 58839
461 Ga0207675_100002328 3300026118 Bacteria 18830
462 Ga0207675_100157943 3300026118 Bacteria 2161
463 Ga0207683_10000211 3300026121 Bacteria 50758
464 Ga0207683_10022293 3300026121 Bacteria 5434
465 Ga0207683_10037711 3300026121 Bacteria 4210
466 Ga0207683_10066532 3300026121 Bacteria 3178
467 Ga0207683_10585721 3300026121 Bacteria 1032
468 Ga0207698_10000769 3300026142 Bacteria 18686
469 Ga0207698_10061313 3300026142 Bacteria 2930
470 Ga0207698_10324072 3300026142 Bacteria 1444
471 Ga0207698_11243976 3300026142 Bacteria 759
472 Ga0207428_10842035 3300027907 Bacteria 650
473 Ga0268266_10001501 3300028379 Bacteria 27588
474 Ga0268266_10042481 3300028379 Bacteria 3883
475 Ga0268265_10000394 3300028380 Bacteria 46647
476 Ga0268265_10057941 3300028380 Bacteria 2955
477 Ga0268265_10473830 3300028380 Bacteria 1174
478 Ga0268265_10658635 3300028380 Bacteria 1007
479 Ga0268264_10000191 3300028381 Bacteria 127257
480 Ga0268264_10000573 3300028381 Bacteria 44555
481 Ga0268264_10088693 3300028381 Bacteria 2662
482 Ga0268264_10108427 3300028381 Bacteria 2427
483 Ga0268264_10247008 3300028381 Bacteria 1656
484 Ga0268264_10457892 3300028381 Bacteria 1237
485 Ga0265334_10003345 3300028573 Bacteria 7317
486 Ga0307515_10239470 3300028794 Bacteria 1589
487 Ga0316578_10157889 3300031728 Bacteria 1367
488 Ga0307405_11616886 3300031731 Bacteria 572
489 Ga0307413_10006621 3300031824 Bacteria 5311
490 Ga0307413_10561387 3300031824 Bacteria 928
491 Ga0307406_10436755 3300031901 Bacteria 1047
492 Ga0307409_100552750 3300031995 Bacteria 1130
493 Ga0307409_100841718 3300031995 Bacteria 928
494 Ga0307416_100369602 3300032002 Bacteria 1460
495 Ga0307416_100919229 3300032002 Bacteria 976
496 Ga0373932_0028696 3300035112 Bacteria 1531
497 Ga0373931_0042310 3300035691 Bacteria 2395
498 Ga0373931_0049971 3300035691 Bacteria 2224
499 Ga0316582_0387656 3300036647 Bacteria 962
500 Ga0316584_0209445 3300036712 Bacteria 1435
501 Ga0395900_0730761 3300037418 Bacteria 922
502 Ga0395898_0131033 3300037466 Bacteria 2402
503 Ga0395905_0069259 3300037471 Bacteria 3304
504 Ga0395905_0562886 3300037471 Bacteria 1041
505 Ga0436364_1106144 3300037853 Bacteria 1716
506 Ga0395901_0719116 3300038443 Bacteria 994
507 Ga0436365_0144265 3300039437 Bacteria 938
508 Ga0436363_1179098 3300039450 Bacteria 4029
509 Ga0439466_0056748 3300041411 Bacteria 1270
510 Ga0439465_0008035 3300041413 Bacteria 3338
511 Ga0451797_0847368 3300041453 Bacteria 602
512 Ga0451800_1652997 3300041459 Bacteria 761
513 Ga0451833_1468257 3300041491 Bacteria 811
514 Ga0439448_0022702 3300042005 Bacteria 1953
515 Ga0439449_0063452 3300042007 Bacteria 1363
516 Ga0439455_0008314 3300042012 Bacteria 2220
517 Ga0466969_0107871 3300044656 Bacteria 1305
518 Ga0466972_0026587 3300044658 Bacteria 2868
519 Ga0466972_0040075 3300044658 Bacteria 2283
520 Ga0466972_0042134 3300044658 Bacteria 2221
521 Ga0466965_0002372 3300044683 Bacteria 7980
522 Ga0466965_0011035 3300044683 Bacteria 4225
523 Ga0466961_0056390 3300044693 Bacteria 2503
524 Ga0466961_0132942 3300044693 Bacteria 1559
525 Ga0466963_0002485 3300044694 Bacteria 10309
526 Ga0466963_0035011 3300044694 Bacteria 3270
527 Ga0466963_0040258 3300044694 Bacteria 3063
528 Ga0466963_0355428 3300044694 Bacteria 1032
529 Ga0466963_0467742 3300044694 Bacteria 890
530 Ga0466964_0025375 3300044706 Bacteria 2314
531 Ga0466971_0081272 3300044719 Bacteria 1478
532 Ga0466970_0077516 3300044765 Bacteria 1792
533 Ga0466970_0088377 3300044765 Bacteria 1680
534 Ga0466970_0121481 3300044765 Bacteria 1431
535 Ga0466970_0168949 3300044765 Bacteria 1211
536 Ga0466970_0413414 3300044765 Bacteria 771
537 Ga0466957_0047977 3300044842 Bacteria 2595
538 Ga0466957_0098253 3300044842 Bacteria 1842
539 Ga0466960_0000043 3300044901 Bacteria 40805
540 Ga0466960_0000469 3300044901 Bacteria 13834
541 Ga0466959_0363772 3300045049 Bacteria 985
542 Ga0466959_0801513 3300045049 Bacteria 630
543 Ga0451576_0041703 3300045051 Bacteria 4851
544 Ga0466958_0032613 3300045836 Bacteria 3100
545 Ga0466958_0036071 3300045836 Bacteria 2958
546 Ga0466958_0182795 3300045836 Bacteria 1331
547 Ga0466958_0200853 3300045836 Bacteria 1269
548 Ga0466967_0038592 3300045976 Bacteria 4097
549 Ga0466967_0045146 3300045976 Bacteria 3827
550 Ga0466967_0051054 3300045976 Bacteria 3623
551 Ga0466967_0081226 3300045976 Bacteria 2928
552 Ga0466967_0302113 3300045976 Bacteria 1540
553 Ga0466967_1234555 3300045976 Bacteria 745
554 Ga0495627_013326 3300046453 Bacteria 2894
555 Ga0495627_124216 3300046453 Bacteria 728
556 Ga0495592_0418933 3300046454 Bacteria 845
557 Ga0495603_0003497 3300046455 Bacteria 9346
558 Ga0495603_0241715 3300046455 Bacteria 1040
559 Ga0495629_0132414 3300046459 Bacteria 1737
560 Ga0495638_0464910 3300046460 Bacteria 643
561 Ga0495651_0002255 3300046462 Bacteria 14897
562 Ga0495651_0074671 3300046462 Bacteria 2572
563 Ga0495651_0549699 3300046462 Bacteria 734
564 Ga0495662_0009605 3300046476 Bacteria 4743
565 Ga0495664_0135702 3300046477 Bacteria 1491
566 Ga0495585_0105796 3300046492 Bacteria 1500
567 Ga0495594_0011704 3300046499 Bacteria 4562
568 Ga0495594_0079672 3300046499 Bacteria 1829
569 Ga0495608_0168712 3300046511 Bacteria 1389
570 Ga0495628_0010353 3300046516 Bacteria 7929
571 Ga0495648_0001220 3300046524 Bacteria 25766
572 Ga0495666_0179583 3300046526 Bacteria 978
573 Ga0495642_0151503 3300046528 Bacteria 1003
574 Ga0495652_0010947 3300046529 Bacteria 8216
575 Ga0495645_0054714 3300046543 Bacteria 2899
576 Ga0495622_0065637 3300046557 Bacteria 1678
577 Ga0495611_0045992 3300046648 Bacteria 1956
578 Ga0495625_0102107 3300046660 Bacteria 1969
579 Ga0495635_0088184 3300046663 Bacteria 2123
580 Ga0495635_0167194 3300046663 Bacteria 1496
581 Ga0495588_0038616 3300046674 Bacteria 2429
582 Ga0495657_0002058 3300046675 Bacteria 17117
583 Ga0495623_0274297 3300046679 Bacteria 940
584 Ga0495646_0299653 3300046680 Bacteria 851
585 Ga0495613_0004186 3300046689 Bacteria 10795
586 Ga0495613_0535905 3300046689 Bacteria 785
587 Ga0495581_0025921 3300047315 Bacteria 3400
588 Ga0495604_0255731 3300047317 Bacteria 1192
589 Ga0495636_0011349 3300047318 Bacteria 3526
590 Ga0495672_0018774 3300047320 Bacteria 4579
591 Ga0495685_095976 3300047447 Bacteria 980
592 Ga0495673_0078536 3300047469 Bacteria 1371
593 Ga0495602_0880768 3300048088 Bacteria 597
594 Ga0495626_0129437 3300048091 Bacteria 1079
595 Ga0496100_0026032 3300048903 Bacteria 3583
596 Ga0496100_0028049 3300048903 Bacteria 3469
597 Ga0496100_0042550 3300048903 Bacteria 2901
598 Ga0496100_0069186 3300048903 Bacteria 2350
599 Ga0496100_0121897 3300048903 Bacteria 1825
600 Ga0496101_0000011 3300048904 Bacteria 272153
601 Ga0496101_0195083 3300048904 Bacteria 1564
602 Ga0496101_0230720 3300048904 Bacteria 1439
603 Ga0496101_0442524 3300048904 Bacteria 1025
604 Ga0496102_0000012 3300048905 Bacteria 315470
605 Ga0496102_0001137 3300048905 Bacteria 24377
606 Ga0496102_0018021 3300048905 Bacteria 6196
607 Ga0496102_0061518 3300048905 Bacteria 3436
608 Ga0496102_0082523 3300048905 Bacteria 2964
609 Ga0496102_0250045 3300048905 Bacteria 1671
610 Ga0496103_0000005 3300048906 Bacteria 505416
611 Ga0496103_0037464 3300048906 Bacteria 2972
612 Ga0496103_0122412 3300048906 Bacteria 1658
613 Ga0496103_0128696 3300048906 Bacteria 1616
614 Ga0496104_0234603 3300048907 Bacteria 1746
615 Ga0496104_0502396 3300048907 Bacteria 1124
616 Ga0496104_1405697 3300048907 Bacteria 601
617 Ga0496105_0349170 3300048908 Bacteria 1182
618 Ga0496105_0566537 3300048908 Bacteria 885
619 Ga0496105_0587424 3300048908 Bacteria 866
620 Ga0496106_0001297 3300048909 Bacteria 18784
621 Ga0496106_0016284 3300048909 Bacteria 5502
622 Ga0496106_0118266 3300048909 Bacteria 2069
623 Ga0496106_0148203 3300048909 Bacteria 1850
624 Ga0496106_0180349 3300048909 Bacteria 1676
625 Ga0496106_0210448 3300048909 Bacteria 1549
626 Ga0496106_0710788 3300048909 Bacteria 800
627 Ga0496107_0008820 3300048910 Bacteria 6987
628 Ga0496107_0082594 3300048910 Bacteria 2343
629 Ga0496107_0253131 3300048910 Bacteria 1310
630 Ga0496108_0006199 3300048911 Bacteria 9683
631 Ga0496108_0013662 3300048911 Bacteria 6628
632 Ga0496108_0045273 3300048911 Bacteria 3675
633 Ga0496108_0217179 3300048911 Bacteria 1660
634 Ga0496108_0362213 3300048911 Bacteria 1266
635 Ga0496108_0672651 3300048911 Bacteria 899
636 Ga0496108_0709998 3300048911 Bacteria 872
637 Ga0496109_0002194 3300048912 Bacteria 16200
638 Ga0496109_0013758 3300048912 Bacteria 7030
639 Ga0496109_0031454 3300048912 Bacteria 4762
640 Ga0496109_0080789 3300048912 Bacteria 2996
