F482187
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 819 | 368 | 805 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300046462|Ga0495651_0549699|Ga0495651_0549699_86_724 |
| Length | 192 |
| Sequence | MPFYYALVVATCFERLAELVVAKRNARWSFARGGVETGRGHYPAMVVLHTGLLAGCLVEPWAAGRSFVPRLGVPMLLVAVAAQGLRWWCIRTLGPRWNTRVIVVPGLPLVDGGPYRWFRHPNYVAVVAEGIALPLAGSAWITAVVFNVLNAVLLTVRLRCETAALAPARSSWPDPGSGGLVPDGAVPPAAAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 3 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 6 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 7 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 8 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 9 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 10 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 11 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 12 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 13 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 14 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 15 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 103 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 107 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 207 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 221 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 222 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 223 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 224 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 225 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 226 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 231 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 236 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 239 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 245 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 246 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 302 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 303 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 304 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 305 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 306 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 307 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 308 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 309 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 348 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 355 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 359 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 360 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 361 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 367 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 368 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.17 |
| Metatranscriptomes | 0.12 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.62 |
| Nodule | 0 |
| Rhizoplane | 7.94 |
| Rhizosphere | 81.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_11460553 | 2162886012 | Bacteria | 1050 |
| 2 | JGI24736J21556_1031421 | 3300001904 | Bacteria | 820 |
| 3 | JGI24747J21853_1001272 | 3300001978 | Bacteria | 1857 |
| 4 | JGI24740J21852_10019352 | 3300001979 | Bacteria | 2399 |
| 5 | JGI24739J22299_10004941 | 3300001989 | Bacteria | 5079 |
| 6 | JGI24739J22299_10020750 | 3300001989 | Bacteria | 2345 |
| 7 | JGI24737J22298_10011988 | 3300001990 | Bacteria | 2832 |
| 8 | JGI24737J22298_10128887 | 3300001990 | Bacteria | 747 |
| 9 | JGI24750J21931_1010170 | 3300002070 | Bacteria | 1222 |
| 10 | JGI24745J21846_1002280 | 3300002073 | Bacteria | 1945 |
| 11 | JGI24738J21930_10024878 | 3300002075 | Bacteria | 1231 |
| 12 | JGI24749J21850_1001787 | 3300002076 | Bacteria | 3043 |
| 13 | JGI24034J26672_10012218 | 3300002239 | Bacteria | 1292 |
| 14 | JGI24751J29686_10021542 | 3300002459 | Bacteria | 1336 |
| 15 | rootH2_10195207 | 3300003320 | Bacteria | 5915 |
| 16 | Ga0006562J51391_1083609 | 3300003578 | Bacteria | 1010 |
| 17 | Ga0065715_10170299 | 3300005293 | Bacteria | 1552 |
| 18 | Ga0065707_10099990 | 3300005295 | Bacteria | 2964 |
| 19 | Ga0070658_10000182 | 3300005327 | Bacteria | 55103 |
| 20 | Ga0070676_10000569 | 3300005328 | Bacteria | 17905 |
| 21 | Ga0070683_100002426 | 3300005329 | Bacteria | 14814 |
| 22 | Ga0070683_100253818 | 3300005329 | Bacteria | 1673 |
| 23 | Ga0070690_100000724 | 3300005330 | Bacteria | 16921 |
| 24 | Ga0070670_100013501 | 3300005331 | Bacteria | 6997 |
| 25 | Ga0070670_100147157 | 3300005331 | Bacteria | 2038 |
| 26 | Ga0070677_10000089 | 3300005333 | Bacteria | 29502 |
| 27 | Ga0068869_100000722 | 3300005334 | Bacteria | 18814 |
| 28 | Ga0068869_100009208 | 3300005334 | Bacteria | 6397 |
| 29 | Ga0070666_10006924 | 3300005335 | Bacteria | 6987 |
| 30 | Ga0070666_10019805 | 3300005335 | Bacteria | 4346 |
| 31 | Ga0070682_100012388 | 3300005337 | Bacteria | 4890 |
| 32 | Ga0070682_101114089 | 3300005337 | Bacteria | 662 |
| 33 | Ga0068868_100001079 | 3300005338 | Bacteria | 18679 |
| 34 | Ga0068868_100154087 | 3300005338 | Bacteria | 1894 |
| 35 | Ga0070660_100000514 | 3300005339 | Bacteria | 25808 |
| 36 | Ga0070689_100001136 | 3300005340 | Bacteria | 16782 |
| 37 | Ga0070689_100277565 | 3300005340 | Bacteria | 1389 |
| 38 | Ga0070691_10021525 | 3300005341 | Bacteria | 2984 |
| 39 | Ga0070691_10339571 | 3300005341 | Bacteria | 831 |
| 40 | Ga0070687_100000027 | 3300005343 | Bacteria | 45546 |
| 41 | Ga0070687_100034601 | 3300005343 | Bacteria | 2502 |
| 42 | Ga0070687_100045218 | 3300005343 | Bacteria | 2247 |
| 43 | Ga0070661_100001599 | 3300005344 | Bacteria | 15686 |
| 44 | Ga0070661_100002829 | 3300005344 | Bacteria | 11925 |
| 45 | Ga0070692_10001590 | 3300005345 | Bacteria | 8345 |
| 46 | Ga0070692_10003754 | 3300005345 | Bacteria | 6243 |
| 47 | Ga0070668_100000852 | 3300005347 | Bacteria | 21155 |
| 48 | Ga0070668_100104767 | 3300005347 | Bacteria | 2245 |
| 49 | Ga0070668_100167002 | 3300005347 | Bacteria | 1789 |
| 50 | Ga0070668_100203259 | 3300005347 | Bacteria | 1627 |
| 51 | Ga0070669_100000180 | 3300005353 | Bacteria | 55244 |
| 52 | Ga0070675_100002254 | 3300005354 | Bacteria | 14301 |
| 53 | Ga0070675_100039563 | 3300005354 | Bacteria | 3849 |
| 54 | Ga0070671_100000129 | 3300005355 | Bacteria | 48602 |
| 55 | Ga0070674_100001566 | 3300005356 | Bacteria | 12244 |
| 56 | Ga0070674_100015749 | 3300005356 | Bacteria | 4728 |
| 57 | Ga0070674_100082636 | 3300005356 | Bacteria | 2298 |
| 58 | Ga0070674_100147910 | 3300005356 | Bacteria | 1770 |
| 59 | Ga0070674_100802746 | 3300005356 | Bacteria | 813 |
| 60 | Ga0070673_100000805 | 3300005364 | Bacteria | 17537 |
| 61 | Ga0070673_100054937 | 3300005364 | Bacteria | 3136 |
| 62 | Ga0070688_100000146 | 3300005365 | Bacteria | 38115 |
| 63 | Ga0070688_100049376 | 3300005365 | Bacteria | 2618 |
| 64 | Ga0070688_100590746 | 3300005365 | Bacteria | 849 |
| 65 | Ga0070659_100000665 | 3300005366 | Bacteria | 24949 |
| 66 | Ga0070659_100210273 | 3300005366 | Bacteria | 1603 |
| 67 | Ga0070659_100279038 | 3300005366 | Bacteria | 1390 |
| 68 | Ga0070667_100004504 | 3300005367 | Bacteria | 11756 |
| 69 | Ga0070667_100042097 | 3300005367 | Bacteria | 3832 |
| 70 | Ga0070703_10013006 | 3300005406 | Bacteria | 2359 |
| 71 | Ga0070709_10170486 | 3300005434 | Bacteria | 1520 |
| 72 | Ga0070709_10376036 | 3300005434 | Bacteria | 1055 |
| 73 | Ga0070714_100461014 | 3300005435 | Bacteria | 1208 |
| 74 | Ga0070714_100544810 | 3300005435 | Bacteria | 1110 |
| 75 | Ga0070713_100297184 | 3300005436 | Bacteria | 1486 |
| 76 | Ga0070710_10031660 | 3300005437 | Bacteria | 2858 |
| 77 | Ga0070710_10094810 | 3300005437 | Bacteria | 1767 |
| 78 | Ga0070701_10000764 | 3300005438 | Bacteria | 11468 |
| 79 | Ga0070701_10053918 | 3300005438 | Bacteria | 2095 |
| 80 | Ga0070711_100009150 | 3300005439 | Bacteria | 6087 |
| 81 | Ga0070711_100040182 | 3300005439 | Bacteria | 3153 |
| 82 | Ga0070711_100173052 | 3300005439 | Bacteria | 1647 |
| 83 | Ga0070705_100000359 | 3300005440 | Bacteria | 26757 |
| 84 | Ga0070705_100366641 | 3300005440 | Bacteria | 1055 |
| 85 | Ga0070700_100030853 | 3300005441 | Bacteria | 3207 |
| 86 | Ga0070700_100085893 | 3300005441 | Bacteria | 2042 |
| 87 | Ga0070663_100001822 | 3300005455 | Bacteria | 11864 |
| 88 | Ga0070663_100067069 | 3300005455 | Bacteria | 2602 |
| 89 | Ga0070678_100000484 | 3300005456 | Bacteria | 19006 |
| 90 | Ga0070678_100015071 | 3300005456 | Bacteria | 4900 |
| 91 | Ga0070678_100226417 | 3300005456 | Bacteria | 1557 |
| 92 | Ga0070678_100252038 | 3300005456 | Bacteria | 1480 |
| 93 | Ga0070678_100255369 | 3300005456 | Bacteria | 1471 |
| 94 | Ga0070678_100566889 | 3300005456 | Bacteria | 1010 |
| 95 | Ga0070662_100001061 | 3300005457 | Bacteria | 16791 |
| 96 | Ga0070662_100178920 | 3300005457 | Bacteria | 1671 |
| 97 | Ga0070681_10082039 | 3300005458 | Bacteria | 3180 |
| 98 | Ga0068867_100001778 | 3300005459 | Bacteria | 14985 |
| 99 | Ga0068867_100014530 | 3300005459 | Bacteria | 5580 |
| 100 | Ga0068867_100173617 | 3300005459 | Bacteria | 1709 |
| 101 | Ga0068867_100199365 | 3300005459 | Bacteria | 1602 |
| 102 | Ga0070685_10000749 | 3300005466 | Bacteria | 17655 |
| 103 | Ga0070685_10121005 | 3300005466 | Bacteria | 1625 |
| 104 | Ga0070679_100035378 | 3300005530 | Bacteria | 4955 |
| 105 | Ga0070684_100013533 | 3300005535 | Bacteria | 6582 |
| 106 | Ga0070684_100020868 | 3300005535 | Bacteria | 5438 |
| 107 | Ga0070684_100117504 | 3300005535 | Bacteria | 2390 |
| 108 | Ga0070684_100290814 | 3300005535 | Bacteria | 1498 |
| 109 | Ga0068853_100019372 | 3300005539 | Bacteria | 5641 |
| 110 | Ga0068853_100088042 | 3300005539 | Bacteria | 2725 |
| 111 | Ga0070672_100001357 | 3300005543 | Bacteria | 15113 |
| 112 | Ga0070686_100017067 | 3300005544 | Bacteria | 4236 |
| 113 | Ga0070696_100032755 | 3300005546 | Bacteria | 3567 |
| 114 | Ga0070696_100190780 | 3300005546 | Bacteria | 1525 |
| 115 | Ga0070693_100072408 | 3300005547 | Bacteria | 2033 |
| 116 | Ga0070665_100202691 | 3300005548 | Bacteria | 1984 |
| 117 | Ga0070665_100303175 | 3300005548 | Bacteria | 1600 |
| 118 | Ga0070665_100489595 | 3300005548 | Bacteria | 1241 |
| 119 | Ga0070704_100005137 | 3300005549 | Bacteria | 7606 |
| 120 | Ga0070704_100039056 | 3300005549 | Bacteria | 3256 |
| 121 | Ga0070704_100330317 | 3300005549 | Bacteria | 1280 |
| 122 | Ga0068855_100000320 | 3300005563 | Bacteria | 59730 |
| 123 | Ga0068855_100472536 | 3300005563 | Bacteria | 1366 |
| 124 | Ga0070664_100001107 | 3300005564 | Bacteria | 21323 |
| 125 | Ga0070664_100003364 | 3300005564 | Bacteria | 12931 |
| 126 | Ga0068857_100001857 | 3300005577 | Bacteria | 17003 |
| 127 | Ga0068857_100006286 | 3300005577 | Bacteria | 10161 |
| 128 | Ga0068857_100022219 | 3300005577 | Bacteria | 5581 |
| 129 | Ga0068854_100001176 | 3300005578 | Bacteria | 15687 |
| 130 | Ga0068854_100053392 | 3300005578 | Bacteria | 2902 |
| 131 | Ga0068854_100068024 | 3300005578 | Bacteria | 2597 |
| 132 | Ga0068854_100406884 | 3300005578 | Bacteria | 1127 |
| 133 | Ga0068856_100065742 | 3300005614 | Bacteria | 3584 |
| 134 | Ga0068856_100085158 | 3300005614 | Bacteria | 3140 |
| 135 | Ga0070702_100014349 | 3300005615 | Bacteria | 4018 |
| 136 | Ga0070702_100025003 | 3300005615 | Bacteria | 3194 |
| 137 | Ga0070702_100090495 | 3300005615 | Bacteria | 1855 |
| 138 | Ga0070702_100259467 | 3300005615 | Bacteria | 1182 |
| 139 | Ga0068852_100000158 | 3300005616 | Bacteria | 45258 |
| 140 | Ga0068852_100805061 | 3300005616 | Bacteria | 954 |
| 141 | Ga0068852_101271339 | 3300005616 | Bacteria | 757 |
| 142 | Ga0068859_100020605 | 3300005617 | Bacteria | 6616 |
| 143 | Ga0068859_100042188 | 3300005617 | Bacteria | 4582 |
| 144 | Ga0068864_100001189 | 3300005618 | Bacteria | 21646 |
| 145 | Ga0068864_100100427 | 3300005618 | Bacteria | 2565 |
| 146 | Ga0068866_10000414 | 3300005718 | Bacteria | 19861 |
| 147 | Ga0068866_10017449 | 3300005718 | Bacteria | 3228 |
| 148 | Ga0068866_10020552 | 3300005718 | Bacteria | 3027 |
| 149 | Ga0068866_10040009 | 3300005718 | Bacteria | 2318 |
| 150 | Ga0068866_10117038 | 3300005718 | Bacteria | 1496 |
| 151 | Ga0068866_10777659 | 3300005718 | Bacteria | 663 |
| 152 | Ga0068861_100000079 | 3300005719 | Bacteria | 46599 |
| 153 | Ga0068861_100009494 | 3300005719 | Bacteria | 6719 |
| 154 | Ga0068861_100152470 | 3300005719 | Bacteria | 1898 |
| 155 | Ga0068851_10004904 | 3300005834 | Bacteria | 6063 |
| 156 | Ga0068851_10100414 | 3300005834 | Bacteria | 1535 |
| 157 | Ga0068870_10000320 | 3300005840 | Bacteria | 17840 |
| 158 | Ga0068870_10005167 | 3300005840 | Bacteria | 5683 |
| 159 | Ga0068870_10400233 | 3300005840 | Bacteria | 893 |
| 160 | Ga0068863_100000361 | 3300005841 | Bacteria | 46280 |
| 161 | Ga0068863_100071922 | 3300005841 | Bacteria | 3272 |
| 162 | Ga0068858_100003786 | 3300005842 | Bacteria | 14955 |
| 163 | Ga0068858_100019169 | 3300005842 | Bacteria | 6400 |
| 164 | Ga0068858_100264096 | 3300005842 | Bacteria | 1637 |
| 165 | Ga0068858_100572605 | 3300005842 | Bacteria | 1094 |
| 166 | Ga0068860_100000571 | 3300005843 | Bacteria | 44338 |
| 167 | Ga0068860_100017431 | 3300005843 | Bacteria | 6997 |
| 168 | Ga0068860_100060696 | 3300005843 | Bacteria | 3593 |
| 169 | Ga0068860_100064628 | 3300005843 | Bacteria | 3475 |
| 170 | Ga0068862_100001958 | 3300005844 | Bacteria | 18679 |
| 171 | Ga0068862_100082678 | 3300005844 | Bacteria | 2787 |
| 172 | Ga0068862_100144824 | 3300005844 | Bacteria | 2111 |
| 173 | Ga0068862_100155625 | 3300005844 | Bacteria | 2037 |
| 174 | Ga0081540_1000073 | 3300005983 | Bacteria | 108893 |
| 175 | Ga0081540_1000149 | 3300005983 | Bacteria | 72363 |
| 176 | Ga0081540_1099026 | 3300005983 | Bacteria | 1261 |
| 177 | Ga0075365_10084118 | 3300006038 | Bacteria | 2159 |
| 178 | Ga0075365_10176126 | 3300006038 | Bacteria | 1494 |
| 179 | Ga0075365_10481819 | 3300006038 | Bacteria | 876 |
| 180 | Ga0075363_100015596 | 3300006048 | Bacteria | 3738 |
| 181 | Ga0075363_100119192 | 3300006048 | Bacteria | 1472 |
| 182 | Ga0075363_100451152 | 3300006048 | Bacteria | 760 |
| 183 | Ga0075364_10028064 | 3300006051 | Bacteria | 3601 |
| 184 | Ga0075364_10128574 | 3300006051 | Bacteria | 1699 |
| 185 | Ga0075364_10249696 | 3300006051 | Bacteria | 1206 |
| 186 | Ga0070715_10003349 | 3300006163 | Bacteria | 5079 |
| 187 | Ga0070715_10007835 | 3300006163 | Bacteria | 3693 |
| 188 | Ga0070715_10409521 | 3300006163 | Bacteria | 756 |
| 189 | Ga0070716_100006523 | 3300006173 | Bacteria | 5704 |
| 190 | Ga0070716_100008515 | 3300006173 | Bacteria | 5091 |
| 191 | Ga0070716_100062805 | 3300006173 | Bacteria | 2155 |
| 192 | Ga0070712_100007763 | 3300006175 | Bacteria | 6716 |
| 193 | Ga0070712_100020521 | 3300006175 | Bacteria | 4324 |
| 194 | Ga0070712_100099419 | 3300006175 | Bacteria | 2147 |
| 195 | Ga0070712_100219196 | 3300006175 | Bacteria | 1505 |
| 196 | Ga0075367_10023412 | 3300006178 | Bacteria | 3475 |
| 197 | Ga0075369_10015734 | 3300006186 | Bacteria | 3041 |
| 198 | Ga0075369_10037824 | 3300006186 | Bacteria | 2057 |
| 199 | Ga0075369_10085246 | 3300006186 | Bacteria | 1405 |
| 200 | Ga0075369_10172536 | 3300006186 | Bacteria | 994 |
| 201 | Ga0075369_10174420 | 3300006186 | Bacteria | 988 |
| 202 | Ga0075369_10296041 | 3300006186 | Bacteria | 755 |
| 203 | Ga0097621_100001336 | 3300006237 | Bacteria | 16961 |
| 204 | Ga0097621_100103784 | 3300006237 | Bacteria | 2395 |
| 205 | Ga0075370_10068654 | 3300006353 | Bacteria | 2024 |
| 206 | Ga0075370_10355257 | 3300006353 | Bacteria | 876 |
| 207 | Ga0068871_100000398 | 3300006358 | Bacteria | 30329 |
| 208 | Ga0068871_100035728 | 3300006358 | Bacteria | 3951 |
| 209 | Ga0068871_100077582 | 3300006358 | Bacteria | 2746 |
| 210 | Ga0075428_100189524 | 3300006844 | Bacteria | 2224 |
| 211 | Ga0075429_100024137 | 3300006880 | Bacteria | 5274 |
| 212 | Ga0075429_100811309 | 3300006880 | Bacteria | 819 |
| 213 | Ga0068865_100010117 | 3300006881 | Bacteria | 5866 |
| 214 | Ga0068865_100013937 | 3300006881 | Bacteria | 5098 |
| 215 | Ga0068865_100022210 | 3300006881 | Bacteria | 4135 |
| 216 | Ga0068865_100065613 | 3300006881 | Bacteria | 2558 |
| 217 | Ga0068865_100529637 | 3300006881 | Bacteria | 986 |
| 218 | Ga0097620_100020605 | 3300006931 | Bacteria | 6616 |
| 219 | Ga0097620_100042189 | 3300006931 | Bacteria | 4582 |
| 220 | Ga0097620_100116593 | 3300006931 | Bacteria | 2735 |
| 221 | Ga0075435_100272641 | 3300007076 | Bacteria | 1443 |
| 222 | Ga0105250_10051770 | 3300009092 | Bacteria | 1647 |
| 223 | Ga0105250_10147845 | 3300009092 | Bacteria | 976 |
| 224 | Ga0105240_10002584 | 3300009093 | Bacteria | 28996 |
| 225 | Ga0111539_10529903 | 3300009094 | Bacteria | 1372 |
| 226 | Ga0111539_11096885 | 3300009094 | Bacteria | 925 |
| 227 | Ga0105245_10000137 | 3300009098 | Bacteria | 69634 |
| 228 | Ga0105245_10352469 | 3300009098 | Bacteria | 1459 |
| 229 | Ga0105245_10562407 | 3300009098 | Bacteria | 1163 |
| 230 | Ga0105247_10000106 | 3300009101 | Bacteria | 87195 |
| 231 | Ga0105247_10168466 | 3300009101 | Bacteria | 1455 |
| 232 | Ga0105247_10288677 | 3300009101 | Bacteria | 1134 |
| 233 | Ga0114129_10054328 | 3300009147 | Bacteria | 5615 |
| 234 | Ga0105243_10004158 | 3300009148 | Bacteria | 11485 |
| 235 | Ga0105243_10034369 | 3300009148 | Bacteria | 3924 |
| 236 | Ga0105243_10159333 | 3300009148 | Bacteria | 1944 |
| 237 | Ga0105243_10328869 | 3300009148 | Bacteria | 1395 |
| 238 | Ga0105241_10002148 | 3300009174 | Bacteria | 14861 |
| 239 | Ga0105241_10139258 | 3300009174 | Bacteria | 1974 |
| 240 | Ga0105241_10201326 | 3300009174 | Bacteria | 1663 |
| 241 | Ga0105242_10001041 | 3300009176 | Bacteria | 21756 |
| 242 | Ga0105242_10035466 | 3300009176 | Bacteria | 4000 |
| 243 | Ga0105242_10086989 | 3300009176 | Bacteria | 2623 |
| 244 | Ga0105248_10001344 | 3300009177 | Bacteria | 27398 |
| 245 | Ga0105237_10000599 | 3300009545 | Bacteria | 50226 |
| 246 | Ga0105237_10002051 | 3300009545 | Bacteria | 25601 |
| 247 | Ga0105237_10139611 | 3300009545 | Bacteria | 2417 |
| 248 | Ga0105237_10222783 | 3300009545 | Bacteria | 1886 |
| 249 | Ga0105237_10300729 | 3300009545 | Bacteria | 1608 |
| 250 | Ga0105237_12174550 | 3300009545 | Bacteria | 564 |
| 251 | Ga0105238_10000994 | 3300009551 | Bacteria | 28961 |
| 252 | Ga0105238_10442471 | 3300009551 | Bacteria | 1296 |
| 253 | Ga0105249_10000275 | 3300009553 | Bacteria | 54246 |
| 254 | Ga0105249_10071738 | 3300009553 | Bacteria | 3201 |
| 255 | Ga0105249_10079289 | 3300009553 | Bacteria | 3048 |
| 256 | Ga0105249_10094239 | 3300009553 | Bacteria | 2806 |
| 257 | Ga0105249_11229972 | 3300009553 | Bacteria | 820 |
| 258 | Ga0105249_11368103 | 3300009553 | Bacteria | 780 |
| 259 | Ga0105239_10003039 | 3300010375 | Bacteria | 20851 |
| 260 | Ga0105239_10003587 | 3300010375 | Bacteria | 18952 |
| 261 | Ga0105239_10101877 | 3300010375 | Bacteria | 3177 |
| 262 | Ga0105239_10217076 | 3300010375 | Bacteria | 2144 |
| 263 | Ga0105239_11203403 | 3300010375 | Bacteria | 873 |
| 264 | Ga0105246_10006490 | 3300011119 | Bacteria | 7145 |
| 265 | Ga0105246_10025541 | 3300011119 | Bacteria | 3851 |
| 266 | Ga0105246_10079286 | 3300011119 | Bacteria | 2335 |
| 267 | Ga0105246_10215227 | 3300011119 | Bacteria | 1502 |
| 268 | Ga0157373_10005362 | 3300013100 | Bacteria | 9634 |
| 269 | Ga0157371_10001570 | 3300013102 | Bacteria | 23478 |
| 270 | Ga0157371_10857635 | 3300013102 | Bacteria | 687 |
| 271 | Ga0157370_10206097 | 3300013104 | Bacteria | 1823 |
| 272 | Ga0157369_10000816 | 3300013105 | Bacteria | 39816 |
| 273 | Ga0157374_10002351 | 3300013296 | Bacteria | 15958 |
| 274 | Ga0157374_10004568 | 3300013296 | Bacteria | 11613 |
| 275 | Ga0157374_10932484 | 3300013296 | Bacteria | 886 |
| 276 | Ga0157378_10001420 | 3300013297 | Bacteria | 21534 |
| 277 | Ga0157378_10042343 | 3300013297 | Bacteria | 4042 |
| 278 | Ga0163162_10000729 | 3300013306 | Bacteria | 30485 |
| 279 | Ga0163162_10081460 | 3300013306 | Bacteria | 3307 |
| 280 | Ga0163162_10213906 | 3300013306 | Bacteria | 2058 |
| 281 | Ga0163162_10840999 | 3300013306 | Bacteria | 1033 |
| 282 | Ga0157372_10000520 | 3300013307 | Bacteria | 42470 |
| 283 | Ga0157372_10086249 | 3300013307 | Bacteria | 3562 |
| 284 | Ga0157372_10290188 | 3300013307 | Bacteria | 1903 |
| 285 | Ga0157375_10003665 | 3300013308 | Bacteria | 13330 |
| 286 | Ga0157375_10078114 | 3300013308 | Bacteria | 3342 |
| 287 | Ga0157375_10299855 | 3300013308 | Bacteria | 1771 |
| 288 | Ga0157375_10359424 | 3300013308 | Bacteria | 1622 |