641 Ga0496109_0223772 3300048912 Bacteria 1770
642 Ga0496110_0033275 3300048913 Bacteria 4458
643 Ga0496110_0508563 3300048913 Bacteria 1096
644 Ga0496110_0682966 3300048913 Bacteria 928
645 Ga0496111_0062566 3300048914 Bacteria 2699
646 Ga0496111_0193736 3300048914 Bacteria 1511
647 Ga0496111_0251545 3300048914 Bacteria 1312
648 Ga0496112_0017179 3300048915 Bacteria 6794
649 Ga0496113_0040483 3300048916 Bacteria 3434
650 Ga0496113_0100314 3300048916 Bacteria 2243
651 Ga0496113_0602811 3300048916 Bacteria 879
652 Ga0496114_0067272 3300048917 Bacteria 3005
653 Ga0496114_0071163 3300048917 Bacteria 2922
654 Ga0496114_0635220 3300048917 Bacteria 940
655 Ga0496115_0113667 3300048918 Bacteria 2225
656 Ga0496115_0142055 3300048918 Bacteria 1981
657 Ga0496115_0263418 3300048918 Bacteria 1417
658 Ga0496116_0000050 3300048919 Bacteria 311670
659 Ga0496117_0000042 3300048920 Bacteria 315470
660 Ga0496118_0000037 3300048921 Bacteria 315470
661 Ga0496118_0154389 3300048921 Bacteria 1431
662 Ga0496119_0000486 3300048922 Bacteria 54401
663 Ga0496120_0000121 3300048923 Bacteria 131612
664 Ga0496121_0001091 3300048924 Bacteria 47947
665 Ga0496121_0023565 3300048924 Bacteria 5922
666 Ga0496121_0267175 3300048924 Bacteria 1178
667 Ga0496122_0000575 3300048925 Bacteria 75355
668 Ga0496123_0000333 3300048926 Bacteria 89644
669 Ga0496124_0002355 3300048927 Bacteria 24936
670 Ga0496124_0342524 3300048927 Bacteria 1061
671 Ga0496126_0000236 3300048929 Bacteria 119350
672 Ga0496126_0013491 3300048929 Bacteria 8304
673 Ga0496126_0024488 3300048929 Bacteria 5828
674 Ga0496126_0073036 3300048929 Bacteria 3050
675 Ga0496126_0079850 3300048929 Bacteria 2895
676 Ga0501031_0098159 3300049568 Bacteria 1911
677 Ga0501031_0320427 3300049568 Bacteria 1004
678 Ga0501032_0031446 3300049569 Bacteria 3639
679 Ga0501032_0038218 3300049569 Bacteria 3270
680 Ga0501032_0254095 3300049569 Bacteria 1140
681 Ga0501032_0402800 3300049569 Bacteria 879
682 Ga0501034_0013772 3300049571 Bacteria 8320
683 Ga0501034_0030998 3300049571 Bacteria 5434
684 Ga0501034_0378456 3300049571 Bacteria 1341
685 Ga0501036_0052771 3300049572 Bacteria 3443
686 Ga0501036_0170547 3300049572 Bacteria 1833
687 Ga0501036_0545845 3300049572 Bacteria 963
688 Ga0501037_0005801 3300049573 Bacteria 9012
689 Ga0501037_0040445 3300049573 Bacteria 3431
690 Ga0501037_0172794 3300049573 Bacteria 1535
691 Ga0501038_0010056 3300049574 Bacteria 8663
692 Ga0501038_0026723 3300049574 Bacteria 5139
693 Ga0501038_0040632 3300049574 Bacteria 4059
694 Ga0501038_0814077 3300049574 Bacteria 693
695 Ga0501039_0000835 3300049575 Bacteria 22275
696 Ga0501039_0021000 3300049575 Bacteria 5008
697 Ga0501039_0024627 3300049575 Bacteria 4623
698 Ga0501039_0122273 3300049575 Bacteria 2040
699 Ga0501039_0515647 3300049575 Bacteria 939
700 Ga0501040_0003702 3300049576 Bacteria 9907
701 Ga0501041_0010911 3300049577 Bacteria 5362
702 Ga0501041_0090643 3300049577 Bacteria 1887
703 Ga0501041_0755805 3300049577 Bacteria 623
704 Ga0501042_0009588 3300049578 Bacteria 6460
705 Ga0501042_0220267 3300049578 Bacteria 1369
706 Ga0501042_0602855 3300049578 Bacteria 798
707 Ga0501043_0016855 3300049579 Bacteria 5726
708 Ga0501043_0142364 3300049579 Bacteria 1877
709 Ga0501043_0247622 3300049579 Bacteria 1373
710 Ga0501043_0391717 3300049579 Bacteria 1050
711 Ga0501043_0435751 3300049579 Bacteria 987
712 Ga0501046_0003883 3300049580 Bacteria 13668
713 Ga0501046_0076146 3300049580 Bacteria 2600
714 Ga0501047_0070038 3300049581 Bacteria 3376
715 Ga0501048_0004420 3300049582 Bacteria 10704
716 Ga0501048_0012968 3300049582 Bacteria 6190
717 Ga0501048_0090672 3300049582 Bacteria 2156
718 Ga0501067_0214213 3300049583 Bacteria 1073
719 Ga0501068_0421418 3300049584 Bacteria 862
720 Ga0501070_0008673 3300049586 Bacteria 8595
721 Ga0501070_0047959 3300049586 Bacteria 3549
722 Ga0501070_0104510 3300049586 Bacteria 2342
723 Ga0501070_0170676 3300049586 Bacteria 1792
724 Ga0501070_0640986 3300049586 Bacteria 844
725 Ga0501071_0051099 3300049587 Bacteria 2978
726 Ga0501071_0052358 3300049587 Bacteria 2943
727 Ga0501072_0004450 3300049588 Bacteria 10644
728 Ga0501072_0165450 3300049588 Bacteria 1764
729 Ga0501072_1146013 3300049588 Bacteria 605
730 Ga0501073_0016582 3300049589 Bacteria 5338
731 Ga0501073_0113746 3300049589 Bacteria 1877
732 Ga0501073_0130731 3300049589 Bacteria 1740
733 Ga0501074_0012053 3300049590 Bacteria 6281
734 Ga0501074_0148269 3300049590 Bacteria 1678
735 Ga0501075_0002801 3300049591 Bacteria 11684
736 Ga0501075_0267043 3300049591 Bacteria 1304
737 Ga0501075_0547385 3300049591 Bacteria 883
738 Ga0501076_0010097 3300049592 Bacteria 6990
739 Ga0501076_0187038 3300049592 Bacteria 1689
740 Ga0501077_0019963 3300049593 Bacteria 4240
741 Ga0501077_0025068 3300049593 Bacteria 3788
742 Ga0501077_0366626 3300049593 Bacteria 920
743 Ga0501079_0043461 3300049741 Bacteria 3468
744 Ga0501079_0308180 3300049741 Bacteria 1239
745 Ga0501079_0325869 3300049741 Bacteria 1203
746 Ga0501079_0466005 3300049741 Bacteria 992
747 Ga0501080_0111948 3300049742 Bacteria 2530
748 Ga0501080_0148074 3300049742 Bacteria 2171
749 Ga0501080_0180353 3300049742 Bacteria 1944
750 Ga0501080_1122028 3300049742 Bacteria 678
751 Ga0501081_0001208 3300049743 Bacteria 15698
752 Ga0501081_0093130 3300049743 Bacteria 2121
753 Ga0501083_0143535 3300049744 Bacteria 1563
754 Ga0501035_0176459 3300049822 Bacteria 1843
755 Ga0501035_0351537 3300049822 Bacteria 1233
756 Ga0501044_0005313 3300049823 Bacteria 14326
757 Ga0501044_0035058 3300049823 Bacteria 5256
758 Ga0501044_0077022 3300049823 Bacteria 3383
759 Ga0501044_0209272 3300049823 Bacteria 1905
760 Ga0501045_0002030 3300049824 Bacteria 13686
761 Ga0501045_0008210 3300049824 Bacteria 7272
762 Ga0501045_0068393 3300049824 Bacteria 2609
763 Ga0501045_0704738 3300049824 Bacteria 745
764 Ga0501045_0717420 3300049824 Bacteria 737
765 nmdc:mga03683_105759_c1 3300050489 Bacteria 1240
766 nmdc:mga03n38_262145_c1 3300050490 Bacteria 916
767 nmdc:mga03n38_36616_c1 3300050490 Bacteria 2111
768 nmdc:mga00v17_121920_c1 3300050491 Bacteria 1660
769 nmdc:mga00v17_13678_c1 3300050491 Bacteria 4511
770 nmdc:mga00v17_15716_c1 3300050491 Bacteria 4253
771 nmdc:mga00v17_414792_c1 3300050491 Bacteria 875
772 nmdc:mga00v17_487595_c1 3300050491 Bacteria 799
773 nmdc:mga0yw44_73649_c1 3300050492 Bacteria 2125
774 nmdc:mga06z11_147040_c1 3300050494 Bacteria 1336
775 nmdc:mga06z11_227417_c1 3300050494 Bacteria 1092
776 nmdc:mga04h51_223715_c1 3300050495 Bacteria 747
777 nmdc:mga07m45_250553_c1 3300050496 Bacteria 1030
778 nmdc:mga07m45_337611_c1 3300050496 Bacteria 876
779 nmdc:mga07m45_9571_c1 3300050496 Bacteria 5033
780 nmdc:mga05p37_91320_c1 3300050507 Bacteria 3752
781 nmdc:mga08y16_351843_c2 3300050511 Bacteria 958
782 nmdc:mga08y16_727562_c1 3300050511 Bacteria 990
783 nmdc:mga0rr50_473858_c1 3300050513 Bacteria 1063
784 nmdc:mga0sz30_130967_c1 3300050516 Bacteria 1105
785 nmdc:mga0sz30_157965_c1 3300050516 Bacteria 1004
786 nmdc:mga0sz30_29044_c1 3300050516 Bacteria 2277
787 nmdc:mga0sz30_37734_c1 3300050516 Bacteria 2023
788 Ga0495612_0130076 3300053078 Bacteria 1087
789 Ga0500635_0002203 3300053080 Bacteria 4794
790 Ga0500635_0033503 3300053080 Bacteria 1676
791 Ga0495655_0051788 3300053083 Bacteria 1089
792 Ga0495619_0022860 3300053085 Bacteria 4004
793 Ga0500643_008952 3300053087 Bacteria 3874
794 Ga0500595_053019 3300053119 Bacteria 1250
795 Ga0500652_001304 3300053131 Bacteria 7903
796 Ga0500573_0066479 3300053140 Bacteria 2061
797 Ga0500588_0109841 3300053146 Bacteria 961
798 Ga0500627_0004080 3300053158 Bacteria 4628
799 Ga0500645_000188 3300053730 Bacteria 48061
800 Ga0501084_0036510 3300054114 Bacteria 4104
801 Ga0501084_0062212 3300054114 Bacteria 3124
802 Ga0501082_0027018 3300060353 Bacteria 4945
803 Ga0501082_0060248 3300060353 Bacteria 3269
804 Ga0530510_0003870 3300061734 Bacteria 10318
805 Ga0530510_0005493 3300061734 Bacteria 8779

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005840 Ga0068870_10400233 Ga0068870_104002332 154
2 3300006173 Ga0070716_100008515 Ga0070716_1000085156 154
3 3300041411 Ga0439466_0056748 Ga0439466_0056748_787_1251 154
4 3300005459 Ga0068867_100199365 Ga0068867_1001993652 163
5 3300005547 Ga0070693_100072408 Ga0070693_1000724082 163
6 3300005616 Ga0068852_101271339 Ga0068852_1012713392 163
7 3300006881 Ga0068865_100529637 Ga0068865_1005296372 163
8 3300009098 Ga0105245_10562407 Ga0105245_105624072 163
9 3300009174 Ga0105241_10139258 Ga0105241_101392582 163