| 289 | Ga0157375_10730200 | 3300013308 | Bacteria | 1143 |
| 290 | Ga0163163_10009942 | 3300014325 | Bacteria | 8530 |
| 291 | Ga0163163_10030863 | 3300014325 | Bacteria | 5168 |
| 292 | Ga0163163_10315748 | 3300014325 | Bacteria | 1616 |
| 293 | Ga0157380_10005423 | 3300014326 | Bacteria | 8909 |
| 294 | Ga0157380_10266495 | 3300014326 | Bacteria | 1559 |
| 295 | Ga0157380_10272752 | 3300014326 | Bacteria | 1543 |
| 296 | Ga0157380_10541549 | 3300014326 | Bacteria | 1140 |
| 297 | Ga0157380_10833528 | 3300014326 | Bacteria | 942 |
| 298 | Ga0157377_10000281 | 3300014745 | Bacteria | 24418 |
| 299 | Ga0157379_10000385 | 3300014968 | Bacteria | 35739 |
| 300 | Ga0157379_10272539 | 3300014968 | Bacteria | 1539 |
| 301 | Ga0157379_10624771 | 3300014968 | Bacteria | 1007 |
| 302 | Ga0157376_10001076 | 3300014969 | Bacteria | 17890 |
| 303 | Ga0157376_10016729 | 3300014969 | Bacteria | 5577 |
| 304 | Ga0157376_10052557 | 3300014969 | Bacteria | 3388 |
| 305 | Ga0157376_10194582 | 3300014969 | Bacteria | 1862 |
| 306 | Ga0157376_10340628 | 3300014969 | Bacteria | 1432 |
| 307 | Ga0157376_10527304 | 3300014969 | Bacteria | 1165 |
| 308 | Ga0163161_10002375 | 3300017792 | Bacteria | 13484 |
| 309 | Ga0163161_10222663 | 3300017792 | Bacteria | 1461 |
| 310 | Ga0207697_10000433 | 3300025315 | Bacteria | 23583 |
| 311 | Ga0207656_10000538 | 3300025321 | Bacteria | 12547 |
| 312 | Ga0207696_1098850 | 3300025711 | Bacteria | 796 |
| 313 | Ga0207653_10036117 | 3300025885 | Bacteria | 1609 |
| 314 | Ga0207682_10000118 | 3300025893 | Bacteria | 36634 |
| 315 | Ga0207692_10014881 | 3300025898 | Bacteria | 3410 |
| 316 | Ga0207692_10016015 | 3300025898 | Bacteria | 3310 |
| 317 | Ga0207692_10051617 | 3300025898 | Bacteria | 2086 |
| 318 | Ga0207692_10109567 | 3300025898 | Bacteria | 1530 |
| 319 | Ga0207642_10000709 | 3300025899 | Bacteria | 10306 |
| 320 | Ga0207642_10005782 | 3300025899 | Bacteria | 4065 |
| 321 | Ga0207642_10010405 | 3300025899 | Bacteria | 3277 |
| 322 | Ga0207642_10018722 | 3300025899 | Bacteria | 2664 |
| 323 | Ga0207642_10110326 | 3300025899 | Bacteria | 1399 |
| 324 | Ga0207710_10003842 | 3300025900 | Bacteria | 6639 |
| 325 | Ga0207688_10000174 | 3300025901 | Bacteria | 28429 |
| 326 | Ga0207688_10003983 | 3300025901 | Bacteria | 8049 |
| 327 | Ga0207688_10023517 | 3300025901 | Bacteria | 3375 |
| 328 | Ga0207688_10073509 | 3300025901 | Bacteria | 1943 |
| 329 | Ga0207680_10000198 | 3300025903 | Bacteria | 29025 |
| 330 | Ga0207680_10094552 | 3300025903 | Bacteria | 1908 |
| 331 | Ga0207680_10130677 | 3300025903 | Bacteria | 1655 |
| 332 | Ga0207647_10000568 | 3300025904 | Bacteria | 28920 |
| 333 | Ga0207647_10011974 | 3300025904 | Bacteria | 6055 |
| 334 | Ga0207685_10027666 | 3300025905 | Bacteria | 1987 |
| 335 | Ga0207685_10062108 | 3300025905 | Bacteria | 1483 |
| 336 | Ga0207699_10242716 | 3300025906 | Bacteria | 1238 |
| 337 | Ga0207645_10000053 | 3300025907 | Bacteria | 83208 |
| 338 | Ga0207643_10000013 | 3300025908 | Bacteria | 130464 |
| 339 | Ga0207643_10002721 | 3300025908 | Bacteria | 9563 |
| 340 | Ga0207705_10095065 | 3300025909 | Bacteria | 2186 |
| 341 | Ga0207654_10000934 | 3300025911 | Bacteria | 16089 |
| 342 | Ga0207654_10130538 | 3300025911 | Bacteria | 1590 |
| 343 | Ga0207707_10390494 | 3300025912 | Bacteria | 1196 |
| 344 | Ga0207695_10016806 | 3300025913 | Bacteria | 8543 |
| 345 | Ga0207695_10350216 | 3300025913 | Bacteria | 1364 |
| 346 | Ga0207671_10004398 | 3300025914 | Bacteria | 13507 |
| 347 | Ga0207671_10008894 | 3300025914 | Bacteria | 8456 |
| 348 | Ga0207671_10420685 | 3300025914 | Bacteria | 1063 |
| 349 | Ga0207693_10005271 | 3300025915 | Bacteria | 10814 |
| 350 | Ga0207693_10014044 | 3300025915 | Bacteria | 6448 |
| 351 | Ga0207693_10350892 | 3300025915 | Bacteria | 1154 |
| 352 | Ga0207663_10094398 | 3300025916 | Bacteria | 1993 |
| 353 | Ga0207662_10000009 | 3300025918 | Bacteria | 95358 |
| 354 | Ga0207662_10024801 | 3300025918 | Bacteria | 3451 |
| 355 | Ga0207662_10180570 | 3300025918 | Bacteria | 1358 |
| 356 | Ga0207657_10000042 | 3300025919 | Bacteria | 118735 |
| 357 | Ga0207657_10373636 | 3300025919 | Bacteria | 1123 |
| 358 | Ga0207649_10000765 | 3300025920 | Bacteria | 20907 |
| 359 | Ga0207649_10001685 | 3300025920 | Bacteria | 12763 |
| 360 | Ga0207652_10105629 | 3300025921 | Bacteria | 2492 |
| 361 | Ga0207681_10000933 | 3300025923 | Bacteria | 19036 |
| 362 | Ga0207681_10363182 | 3300025923 | Bacteria | 1162 |
| 363 | Ga0207694_10009688 | 3300025924 | Bacteria | 7263 |
| 364 | Ga0207694_10599830 | 3300025924 | Bacteria | 926 |
| 365 | Ga0207650_10000245 | 3300025925 | Bacteria | 59462 |
| 366 | Ga0207659_10000115 | 3300025926 | Bacteria | 46765 |
| 367 | Ga0207687_10002436 | 3300025927 | Bacteria | 12637 |
| 368 | Ga0207687_10027783 | 3300025927 | Bacteria | 3798 |
| 369 | Ga0207687_10161602 | 3300025927 | Bacteria | 1720 |
| 370 | Ga0207644_10000201 | 3300025931 | Bacteria | 42183 |
| 371 | Ga0207644_10158060 | 3300025931 | Bacteria | 1760 |
| 372 | Ga0207690_10001478 | 3300025932 | Bacteria | 14685 |
| 373 | Ga0207690_10328697 | 3300025932 | Bacteria | 1203 |
| 374 | Ga0207690_10920098 | 3300025932 | Bacteria | 726 |
| 375 | Ga0207690_10972111 | 3300025932 | Bacteria | 706 |
| 376 | Ga0207706_10000046 | 3300025933 | Bacteria | 119273 |
| 377 | Ga0207706_10020804 | 3300025933 | Bacteria | 5893 |
| 378 | Ga0207706_10055761 | 3300025933 | Bacteria | 3484 |
| 379 | Ga0207706_10136331 | 3300025933 | Bacteria | 2159 |
| 380 | Ga0207706_10254040 | 3300025933 | Bacteria | 1535 |
| 381 | Ga0207686_10002723 | 3300025934 | Bacteria | 9582 |
| 382 | Ga0207686_10047915 | 3300025934 | Bacteria | 2644 |
| 383 | Ga0207686_10056753 | 3300025934 | Bacteria | 2463 |
| 384 | Ga0207686_10071015 | 3300025934 | Bacteria | 2239 |
| 385 | Ga0207709_10004072 | 3300025935 | Bacteria | 8507 |
| 386 | Ga0207709_10183047 | 3300025935 | Bacteria | 1481 |
| 387 | Ga0207709_10284984 | 3300025935 | Bacteria | 1222 |
| 388 | Ga0207709_10299212 | 3300025935 | Bacteria | 1196 |
| 389 | Ga0207670_10000295 | 3300025936 | Bacteria | 30013 |
| 390 | Ga0207670_10115375 | 3300025936 | Bacteria | 1943 |
| 391 | Ga0207669_10000636 | 3300025937 | Bacteria | 15145 |
| 392 | Ga0207669_10102261 | 3300025937 | Bacteria | 1898 |
| 393 | Ga0207669_10107688 | 3300025937 | Bacteria | 1859 |
| 394 | Ga0207704_10000747 | 3300025938 | Bacteria | 14307 |
| 395 | Ga0207704_10130090 | 3300025938 | Bacteria | 1741 |
| 396 | Ga0207665_10010565 | 3300025939 | Bacteria | 6064 |
| 397 | Ga0207665_10021889 | 3300025939 | Bacteria | 4204 |
| 398 | Ga0207665_10061042 | 3300025939 | Bacteria | 2554 |
| 399 | Ga0207691_10000314 | 3300025940 | Bacteria | 48335 |
| 400 | Ga0207691_10005262 | 3300025940 | Bacteria | 12490 |
| 401 | Ga0207691_10068947 | 3300025940 | Bacteria | 3195 |
| 402 | Ga0207711_10000234 | 3300025941 | Bacteria | 59526 |
| 403 | Ga0207711_10200480 | 3300025941 | Bacteria | 1821 |
| 404 | Ga0207689_10000071 | 3300025942 | Bacteria | 82580 |
| 405 | Ga0207689_10009642 | 3300025942 | Bacteria | 8325 |
| 406 | Ga0207689_10145791 | 3300025942 | Bacteria | 1950 |
| 407 | Ga0207661_10005312 | 3300025944 | Bacteria | 9068 |
| 408 | Ga0207679_10000111 | 3300025945 | Bacteria | 66057 |
| 409 | Ga0207679_10000530 | 3300025945 | Bacteria | 25785 |
| 410 | Ga0207667_10003794 | 3300025949 | Bacteria | 18600 |
| 411 | Ga0207667_10362361 | 3300025949 | Bacteria | 1478 |
| 412 | Ga0207651_10000270 | 3300025960 | Bacteria | 22154 |
| 413 | Ga0207651_10005041 | 3300025960 | Bacteria | 6734 |
| 414 | Ga0207651_10042064 | 3300025960 | Bacteria | 3038 |
| 415 | Ga0207651_10514744 | 3300025960 | Bacteria | 1036 |
| 416 | Ga0207712_10000329 | 3300025961 | Bacteria | 43533 |
| 417 | Ga0207712_10652502 | 3300025961 | Bacteria | 915 |
| 418 | Ga0207712_10918365 | 3300025961 | Bacteria | 774 |
| 419 | Ga0207668_10003034 | 3300025972 | Bacteria | 9843 |
| 420 | Ga0207668_10052992 | 3300025972 | Bacteria | 2810 |
| 421 | Ga0207668_10067809 | 3300025972 | Bacteria | 2534 |
| 422 | Ga0207668_10278841 | 3300025972 | Bacteria | 1370 |
| 423 | Ga0207668_10503883 | 3300025972 | Bacteria | 1042 |
| 424 | Ga0207640_10002320 | 3300025981 | Bacteria | 10226 |
| 425 | Ga0207640_10033664 | 3300025981 | Bacteria | 3191 |
| 426 | Ga0207640_10388004 | 3300025981 | Bacteria | 1134 |
| 427 | Ga0207658_10000980 | 3300025986 | Bacteria | 23563 |
| 428 | Ga0207658_10096480 | 3300025986 | Bacteria | 2306 |
| 429 | Ga0207658_10267197 | 3300025986 | Bacteria | 1460 |
| 430 | Ga0207658_10281707 | 3300025986 | Bacteria | 1425 |
| 431 | Ga0207677_10000181 | 3300026023 | Bacteria | 50309 |
| 432 | Ga0207677_10023893 | 3300026023 | Bacteria | 3785 |
| 433 | Ga0207677_10058521 | 3300026023 | Bacteria | 2654 |
| 434 | Ga0207677_10170444 | 3300026023 | Bacteria | 1701 |
| 435 | Ga0207703_10001550 | 3300026035 | Bacteria | 20837 |
| 436 | Ga0207703_10043847 | 3300026035 | Bacteria | 3592 |
| 437 | Ga0207703_10076887 | 3300026035 | Bacteria | 2770 |
| 438 | Ga0207703_10336047 | 3300026035 | Bacteria | 1387 |
| 439 | Ga0207703_10478035 | 3300026035 | Bacteria | 1167 |
| 440 | Ga0207639_10014494 | 3300026041 | Bacteria | 5546 |
| 441 | Ga0207678_10000430 | 3300026067 | Bacteria | 38062 |
| 442 | Ga0207678_10016962 | 3300026067 | Bacteria | 6395 |
| 443 | Ga0207678_10107147 | 3300026067 | Bacteria | 2384 |
| 444 | Ga0207678_10554867 | 3300026067 | Bacteria | 1005 |
| 445 | Ga0207708_10001377 | 3300026075 | Bacteria | 18288 |
| 446 | Ga0207708_10014636 | 3300026075 | Bacteria | 5871 |
| 447 | Ga0207708_10136029 | 3300026075 | Bacteria | 1925 |
| 448 | Ga0207702_10000881 | 3300026078 | Bacteria | 31236 |
| 449 | Ga0207641_10000652 | 3300026088 | Bacteria | 37792 |
| 450 | Ga0207641_10347435 | 3300026088 | Bacteria | 1413 |
| 451 | Ga0207648_10000302 | 3300026089 | Bacteria | 53741 |
| 452 | Ga0207648_10003123 | 3300026089 | Bacteria | 17493 |
| 453 | Ga0207648_10031437 | 3300026089 | Bacteria | 4694 |
| 454 | Ga0207648_10184706 | 3300026089 | Bacteria | 1846 |
| 455 | Ga0207676_10000642 | 3300026095 | Bacteria | 28097 |
| 456 | Ga0207676_10055890 | 3300026095 | Bacteria | 3101 |
| 457 | Ga0207674_10001952 | 3300026116 | Bacteria | 26135 |