10 3300009553 Ga0105249_10079289 Ga0105249_100792894 163
11 3300011119 Ga0105246_10215227 Ga0105246_102152272 163
12 3300013296 Ga0157374_10004568 Ga0157374_100045687 163
13 3300013308 Ga0157375_10359424 Ga0157375_103594242 163
14 3300025918 Ga0207662_10180570 Ga0207662_101805702 163
15 3300025927 Ga0207687_10161602 Ga0207687_101616022 163
16 3300025942 Ga0207689_10145791 Ga0207689_101457912 163
17 3300026035 Ga0207703_10043847 Ga0207703_100438472 163
18 3300026095 Ga0207676_10055890 Ga0207676_100558904 163
19 3300026142 Ga0207698_10324072 Ga0207698_103240722 163
20 3300028380 Ga0268265_10473830 Ga0268265_104738302 163
21 3300048903 Ga0496100_0069186 Ga0496100_0069186_1512_2003 163
22 3300048911 Ga0496108_0006199 Ga0496108_0006199_7235_7726 163
23 3300048912 Ga0496109_0031454 Ga0496109_0031454_2661_3152 163
24 3300048913 Ga0496110_0033275 Ga0496110_0033275_110_601 163
25 3300048916 Ga0496113_0100314 Ga0496113_0100314_1495_1986 163
26 3300049586 Ga0501070_0640986 Ga0501070_0640986_250_759 163
27 iso_pu_bacteria 2643221679 2644444457 164
28 iso_pu_bacteria 2643221687 2644485590 165
29 iso_pu_bacteria 2738541274 2738706981 165
30 iso_pu_bacteria 2738543028 2739333685 165
31 iso_pu_bacteria 2902799365 2902800535 165
32 3300045976 Ga0466967_1234555 Ga0466967_1234555_198_698 166
33 3300005844 Ga0068862_100144824 Ga0068862_1001448243 167
34 3300006048 Ga0075363_100451152 Ga0075363_1004511521 167
35 3300006186 Ga0075369_10296041 Ga0075369_102960412 167
36 3300025986 Ga0207658_10267197 Ga0207658_102671972 167
37 3300044658 Ga0466972_0026587 Ga0466972_0026587_396_899 167
38 3300044683 Ga0466965_0011035 Ga0466965_0011035_956_1459 167
39 3300044765 Ga0466970_0121481 Ga0466970_0121481_552_1055 167
40 3300044901 Ga0466960_0000043 Ga0466960_0000043_5272_5775 167
41 3300045976 Ga0466967_0081226 Ga0466967_0081226_135_638 167
42 3300050490 nmdc:mga03n38_262145_c1 nmdc:mga03n38_262145_c1_210_713 167
43 3300006881 Ga0068865_100065613 Ga0068865_1000656133 168
44 iso_pu_bacteria 2643221613 2644084569 168
45 iso_pu_bacteria 2643221721 2644667190 168
46 iso_pu_bacteria 2935890801 2935891204 168
47 iso_pu_bacteria 8033684223 8033688680 168
48 iso_pu_bacteria 8048406513 8048414105 168
49 3300003320 rootH2_10195207 rootH2_101952074 169
50 3300005337 Ga0070682_101114089 Ga0070682_1011140891 169
51 3300005347 Ga0070668_100203259 Ga0070668_1002032592 169
52 3300005356 Ga0070674_100147910 Ga0070674_1001479102 169
53 3300005434 Ga0070709_10376036 Ga0070709_103760362 169
54 3300005437 Ga0070710_10094810 Ga0070710_100948102 169
55 3300005440 Ga0070705_100366641 Ga0070705_1003666412 169
56 3300005456 Ga0070678_100226417 Ga0070678_1002264172 169
57 3300005548 Ga0070665_100489595 Ga0070665_1004895952 169
58 3300005616 Ga0068852_100805061 Ga0068852_1008050612 169
59 3300005718 Ga0068866_10040009 Ga0068866_100400093 169
60 3300005718 Ga0068866_10777659 Ga0068866_107776591 169
61 3300006038 Ga0075365_10084118 Ga0075365_100841182 169
62 3300006048 Ga0075363_100015596 Ga0075363_1000155964 169
63 3300006051 Ga0075364_10028064 Ga0075364_100280644 169
64 3300006173 Ga0070716_100062805 Ga0070716_1000628052 169
65 3300006175 Ga0070712_100219196 Ga0070712_1002191962 169
66 3300006178 Ga0075367_10023412 Ga0075367_100234122 169
67 3300006186 Ga0075369_10015734 Ga0075369_100157342 169
68 3300006186 Ga0075369_10037824 Ga0075369_100378242 169
69 3300006186 Ga0075369_10085246 Ga0075369_100852462 169
70 3300006186 Ga0075369_10172536 Ga0075369_101725362 169
71 3300006186 Ga0075369_10174420 Ga0075369_101744202 169
72 3300006353 Ga0075370_10355257 Ga0075370_103552571 169
73 3300009148 Ga0105243_10159333 Ga0105243_101593332 169
74 3300009174 Ga0105241_10201326 Ga0105241_102013262 169
75 3300009545 Ga0105237_10002051 Ga0105237_100020517 169
76 3300009545 Ga0105237_10300729 Ga0105237_103007292 169
77 3300009551 Ga0105238_10442471 Ga0105238_104424712 169
78 3300009553 Ga0105249_11368103 Ga0105249_113681032 169
79 3300010375 Ga0105239_10003039 Ga0105239_1000303914 169
80 3300010375 Ga0105239_10217076 Ga0105239_102170762 169
81 3300013297 Ga0157378_10042343 Ga0157378_100423432 169
82 3300013306 Ga0163162_10840999 Ga0163162_108409991 169
83 3300013308 Ga0157375_10299855 Ga0157375_102998552 169
84 3300014326 Ga0157380_10266495 Ga0157380_102664952 169
85 3300014968 Ga0157379_10272539 Ga0157379_102725392 169
86 3300014969 Ga0157376_10340628 Ga0157376_103406282 169
87 3300025898 Ga0207692_10016015 Ga0207692_100160153 169
88 3300025898 Ga0207692_10051617 Ga0207692_100516172 169
89 3300025899 Ga0207642_10010405 Ga0207642_100104053 169
90 3300025913 Ga0207695_10350216 Ga0207695_103502162 169
91 3300025914 Ga0207671_10004398 Ga0207671_1000439810 169
92 3300025915 Ga0207693_10350892 Ga0207693_103508922 169
93 3300025932 Ga0207690_10328697 Ga0207690_103286972 169
94 3300025933 Ga0207706_10055761 Ga0207706_100557613 169
95 3300025933 Ga0207706_10136331 Ga0207706_101363312 169
96 3300025939 Ga0207665_10061042 Ga0207665_100610423 169
97 3300025941 Ga0207711_10200480 Ga0207711_102004802 169
98 3300025972 Ga0207668_10052992 Ga0207668_100529921 169
99 3300025972 Ga0207668_10278841 Ga0207668_102788412 169
100 3300025981 Ga0207640_10033664 Ga0207640_100336645 169
101 3300025986 Ga0207658_10096480 Ga0207658_100964802 169
102 3300026035 Ga0207703_10076887 Ga0207703_100768873 169
103 3300026067 Ga0207678_10107147 Ga0207678_101071473 169
104 3300026089 Ga0207648_10031437 Ga0207648_100314372 169
105 3300026089 Ga0207648_10184706 Ga0207648_101847062 169
106 3300026116 Ga0207674_10565351 Ga0207674_105653512 169
107 3300028381 Ga0268264_10457892 Ga0268264_104578922 169
108 3300031728 Ga0316578_10157889 Ga0316578_101578892 169
109 3300031731 Ga0307405_11616886 Ga0307405_116168861 169
110 3300036647 Ga0316582_0387656 Ga0316582_0387656_239_748 169
111 3300036712 Ga0316584_0209445 Ga0316584_0209445_655_1164 169
112 3300037418 Ga0395900_0730761 Ga0395900_0730761_284_793 169
113 3300037471 Ga0395905_0069259 Ga0395905_0069259_1646_2155 169
114 3300039437 Ga0436365_0144265 Ga0436365_0144265_54_563 169
115 3300044658 Ga0466972_0042134 Ga0466972_0042134_210_719 169
116 3300046460 Ga0495638_0464910 Ga0495638_0464910_61_570 169
117 3300046524 Ga0495648_0001220 Ga0495648_0001220_22269_22778 169
118 3300046528 Ga0495642_0151503 Ga0495642_0151503_203_712 169
119 3300046648 Ga0495611_0045992 Ga0495611_0045992_878_1387 169
120 3300046663 Ga0495635_0167194 Ga0495635_0167194_922_1431 169
121 3300047320 Ga0495672_0018774 Ga0495672_0018774_2719_3228 169
122 3300047469 Ga0495673_0078536 Ga0495673_0078536_70_579 169
123 3300048091 Ga0495626_0129437 Ga0495626_0129437_113_622 169
124 3300048904 Ga0496101_0000011 Ga0496101_0000011_138569_139078 169
125 3300048904 Ga0496101_0230720 Ga0496101_0230720_148_657 169
126 3300048904 Ga0496101_0442524 Ga0496101_0442524_458_967 169
127 3300048905 Ga0496102_0000012 Ga0496102_0000012_164417_164926 169
128 3300048905 Ga0496102_0061518 Ga0496102_0061518_2828_3337 169
129 3300048906 Ga0496103_0000005 Ga0496103_0000005_150537_151046 169
130 3300048907 Ga0496104_1405697 Ga0496104_1405697_72_581 169
131 3300048909 Ga0496106_0016284 Ga0496106_0016284_210_719 169
132 3300048909 Ga0496106_0710788 Ga0496106_0710788_136_645 169
133 3300048910 Ga0496107_0008820 Ga0496107_0008820_6252_6761 169
134 3300048919 Ga0496116_0000050 Ga0496116_0000050_160638_161147 169
135 3300048920 Ga0496117_0000042 Ga0496117_0000042_150545_151054 169
136 3300048921 Ga0496118_0000037 Ga0496118_0000037_150545_151054 169
137 3300048922 Ga0496119_0000486 Ga0496119_0000486_2799_3308 169
138 3300048923 Ga0496120_0000121 Ga0496120_0000121_128305_128814 169
139 3300048924 Ga0496121_0001091 Ga0496121_0001091_22839_23348 169
140 3300048924 Ga0496121_0267175 Ga0496121_0267175_367_876 169
141 3300048929 Ga0496126_0000236 Ga0496126_0000236_116071_116580 169
142 3300048929 Ga0496126_0073036 Ga0496126_0073036_170_679 169
143 3300048929 Ga0496126_0079850 Ga0496126_0079850_24_533 169
144 3300049569 Ga0501032_0031446 Ga0501032_0031446_1079_1588 169
145 3300049571 Ga0501034_0030998 Ga0501034_0030998_361_870 169
146 3300049573 Ga0501037_0040445 Ga0501037_0040445_1844_2353 169
147 3300049574 Ga0501038_0040632 Ga0501038_0040632_2598_3107 169
148 3300049575 Ga0501039_0000835 Ga0501039_0000835_2441_2950 169
149 3300049579 Ga0501043_0016855 Ga0501043_0016855_2620_3129 169
150 3300049583 Ga0501067_0214213 Ga0501067_0214213_273_782 169
151 3300049584 Ga0501068_0421418 Ga0501068_0421418_202_711 169
152 3300049586 Ga0501070_0008673 Ga0501070_0008673_2446_2955 169
153 3300049589 Ga0501073_0016582 Ga0501073_0016582_600_1109 169
154 3300049823 Ga0501044_0005313 Ga0501044_0005313_11198_11707 169
155 3300050489 nmdc:mga03683_105759_c1 nmdc:mga03683_105759_c1_202_711 169
156 3300050490 nmdc:mga03n38_36616_c1 nmdc:mga03n38_36616_c1_389_898 169
157 3300050491 nmdc:mga00v17_15716_c1 nmdc:mga00v17_15716_c1_3329_3838 169
158 3300050492 nmdc:mga0yw44_73649_c1 nmdc:mga0yw44_73649_c1_606_1115 169
159 3300050494 nmdc:mga06z11_147040_c1 nmdc:mga06z11_147040_c1_401_910 169
160 3300050496 nmdc:mga07m45_337611_c1 nmdc:mga07m45_337611_c1_23_532 169
161 3300050516 nmdc:mga0sz30_130967_c1 nmdc:mga0sz30_130967_c1_135_644 169
162 3300050516 nmdc:mga0sz30_157965_c1 nmdc:mga0sz30_157965_c1_223_732 169
163 3300050516 nmdc:mga0sz30_29044_c1 nmdc:mga0sz30_29044_c1_1354_1863 169
164 3300050516 nmdc:mga0sz30_37734_c1 nmdc:mga0sz30_37734_c1_1484_1993 169
165 3300053078 Ga0495612_0130076 Ga0495612_0130076_53_562 169
166 3300053080 Ga0500635_0002203 Ga0500635_0002203_2703_3212 169
167 3300053080 Ga0500635_0033503 Ga0500635_0033503_499_1008 169
168 3300053087 Ga0500643_008952 Ga0500643_008952_1843_2352 169
169 3300053119 Ga0500595_053019 Ga0500595_053019_248_757 169
170 3300053131 Ga0500652_001304 Ga0500652_001304_3302_3811 169
171 3300053146 Ga0500588_0109841 Ga0500588_0109841_352_861 169
172 3300053158 Ga0500627_0004080 Ga0500627_0004080_4078_4587 169
173 3300053730 Ga0500645_000188 Ga0500645_000188_12492_13001 169
174 3300001979 JGI24740J21852_10019352 JGI24740J21852_100193522 170
175 3300001989 JGI24739J22299_10004941 JGI24739J22299_100049415 170
176 3300001989 JGI24739J22299_10020750 JGI24739J22299_100207504 170
177 3300001990 JGI24737J22298_10011988 JGI24737J22298_100119882 170
178 3300002075 JGI24738J21930_10024878 JGI24738J21930_100248782 170
179 3300005334 Ga0068869_100009208 Ga0068869_1000092084 170
180 3300005343 Ga0070687_100045218 Ga0070687_1000452182 170
181 3300005347 Ga0070668_100104767 Ga0070668_1001047672 170
182 3300005356 Ga0070674_100082636 Ga0070674_1000826362 170
183 3300005364 Ga0070673_100054937 Ga0070673_1000549372 170
184 3300005435 Ga0070714_100461014 Ga0070714_1004610142 170
185 3300005435 Ga0070714_100544810 Ga0070714_1005448102 170
186 3300005436 Ga0070713_100297184 Ga0070713_1002971842 170
187 3300005437 Ga0070710_10031660 Ga0070710_100316602 170
188 3300005455 Ga0070663_100067069 Ga0070663_1000670692 170
189 3300005456 Ga0070678_100255369 Ga0070678_1002553692 170
190 3300005457 Ga0070662_100178920 Ga0070662_1001789202 170
191 3300005539 Ga0068853_100088042 Ga0068853_1000880423 170
192 3300005546 Ga0070696_100190780 Ga0070696_1001907802 170
193 3300005549 Ga0070704_100330317 Ga0070704_1003303172 170
194 3300005563 Ga0068855_100472536 Ga0068855_1004725362 170
195 3300005577 Ga0068857_100022219 Ga0068857_1000222195 170
196 3300005578 Ga0068854_100068024 Ga0068854_1000680242 170
197 3300005615 Ga0070702_100090495 Ga0070702_1000904952 170
198 3300005617 Ga0068859_100042188 Ga0068859_1000421883 170
199 3300005618 Ga0068864_100100427 Ga0068864_1001004272 170
200 3300005718 Ga0068866_10017449 Ga0068866_100174492 170
201 3300005719 Ga0068861_100152470 Ga0068861_1001524702 170
202 3300005834 Ga0068851_10100414 Ga0068851_101004142 170
203 3300005842 Ga0068858_100019169 Ga0068858_1000191692 170
204 3300005842 Ga0068858_100264096 Ga0068858_1002640962 170
205 3300005843 Ga0068860_100064628 Ga0068860_1000646282 170
206 3300005844 Ga0068862_100155625 Ga0068862_1001556252 170
207 3300005983 Ga0081540_1099026 Ga0081540_10990262 170
208 3300006163 Ga0070715_10007835 Ga0070715_100078354 170
209 3300006163 Ga0070715_10409521 Ga0070715_104095212 170
210 3300006931 Ga0097620_100042189 Ga0097620_1000421894 170
211 3300009101 Ga0105247_10168466 Ga0105247_101684662 170
212 3300009176 Ga0105242_10035466 Ga0105242_100354662 170
213 3300009545 Ga0105237_10139611 Ga0105237_101396112 170
214 3300009545 Ga0105237_12174550 Ga0105237_121745501 170
215 3300009553 Ga0105249_10071738 Ga0105249_100717382 170
216 3300009553 Ga0105249_11229972 Ga0105249_112299722 170
217 3300010375 Ga0105239_10101877 Ga0105239_101018772 170
218 3300013102 Ga0157371_10857635 Ga0157371_108576352 170
219 3300013306 Ga0163162_10081460 Ga0163162_100814603 170
220 3300013307 Ga0157372_10290188 Ga0157372_102901882 170
221 3300014968 Ga0157379_10624771 Ga0157379_106247712 170
222 3300025898 Ga0207692_10014881 Ga0207692_100148812 170
223 3300025899 Ga0207642_10018722 Ga0207642_100187223 170
224 3300025899 Ga0207642_10110326 Ga0207642_101103262 170
225 3300025901 Ga0207688_10003983 Ga0207688_100039834 170
226 3300025901 Ga0207688_10073509 Ga0207688_100735093 170
227 3300025903 Ga0207680_10130677 Ga0207680_101306772 170
228 3300025904 Ga0207647_10011974 Ga0207647_100119743 170
229 3300025905 Ga0207685_10027666 Ga0207685_100276662 170
230 3300025905 Ga0207685_10062108 Ga0207685_100621082 170
231 3300025911 Ga0207654_10130538 Ga0207654_101305382 170
232 3300025914 Ga0207671_10420685 Ga0207671_104206852 170
233 3300025931 Ga0207644_10158060 Ga0207644_101580602 170
234 3300025933 Ga0207706_10020804 Ga0207706_100208046 170
235 3300025933 Ga0207706_10254040 Ga0207706_102540402 170
236 3300025934 Ga0207686_10071015 Ga0207686_100710152 170
237 3300025935 Ga0207709_10284984 Ga0207709_102849842 170
238 3300025936 Ga0207670_10115375 Ga0207670_101153752 170
239 3300025939 Ga0207665_10021889 Ga0207665_100218893 170
240 3300025940 Ga0207691_10068947 Ga0207691_100689474 170
241 3300025949 Ga0207667_10362361 Ga0207667_103623612 170
242 3300025960 Ga0207651_10042064 Ga0207651_100420644 170
243 3300025961 Ga0207712_10918365 Ga0207712_109183652 170
244 3300025972 Ga0207668_10067809 Ga0207668_100678093 170
245 3300026023 Ga0207677_10023893 Ga0207677_100238933 170
246 3300026023 Ga0207677_10058521 Ga0207677_100585212 170
247 3300026035 Ga0207703_10336047 Ga0207703_103360472 170
248 3300026067 Ga0207678_10016962 Ga0207678_100169626 170
249 3300026067 Ga0207678_10554867 Ga0207678_105548672 170
250 3300026075 Ga0207708_10014636 Ga0207708_100146365 170
251 3300026116 Ga0207674_10033236 Ga0207674_100332365 170
252 3300026118 Ga0207675_100157943 Ga0207675_1001579432 170
253 3300026121 Ga0207683_10066532 Ga0207683_100665323 170
254 3300026142 Ga0207698_11243976 Ga0207698_112439762 170
255 3300028379 Ga0268266_10042481 Ga0268266_100424815 170
256 3300028380 Ga0268265_10658635 Ga0268265_106586352 170
257 3300028381 Ga0268264_10088693 Ga0268264_100886934 170
258 3300031901 Ga0307406_10436755 Ga0307406_104367551 170
259 3300035112 Ga0373932_0028696 Ga0373932_0028696_982_1494 170
260 3300035691 Ga0373931_0042310 Ga0373931_0042310_1157_1669 170
261 3300035691 Ga0373931_0049971 Ga0373931_0049971_65_577 170
262 3300041413 Ga0439465_0008035 Ga0439465_0008035_376_888 170
263 3300044693 Ga0466961_0056390 Ga0466961_0056390_732_1253 170
264 3300044765 Ga0466970_0077516 Ga0466970_0077516_723_1244 170
265 3300045836 Ga0466958_0036071 Ga0466958_0036071_175_696 170
266 3300046453 Ga0495627_013326 Ga0495627_013326_1237_1749 170
267 3300046455 Ga0495603_0241715 Ga0495603_0241715_369_881 170
268 3300046492 Ga0495585_0105796 Ga0495585_0105796_710_1222 170
269 3300046499 Ga0495594_0079672 Ga0495594_0079672_1239_1751 170
270 3300046526 Ga0495666_0179583 Ga0495666_0179583_28_540 170
271 3300046660 Ga0495625_0102107 Ga0495625_0102107_1168_1680 170
272 3300046689 Ga0495613_0535905 Ga0495613_0535905_39_551 170
273 3300047317 Ga0495604_0255731 Ga0495604_0255731_186_698 170
274 3300048903 Ga0496100_0026032 Ga0496100_0026032_961_1473 170
275 3300048903 Ga0496100_0042550 Ga0496100_0042550_2236_2748 170
276 3300048905 Ga0496102_0250045 Ga0496102_0250045_844_1356 170
277 3300048906 Ga0496103_0122412 Ga0496103_0122412_77_589 170
278 3300048907 Ga0496104_0502396 Ga0496104_0502396_138_650 170
279 3300048908 Ga0496105_0566537 Ga0496105_0566537_186_698 170
280 3300048909 Ga0496106_0118266 Ga0496106_0118266_513_1025 170
281 3300048909 Ga0496106_0180349 Ga0496106_0180349_619_1131 170
282 3300048910 Ga0496107_0082594 Ga0496107_0082594_1067_1579 170
283 3300048910 Ga0496107_0253131 Ga0496107_0253131_446_958 170
284 3300048911 Ga0496108_0709998 Ga0496108_0709998_327_839 170
285 3300048912 Ga0496109_0080789 Ga0496109_0080789_1401_1913 170
286 3300048918 Ga0496115_0263418 Ga0496115_0263418_428_940 170
287 3300049823 Ga0501044_0077022 Ga0501044_0077022_752_1264 170
288 iso_pu_bacteria 3006393351 3006397986 170
289 3300003578 Ga0006562J51391_1083609 Ga0006562J51391_10836092 171
290 3300005338 Ga0068868_100154087 Ga0068868_1001540872 171