| 458 | Ga0207674_10033236 | 3300026116 | Bacteria | 5402 |
| 459 | Ga0207674_10565351 | 3300026116 | Bacteria | 1098 |
| 460 | Ga0207675_100000165 | 3300026118 | Bacteria | 58839 |
| 461 | Ga0207675_100002328 | 3300026118 | Bacteria | 18830 |
| 462 | Ga0207675_100157943 | 3300026118 | Bacteria | 2161 |
| 463 | Ga0207683_10000211 | 3300026121 | Bacteria | 50758 |
| 464 | Ga0207683_10022293 | 3300026121 | Bacteria | 5434 |
| 465 | Ga0207683_10037711 | 3300026121 | Bacteria | 4210 |
| 466 | Ga0207683_10066532 | 3300026121 | Bacteria | 3178 |
| 467 | Ga0207683_10585721 | 3300026121 | Bacteria | 1032 |
| 468 | Ga0207698_10000769 | 3300026142 | Bacteria | 18686 |
| 469 | Ga0207698_10061313 | 3300026142 | Bacteria | 2930 |
| 470 | Ga0207698_10324072 | 3300026142 | Bacteria | 1444 |
| 471 | Ga0207698_11243976 | 3300026142 | Bacteria | 759 |
| 472 | Ga0207428_10842035 | 3300027907 | Bacteria | 650 |
| 473 | Ga0268266_10001501 | 3300028379 | Bacteria | 27588 |
| 474 | Ga0268266_10042481 | 3300028379 | Bacteria | 3883 |
| 475 | Ga0268265_10000394 | 3300028380 | Bacteria | 46647 |
| 476 | Ga0268265_10057941 | 3300028380 | Bacteria | 2955 |
| 477 | Ga0268265_10473830 | 3300028380 | Bacteria | 1174 |
| 478 | Ga0268265_10658635 | 3300028380 | Bacteria | 1007 |
| 479 | Ga0268264_10000191 | 3300028381 | Bacteria | 127257 |
| 480 | Ga0268264_10000573 | 3300028381 | Bacteria | 44555 |
| 481 | Ga0268264_10088693 | 3300028381 | Bacteria | 2662 |
| 482 | Ga0268264_10108427 | 3300028381 | Bacteria | 2427 |
| 483 | Ga0268264_10247008 | 3300028381 | Bacteria | 1656 |
| 484 | Ga0268264_10457892 | 3300028381 | Bacteria | 1237 |
| 485 | Ga0265334_10003345 | 3300028573 | Bacteria | 7317 |
| 486 | Ga0307515_10239470 | 3300028794 | Bacteria | 1589 |
| 487 | Ga0316578_10157889 | 3300031728 | Bacteria | 1367 |
| 488 | Ga0307405_11616886 | 3300031731 | Bacteria | 572 |
| 489 | Ga0307413_10006621 | 3300031824 | Bacteria | 5311 |
| 490 | Ga0307413_10561387 | 3300031824 | Bacteria | 928 |
| 491 | Ga0307406_10436755 | 3300031901 | Bacteria | 1047 |
| 492 | Ga0307409_100552750 | 3300031995 | Bacteria | 1130 |
| 493 | Ga0307409_100841718 | 3300031995 | Bacteria | 928 |
| 494 | Ga0307416_100369602 | 3300032002 | Bacteria | 1460 |
| 495 | Ga0307416_100919229 | 3300032002 | Bacteria | 976 |
| 496 | Ga0373932_0028696 | 3300035112 | Bacteria | 1531 |
| 497 | Ga0373931_0042310 | 3300035691 | Bacteria | 2395 |
| 498 | Ga0373931_0049971 | 3300035691 | Bacteria | 2224 |
| 499 | Ga0316582_0387656 | 3300036647 | Bacteria | 962 |
| 500 | Ga0316584_0209445 | 3300036712 | Bacteria | 1435 |
| 501 | Ga0395900_0730761 | 3300037418 | Bacteria | 922 |
| 502 | Ga0395898_0131033 | 3300037466 | Bacteria | 2402 |
| 503 | Ga0395905_0069259 | 3300037471 | Bacteria | 3304 |
| 504 | Ga0395905_0562886 | 3300037471 | Bacteria | 1041 |
| 505 | Ga0436364_1106144 | 3300037853 | Bacteria | 1716 |
| 506 | Ga0395901_0719116 | 3300038443 | Bacteria | 994 |
| 507 | Ga0436365_0144265 | 3300039437 | Bacteria | 938 |
| 508 | Ga0436363_1179098 | 3300039450 | Bacteria | 4029 |
| 509 | Ga0439466_0056748 | 3300041411 | Bacteria | 1270 |
| 510 | Ga0439465_0008035 | 3300041413 | Bacteria | 3338 |
| 511 | Ga0451797_0847368 | 3300041453 | Bacteria | 602 |
| 512 | Ga0451800_1652997 | 3300041459 | Bacteria | 761 |
| 513 | Ga0451833_1468257 | 3300041491 | Bacteria | 811 |
| 514 | Ga0439448_0022702 | 3300042005 | Bacteria | 1953 |
| 515 | Ga0439449_0063452 | 3300042007 | Bacteria | 1363 |
| 516 | Ga0439455_0008314 | 3300042012 | Bacteria | 2220 |
| 517 | Ga0466969_0107871 | 3300044656 | Bacteria | 1305 |
| 518 | Ga0466972_0026587 | 3300044658 | Bacteria | 2868 |
| 519 | Ga0466972_0040075 | 3300044658 | Bacteria | 2283 |
| 520 | Ga0466972_0042134 | 3300044658 | Bacteria | 2221 |
| 521 | Ga0466965_0002372 | 3300044683 | Bacteria | 7980 |
| 522 | Ga0466965_0011035 | 3300044683 | Bacteria | 4225 |
| 523 | Ga0466961_0056390 | 3300044693 | Bacteria | 2503 |
| 524 | Ga0466961_0132942 | 3300044693 | Bacteria | 1559 |
| 525 | Ga0466963_0002485 | 3300044694 | Bacteria | 10309 |
| 526 | Ga0466963_0035011 | 3300044694 | Bacteria | 3270 |
| 527 | Ga0466963_0040258 | 3300044694 | Bacteria | 3063 |
| 528 | Ga0466963_0355428 | 3300044694 | Bacteria | 1032 |
| 529 | Ga0466963_0467742 | 3300044694 | Bacteria | 890 |
| 530 | Ga0466964_0025375 | 3300044706 | Bacteria | 2314 |
| 531 | Ga0466971_0081272 | 3300044719 | Bacteria | 1478 |
| 532 | Ga0466970_0077516 | 3300044765 | Bacteria | 1792 |
| 533 | Ga0466970_0088377 | 3300044765 | Bacteria | 1680 |
| 534 | Ga0466970_0121481 | 3300044765 | Bacteria | 1431 |
| 535 | Ga0466970_0168949 | 3300044765 | Bacteria | 1211 |
| 536 | Ga0466970_0413414 | 3300044765 | Bacteria | 771 |
| 537 | Ga0466957_0047977 | 3300044842 | Bacteria | 2595 |
| 538 | Ga0466957_0098253 | 3300044842 | Bacteria | 1842 |
| 539 | Ga0466960_0000043 | 3300044901 | Bacteria | 40805 |
| 540 | Ga0466960_0000469 | 3300044901 | Bacteria | 13834 |
| 541 | Ga0466959_0363772 | 3300045049 | Bacteria | 985 |
| 542 | Ga0466959_0801513 | 3300045049 | Bacteria | 630 |
| 543 | Ga0451576_0041703 | 3300045051 | Bacteria | 4851 |
| 544 | Ga0466958_0032613 | 3300045836 | Bacteria | 3100 |
| 545 | Ga0466958_0036071 | 3300045836 | Bacteria | 2958 |
| 546 | Ga0466958_0182795 | 3300045836 | Bacteria | 1331 |
| 547 | Ga0466958_0200853 | 3300045836 | Bacteria | 1269 |
| 548 | Ga0466967_0038592 | 3300045976 | Bacteria | 4097 |
| 549 | Ga0466967_0045146 | 3300045976 | Bacteria | 3827 |
| 550 | Ga0466967_0051054 | 3300045976 | Bacteria | 3623 |
| 551 | Ga0466967_0081226 | 3300045976 | Bacteria | 2928 |
| 552 | Ga0466967_0302113 | 3300045976 | Bacteria | 1540 |
| 553 | Ga0466967_1234555 | 3300045976 | Bacteria | 745 |
| 554 | Ga0495627_013326 | 3300046453 | Bacteria | 2894 |
| 555 | Ga0495627_124216 | 3300046453 | Bacteria | 728 |
| 556 | Ga0495592_0418933 | 3300046454 | Bacteria | 845 |
| 557 | Ga0495603_0003497 | 3300046455 | Bacteria | 9346 |
| 558 | Ga0495603_0241715 | 3300046455 | Bacteria | 1040 |
| 559 | Ga0495629_0132414 | 3300046459 | Bacteria | 1737 |
| 560 | Ga0495638_0464910 | 3300046460 | Bacteria | 643 |
| 561 | Ga0495651_0002255 | 3300046462 | Bacteria | 14897 |
| 562 | Ga0495651_0074671 | 3300046462 | Bacteria | 2572 |
| 563 | Ga0495651_0549699 | 3300046462 | Bacteria | 734 |
| 564 | Ga0495662_0009605 | 3300046476 | Bacteria | 4743 |
| 565 | Ga0495664_0135702 | 3300046477 | Bacteria | 1491 |
| 566 | Ga0495585_0105796 | 3300046492 | Bacteria | 1500 |
| 567 | Ga0495594_0011704 | 3300046499 | Bacteria | 4562 |
| 568 | Ga0495594_0079672 | 3300046499 | Bacteria | 1829 |
| 569 | Ga0495608_0168712 | 3300046511 | Bacteria | 1389 |
| 570 | Ga0495628_0010353 | 3300046516 | Bacteria | 7929 |
| 571 | Ga0495648_0001220 | 3300046524 | Bacteria | 25766 |
| 572 | Ga0495666_0179583 | 3300046526 | Bacteria | 978 |
| 573 | Ga0495642_0151503 | 3300046528 | Bacteria | 1003 |
| 574 | Ga0495652_0010947 | 3300046529 | Bacteria | 8216 |
| 575 | Ga0495645_0054714 | 3300046543 | Bacteria | 2899 |
| 576 | Ga0495622_0065637 | 3300046557 | Bacteria | 1678 |
| 577 | Ga0495611_0045992 | 3300046648 | Bacteria | 1956 |
| 578 | Ga0495625_0102107 | 3300046660 | Bacteria | 1969 |
| 579 | Ga0495635_0088184 | 3300046663 | Bacteria | 2123 |
| 580 | Ga0495635_0167194 | 3300046663 | Bacteria | 1496 |
| 581 | Ga0495588_0038616 | 3300046674 | Bacteria | 2429 |
| 582 | Ga0495657_0002058 | 3300046675 | Bacteria | 17117 |
| 583 | Ga0495623_0274297 | 3300046679 | Bacteria | 940 |
| 584 | Ga0495646_0299653 | 3300046680 | Bacteria | 851 |
| 585 | Ga0495613_0004186 | 3300046689 | Bacteria | 10795 |
| 586 | Ga0495613_0535905 | 3300046689 | Bacteria | 785 |
| 587 | Ga0495581_0025921 | 3300047315 | Bacteria | 3400 |
| 588 | Ga0495604_0255731 | 3300047317 | Bacteria | 1192 |
| 589 | Ga0495636_0011349 | 3300047318 | Bacteria | 3526 |
| 590 | Ga0495672_0018774 | 3300047320 | Bacteria | 4579 |
| 591 | Ga0495685_095976 | 3300047447 | Bacteria | 980 |
| 592 | Ga0495673_0078536 | 3300047469 | Bacteria | 1371 |
| 593 | Ga0495602_0880768 | 3300048088 | Bacteria | 597 |
| 594 | Ga0495626_0129437 | 3300048091 | Bacteria | 1079 |
| 595 | Ga0496100_0026032 | 3300048903 | Bacteria | 3583 |
| 596 | Ga0496100_0028049 | 3300048903 | Bacteria | 3469 |
| 597 | Ga0496100_0042550 | 3300048903 | Bacteria | 2901 |
| 598 | Ga0496100_0069186 | 3300048903 | Bacteria | 2350 |
| 599 | Ga0496100_0121897 | 3300048903 | Bacteria | 1825 |
| 600 | Ga0496101_0000011 | 3300048904 | Bacteria | 272153 |
| 601 | Ga0496101_0195083 | 3300048904 | Bacteria | 1564 |
| 602 | Ga0496101_0230720 | 3300048904 | Bacteria | 1439 |
| 603 | Ga0496101_0442524 | 3300048904 | Bacteria | 1025 |
| 604 | Ga0496102_0000012 | 3300048905 | Bacteria | 315470 |
| 605 | Ga0496102_0001137 | 3300048905 | Bacteria | 24377 |
| 606 | Ga0496102_0018021 | 3300048905 | Bacteria | 6196 |
| 607 | Ga0496102_0061518 | 3300048905 | Bacteria | 3436 |
| 608 | Ga0496102_0082523 | 3300048905 | Bacteria | 2964 |
| 609 | Ga0496102_0250045 | 3300048905 | Bacteria | 1671 |
| 610 | Ga0496103_0000005 | 3300048906 | Bacteria | 505416 |
| 611 | Ga0496103_0037464 | 3300048906 | Bacteria | 2972 |
| 612 | Ga0496103_0122412 | 3300048906 | Bacteria | 1658 |
| 613 | Ga0496103_0128696 | 3300048906 | Bacteria | 1616 |
| 614 | Ga0496104_0234603 | 3300048907 | Bacteria | 1746 |
| 615 | Ga0496104_0502396 | 3300048907 | Bacteria | 1124 |
| 616 | Ga0496104_1405697 | 3300048907 | Bacteria | 601 |
| 617 | Ga0496105_0349170 | 3300048908 | Bacteria | 1182 |
| 618 | Ga0496105_0566537 | 3300048908 | Bacteria | 885 |
| 619 | Ga0496105_0587424 | 3300048908 | Bacteria | 866 |
| 620 | Ga0496106_0001297 | 3300048909 | Bacteria | 18784 |
| 621 | Ga0496106_0016284 | 3300048909 | Bacteria | 5502 |
| 622 | Ga0496106_0118266 | 3300048909 | Bacteria | 2069 |
| 623 | Ga0496106_0148203 | 3300048909 | Bacteria | 1850 |
| 624 | Ga0496106_0180349 | 3300048909 | Bacteria | 1676 |
| 625 | Ga0496106_0210448 | 3300048909 | Bacteria | 1549 |
| 626 | Ga0496106_0710788 | 3300048909 | Bacteria | 800 |
| 627 | Ga0496107_0008820 | 3300048910 | Bacteria | 6987 |
| 628 | Ga0496107_0082594 | 3300048910 | Bacteria | 2343 |
| 629 | Ga0496107_0253131 | 3300048910 | Bacteria | 1310 |
| 630 | Ga0496108_0006199 | 3300048911 | Bacteria | 9683 |
| 631 | Ga0496108_0013662 | 3300048911 | Bacteria | 6628 |
| 632 | Ga0496108_0045273 | 3300048911 | Bacteria | 3675 |
| 633 | Ga0496108_0217179 | 3300048911 | Bacteria | 1660 |
| 634 | Ga0496108_0362213 | 3300048911 | Bacteria | 1266 |
| 635 | Ga0496108_0672651 | 3300048911 | Bacteria | 899 |
| 636 | Ga0496108_0709998 | 3300048911 | Bacteria | 872 |
| 637 | Ga0496109_0002194 | 3300048912 | Bacteria | 16200 |
| 638 | Ga0496109_0013758 | 3300048912 | Bacteria | 7030 |
| 639 | Ga0496109_0031454 | 3300048912 | Bacteria | 4762 |
| 640 | Ga0496109_0080789 | 3300048912 | Bacteria | 2996 |
| 641 | Ga0496109_0223772 | 3300048912 | Bacteria | 1770 |
| 642 | Ga0496110_0033275 | 3300048913 | Bacteria | 4458 |
| 643 | Ga0496110_0508563 | 3300048913 | Bacteria | 1096 |
| 644 | Ga0496110_0682966 | 3300048913 | Bacteria | 928 |
| 645 | Ga0496111_0062566 | 3300048914 | Bacteria | 2699 |
| 646 | Ga0496111_0193736 | 3300048914 | Bacteria | 1511 |
| 647 | Ga0496111_0251545 | 3300048914 | Bacteria | 1312 |
| 648 | Ga0496112_0017179 | 3300048915 | Bacteria | 6794 |
| 649 | Ga0496113_0040483 | 3300048916 | Bacteria | 3434 |
| 650 | Ga0496113_0100314 | 3300048916 | Bacteria | 2243 |
| 651 | Ga0496113_0602811 | 3300048916 | Bacteria | 879 |
| 652 | Ga0496114_0067272 | 3300048917 | Bacteria | 3005 |
| 653 | Ga0496114_0071163 | 3300048917 | Bacteria | 2922 |
| 654 | Ga0496114_0635220 | 3300048917 | Bacteria | 940 |
| 655 | Ga0496115_0113667 | 3300048918 | Bacteria | 2225 |
| 656 | Ga0496115_0142055 | 3300048918 | Bacteria | 1981 |
| 657 | Ga0496115_0263418 | 3300048918 | Bacteria | 1417 |
| 658 | Ga0496116_0000050 | 3300048919 | Bacteria | 311670 |
| 659 | Ga0496117_0000042 | 3300048920 | Bacteria | 315470 |
| 660 | Ga0496118_0000037 | 3300048921 | Bacteria | 315470 |
| 661 | Ga0496118_0154389 | 3300048921 | Bacteria | 1431 |
| 662 | Ga0496119_0000486 | 3300048922 | Bacteria | 54401 |
| 663 | Ga0496120_0000121 | 3300048923 | Bacteria | 131612 |
| 664 | Ga0496121_0001091 | 3300048924 | Bacteria | 47947 |
| 665 | Ga0496121_0023565 | 3300048924 | Bacteria | 5922 |
| 666 | Ga0496121_0267175 | 3300048924 | Bacteria | 1178 |
| 667 | Ga0496122_0000575 | 3300048925 | Bacteria | 75355 |
| 668 | Ga0496123_0000333 | 3300048926 | Bacteria | 89644 |
| 669 | Ga0496124_0002355 | 3300048927 | Bacteria | 24936 |
| 670 | Ga0496124_0342524 | 3300048927 | Bacteria | 1061 |
| 671 | Ga0496126_0000236 | 3300048929 | Bacteria | 119350 |
| 672 | Ga0496126_0013491 | 3300048929 | Bacteria | 8304 |
| 673 | Ga0496126_0024488 | 3300048929 | Bacteria | 5828 |
| 674 | Ga0496126_0073036 | 3300048929 | Bacteria | 3050 |
| 675 | Ga0496126_0079850 | 3300048929 | Bacteria | 2895 |
| 676 | Ga0501031_0098159 | 3300049568 | Bacteria | 1911 |
| 677 | Ga0501031_0320427 | 3300049568 | Bacteria | 1004 |
| 678 | Ga0501032_0031446 | 3300049569 | Bacteria | 3639 |
| 679 | Ga0501032_0038218 | 3300049569 | Bacteria | 3270 |
| 680 | Ga0501032_0254095 | 3300049569 | Bacteria | 1140 |
| 681 | Ga0501032_0402800 | 3300049569 | Bacteria | 879 |
| 682 | Ga0501034_0013772 | 3300049571 | Bacteria | 8320 |
| 683 | Ga0501034_0030998 | 3300049571 | Bacteria | 5434 |
| 684 | Ga0501034_0378456 | 3300049571 | Bacteria | 1341 |
| 685 | Ga0501036_0052771 | 3300049572 | Bacteria | 3443 |
| 686 | Ga0501036_0170547 | 3300049572 | Bacteria | 1833 |
| 687 | Ga0501036_0545845 | 3300049572 | Bacteria | 963 |
| 688 | Ga0501037_0005801 | 3300049573 | Bacteria | 9012 |
| 689 | Ga0501037_0040445 | 3300049573 | Bacteria | 3431 |
| 690 | Ga0501037_0172794 | 3300049573 | Bacteria | 1535 |
| 691 | Ga0501038_0010056 | 3300049574 | Bacteria | 8663 |
| 692 | Ga0501038_0026723 | 3300049574 | Bacteria | 5139 |
| 693 | Ga0501038_0040632 | 3300049574 | Bacteria | 4059 |
| 694 | Ga0501038_0814077 | 3300049574 | Bacteria | 693 |
| 695 | Ga0501039_0000835 | 3300049575 | Bacteria | 22275 |
| 696 | Ga0501039_0021000 | 3300049575 | Bacteria | 5008 |
| 697 | Ga0501039_0024627 | 3300049575 | Bacteria | 4623 |
| 698 | Ga0501039_0122273 | 3300049575 | Bacteria | 2040 |
| 699 | Ga0501039_0515647 | 3300049575 | Bacteria | 939 |
| 700 | Ga0501040_0003702 | 3300049576 | Bacteria | 9907 |
| 701 | Ga0501041_0010911 | 3300049577 | Bacteria | 5362 |
| 702 | Ga0501041_0090643 | 3300049577 | Bacteria | 1887 |
| 703 | Ga0501041_0755805 | 3300049577 | Bacteria | 623 |
| 704 | Ga0501042_0009588 | 3300049578 | Bacteria | 6460 |
| 705 | Ga0501042_0220267 | 3300049578 | Bacteria | 1369 |
| 706 | Ga0501042_0602855 | 3300049578 | Bacteria | 798 |
| 707 | Ga0501043_0016855 | 3300049579 | Bacteria | 5726 |
| 708 | Ga0501043_0142364 | 3300049579 | Bacteria | 1877 |
| 709 | Ga0501043_0247622 | 3300049579 | Bacteria | 1373 |
| 710 | Ga0501043_0391717 | 3300049579 | Bacteria | 1050 |
| 711 | Ga0501043_0435751 | 3300049579 | Bacteria | 987 |
| 712 | Ga0501046_0003883 | 3300049580 | Bacteria | 13668 |
| 713 | Ga0501046_0076146 | 3300049580 | Bacteria | 2600 |
| 714 | Ga0501047_0070038 | 3300049581 | Bacteria | 3376 |
| 715 | Ga0501048_0004420 | 3300049582 | Bacteria | 10704 |
| 716 | Ga0501048_0012968 | 3300049582 | Bacteria | 6190 |
| 717 | Ga0501048_0090672 | 3300049582 | Bacteria | 2156 |
| 718 | Ga0501067_0214213 | 3300049583 | Bacteria | 1073 |
| 719 | Ga0501068_0421418 | 3300049584 | Bacteria | 862 |
| 720 | Ga0501070_0008673 | 3300049586 | Bacteria | 8595 |
| 721 | Ga0501070_0047959 | 3300049586 | Bacteria | 3549 |
| 722 | Ga0501070_0104510 | 3300049586 | Bacteria | 2342 |
| 723 | Ga0501070_0170676 | 3300049586 | Bacteria | 1792 |
| 724 | Ga0501070_0640986 | 3300049586 | Bacteria | 844 |
| 725 | Ga0501071_0051099 | 3300049587 | Bacteria | 2978 |
| 726 | Ga0501071_0052358 | 3300049587 | Bacteria | 2943 |
| 727 | Ga0501072_0004450 | 3300049588 | Bacteria | 10644 |
| 728 | Ga0501072_0165450 | 3300049588 | Bacteria | 1764 |
| 729 | Ga0501072_1146013 | 3300049588 | Bacteria | 605 |
| 730 | Ga0501073_0016582 | 3300049589 | Bacteria | 5338 |
| 731 | Ga0501073_0113746 | 3300049589 | Bacteria | 1877 |
| 732 | Ga0501073_0130731 | 3300049589 | Bacteria | 1740 |
| 733 | Ga0501074_0012053 | 3300049590 | Bacteria | 6281 |
| 734 | Ga0501074_0148269 | 3300049590 | Bacteria | 1678 |
| 735 | Ga0501075_0002801 | 3300049591 | Bacteria | 11684 |
| 736 | Ga0501075_0267043 | 3300049591 | Bacteria | 1304 |
| 737 | Ga0501075_0547385 | 3300049591 | Bacteria | 883 |
| 738 | Ga0501076_0010097 | 3300049592 | Bacteria | 6990 |
| 739 | Ga0501076_0187038 | 3300049592 | Bacteria | 1689 |
| 740 | Ga0501077_0019963 | 3300049593 | Bacteria | 4240 |
| 741 | Ga0501077_0025068 | 3300049593 | Bacteria | 3788 |
| 742 | Ga0501077_0366626 | 3300049593 | Bacteria | 920 |
| 743 | Ga0501079_0043461 | 3300049741 | Bacteria | 3468 |
| 744 | Ga0501079_0308180 | 3300049741 | Bacteria | 1239 |
| 745 | Ga0501079_0325869 | 3300049741 | Bacteria | 1203 |
| 746 | Ga0501079_0466005 | 3300049741 | Bacteria | 992 |
| 747 | Ga0501080_0111948 | 3300049742 | Bacteria | 2530 |
| 748 | Ga0501080_0148074 | 3300049742 | Bacteria | 2171 |
| 749 | Ga0501080_0180353 | 3300049742 | Bacteria | 1944 |
| 750 | Ga0501080_1122028 | 3300049742 | Bacteria | 678 |
| 751 | Ga0501081_0001208 | 3300049743 | Bacteria | 15698 |
| 752 | Ga0501081_0093130 | 3300049743 | Bacteria | 2121 |
| 753 | Ga0501083_0143535 | 3300049744 | Bacteria | 1563 |
| 754 | Ga0501035_0176459 | 3300049822 | Bacteria | 1843 |
| 755 | Ga0501035_0351537 | 3300049822 | Bacteria | 1233 |
| 756 | Ga0501044_0005313 | 3300049823 | Bacteria | 14326 |
| 757 | Ga0501044_0035058 | 3300049823 | Bacteria | 5256 |
| 758 | Ga0501044_0077022 | 3300049823 | Bacteria | 3383 |
| 759 | Ga0501044_0209272 | 3300049823 | Bacteria | 1905 |
| 760 | Ga0501045_0002030 | 3300049824 | Bacteria | 13686 |
| 761 | Ga0501045_0008210 | 3300049824 | Bacteria | 7272 |
| 762 | Ga0501045_0068393 | 3300049824 | Bacteria | 2609 |
| 763 | Ga0501045_0704738 | 3300049824 | Bacteria | 745 |
| 764 | Ga0501045_0717420 | 3300049824 | Bacteria | 737 |
| 765 | nmdc:mga03683_105759_c1 | 3300050489 | Bacteria | 1240 |
| 766 | nmdc:mga03n38_262145_c1 | 3300050490 | Bacteria | 916 |
| 767 | nmdc:mga03n38_36616_c1 | 3300050490 | Bacteria | 2111 |
| 768 | nmdc:mga00v17_121920_c1 | 3300050491 | Bacteria | 1660 |
| 769 | nmdc:mga00v17_13678_c1 | 3300050491 | Bacteria | 4511 |
| 770 | nmdc:mga00v17_15716_c1 | 3300050491 | Bacteria | 4253 |
| 771 | nmdc:mga00v17_414792_c1 | 3300050491 | Bacteria | 875 |
| 772 | nmdc:mga00v17_487595_c1 | 3300050491 | Bacteria | 799 |
| 773 | nmdc:mga0yw44_73649_c1 | 3300050492 | Bacteria | 2125 |
| 774 | nmdc:mga06z11_147040_c1 | 3300050494 | Bacteria | 1336 |
| 775 | nmdc:mga06z11_227417_c1 | 3300050494 | Bacteria | 1092 |
| 776 | nmdc:mga04h51_223715_c1 | 3300050495 | Bacteria | 747 |
| 777 | nmdc:mga07m45_250553_c1 | 3300050496 | Bacteria | 1030 |
| 778 | nmdc:mga07m45_337611_c1 | 3300050496 | Bacteria | 876 |
| 779 | nmdc:mga07m45_9571_c1 | 3300050496 | Bacteria | 5033 |
| 780 | nmdc:mga05p37_91320_c1 | 3300050507 | Bacteria | 3752 |
| 781 | nmdc:mga08y16_351843_c2 | 3300050511 | Bacteria | 958 |
| 782 | nmdc:mga08y16_727562_c1 | 3300050511 | Bacteria | 990 |
| 783 | nmdc:mga0rr50_473858_c1 | 3300050513 | Bacteria | 1063 |
| 784 | nmdc:mga0sz30_130967_c1 | 3300050516 | Bacteria | 1105 |
| 785 | nmdc:mga0sz30_157965_c1 | 3300050516 | Bacteria | 1004 |
| 786 | nmdc:mga0sz30_29044_c1 | 3300050516 | Bacteria | 2277 |
| 787 | nmdc:mga0sz30_37734_c1 | 3300050516 | Bacteria | 2023 |
| 788 | Ga0495612_0130076 | 3300053078 | Bacteria | 1087 |
| 789 | Ga0500635_0002203 | 3300053080 | Bacteria | 4794 |
| 790 | Ga0500635_0033503 | 3300053080 | Bacteria | 1676 |
| 791 | Ga0495655_0051788 | 3300053083 | Bacteria | 1089 |
| 792 | Ga0495619_0022860 | 3300053085 | Bacteria | 4004 |
| 793 | Ga0500643_008952 | 3300053087 | Bacteria | 3874 |
| 794 | Ga0500595_053019 | 3300053119 | Bacteria | 1250 |
| 795 | Ga0500652_001304 | 3300053131 | Bacteria | 7903 |
| 796 | Ga0500573_0066479 | 3300053140 | Bacteria | 2061 |
| 797 | Ga0500588_0109841 | 3300053146 | Bacteria | 961 |
| 798 | Ga0500627_0004080 | 3300053158 | Bacteria | 4628 |
| 799 | Ga0500645_000188 | 3300053730 | Bacteria | 48061 |
| 800 | Ga0501084_0036510 | 3300054114 | Bacteria | 4104 |