291 3300005341 Ga0070691_10339571 Ga0070691_103395712 171
292 3300005356 Ga0070674_100015749 Ga0070674_1000157493 171
293 3300005365 Ga0070688_100590746 Ga0070688_1005907462 171
294 3300005366 Ga0070659_100210273 Ga0070659_1002102732 171
295 3300005434 Ga0070709_10170486 Ga0070709_101704862 171
296 3300005439 Ga0070711_100009150 Ga0070711_1000091502 171
297 3300005456 Ga0070678_100015071 Ga0070678_1000150713 171
298 3300005459 Ga0068867_100173617 Ga0068867_1001736172 171
299 3300005546 Ga0070696_100032755 Ga0070696_1000327553 171
300 3300005549 Ga0070704_100005137 Ga0070704_1000051372 171
301 3300005578 Ga0068854_100406884 Ga0068854_1004068842 171
302 3300005615 Ga0070702_100025003 Ga0070702_1000250032 171
303 3300005718 Ga0068866_10020552 Ga0068866_100205523 171
304 3300005844 Ga0068862_100082678 Ga0068862_1000826783 171
305 3300006163 Ga0070715_10003349 Ga0070715_100033494 171
306 3300006173 Ga0070716_100006523 Ga0070716_1000065232 171
307 3300006175 Ga0070712_100007763 Ga0070712_1000077632 171
308 3300006881 Ga0068865_100010117 Ga0068865_1000101172 171
309 3300009098 Ga0105245_10352469 Ga0105245_103524692 171
310 3300009176 Ga0105242_10086989 Ga0105242_100869893 171
311 3300010375 Ga0105239_11203403 Ga0105239_112034032 171
312 3300013104 Ga0157370_10206097 Ga0157370_102060972 171
313 3300013306 Ga0163162_10213906 Ga0163162_102139062 171
314 3300014326 Ga0157380_10541549 Ga0157380_105415492 171
315 3300014969 Ga0157376_10194582 Ga0157376_101945822 171
316 3300017792 Ga0163161_10222663 Ga0163161_102226632 171
317 3300025899 Ga0207642_10005782 Ga0207642_100057823 171
318 3300025906 Ga0207699_10242716 Ga0207699_102427162 171
319 3300025915 Ga0207693_10014044 Ga0207693_100140445 171
320 3300025916 Ga0207663_10094398 Ga0207663_100943982 171
321 3300025934 Ga0207686_10047915 Ga0207686_100479152 171
322 3300025937 Ga0207669_10107688 Ga0207669_101076882 171
323 3300025938 Ga0207704_10130090 Ga0207704_101300902 171
324 3300025939 Ga0207665_10010565 Ga0207665_100105653 171
325 3300025981 Ga0207640_10388004 Ga0207640_103880042 171
326 3300026023 Ga0207677_10170444 Ga0207677_101704442 171
327 3300026121 Ga0207683_10022293 Ga0207683_100222934 171
328 3300028380 Ga0268265_10057941 Ga0268265_100579413 171
329 3300028381 Ga0268264_10108427 Ga0268264_101084272 171
330 3300044765 Ga0466970_0413414 Ga0466970_0413414_129_644 171
331 3300046462 Ga0495651_0074671 Ga0495651_0074671_1015_1530 171
332 3300048903 Ga0496100_0121897 Ga0496100_0121897_757_1272 171
333 3300048904 Ga0496101_0195083 Ga0496101_0195083_993_1508 171
334 3300048906 Ga0496103_0128696 Ga0496103_0128696_353_868 171
335 3300048908 Ga0496105_0349170 Ga0496105_0349170_45_566 171
336 3300048909 Ga0496106_0148203 Ga0496106_0148203_601_1116 171
337 3300048918 Ga0496115_0113667 Ga0496115_0113667_1313_1828 171
338 3300049569 Ga0501032_0402800 Ga0501032_0402800_86_601 171
339 3300049577 Ga0501041_0755805 Ga0501041_0755805_93_611 171
340 3300049591 Ga0501075_0547385 Ga0501075_0547385_329_847 171
341 3300049593 Ga0501077_0366626 Ga0501077_0366626_324_842 171
342 3300049742 Ga0501080_1122028 Ga0501080_1122028_108_626 171
343 3300049822 Ga0501035_0176459 Ga0501035_0176459_223_738 171
344 3300049824 Ga0501045_0717420 Ga0501045_0717420_48_566 171
345 3300053085 Ga0495619_0022860 Ga0495619_0022860_2009_2524 171
346 3300005535 Ga0070684_100290814 Ga0070684_1002908142 172
347 3300006051 Ga0075364_10249696 Ga0075364_102496962 172
348 3300006844 Ga0075428_100189524 Ga0075428_1001895242 172
349 3300006880 Ga0075429_100024137 Ga0075429_1000241373 172
350 3300006931 Ga0097620_100116593 Ga0097620_1001165934 172
351 3300009147 Ga0114129_10054328 Ga0114129_100543288 172
352 3300025898 Ga0207692_10109567 Ga0207692_101095672 172
353 3300026075 Ga0207708_10136029 Ga0207708_101360292 172
354 3300026121 Ga0207683_10037711 Ga0207683_100377114 172
355 3300038443 Ga0395901_0719116 Ga0395901_0719116_49_591 172
356 3300044658 Ga0466972_0040075 Ga0466972_0040075_1348_1941 172
357 3300044683 Ga0466965_0002372 Ga0466965_0002372_6039_6632 172
358 3300044901 Ga0466960_0000469 Ga0466960_0000469_345_950 172
359 3300048905 Ga0496102_0018021 Ga0496102_0018021_5298_5825 172
360 3300048906 Ga0496103_0037464 Ga0496103_0037464_176_703 172
361 3300048921 Ga0496118_0154389 Ga0496118_0154389_472_999 172
362 3300050491 nmdc:mga00v17_121920_c1 nmdc:mga00v17_121920_c1_854_1381 172
363 3300050507 nmdc:mga05p37_91320_c1 nmdc:mga05p37_91320_c1_2825_3346 172
364 3300005335 Ga0070666_10006924 Ga0070666_100069246 173
365 3300005343 Ga0070687_100034601 Ga0070687_1000346013 173
366 3300005367 Ga0070667_100042097 Ga0070667_1000420974 173
367 3300005406 Ga0070703_10013006 Ga0070703_100130062 173
368 3300005439 Ga0070711_100040182 Ga0070711_1000401822 173
369 3300005441 Ga0070700_100085893 Ga0070700_1000858931 173
370 3300005456 Ga0070678_100566889 Ga0070678_1005668892 173
371 3300005548 Ga0070665_100303175 Ga0070665_1003031752 173
372 3300005614 Ga0068856_100065742 Ga0068856_1000657423 173
373 3300005841 Ga0068863_100071922 Ga0068863_1000719223 173
374 3300005843 Ga0068860_100060696 Ga0068860_1000606962 173
375 3300006175 Ga0070712_100020521 Ga0070712_1000205214 173
376 3300006358 Ga0068871_100035728 Ga0068871_1000357284 173
377 3300009545 Ga0105237_10222783 Ga0105237_102227831 173
378 3300011119 Ga0105246_10006490 Ga0105246_100064906 173
379 3300013308 Ga0157375_10078114 Ga0157375_100781141 173
380 3300014325 Ga0163163_10009942 Ga0163163_100099427 173
381 3300014969 Ga0157376_10052557 Ga0157376_100525573 173
382 3300025885 Ga0207653_10036117 Ga0207653_100361171 173
383 3300025903 Ga0207680_10094552 Ga0207680_100945522 173
384 3300025915 Ga0207693_10005271 Ga0207693_100052715 173
385 3300025918 Ga0207662_10024801 Ga0207662_100248014 173
386 3300025923 Ga0207681_10363182 Ga0207681_103631821 173
387 3300025934 Ga0207686_10056753 Ga0207686_100567532 173
388 3300025937 Ga0207669_10102261 Ga0207669_101022612 173
389 3300025942 Ga0207689_10009642 Ga0207689_100096425 173
390 3300025960 Ga0207651_10005041 Ga0207651_100050416 173
391 3300025986 Ga0207658_10281707 Ga0207658_102817072 173
392 3300026035 Ga0207703_10478035 Ga0207703_104780352 173
393 3300026088 Ga0207641_10347435 Ga0207641_103474352 173
394 3300031824 Ga0307413_10006621 Ga0307413_100066215 173
395 3300042007 Ga0439449_0063452 Ga0439449_0063452_253_774 173
396 3300044694 Ga0466963_0002485 Ga0466963_0002485_1728_2249 173
397 3300044694 Ga0466963_0040258 Ga0466963_0040258_2438_2959 173
398 3300044842 Ga0466957_0098253 Ga0466957_0098253_114_635 173
399 3300045836 Ga0466958_0032613 Ga0466958_0032613_982_1503 173
400 3300045976 Ga0466967_0038592 Ga0466967_0038592_2247_2768 173
401 3300045976 Ga0466967_0051054 Ga0466967_0051054_1732_2253 173
402 3300046511 Ga0495608_0168712 Ga0495608_0168712_62_583 173
403 3300048905 Ga0496102_0082523 Ga0496102_0082523_2433_2954 173
404 3300048907 Ga0496104_0234603 Ga0496104_0234603_17_538 173
405 3300048908 Ga0496105_0587424 Ga0496105_0587424_322_843 173
406 3300048911 Ga0496108_0013662 Ga0496108_0013662_4166_4687 173
407 3300048914 Ga0496111_0251545 Ga0496111_0251545_302_823 173
408 3300048916 Ga0496113_0040483 Ga0496113_0040483_2147_2668 173
409 3300048917 Ga0496114_0071163 Ga0496114_0071163_1758_2279 173
410 3300048929 Ga0496126_0024488 Ga0496126_0024488_1257_1778 173
411 iso_pu_bacteria 2857481737 2857484399 173
412 iso_pu_bacteria 2932431166 2932431854 173
413 3300044656 Ga0466969_0107871 Ga0466969_0107871_644_1174 174
414 3300044693 Ga0466961_0132942 Ga0466961_0132942_622_1152 174
415 3300044765 Ga0466970_0088377 Ga0466970_0088377_679_1209 174
416 3300045049 Ga0466959_0363772 Ga0466959_0363772_415_945 174
417 3300045836 Ga0466958_0200853 Ga0466958_0200853_214_744 174
418 3300046454 Ga0495592_0418933 Ga0495592_0418933_45_578 174
419 3300046462 Ga0495651_0002255 Ga0495651_0002255_8782_9315 174
420 3300046477 Ga0495664_0135702 Ga0495664_0135702_676_1209 174
421 3300046516 Ga0495628_0010353 Ga0495628_0010353_3732_4265 174
422 3300046529 Ga0495652_0010947 Ga0495652_0010947_992_1525 174
423 3300046543 Ga0495645_0054714 Ga0495645_0054714_1381_1914 174
424 3300046679 Ga0495623_0274297 Ga0495623_0274297_28_561 174
425 3300046680 Ga0495646_0299653 Ga0495646_0299653_123_647 174
426 3300048088 Ga0495602_0880768 Ga0495602_0880768_37_570 174
427 3300048903 Ga0496100_0028049 Ga0496100_0028049_337_861 174
428 3300048924 Ga0496121_0023565 Ga0496121_0023565_2324_2848 174
429 3300048927 Ga0496124_0342524 Ga0496124_0342524_97_621 174