| 801 | Ga0501084_0062212 | 3300054114 | Bacteria | 3124 |
| 802 | Ga0501082_0027018 | 3300060353 | Bacteria | 4945 |
| 803 | Ga0501082_0060248 | 3300060353 | Bacteria | 3269 |
| 804 | Ga0530510_0003870 | 3300061734 | Bacteria | 10318 |
| 805 | Ga0530510_0005493 | 3300061734 | Bacteria | 8779 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005840 | Ga0068870_10400233 | Ga0068870_104002332 | 154 |
| 2 | 3300006173 | Ga0070716_100008515 | Ga0070716_1000085156 | 154 |
| 3 | 3300041411 | Ga0439466_0056748 | Ga0439466_0056748_787_1251 | 154 |
| 4 | 3300005459 | Ga0068867_100199365 | Ga0068867_1001993652 | 163 |
| 5 | 3300005547 | Ga0070693_100072408 | Ga0070693_1000724082 | 163 |
| 6 | 3300005616 | Ga0068852_101271339 | Ga0068852_1012713392 | 163 |
| 7 | 3300006881 | Ga0068865_100529637 | Ga0068865_1005296372 | 163 |
| 8 | 3300009098 | Ga0105245_10562407 | Ga0105245_105624072 | 163 |
| 9 | 3300009174 | Ga0105241_10139258 | Ga0105241_101392582 | 163 |
| 10 | 3300009553 | Ga0105249_10079289 | Ga0105249_100792894 | 163 |
| 11 | 3300011119 | Ga0105246_10215227 | Ga0105246_102152272 | 163 |
| 12 | 3300013296 | Ga0157374_10004568 | Ga0157374_100045687 | 163 |
| 13 | 3300013308 | Ga0157375_10359424 | Ga0157375_103594242 | 163 |
| 14 | 3300025918 | Ga0207662_10180570 | Ga0207662_101805702 | 163 |
| 15 | 3300025927 | Ga0207687_10161602 | Ga0207687_101616022 | 163 |
| 16 | 3300025942 | Ga0207689_10145791 | Ga0207689_101457912 | 163 |
| 17 | 3300026035 | Ga0207703_10043847 | Ga0207703_100438472 | 163 |
| 18 | 3300026095 | Ga0207676_10055890 | Ga0207676_100558904 | 163 |
| 19 | 3300026142 | Ga0207698_10324072 | Ga0207698_103240722 | 163 |
| 20 | 3300028380 | Ga0268265_10473830 | Ga0268265_104738302 | 163 |
| 21 | 3300048903 | Ga0496100_0069186 | Ga0496100_0069186_1512_2003 | 163 |
| 22 | 3300048911 | Ga0496108_0006199 | Ga0496108_0006199_7235_7726 | 163 |
| 23 | 3300048912 | Ga0496109_0031454 | Ga0496109_0031454_2661_3152 | 163 |
| 24 | 3300048913 | Ga0496110_0033275 | Ga0496110_0033275_110_601 | 163 |
| 25 | 3300048916 | Ga0496113_0100314 | Ga0496113_0100314_1495_1986 | 163 |
| 26 | 3300049586 | Ga0501070_0640986 | Ga0501070_0640986_250_759 | 163 |
| 27 | iso_pu_bacteria | 2643221679 | 2644444457 | 164 |
| 28 | iso_pu_bacteria | 2643221687 | 2644485590 | 165 |
| 29 | iso_pu_bacteria | 2738541274 | 2738706981 | 165 |
| 30 | iso_pu_bacteria | 2738543028 | 2739333685 | 165 |
| 31 | iso_pu_bacteria | 2902799365 | 2902800535 | 165 |
| 32 | 3300045976 | Ga0466967_1234555 | Ga0466967_1234555_198_698 | 166 |
| 33 | 3300005844 | Ga0068862_100144824 | Ga0068862_1001448243 | 167 |
| 34 | 3300006048 | Ga0075363_100451152 | Ga0075363_1004511521 | 167 |
| 35 | 3300006186 | Ga0075369_10296041 | Ga0075369_102960412 | 167 |
| 36 | 3300025986 | Ga0207658_10267197 | Ga0207658_102671972 | 167 |
| 37 | 3300044658 | Ga0466972_0026587 | Ga0466972_0026587_396_899 | 167 |
| 38 | 3300044683 | Ga0466965_0011035 | Ga0466965_0011035_956_1459 | 167 |
| 39 | 3300044765 | Ga0466970_0121481 | Ga0466970_0121481_552_1055 | 167 |
| 40 | 3300044901 | Ga0466960_0000043 | Ga0466960_0000043_5272_5775 | 167 |
| 41 | 3300045976 | Ga0466967_0081226 | Ga0466967_0081226_135_638 | 167 |
| 42 | 3300050490 | nmdc:mga03n38_262145_c1 | nmdc:mga03n38_262145_c1_210_713 | 167 |
| 43 | 3300006881 | Ga0068865_100065613 | Ga0068865_1000656133 | 168 |
| 44 | iso_pu_bacteria | 2643221613 | 2644084569 | 168 |
| 45 | iso_pu_bacteria | 2643221721 | 2644667190 | 168 |
| 46 | iso_pu_bacteria | 2935890801 | 2935891204 | 168 |
| 47 | iso_pu_bacteria | 8033684223 | 8033688680 | 168 |
| 48 | iso_pu_bacteria | 8048406513 | 8048414105 | 168 |
| 49 | 3300003320 | rootH2_10195207 | rootH2_101952074 | 169 |
| 50 | 3300005337 | Ga0070682_101114089 | Ga0070682_1011140891 | 169 |
| 51 | 3300005347 | Ga0070668_100203259 | Ga0070668_1002032592 | 169 |
| 52 | 3300005356 | Ga0070674_100147910 | Ga0070674_1001479102 | 169 |
| 53 | 3300005434 | Ga0070709_10376036 | Ga0070709_103760362 | 169 |
| 54 | 3300005437 | Ga0070710_10094810 | Ga0070710_100948102 | 169 |
| 55 | 3300005440 | Ga0070705_100366641 | Ga0070705_1003666412 | 169 |
| 56 | 3300005456 | Ga0070678_100226417 | Ga0070678_1002264172 | 169 |
| 57 | 3300005548 | Ga0070665_100489595 | Ga0070665_1004895952 | 169 |
| 58 | 3300005616 | Ga0068852_100805061 | Ga0068852_1008050612 | 169 |
| 59 | 3300005718 | Ga0068866_10040009 | Ga0068866_100400093 | 169 |
| 60 | 3300005718 | Ga0068866_10777659 | Ga0068866_107776591 | 169 |
| 61 | 3300006038 | Ga0075365_10084118 | Ga0075365_100841182 | 169 |
| 62 | 3300006048 | Ga0075363_100015596 | Ga0075363_1000155964 | 169 |
| 63 | 3300006051 | Ga0075364_10028064 | Ga0075364_100280644 | 169 |
| 64 | 3300006173 | Ga0070716_100062805 | Ga0070716_1000628052 | 169 |
| 65 | 3300006175 | Ga0070712_100219196 | Ga0070712_1002191962 | 169 |
| 66 | 3300006178 | Ga0075367_10023412 | Ga0075367_100234122 | 169 |
| 67 | 3300006186 | Ga0075369_10015734 | Ga0075369_100157342 | 169 |
| 68 | 3300006186 | Ga0075369_10037824 | Ga0075369_100378242 | 169 |
| 69 | 3300006186 | Ga0075369_10085246 | Ga0075369_100852462 | 169 |
| 70 | 3300006186 | Ga0075369_10172536 | Ga0075369_101725362 | 169 |
| 71 | 3300006186 | Ga0075369_10174420 | Ga0075369_101744202 | 169 |
| 72 | 3300006353 | Ga0075370_10355257 | Ga0075370_103552571 | 169 |
| 73 | 3300009148 | Ga0105243_10159333 | Ga0105243_101593332 | 169 |
| 74 | 3300009174 | Ga0105241_10201326 | Ga0105241_102013262 | 169 |
| 75 | 3300009545 | Ga0105237_10002051 | Ga0105237_100020517 | 169 |
| 76 | 3300009545 | Ga0105237_10300729 | Ga0105237_103007292 | 169 |
| 77 | 3300009551 | Ga0105238_10442471 | Ga0105238_104424712 | 169 |
| 78 | 3300009553 | Ga0105249_11368103 | Ga0105249_113681032 | 169 |
| 79 | 3300010375 | Ga0105239_10003039 | Ga0105239_1000303914 | 169 |
| 80 | 3300010375 | Ga0105239_10217076 | Ga0105239_102170762 | 169 |
| 81 | 3300013297 | Ga0157378_10042343 | Ga0157378_100423432 | 169 |
| 82 | 3300013306 | Ga0163162_10840999 | Ga0163162_108409991 | 169 |
| 83 | 3300013308 | Ga0157375_10299855 | Ga0157375_102998552 | 169 |
| 84 | 3300014326 | Ga0157380_10266495 | Ga0157380_102664952 | 169 |
| 85 | 3300014968 | Ga0157379_10272539 | Ga0157379_102725392 | 169 |
| 86 | 3300014969 | Ga0157376_10340628 | Ga0157376_103406282 | 169 |
| 87 | 3300025898 | Ga0207692_10016015 | Ga0207692_100160153 | 169 |
| 88 | 3300025898 | Ga0207692_10051617 | Ga0207692_100516172 | 169 |
| 89 | 3300025899 | Ga0207642_10010405 | Ga0207642_100104053 | 169 |
| 90 | 3300025913 | Ga0207695_10350216 | Ga0207695_103502162 | 169 |
| 91 | 3300025914 | Ga0207671_10004398 | Ga0207671_1000439810 | 169 |
| 92 | 3300025915 | Ga0207693_10350892 | Ga0207693_103508922 | 169 |
| 93 | 3300025932 | Ga0207690_10328697 | Ga0207690_103286972 | 169 |
| 94 | 3300025933 | Ga0207706_10055761 | Ga0207706_100557613 | 169 |
| 95 | 3300025933 | Ga0207706_10136331 | Ga0207706_101363312 | 169 |
| 96 | 3300025939 | Ga0207665_10061042 | Ga0207665_100610423 | 169 |
| 97 | 3300025941 | Ga0207711_10200480 | Ga0207711_102004802 | 169 |
| 98 | 3300025972 | Ga0207668_10052992 | Ga0207668_100529921 | 169 |
| 99 | 3300025972 | Ga0207668_10278841 | Ga0207668_102788412 | 169 |
| 100 | 3300025981 | Ga0207640_10033664 | Ga0207640_100336645 | 169 |
| 101 | 3300025986 | Ga0207658_10096480 | Ga0207658_100964802 | 169 |
| 102 | 3300026035 | Ga0207703_10076887 | Ga0207703_100768873 | 169 |
| 103 | 3300026067 | Ga0207678_10107147 | Ga0207678_101071473 | 169 |
| 104 | 3300026089 | Ga0207648_10031437 | Ga0207648_100314372 | 169 |
| 105 | 3300026089 | Ga0207648_10184706 | Ga0207648_101847062 | 169 |
| 106 | 3300026116 | Ga0207674_10565351 | Ga0207674_105653512 | 169 |
| 107 | 3300028381 | Ga0268264_10457892 | Ga0268264_104578922 | 169 |
| 108 | 3300031728 | Ga0316578_10157889 | Ga0316578_101578892 | 169 |
| 109 | 3300031731 | Ga0307405_11616886 | Ga0307405_116168861 | 169 |
| 110 | 3300036647 | Ga0316582_0387656 | Ga0316582_0387656_239_748 | 169 |
| 111 | 3300036712 | Ga0316584_0209445 | Ga0316584_0209445_655_1164 | 169 |
| 112 | 3300037418 | Ga0395900_0730761 | Ga0395900_0730761_284_793 | 169 |
| 113 | 3300037471 | Ga0395905_0069259 | Ga0395905_0069259_1646_2155 | 169 |
| 114 | 3300039437 | Ga0436365_0144265 | Ga0436365_0144265_54_563 | 169 |
| 115 | 3300044658 | Ga0466972_0042134 | Ga0466972_0042134_210_719 | 169 |
| 116 | 3300046460 | Ga0495638_0464910 | Ga0495638_0464910_61_570 | 169 |
| 117 | 3300046524 | Ga0495648_0001220 | Ga0495648_0001220_22269_22778 | 169 |
| 118 | 3300046528 | Ga0495642_0151503 | Ga0495642_0151503_203_712 | 169 |
| 119 | 3300046648 | Ga0495611_0045992 | Ga0495611_0045992_878_1387 | 169 |
| 120 | 3300046663 | Ga0495635_0167194 | Ga0495635_0167194_922_1431 | 169 |
| 121 | 3300047320 | Ga0495672_0018774 | Ga0495672_0018774_2719_3228 | 169 |
| 122 | 3300047469 | Ga0495673_0078536 | Ga0495673_0078536_70_579 | 169 |
| 123 | 3300048091 | Ga0495626_0129437 | Ga0495626_0129437_113_622 | 169 |
| 124 | 3300048904 | Ga0496101_0000011 | Ga0496101_0000011_138569_139078 | 169 |
| 125 | 3300048904 | Ga0496101_0230720 | Ga0496101_0230720_148_657 | 169 |
| 126 | 3300048904 | Ga0496101_0442524 | Ga0496101_0442524_458_967 | 169 |
| 127 | 3300048905 | Ga0496102_0000012 | Ga0496102_0000012_164417_164926 | 169 |
| 128 | 3300048905 | Ga0496102_0061518 | Ga0496102_0061518_2828_3337 | 169 |
| 129 | 3300048906 | Ga0496103_0000005 | Ga0496103_0000005_150537_151046 | 169 |
| 130 | 3300048907 | Ga0496104_1405697 | Ga0496104_1405697_72_581 | 169 |
| 131 | 3300048909 | Ga0496106_0016284 | Ga0496106_0016284_210_719 | 169 |
| 132 | 3300048909 | Ga0496106_0710788 | Ga0496106_0710788_136_645 | 169 |
| 133 | 3300048910 | Ga0496107_0008820 | Ga0496107_0008820_6252_6761 | 169 |
| 134 | 3300048919 | Ga0496116_0000050 | Ga0496116_0000050_160638_161147 | 169 |
| 135 | 3300048920 | Ga0496117_0000042 | Ga0496117_0000042_150545_151054 | 169 |
| 136 | 3300048921 | Ga0496118_0000037 | Ga0496118_0000037_150545_151054 | 169 |
| 137 | 3300048922 | Ga0496119_0000486 | Ga0496119_0000486_2799_3308 | 169 |
| 138 | 3300048923 | Ga0496120_0000121 | Ga0496120_0000121_128305_128814 | 169 |
| 139 | 3300048924 | Ga0496121_0001091 | Ga0496121_0001091_22839_23348 | 169 |
| 140 | 3300048924 | Ga0496121_0267175 | Ga0496121_0267175_367_876 | 169 |
| 141 | 3300048929 | Ga0496126_0000236 | Ga0496126_0000236_116071_116580 | 169 |
| 142 | 3300048929 | Ga0496126_0073036 | Ga0496126_0073036_170_679 | 169 |
| 143 | 3300048929 | Ga0496126_0079850 | Ga0496126_0079850_24_533 | 169 |
| 144 | 3300049569 | Ga0501032_0031446 | Ga0501032_0031446_1079_1588 | 169 |
| 145 | 3300049571 | Ga0501034_0030998 | Ga0501034_0030998_361_870 | 169 |
| 146 | 3300049573 | Ga0501037_0040445 | Ga0501037_0040445_1844_2353 | 169 |
| 147 | 3300049574 | Ga0501038_0040632 | Ga0501038_0040632_2598_3107 | 169 |
| 148 | 3300049575 | Ga0501039_0000835 | Ga0501039_0000835_2441_2950 | 169 |
| 149 | 3300049579 | Ga0501043_0016855 | Ga0501043_0016855_2620_3129 | 169 |
| 150 | 3300049583 | Ga0501067_0214213 | Ga0501067_0214213_273_782 | 169 |
| 151 | 3300049584 | Ga0501068_0421418 | Ga0501068_0421418_202_711 | 169 |
| 152 | 3300049586 | Ga0501070_0008673 | Ga0501070_0008673_2446_2955 | 169 |
| 153 | 3300049589 | Ga0501073_0016582 | Ga0501073_0016582_600_1109 | 169 |
| 154 | 3300049823 | Ga0501044_0005313 | Ga0501044_0005313_11198_11707 | 169 |
| 155 | 3300050489 | nmdc:mga03683_105759_c1 | nmdc:mga03683_105759_c1_202_711 | 169 |
| 156 | 3300050490 | nmdc:mga03n38_36616_c1 | nmdc:mga03n38_36616_c1_389_898 | 169 |
| 157 | 3300050491 | nmdc:mga00v17_15716_c1 | nmdc:mga00v17_15716_c1_3329_3838 | 169 |
| 158 | 3300050492 | nmdc:mga0yw44_73649_c1 | nmdc:mga0yw44_73649_c1_606_1115 | 169 |
| 159 | 3300050494 | nmdc:mga06z11_147040_c1 | nmdc:mga06z11_147040_c1_401_910 | 169 |
| 160 | 3300050496 | nmdc:mga07m45_337611_c1 | nmdc:mga07m45_337611_c1_23_532 | 169 |
| 161 | 3300050516 | nmdc:mga0sz30_130967_c1 | nmdc:mga0sz30_130967_c1_135_644 | 169 |
| 162 | 3300050516 | nmdc:mga0sz30_157965_c1 | nmdc:mga0sz30_157965_c1_223_732 | 169 |
| 163 | 3300050516 | nmdc:mga0sz30_29044_c1 | nmdc:mga0sz30_29044_c1_1354_1863 | 169 |
| 164 | 3300050516 | nmdc:mga0sz30_37734_c1 | nmdc:mga0sz30_37734_c1_1484_1993 | 169 |
| 165 | 3300053078 | Ga0495612_0130076 | Ga0495612_0130076_53_562 | 169 |
| 166 | 3300053080 | Ga0500635_0002203 | Ga0500635_0002203_2703_3212 | 169 |
| 167 | 3300053080 | Ga0500635_0033503 | Ga0500635_0033503_499_1008 | 169 |
| 168 | 3300053087 | Ga0500643_008952 | Ga0500643_008952_1843_2352 | 169 |
| 169 | 3300053119 | Ga0500595_053019 | Ga0500595_053019_248_757 | 169 |
| 170 | 3300053131 | Ga0500652_001304 | Ga0500652_001304_3302_3811 | 169 |
| 171 | 3300053146 | Ga0500588_0109841 | Ga0500588_0109841_352_861 | 169 |
| 172 | 3300053158 | Ga0500627_0004080 | Ga0500627_0004080_4078_4587 | 169 |
| 173 | 3300053730 | Ga0500645_000188 | Ga0500645_000188_12492_13001 | 169 |
| 174 | 3300001979 | JGI24740J21852_10019352 | JGI24740J21852_100193522 | 170 |
| 175 | 3300001989 | JGI24739J22299_10004941 | JGI24739J22299_100049415 | 170 |
| 176 | 3300001989 | JGI24739J22299_10020750 | JGI24739J22299_100207504 | 170 |
| 177 | 3300001990 | JGI24737J22298_10011988 | JGI24737J22298_100119882 | 170 |
| 178 | 3300002075 | JGI24738J21930_10024878 | JGI24738J21930_100248782 | 170 |
| 179 | 3300005334 | Ga0068869_100009208 | Ga0068869_1000092084 | 170 |
| 180 | 3300005343 | Ga0070687_100045218 | Ga0070687_1000452182 | 170 |
| 181 | 3300005347 | Ga0070668_100104767 | Ga0070668_1001047672 | 170 |
| 182 | 3300005356 | Ga0070674_100082636 | Ga0070674_1000826362 | 170 |
| 183 | 3300005364 | Ga0070673_100054937 | Ga0070673_1000549372 | 170 |
| 184 | 3300005435 | Ga0070714_100461014 | Ga0070714_1004610142 | 170 |
| 185 | 3300005435 | Ga0070714_100544810 | Ga0070714_1005448102 | 170 |
| 186 | 3300005436 | Ga0070713_100297184 | Ga0070713_1002971842 | 170 |
| 187 | 3300005437 | Ga0070710_10031660 | Ga0070710_100316602 | 170 |
| 188 | 3300005455 | Ga0070663_100067069 | Ga0070663_1000670692 | 170 |
| 189 | 3300005456 | Ga0070678_100255369 | Ga0070678_1002553692 | 170 |
| 190 | 3300005457 | Ga0070662_100178920 | Ga0070662_1001789202 | 170 |
| 191 | 3300005539 | Ga0068853_100088042 | Ga0068853_1000880423 | 170 |
| 192 | 3300005546 | Ga0070696_100190780 | Ga0070696_1001907802 | 170 |
| 193 | 3300005549 | Ga0070704_100330317 | Ga0070704_1003303172 | 170 |
| 194 | 3300005563 | Ga0068855_100472536 | Ga0068855_1004725362 | 170 |
| 195 | 3300005577 | Ga0068857_100022219 | Ga0068857_1000222195 | 170 |
| 196 | 3300005578 | Ga0068854_100068024 | Ga0068854_1000680242 | 170 |
| 197 | 3300005615 | Ga0070702_100090495 | Ga0070702_1000904952 | 170 |
| 198 | 3300005617 | Ga0068859_100042188 | Ga0068859_1000421883 | 170 |
| 199 | 3300005618 | Ga0068864_100100427 | Ga0068864_1001004272 | 170 |
| 200 | 3300005718 | Ga0068866_10017449 | Ga0068866_100174492 | 170 |
| 201 | 3300005719 | Ga0068861_100152470 | Ga0068861_1001524702 | 170 |
| 202 | 3300005834 | Ga0068851_10100414 | Ga0068851_101004142 | 170 |
| 203 | 3300005842 | Ga0068858_100019169 | Ga0068858_1000191692 | 170 |
| 204 | 3300005842 | Ga0068858_100264096 | Ga0068858_1002640962 | 170 |
| 205 | 3300005843 | Ga0068860_100064628 | Ga0068860_1000646282 | 170 |
| 206 | 3300005844 | Ga0068862_100155625 | Ga0068862_1001556252 | 170 |
| 207 | 3300005983 | Ga0081540_1099026 | Ga0081540_10990262 | 170 |
| 208 | 3300006163 | Ga0070715_10007835 | Ga0070715_100078354 | 170 |
| 209 | 3300006163 | Ga0070715_10409521 | Ga0070715_104095212 | 170 |
| 210 | 3300006931 | Ga0097620_100042189 | Ga0097620_1000421894 | 170 |
| 211 | 3300009101 | Ga0105247_10168466 | Ga0105247_101684662 | 170 |
| 212 | 3300009176 | Ga0105242_10035466 | Ga0105242_100354662 | 170 |
| 213 | 3300009545 | Ga0105237_10139611 | Ga0105237_101396112 | 170 |
| 214 | 3300009545 | Ga0105237_12174550 | Ga0105237_121745501 | 170 |
| 215 | 3300009553 | Ga0105249_10071738 | Ga0105249_100717382 | 170 |
| 216 | 3300009553 | Ga0105249_11229972 | Ga0105249_112299722 | 170 |
| 217 | 3300010375 | Ga0105239_10101877 | Ga0105239_101018772 | 170 |
| 218 | 3300013102 | Ga0157371_10857635 | Ga0157371_108576352 | 170 |
| 219 | 3300013306 | Ga0163162_10081460 | Ga0163162_100814603 | 170 |
| 220 | 3300013307 | Ga0157372_10290188 | Ga0157372_102901882 | 170 |
| 221 | 3300014968 | Ga0157379_10624771 | Ga0157379_106247712 | 170 |
| 222 | 3300025898 | Ga0207692_10014881 | Ga0207692_100148812 | 170 |
| 223 | 3300025899 | Ga0207642_10018722 | Ga0207642_100187223 | 170 |
| 224 | 3300025899 | Ga0207642_10110326 | Ga0207642_101103262 | 170 |
| 225 | 3300025901 | Ga0207688_10003983 | Ga0207688_100039834 | 170 |
| 226 | 3300025901 | Ga0207688_10073509 | Ga0207688_100735093 | 170 |
| 227 | 3300025903 | Ga0207680_10130677 | Ga0207680_101306772 | 170 |
| 228 | 3300025904 | Ga0207647_10011974 | Ga0207647_100119743 | 170 |
| 229 | 3300025905 | Ga0207685_10027666 | Ga0207685_100276662 | 170 |
| 230 | 3300025905 | Ga0207685_10062108 | Ga0207685_100621082 | 170 |
| 231 | 3300025911 | Ga0207654_10130538 | Ga0207654_101305382 | 170 |
| 232 | 3300025914 | Ga0207671_10420685 | Ga0207671_104206852 | 170 |
| 233 | 3300025931 | Ga0207644_10158060 | Ga0207644_101580602 | 170 |
| 234 | 3300025933 | Ga0207706_10020804 | Ga0207706_100208046 | 170 |
| 235 | 3300025933 | Ga0207706_10254040 | Ga0207706_102540402 | 170 |
| 236 | 3300025934 | Ga0207686_10071015 | Ga0207686_100710152 | 170 |
| 237 | 3300025935 | Ga0207709_10284984 | Ga0207709_102849842 | 170 |
| 238 | 3300025936 | Ga0207670_10115375 | Ga0207670_101153752 | 170 |
| 239 | 3300025939 | Ga0207665_10021889 | Ga0207665_100218893 | 170 |
| 240 | 3300025940 | Ga0207691_10068947 | Ga0207691_100689474 | 170 |
| 241 | 3300025949 | Ga0207667_10362361 | Ga0207667_103623612 | 170 |
| 242 | 3300025960 | Ga0207651_10042064 | Ga0207651_100420644 | 170 |
| 243 | 3300025961 | Ga0207712_10918365 | Ga0207712_109183652 | 170 |
| 244 | 3300025972 | Ga0207668_10067809 | Ga0207668_100678093 | 170 |
| 245 | 3300026023 | Ga0207677_10023893 | Ga0207677_100238933 | 170 |
| 246 | 3300026023 | Ga0207677_10058521 | Ga0207677_100585212 | 170 |
| 247 | 3300026035 | Ga0207703_10336047 | Ga0207703_103360472 | 170 |
| 248 | 3300026067 | Ga0207678_10016962 | Ga0207678_100169626 | 170 |
| 249 | 3300026067 | Ga0207678_10554867 | Ga0207678_105548672 | 170 |
| 250 | 3300026075 | Ga0207708_10014636 | Ga0207708_100146365 | 170 |
| 251 | 3300026116 | Ga0207674_10033236 | Ga0207674_100332365 | 170 |
| 252 | 3300026118 | Ga0207675_100157943 | Ga0207675_1001579432 | 170 |
| 253 | 3300026121 | Ga0207683_10066532 | Ga0207683_100665323 | 170 |
| 254 | 3300026142 | Ga0207698_11243976 | Ga0207698_112439762 | 170 |
| 255 | 3300028379 | Ga0268266_10042481 | Ga0268266_100424815 | 170 |
| 256 | 3300028380 | Ga0268265_10658635 | Ga0268265_106586352 | 170 |
| 257 | 3300028381 | Ga0268264_10088693 | Ga0268264_100886934 | 170 |
| 258 | 3300031901 | Ga0307406_10436755 | Ga0307406_104367551 | 170 |
| 259 | 3300035112 | Ga0373932_0028696 | Ga0373932_0028696_982_1494 | 170 |
| 260 | 3300035691 | Ga0373931_0042310 | Ga0373931_0042310_1157_1669 | 170 |
| 261 | 3300035691 | Ga0373931_0049971 | Ga0373931_0049971_65_577 | 170 |
| 262 | 3300041413 | Ga0439465_0008035 | Ga0439465_0008035_376_888 | 170 |
| 263 | 3300044693 | Ga0466961_0056390 | Ga0466961_0056390_732_1253 | 170 |
| 264 | 3300044765 | Ga0466970_0077516 | Ga0466970_0077516_723_1244 | 170 |
| 265 | 3300045836 | Ga0466958_0036071 | Ga0466958_0036071_175_696 | 170 |
| 266 | 3300046453 | Ga0495627_013326 | Ga0495627_013326_1237_1749 | 170 |
| 267 | 3300046455 | Ga0495603_0241715 | Ga0495603_0241715_369_881 | 170 |
| 268 | 3300046492 | Ga0495585_0105796 | Ga0495585_0105796_710_1222 | 170 |
| 269 | 3300046499 | Ga0495594_0079672 | Ga0495594_0079672_1239_1751 | 170 |
| 270 | 3300046526 | Ga0495666_0179583 | Ga0495666_0179583_28_540 | 170 |
| 271 | 3300046660 | Ga0495625_0102107 | Ga0495625_0102107_1168_1680 | 170 |
| 272 | 3300046689 | Ga0495613_0535905 | Ga0495613_0535905_39_551 | 170 |
| 273 | 3300047317 | Ga0495604_0255731 | Ga0495604_0255731_186_698 | 170 |
| 274 | 3300048903 | Ga0496100_0026032 | Ga0496100_0026032_961_1473 | 170 |
| 275 | 3300048903 | Ga0496100_0042550 | Ga0496100_0042550_2236_2748 | 170 |
| 276 | 3300048905 | Ga0496102_0250045 | Ga0496102_0250045_844_1356 | 170 |
| 277 | 3300048906 | Ga0496103_0122412 | Ga0496103_0122412_77_589 | 170 |
| 278 | 3300048907 | Ga0496104_0502396 | Ga0496104_0502396_138_650 | 170 |