430 3300053140 Ga0500573_0066479 Ga0500573_0066479_57_593 174
431 3300028573 Ga0265334_10003345 Ga0265334_100033453 175
432 3300028794 Ga0307515_10239470 Ga0307515_102394702 175
433 3300031995 Ga0307409_100841718 Ga0307409_1008417182 175
434 3300046462 Ga0495651_0549699 Ga0495651_0549699_86_724 175
435 3300048929 Ga0496126_0013491 Ga0496126_0013491_2414_2956 175
436 3300053083 Ga0495655_0051788 Ga0495655_0051788_113_640 175
437 iso_pu_bacteria 2867346516 2867350653 175
438 3300001990 JGI24737J22298_10128887 JGI24737J22298_101288872 176
439 3300025932 Ga0207690_10972111 Ga0207690_109721112 176
440 3300025935 Ga0207709_10183047 Ga0207709_101830472 176
441 3300037853 Ga0436364_1106144 Ga0436364_1106144_680_1210 176
442 3300041453 Ga0451797_0847368 Ga0451797_0847368_56_586 176
443 3300041491 Ga0451833_1468257 Ga0451833_1468257_106_636 176
444 3300044694 Ga0466963_0467742 Ga0466963_0467742_230_760 176
445 3300045049 Ga0466959_0801513 Ga0466959_0801513_80_610 176
446 3300045836 Ga0466958_0182795 Ga0466958_0182795_442_972 176
447 3300045976 Ga0466967_0302113 Ga0466967_0302113_280_810 176
448 3300046453 Ga0495627_124216 Ga0495627_124216_171_716 176
449 3300048917 Ga0496114_0067272 Ga0496114_0067272_2057_2587 176
450 3300005458 Ga0070681_10082039 Ga0070681_100820394 177
451 3300005843 Ga0068860_100000571 Ga0068860_10000057135 177
452 3300009092 Ga0105250_10147845 Ga0105250_101478452 177
453 3300013308 Ga0157375_10730200 Ga0157375_107302001 177
454 3300014326 Ga0157380_10833528 Ga0157380_108335282 177
455 3300025711 Ga0207696_1098850 Ga0207696_10988502 177
456 3300025912 Ga0207707_10390494 Ga0207707_103904942 177
457 3300028381 Ga0268264_10000573 Ga0268264_100005738 177
458 3300044694 Ga0466963_0355428 Ga0466963_0355428_210_758 177
459 3300045976 Ga0466967_0045146 Ga0466967_0045146_1501_2049 177
460 3300046455 Ga0495603_0003497 Ga0495603_0003497_1223_1756 177
461 3300046459 Ga0495629_0132414 Ga0495629_0132414_736_1269 177
462 3300046476 Ga0495662_0009605 Ga0495662_0009605_2745_3278 177
463 3300046499 Ga0495594_0011704 Ga0495594_0011704_2937_3470 177
464 3300046557 Ga0495622_0065637 Ga0495622_0065637_321_854 177
465 3300046663 Ga0495635_0088184 Ga0495635_0088184_1116_1649 177
466 3300046674 Ga0495588_0038616 Ga0495588_0038616_169_702 177
467 3300046675 Ga0495657_0002058 Ga0495657_0002058_6126_6659 177
468 3300046689 Ga0495613_0004186 Ga0495613_0004186_4329_4862 177
469 3300047315 Ga0495581_0025921 Ga0495581_0025921_657_1190 177
470 3300047318 Ga0495636_0011349 Ga0495636_0011349_1708_2241 177
471 3300047447 Ga0495685_095976 Ga0495685_095976_238_771 177
472 3300048911 Ga0496108_0045273 Ga0496108_0045273_1152_1685 177
473 3300048912 Ga0496109_0013758 Ga0496109_0013758_5317_5850 177
474 3300048913 Ga0496110_0682966 Ga0496110_0682966_245_778 177
475 3300048917 Ga0496114_0635220 Ga0496114_0635220_358_900 177
476 3300048918 Ga0496115_0142055 Ga0496115_0142055_237_770 177
477 3300049588 Ga0501072_1146013 Ga0501072_1146013_13_546 177
478 3300006038 Ga0075365_10176126 Ga0075365_101761262 178
479 3300006038 Ga0075365_10481819 Ga0075365_104818192 178
480 3300006048 Ga0075363_100119192 Ga0075363_1001191922 178
481 3300006051 Ga0075364_10128574 Ga0075364_101285742 178
482 3300006353 Ga0075370_10068654 Ga0075370_100686543 178
483 3300014325 Ga0163163_10315748 Ga0163163_103157482 178
484 3300025932 Ga0207690_10920098 Ga0207690_109200982 178
485 3300031824 Ga0307413_10561387 Ga0307413_105613871 178
486 3300031995 Ga0307409_100552750 Ga0307409_1005527502 178
487 3300032002 Ga0307416_100369602 Ga0307416_1003696022 178
488 3300049568 Ga0501031_0098159 Ga0501031_0098159_125_664 178
489 3300049569 Ga0501032_0254095 Ga0501032_0254095_431_970 178
490 3300049572 Ga0501036_0052771 Ga0501036_0052771_2267_2806 178
491 3300049573 Ga0501037_0172794 Ga0501037_0172794_308_847 178
492 3300049574 Ga0501038_0814077 Ga0501038_0814077_96_635 178
493 3300049575 Ga0501039_0021000 Ga0501039_0021000_4411_4950 178
494 3300049577 Ga0501041_0090643 Ga0501041_0090643_766_1305 178
495 3300049578 Ga0501042_0602855 Ga0501042_0602855_207_746 178
496 3300049579 Ga0501043_0247622 Ga0501043_0247622_492_1031 178
497 3300049580 Ga0501046_0076146 Ga0501046_0076146_1738_2277 178
498 3300049582 Ga0501048_0090672 Ga0501048_0090672_886_1425 178
499 3300049586 Ga0501070_0170676 Ga0501070_0170676_419_958 178
500 3300049587 Ga0501071_0051099 Ga0501071_0051099_661_1200 178
501 3300049588 Ga0501072_0165450 Ga0501072_0165450_755_1294 178
502 3300049589 Ga0501073_0113746 Ga0501073_0113746_208_747 178
503 3300049591 Ga0501075_0267043 Ga0501075_0267043_393_932 178
504 3300049592 Ga0501076_0187038 Ga0501076_0187038_938_1477 178
505 3300049593 Ga0501077_0025068 Ga0501077_0025068_1112_1651 178
506 3300049741 Ga0501079_0466005 Ga0501079_0466005_90_629 178
507 3300049742 Ga0501080_0180353 Ga0501080_0180353_267_806 178
508 3300049743 Ga0501081_0093130 Ga0501081_0093130_950_1489 178
509 3300049822 Ga0501035_0351537 Ga0501035_0351537_580_1119 178
510 3300049824 Ga0501045_0068393 Ga0501045_0068393_352_891 178
511 3300050491 nmdc:mga00v17_414792_c1 nmdc:mga00v17_414792_c1_120_656 178
512 3300050491 nmdc:mga00v17_487595_c1 nmdc:mga00v17_487595_c1_137_673 178
513 3300050495 nmdc:mga04h51_223715_c1 nmdc:mga04h51_223715_c1_171_707 178
514 3300050496 nmdc:mga07m45_250553_c1 nmdc:mga07m45_250553_c1_474_1010 178
515 3300054114 Ga0501084_0062212 Ga0501084_0062212_1681_2220 178
516 3300060353 Ga0501082_0060248 Ga0501082_0060248_2100_2639 178
517 3300061734 Ga0530510_0005493 Ga0530510_0005493_541_1080 178
518 3300025909 Ga0207705_10095065 Ga0207705_100950652 179
519 3300025924 Ga0207694_10599830 Ga0207694_105998302 179
520 3300048911 Ga0496108_0362213 Ga0496108_0362213_552_1091 179
521 3300048913 Ga0496110_0508563 Ga0496110_0508563_367_906 179
522 3300048914 Ga0496111_0193736 Ga0496111_0193736_960_1499 179
523 3300049568 Ga0501031_0320427 Ga0501031_0320427_115_654 179
524 3300049572 Ga0501036_0545845 Ga0501036_0545845_216_755 179
525 3300049574 Ga0501038_0026723 Ga0501038_0026723_1976_2548 179
526 3300049575 Ga0501039_0024627 Ga0501039_0024627_2664_3236 179
527 3300049575 Ga0501039_0515647 Ga0501039_0515647_95_634 179
528 3300049576 Ga0501040_0003702 Ga0501040_0003702_7199_7771 179
529 3300049577 Ga0501041_0010911 Ga0501041_0010911_2765_3337 179
530 3300049578 Ga0501042_0009588 Ga0501042_0009588_1824_2396 179
531 3300049578 Ga0501042_0220267 Ga0501042_0220267_807_1346 179
532 3300049579 Ga0501043_0142364 Ga0501043_0142364_394_966 179
533 3300049580 Ga0501046_0003883 Ga0501046_0003883_2150_2722 179
534 3300049582 Ga0501048_0004420 Ga0501048_0004420_8211_8783 179
535 3300049586 Ga0501070_0104510 Ga0501070_0104510_182_754 179
536 3300049587 Ga0501071_0052358 Ga0501071_0052358_328_900 179
537 3300049588 Ga0501072_0004450 Ga0501072_0004450_2145_2717 179
538 3300049590 Ga0501074_0012053 Ga0501074_0012053_2859_3431 179
539 3300049591 Ga0501075_0002801 Ga0501075_0002801_2360_2932 179
540 3300049592 Ga0501076_0010097 Ga0501076_0010097_2122_2694 179
541 3300049593 Ga0501077_0019963 Ga0501077_0019963_3014_3586 179
542 3300049741 Ga0501079_0043461 Ga0501079_0043461_1825_2397 179
543 3300049742 Ga0501080_0111948 Ga0501080_0111948_1700_2272 179
544 3300049743 Ga0501081_0001208 Ga0501081_0001208_9162_9734 179
545 3300049744 Ga0501083_0143535 Ga0501083_0143535_364_936 179
546 3300049823 Ga0501044_0209272 Ga0501044_0209272_1070_1642 179
547 3300049824 Ga0501045_0002030 Ga0501045_0002030_11062_11634 179
548 3300049824 Ga0501045_0704738 Ga0501045_0704738_163_702 179
549 3300054114 Ga0501084_0036510 Ga0501084_0036510_1866_2438 179
550 3300060353 Ga0501082_0027018 Ga0501082_0027018_2015_2587 179
551 3300061734 Ga0530510_0003870 Ga0530510_0003870_1858_2430 179
552 3300037466 Ga0395898_0131033 Ga0395898_0131033_1267_1821 180
553 3300037471 Ga0395905_0562886 Ga0395905_0562886_194_748 180
554 3300041459 Ga0451800_1652997 Ga0451800_1652997_110_658 180
555 3300049571 Ga0501034_0378456 Ga0501034_0378456_719_1279 180
556 3300049579 Ga0501043_0435751 Ga0501043_0435751_37_582 180
557 3300005329 Ga0070683_100253818 Ga0070683_1002538182 181
558 3300005331 Ga0070670_100147157 Ga0070670_1001471572 181
559 3300005337 Ga0070682_100012388 Ga0070682_1000123884 181
560 3300005340 Ga0070689_100277565 Ga0070689_1002775651 181
561 3300005345 Ga0070692_10003754 Ga0070692_100037544 181
562 3300005347 Ga0070668_100167002 Ga0070668_1001670022 181
563 3300005354 Ga0070675_100039563 Ga0070675_1000395633 181
564 3300005356 Ga0070674_100802746 Ga0070674_1008027462 181
565 3300005365 Ga0070688_100049376 Ga0070688_1000493763 181
566 3300005366 Ga0070659_100279038 Ga0070659_1002790382 181
567 3300005438 Ga0070701_10053918 Ga0070701_100539182 181
568 3300005441 Ga0070700_100030853 Ga0070700_1000308532 181
569 3300005459 Ga0068867_100014530 Ga0068867_1000145305 181
570 3300005466 Ga0070685_10121005 Ga0070685_101210052 181
571 3300005535 Ga0070684_100013533 Ga0070684_1000135332 181
572 3300005578 Ga0068854_100053392 Ga0068854_1000533922 181
573 3300005615 Ga0070702_100259467 Ga0070702_1002594671 181
574 3300005718 Ga0068866_10117038 Ga0068866_101170382 181
575 3300005719 Ga0068861_100009494 Ga0068861_1000094945 181
576 3300005840 Ga0068870_10005167 Ga0068870_100051679 181
577 3300005842 Ga0068858_100572605 Ga0068858_1005726052 181
578 3300006881 Ga0068865_100022210 Ga0068865_1000222104 181
579 3300009094 Ga0111539_10529903 Ga0111539_105299032 181
580 3300009101 Ga0105247_10288677 Ga0105247_102886772 181
581 3300009148 Ga0105243_10034369 Ga0105243_100343693 181
582 3300009148 Ga0105243_10328869 Ga0105243_103288692 181
583 3300009553 Ga0105249_10094239 Ga0105249_100942392 181
584 3300013296 Ga0157374_10932484 Ga0157374_109324842 181
585 3300013307 Ga0157372_10086249 Ga0157372_100862492 181
586 3300014326 Ga0157380_10005423 Ga0157380_100054237 181
587 3300014326 Ga0157380_10272752 Ga0157380_102727522 181
588 3300014969 Ga0157376_10527304 Ga0157376_105273042 181
589 3300025901 Ga0207688_10023517 Ga0207688_100235173 181
590 3300025908 Ga0207643_10002721 Ga0207643_100027218 181
591 3300025919 Ga0207657_10373636 Ga0207657_103736362 181
592 3300025927 Ga0207687_10027783 Ga0207687_100277834 181
593 3300025935 Ga0207709_10299212 Ga0207709_102992122 181
594 3300025940 Ga0207691_10005262 Ga0207691_100052624 181
595 3300025960 Ga0207651_10514744 Ga0207651_105147442 181
596 3300025961 Ga0207712_10652502 Ga0207712_106525022 181
597 3300025972 Ga0207668_10503883 Ga0207668_105038832 181
598 3300026075 Ga0207708_10001377 Ga0207708_100013773 181
599 3300026089 Ga0207648_10003123 Ga0207648_100031232 181
600 3300026118 Ga0207675_100002328 Ga0207675_1000023286 181
601 3300026142 Ga0207698_10061313 Ga0207698_100613133 181
602 3300028381 Ga0268264_10247008 Ga0268264_102470082 181
603 3300048909 Ga0496106_0210448 Ga0496106_0210448_958_1503 181
604 3300048911 Ga0496108_0672651 Ga0496108_0672651_108_653 181
605 3300048912 Ga0496109_0223772 Ga0496109_0223772_233_778 181
606 3300049569 Ga0501032_0038218 Ga0501032_0038218_1941_2501 181
607 3300049571 Ga0501034_0013772 Ga0501034_0013772_6237_6797 181
608 3300049572 Ga0501036_0170547 Ga0501036_0170547_865_1425 181
609 3300049573 Ga0501037_0005801 Ga0501037_0005801_7095_7655 181
610 3300049574 Ga0501038_0010056 Ga0501038_0010056_194_754 181
611 3300049575 Ga0501039_0122273 Ga0501039_0122273_772_1332 181
612 3300049579 Ga0501043_0391717 Ga0501043_0391717_82_642 181
613 3300049581 Ga0501047_0070038 Ga0501047_0070038_1524_2084 181
614 3300049582 Ga0501048_0012968 Ga0501048_0012968_408_968 181
615 3300049586 Ga0501070_0047959 Ga0501070_0047959_1683_2243 181
616 3300049589 Ga0501073_0130731 Ga0501073_0130731_115_675 181
617 3300049741 Ga0501079_0308180 Ga0501079_0308180_209_769 181
618 3300049823 Ga0501044_0035058 Ga0501044_0035058_1523_2083 181
619 3300049824 Ga0501045_0008210 Ga0501045_0008210_1271_1831 181
620 3300050511 nmdc:mga08y16_727562_c1 nmdc:mga08y16_727562_c1_224_769 181
621 3300048925 Ga0496122_0000575 Ga0496122_0000575_16629_17195 183
622 3300048926 Ga0496123_0000333 Ga0496123_0000333_43403_43969 183
623 3300048927 Ga0496124_0002355 Ga0496124_0002355_5755_6321 183
624 3300005456 Ga0070678_100252038 Ga0070678_1002520382 184
625 3300011119 Ga0105246_10079286 Ga0105246_100792862 184
626 3300026121 Ga0207683_10585721 Ga0207683_105857212 184
627 3300044694 Ga0466963_0035011 Ga0466963_0035011_1138_1707 184
628 3300044706 Ga0466964_0025375 Ga0466964_0025375_1065_1634 184
629 3300044719 Ga0466971_0081272 Ga0466971_0081272_29_598 184
630 3300044765 Ga0466970_0168949 Ga0466970_0168949_363_932 184
631 3300044842 Ga0466957_0047977 Ga0466957_0047977_769_1338 184
632 3300049590 Ga0501074_0148269 Ga0501074_0148269_1023_1586 184
633 3300049741 Ga0501079_0325869 Ga0501079_0325869_62_625 184
634 3300049742 Ga0501080_0148074 Ga0501080_0148074_1008_1571 184
635 3300050491 nmdc:mga00v17_13678_c1 nmdc:mga00v17_13678_c1_2910_3473 184
636 3300050494 nmdc:mga06z11_227417_c1 nmdc:mga06z11_227417_c1_229_792 184
637 3300050496 nmdc:mga07m45_9571_c1 nmdc:mga07m45_9571_c1_4386_4949 184
638 3300032002 Ga0307416_100919229 Ga0307416_1009192292 188
639 2162886012 MBSR1b_contig_11460553 MBSR1b_0351.00007770 191
640 3300001904 JGI24736J21556_1031421 JGI24736J21556_10314212 191
641 3300001978 JGI24747J21853_1001272 JGI24747J21853_10012722 191
642 3300002070 JGI24750J21931_1010170 JGI24750J21931_10101702 191
643 3300002073 JGI24745J21846_1002280 JGI24745J21846_10022802 191
644 3300002076 JGI24749J21850_1001787 JGI24749J21850_10017873 191
645 3300002239 JGI24034J26672_10012218 JGI24034J26672_100122182 191
646 3300002459 JGI24751J29686_10021542 JGI24751J29686_100215422 191
647 3300005293 Ga0065715_10170299 Ga0065715_101702992 191
648 3300005295 Ga0065707_10099990 Ga0065707_100999903 191
649 3300005327 Ga0070658_10000182 Ga0070658_1000018210 191
650 3300005328 Ga0070676_10000569 Ga0070676_100005699 191
651 3300005329 Ga0070683_100002426 Ga0070683_1000024263 191
652 3300005330 Ga0070690_100000724 Ga0070690_1000007247 191
653 3300005331 Ga0070670_100013501 Ga0070670_1000135013 191
654 3300005333 Ga0070677_10000089 Ga0070677_100000899 191
655 3300005334 Ga0068869_100000722 Ga0068869_1000007229 191
656 3300005335 Ga0070666_10019805 Ga0070666_100198055 191
657 3300005338 Ga0068868_100001079 Ga0068868_1000010799 191
658 3300005339 Ga0070660_100000514 Ga0070660_10000051414 191
659 3300005340 Ga0070689_100001136 Ga0070689_1000011364 191
660 3300005341 Ga0070691_10021525 Ga0070691_100215252 191
661 3300005343 Ga0070687_100000027 Ga0070687_1000000279 191
662 3300005344 Ga0070661_100001599 Ga0070661_1000015993 191
663 3300005344 Ga0070661_100002829 Ga0070661_1000028293 191
664 3300005345 Ga0070692_10001590 Ga0070692_100015908 191
665 3300005347 Ga0070668_100000852 Ga0070668_10000085212 191
666 3300005353 Ga0070669_100000180 Ga0070669_10000018038 191
667 3300005354 Ga0070675_100002254 Ga0070675_1000022549 191
668 3300005355 Ga0070671_100000129 Ga0070671_10000012939 191
669 3300005356 Ga0070674_100001566 Ga0070674_1000015668 191
670 3300005364 Ga0070673_100000805 Ga0070673_1000008056 191
671 3300005365 Ga0070688_100000146 Ga0070688_10000014620 191
672 3300005366 Ga0070659_100000665 Ga0070659_1000006659 191
673 3300005367 Ga0070667_100004504 Ga0070667_10000450411 191
674 3300005438 Ga0070701_10000764 Ga0070701_1000076412 191
675 3300005439 Ga0070711_100173052 Ga0070711_1001730522 191
676 3300005440 Ga0070705_100000359 Ga0070705_1000003592 191
677 3300005455 Ga0070663_100001822 Ga0070663_1000018229 191
678 3300005456 Ga0070678_100000484 Ga0070678_1000004846 191
679 3300005457 Ga0070662_100001061 Ga0070662_1000010619 191
680 3300005459 Ga0068867_100001778 Ga0068867_1000017782 191
681 3300005466 Ga0070685_10000749 Ga0070685_100007499 191
682 3300005530 Ga0070679_100035378 Ga0070679_1000353785 191
683 3300005535 Ga0070684_100020868 Ga0070684_1000208682 191
684 3300005535 Ga0070684_100117504 Ga0070684_1001175042 191
685 3300005539 Ga0068853_100019372 Ga0068853_1000193727 191
686 3300005543 Ga0070672_100001357 Ga0070672_1000013579 191
687 3300005544 Ga0070686_100017067 Ga0070686_1000170673 191
688 3300005548 Ga0070665_100202691 Ga0070665_1002026912 191
689 3300005549 Ga0070704_100039056 Ga0070704_1000390563 191
690 3300005563 Ga0068855_100000320 Ga0068855_10000032044 191
691 3300005564 Ga0070664_100001107 Ga0070664_1000011073 191
692 3300005564 Ga0070664_100003364 Ga0070664_1000033644 191
693 3300005577 Ga0068857_100001857 Ga0068857_10000185711 191
694 3300005577 Ga0068857_100006286 Ga0068857_1000062862 191
695 3300005578 Ga0068854_100001176 Ga0068854_1000011769 191
696 3300005614 Ga0068856_100085158 Ga0068856_1000851582 191
697 3300005615 Ga0070702_100014349 Ga0070702_1000143494 191
698 3300005616 Ga0068852_100000158 Ga0068852_10000015838 191
699 3300005617 Ga0068859_100020605 Ga0068859_1000206053 191
700 3300005618 Ga0068864_100001189 Ga0068864_1000011899 191
701 3300005718 Ga0068866_10000414 Ga0068866_1000041411 191
702 3300005719 Ga0068861_100000079 Ga0068861_10000007940 191
703 3300005834 Ga0068851_10004904 Ga0068851_100049044 191
704 3300005840 Ga0068870_10000320 Ga0068870_100003206 191
705 3300005841 Ga0068863_100000361 Ga0068863_10000036140 191
706 3300005842 Ga0068858_100003786 Ga0068858_1000037867 191
707 3300005843 Ga0068860_100017431 Ga0068860_1000174313 191
708 3300005844 Ga0068862_100001958 Ga0068862_1000019589 191
709 3300005983 Ga0081540_1000073 Ga0081540_100007319 191
710 3300005983 Ga0081540_1000149 Ga0081540_100014938 191
711 3300006175 Ga0070712_100099419 Ga0070712_1000994193 191
712 3300006237 Ga0097621_100001336 Ga0097621_1000013369 191
713 3300006237 Ga0097621_100103784 Ga0097621_1001037843 191
714 3300006358 Ga0068871_100000398 Ga0068871_1000003989 191
715 3300006358 Ga0068871_100077582 Ga0068871_1000775823 191
716 3300006880 Ga0075429_100811309 Ga0075429_1008113092 191
717 3300006881 Ga0068865_100013937 Ga0068865_1000139374 191
718 3300006931 Ga0097620_100020605 Ga0097620_1000206053 191
719 3300007076 Ga0075435_100272641 Ga0075435_1002726412 191
720 3300009092 Ga0105250_10051770 Ga0105250_100517702 191
721 3300009093 Ga0105240_10002584 Ga0105240_1000258415 191
722 3300009094 Ga0111539_11096885 Ga0111539_110968853 191
723 3300009098 Ga0105245_10000137 Ga0105245_1000013757 191
724 3300009101 Ga0105247_10000106 Ga0105247_1000010669 191
725 3300009148 Ga0105243_10004158 Ga0105243_100041589 191
726 3300009174 Ga0105241_10002148 Ga0105241_100021483 191
727 3300009176 Ga0105242_10001041 Ga0105242_1000104114 191
728 3300009177 Ga0105248_10001344 Ga0105248_1000134417 191
729 3300009545 Ga0105237_10000599 Ga0105237_100005999 191
730 3300009551 Ga0105238_10000994 Ga0105238_1000099415 191
731 3300009553 Ga0105249_10000275 Ga0105249_1000027517 191
732 3300010375 Ga0105239_10003587 Ga0105239_100035879 191
733 3300011119 Ga0105246_10025541 Ga0105246_100255414 191
734 3300013100 Ga0157373_10005362 Ga0157373_100053628 191
735 3300013102 Ga0157371_10001570 Ga0157371_100015704 191
736 3300013105 Ga0157369_10000816 Ga0157369_1000081630 191
737 3300013296 Ga0157374_10002351 Ga0157374_100023516 191
738 3300013297 Ga0157378_10001420 Ga0157378_100014209 191
739 3300013306 Ga0163162_10000729 Ga0163162_1000072921 191
740 3300013307 Ga0157372_10000520 Ga0157372_1000052017 191
741 3300013308 Ga0157375_10003665 Ga0157375_100036659 191
742 3300014325 Ga0163163_10030863 Ga0163163_100308633 191
743 3300014745 Ga0157377_10000281 Ga0157377_100002819 191
744 3300014968 Ga0157379_10000385 Ga0157379_100003859 191
745 3300014969 Ga0157376_10001076 Ga0157376_100010768 191
746 3300014969 Ga0157376_10016729 Ga0157376_100167295 191
747 3300017792 Ga0163161_10002375 Ga0163161_1000237510 191
748 3300025315 Ga0207697_10000433 Ga0207697_100004339 191
749 3300025321 Ga0207656_10000538 Ga0207656_1000053810 191
750 3300025893 Ga0207682_10000118 Ga0207682_1000011816 191
751 3300025899 Ga0207642_10000709 Ga0207642_100007097 191
752 3300025900 Ga0207710_10003842 Ga0207710_100038426 191
753 3300025901 Ga0207688_10000174 Ga0207688_1000017411 191
754 3300025903 Ga0207680_10000198 Ga0207680_1000019810 191
755 3300025904 Ga0207647_10000568 Ga0207647_1000056823 191
756 3300025907 Ga0207645_10000053 Ga0207645_1000005316 191
757 3300025908 Ga0207643_10000013 Ga0207643_1000001347 191
758 3300025911 Ga0207654_10000934 Ga0207654_1000093410 191
759 3300025913 Ga0207695_10016806 Ga0207695_100168067 191
760 3300025914 Ga0207671_10008894 Ga0207671_100088945 191
761 3300025918 Ga0207662_10000009 Ga0207662_1000000984 191
762 3300025919 Ga0207657_10000042 Ga0207657_1000004215 191
763 3300025920 Ga0207649_10000765 Ga0207649_100007659 191
764 3300025920 Ga0207649_10001685 Ga0207649_100016859 191
765 3300025921 Ga0207652_10105629 Ga0207652_101056292 191
766 3300025923 Ga0207681_10000933 Ga0207681_100009338 191
767 3300025924 Ga0207694_10009688 Ga0207694_100096887 191
768 3300025925 Ga0207650_10000245 Ga0207650_1000024516 191
769 3300025926 Ga0207659_10000115 Ga0207659_1000011517 191
770 3300025927 Ga0207687_10002436 Ga0207687_100024369 191
771 3300025931 Ga0207644_10000201 Ga0207644_100002016 191
772 3300025932 Ga0207690_10001478 Ga0207690_100014789 191
773 3300025933 Ga0207706_10000046 Ga0207706_1000004615 191
774 3300025934 Ga0207686_10002723 Ga0207686_100027232 191
775 3300025935 Ga0207709_10004072 Ga0207709_100040726 191
776 3300025936 Ga0207670_10000295 Ga0207670_100002959 191
777 3300025937 Ga0207669_10000636 Ga0207669_100006366 191
778 3300025938 Ga0207704_10000747 Ga0207704_100007476 191
779 3300025940 Ga0207691_10000314 Ga0207691_1000031411 191
780 3300025941 Ga0207711_10000234 Ga0207711_1000023416 191
781 3300025942 Ga0207689_10000071 Ga0207689_1000007115 191
782 3300025944 Ga0207661_10005312 Ga0207661_100053128 191
783 3300025945 Ga0207679_10000111 Ga0207679_100001119 191
784 3300025945 Ga0207679_10000530 Ga0207679_1000053019 191
785 3300025949 Ga0207667_10003794 Ga0207667_100037949 191
786 3300025960 Ga0207651_10000270 Ga0207651_1000027010 191
787 3300025961 Ga0207712_10000329 Ga0207712_100003297 191
788 3300025972 Ga0207668_10003034 Ga0207668_100030343 191
789 3300025981 Ga0207640_10002320 Ga0207640_100023206 191
790 3300025986 Ga0207658_10000980 Ga0207658_1000098012 191
791 3300026023 Ga0207677_10000181 Ga0207677_1000018144 191
792 3300026035 Ga0207703_10001550 Ga0207703_100015509 191
793 3300026041 Ga0207639_10014494 Ga0207639_100144947 191
794 3300026067 Ga0207678_10000430 Ga0207678_1000043025 191
795 3300026078 Ga0207702_10000881 Ga0207702_100008815 191
796 3300026088 Ga0207641_10000652 Ga0207641_1000065239 191
797 3300026089 Ga0207648_10000302 Ga0207648_1000030215 191
798 3300026095 Ga0207676_10000642 Ga0207676_1000064230 191
799 3300026116 Ga0207674_10001952 Ga0207674_1000195224 191
800 3300026118 Ga0207675_100000165 Ga0207675_10000016516 191
801 3300026121 Ga0207683_10000211 Ga0207683_100002116 191
802 3300026142 Ga0207698_10000769 Ga0207698_100007696 191
803 3300027907 Ga0207428_10842035 Ga0207428_108420351 191
804 3300028379 Ga0268266_10001501 Ga0268266_1000150117 191
805 3300028380 Ga0268265_10000394 Ga0268265_1000039430 191
806 3300028381 Ga0268264_10000191 Ga0268264_10000191108 191
807 3300039450 Ga0436363_1179098 Ga0436363_1179098_2442_3017 191
808 3300042005 Ga0439448_0022702 Ga0439448_0022702_713_1288 191
809 3300042012 Ga0439455_0008314 Ga0439455_0008314_1048_1623 191
810 3300045051 Ga0451576_0041703 Ga0451576_0041703_1552_2127 191
811 3300048905 Ga0496102_0001137 Ga0496102_0001137_3677_4252 191
812 3300048909 Ga0496106_0001297 Ga0496106_0001297_15650_16225 191
813 3300048911 Ga0496108_0217179 Ga0496108_0217179_260_835 191
814 3300048912 Ga0496109_0002194 Ga0496109_0002194_4360_4935 191
815 3300048914 Ga0496111_0062566 Ga0496111_0062566_1153_1728 191
816 3300048915 Ga0496112_0017179 Ga0496112_0017179_2142_2717 191
817 3300048916 Ga0496113_0602811 Ga0496113_0602811_55_630 191
818 3300050511 nmdc:mga08y16_351843_c2 nmdc:mga08y16_351843_c2_30_605 191
819 3300050513 nmdc:mga0rr50_473858_c1 nmdc:mga0rr50_473858_c1_229_804 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

75

167

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.7383 47 186
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.7291 47 169
7bw1-assembly1.cif.gz_A crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride 0.6312 55 171
7c83-assembly1.cif.gz_A crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a 0.5828 79 184
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.5576 47 186
ID Description Score Start End Superfamily
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9885 8 170 1.20.120.1630
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9766 8 170 1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9345 1 170 1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9292 1 170 1.20.120.1630
af_O60725_93_277_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.828 49 176 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A3S7UZI4-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase (Icmt) family 0.9984 1 166 GO:0004671
GO:0016020
GO:0032259
AF-A0A1I4FJJ8-F1-model_v4 Alkylresorcinol O-methyltransferase 0.9967 8 169 GO:0004671
GO:0016020
GO:0032259
AF-A0A3G8ZK48-F1-model_v4 Alkylresorcinol O-methyltransferase 0.9949 5 169 GO:0004671
GO:0016020
AF-A0A1H8J5B9-F1-model_v4 Alkylresorcinol O-methyltransferase 0.9932 6 169 GO:0004671
GO:0016020
GO:0032259
AF-A0A561BW06-F1-model_v4 Alkylresorcinol O-methyltransferase 0.9927 4 169 GO:0004671
GO:0016020
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.08 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map