| 279 | 3300048908 | Ga0496105_0566537 | Ga0496105_0566537_186_698 | 170 |
| 280 | 3300048909 | Ga0496106_0118266 | Ga0496106_0118266_513_1025 | 170 |
| 281 | 3300048909 | Ga0496106_0180349 | Ga0496106_0180349_619_1131 | 170 |
| 282 | 3300048910 | Ga0496107_0082594 | Ga0496107_0082594_1067_1579 | 170 |
| 283 | 3300048910 | Ga0496107_0253131 | Ga0496107_0253131_446_958 | 170 |
| 284 | 3300048911 | Ga0496108_0709998 | Ga0496108_0709998_327_839 | 170 |
| 285 | 3300048912 | Ga0496109_0080789 | Ga0496109_0080789_1401_1913 | 170 |
| 286 | 3300048918 | Ga0496115_0263418 | Ga0496115_0263418_428_940 | 170 |
| 287 | 3300049823 | Ga0501044_0077022 | Ga0501044_0077022_752_1264 | 170 |
| 288 | iso_pu_bacteria | 3006393351 | 3006397986 | 170 |
| 289 | 3300003578 | Ga0006562J51391_1083609 | Ga0006562J51391_10836092 | 171 |
| 290 | 3300005338 | Ga0068868_100154087 | Ga0068868_1001540872 | 171 |
| 291 | 3300005341 | Ga0070691_10339571 | Ga0070691_103395712 | 171 |
| 292 | 3300005356 | Ga0070674_100015749 | Ga0070674_1000157493 | 171 |
| 293 | 3300005365 | Ga0070688_100590746 | Ga0070688_1005907462 | 171 |
| 294 | 3300005366 | Ga0070659_100210273 | Ga0070659_1002102732 | 171 |
| 295 | 3300005434 | Ga0070709_10170486 | Ga0070709_101704862 | 171 |
| 296 | 3300005439 | Ga0070711_100009150 | Ga0070711_1000091502 | 171 |
| 297 | 3300005456 | Ga0070678_100015071 | Ga0070678_1000150713 | 171 |
| 298 | 3300005459 | Ga0068867_100173617 | Ga0068867_1001736172 | 171 |
| 299 | 3300005546 | Ga0070696_100032755 | Ga0070696_1000327553 | 171 |
| 300 | 3300005549 | Ga0070704_100005137 | Ga0070704_1000051372 | 171 |
| 301 | 3300005578 | Ga0068854_100406884 | Ga0068854_1004068842 | 171 |
| 302 | 3300005615 | Ga0070702_100025003 | Ga0070702_1000250032 | 171 |
| 303 | 3300005718 | Ga0068866_10020552 | Ga0068866_100205523 | 171 |
| 304 | 3300005844 | Ga0068862_100082678 | Ga0068862_1000826783 | 171 |
| 305 | 3300006163 | Ga0070715_10003349 | Ga0070715_100033494 | 171 |
| 306 | 3300006173 | Ga0070716_100006523 | Ga0070716_1000065232 | 171 |
| 307 | 3300006175 | Ga0070712_100007763 | Ga0070712_1000077632 | 171 |
| 308 | 3300006881 | Ga0068865_100010117 | Ga0068865_1000101172 | 171 |
| 309 | 3300009098 | Ga0105245_10352469 | Ga0105245_103524692 | 171 |
| 310 | 3300009176 | Ga0105242_10086989 | Ga0105242_100869893 | 171 |
| 311 | 3300010375 | Ga0105239_11203403 | Ga0105239_112034032 | 171 |
| 312 | 3300013104 | Ga0157370_10206097 | Ga0157370_102060972 | 171 |
| 313 | 3300013306 | Ga0163162_10213906 | Ga0163162_102139062 | 171 |
| 314 | 3300014326 | Ga0157380_10541549 | Ga0157380_105415492 | 171 |
| 315 | 3300014969 | Ga0157376_10194582 | Ga0157376_101945822 | 171 |
| 316 | 3300017792 | Ga0163161_10222663 | Ga0163161_102226632 | 171 |
| 317 | 3300025899 | Ga0207642_10005782 | Ga0207642_100057823 | 171 |
| 318 | 3300025906 | Ga0207699_10242716 | Ga0207699_102427162 | 171 |
| 319 | 3300025915 | Ga0207693_10014044 | Ga0207693_100140445 | 171 |
| 320 | 3300025916 | Ga0207663_10094398 | Ga0207663_100943982 | 171 |
| 321 | 3300025934 | Ga0207686_10047915 | Ga0207686_100479152 | 171 |
| 322 | 3300025937 | Ga0207669_10107688 | Ga0207669_101076882 | 171 |
| 323 | 3300025938 | Ga0207704_10130090 | Ga0207704_101300902 | 171 |
| 324 | 3300025939 | Ga0207665_10010565 | Ga0207665_100105653 | 171 |
| 325 | 3300025981 | Ga0207640_10388004 | Ga0207640_103880042 | 171 |
| 326 | 3300026023 | Ga0207677_10170444 | Ga0207677_101704442 | 171 |
| 327 | 3300026121 | Ga0207683_10022293 | Ga0207683_100222934 | 171 |
| 328 | 3300028380 | Ga0268265_10057941 | Ga0268265_100579413 | 171 |
| 329 | 3300028381 | Ga0268264_10108427 | Ga0268264_101084272 | 171 |
| 330 | 3300044765 | Ga0466970_0413414 | Ga0466970_0413414_129_644 | 171 |
| 331 | 3300046462 | Ga0495651_0074671 | Ga0495651_0074671_1015_1530 | 171 |
| 332 | 3300048903 | Ga0496100_0121897 | Ga0496100_0121897_757_1272 | 171 |
| 333 | 3300048904 | Ga0496101_0195083 | Ga0496101_0195083_993_1508 | 171 |
| 334 | 3300048906 | Ga0496103_0128696 | Ga0496103_0128696_353_868 | 171 |
| 335 | 3300048908 | Ga0496105_0349170 | Ga0496105_0349170_45_566 | 171 |
| 336 | 3300048909 | Ga0496106_0148203 | Ga0496106_0148203_601_1116 | 171 |
| 337 | 3300048918 | Ga0496115_0113667 | Ga0496115_0113667_1313_1828 | 171 |
| 338 | 3300049569 | Ga0501032_0402800 | Ga0501032_0402800_86_601 | 171 |
| 339 | 3300049577 | Ga0501041_0755805 | Ga0501041_0755805_93_611 | 171 |
| 340 | 3300049591 | Ga0501075_0547385 | Ga0501075_0547385_329_847 | 171 |
| 341 | 3300049593 | Ga0501077_0366626 | Ga0501077_0366626_324_842 | 171 |
| 342 | 3300049742 | Ga0501080_1122028 | Ga0501080_1122028_108_626 | 171 |
| 343 | 3300049822 | Ga0501035_0176459 | Ga0501035_0176459_223_738 | 171 |
| 344 | 3300049824 | Ga0501045_0717420 | Ga0501045_0717420_48_566 | 171 |
| 345 | 3300053085 | Ga0495619_0022860 | Ga0495619_0022860_2009_2524 | 171 |
| 346 | 3300005535 | Ga0070684_100290814 | Ga0070684_1002908142 | 172 |
| 347 | 3300006051 | Ga0075364_10249696 | Ga0075364_102496962 | 172 |
| 348 | 3300006844 | Ga0075428_100189524 | Ga0075428_1001895242 | 172 |
| 349 | 3300006880 | Ga0075429_100024137 | Ga0075429_1000241373 | 172 |
| 350 | 3300006931 | Ga0097620_100116593 | Ga0097620_1001165934 | 172 |
| 351 | 3300009147 | Ga0114129_10054328 | Ga0114129_100543288 | 172 |
| 352 | 3300025898 | Ga0207692_10109567 | Ga0207692_101095672 | 172 |
| 353 | 3300026075 | Ga0207708_10136029 | Ga0207708_101360292 | 172 |
| 354 | 3300026121 | Ga0207683_10037711 | Ga0207683_100377114 | 172 |
| 355 | 3300038443 | Ga0395901_0719116 | Ga0395901_0719116_49_591 | 172 |
| 356 | 3300044658 | Ga0466972_0040075 | Ga0466972_0040075_1348_1941 | 172 |
| 357 | 3300044683 | Ga0466965_0002372 | Ga0466965_0002372_6039_6632 | 172 |
| 358 | 3300044901 | Ga0466960_0000469 | Ga0466960_0000469_345_950 | 172 |
| 359 | 3300048905 | Ga0496102_0018021 | Ga0496102_0018021_5298_5825 | 172 |
| 360 | 3300048906 | Ga0496103_0037464 | Ga0496103_0037464_176_703 | 172 |
| 361 | 3300048921 | Ga0496118_0154389 | Ga0496118_0154389_472_999 | 172 |
| 362 | 3300050491 | nmdc:mga00v17_121920_c1 | nmdc:mga00v17_121920_c1_854_1381 | 172 |
| 363 | 3300050507 | nmdc:mga05p37_91320_c1 | nmdc:mga05p37_91320_c1_2825_3346 | 172 |
| 364 | 3300005335 | Ga0070666_10006924 | Ga0070666_100069246 | 173 |
| 365 | 3300005343 | Ga0070687_100034601 | Ga0070687_1000346013 | 173 |
| 366 | 3300005367 | Ga0070667_100042097 | Ga0070667_1000420974 | 173 |
| 367 | 3300005406 | Ga0070703_10013006 | Ga0070703_100130062 | 173 |
| 368 | 3300005439 | Ga0070711_100040182 | Ga0070711_1000401822 | 173 |
| 369 | 3300005441 | Ga0070700_100085893 | Ga0070700_1000858931 | 173 |
| 370 | 3300005456 | Ga0070678_100566889 | Ga0070678_1005668892 | 173 |
| 371 | 3300005548 | Ga0070665_100303175 | Ga0070665_1003031752 | 173 |
| 372 | 3300005614 | Ga0068856_100065742 | Ga0068856_1000657423 | 173 |
| 373 | 3300005841 | Ga0068863_100071922 | Ga0068863_1000719223 | 173 |
| 374 | 3300005843 | Ga0068860_100060696 | Ga0068860_1000606962 | 173 |
| 375 | 3300006175 | Ga0070712_100020521 | Ga0070712_1000205214 | 173 |
| 376 | 3300006358 | Ga0068871_100035728 | Ga0068871_1000357284 | 173 |
| 377 | 3300009545 | Ga0105237_10222783 | Ga0105237_102227831 | 173 |
| 378 | 3300011119 | Ga0105246_10006490 | Ga0105246_100064906 | 173 |
| 379 | 3300013308 | Ga0157375_10078114 | Ga0157375_100781141 | 173 |
| 380 | 3300014325 | Ga0163163_10009942 | Ga0163163_100099427 | 173 |
| 381 | 3300014969 | Ga0157376_10052557 | Ga0157376_100525573 | 173 |
| 382 | 3300025885 | Ga0207653_10036117 | Ga0207653_100361171 | 173 |
| 383 | 3300025903 | Ga0207680_10094552 | Ga0207680_100945522 | 173 |
| 384 | 3300025915 | Ga0207693_10005271 | Ga0207693_100052715 | 173 |
| 385 | 3300025918 | Ga0207662_10024801 | Ga0207662_100248014 | 173 |
| 386 | 3300025923 | Ga0207681_10363182 | Ga0207681_103631821 | 173 |
| 387 | 3300025934 | Ga0207686_10056753 | Ga0207686_100567532 | 173 |
| 388 | 3300025937 | Ga0207669_10102261 | Ga0207669_101022612 | 173 |
| 389 | 3300025942 | Ga0207689_10009642 | Ga0207689_100096425 | 173 |
| 390 | 3300025960 | Ga0207651_10005041 | Ga0207651_100050416 | 173 |
| 391 | 3300025986 | Ga0207658_10281707 | Ga0207658_102817072 | 173 |
| 392 | 3300026035 | Ga0207703_10478035 | Ga0207703_104780352 | 173 |
| 393 | 3300026088 | Ga0207641_10347435 | Ga0207641_103474352 | 173 |
| 394 | 3300031824 | Ga0307413_10006621 | Ga0307413_100066215 | 173 |
| 395 | 3300042007 | Ga0439449_0063452 | Ga0439449_0063452_253_774 | 173 |
| 396 | 3300044694 | Ga0466963_0002485 | Ga0466963_0002485_1728_2249 | 173 |
| 397 | 3300044694 | Ga0466963_0040258 | Ga0466963_0040258_2438_2959 | 173 |
| 398 | 3300044842 | Ga0466957_0098253 | Ga0466957_0098253_114_635 | 173 |
| 399 | 3300045836 | Ga0466958_0032613 | Ga0466958_0032613_982_1503 | 173 |
| 400 | 3300045976 | Ga0466967_0038592 | Ga0466967_0038592_2247_2768 | 173 |
| 401 | 3300045976 | Ga0466967_0051054 | Ga0466967_0051054_1732_2253 | 173 |
| 402 | 3300046511 | Ga0495608_0168712 | Ga0495608_0168712_62_583 | 173 |
| 403 | 3300048905 | Ga0496102_0082523 | Ga0496102_0082523_2433_2954 | 173 |
| 404 | 3300048907 | Ga0496104_0234603 | Ga0496104_0234603_17_538 | 173 |
| 405 | 3300048908 | Ga0496105_0587424 | Ga0496105_0587424_322_843 | 173 |
| 406 | 3300048911 | Ga0496108_0013662 | Ga0496108_0013662_4166_4687 | 173 |
| 407 | 3300048914 | Ga0496111_0251545 | Ga0496111_0251545_302_823 | 173 |
| 408 | 3300048916 | Ga0496113_0040483 | Ga0496113_0040483_2147_2668 | 173 |
| 409 | 3300048917 | Ga0496114_0071163 | Ga0496114_0071163_1758_2279 | 173 |
| 410 | 3300048929 | Ga0496126_0024488 | Ga0496126_0024488_1257_1778 | 173 |
| 411 | iso_pu_bacteria | 2857481737 | 2857484399 | 173 |
| 412 | iso_pu_bacteria | 2932431166 | 2932431854 | 173 |
| 413 | 3300044656 | Ga0466969_0107871 | Ga0466969_0107871_644_1174 | 174 |
| 414 | 3300044693 | Ga0466961_0132942 | Ga0466961_0132942_622_1152 | 174 |
| 415 | 3300044765 | Ga0466970_0088377 | Ga0466970_0088377_679_1209 | 174 |
| 416 | 3300045049 | Ga0466959_0363772 | Ga0466959_0363772_415_945 | 174 |
| 417 | 3300045836 | Ga0466958_0200853 | Ga0466958_0200853_214_744 | 174 |
| 418 | 3300046454 | Ga0495592_0418933 | Ga0495592_0418933_45_578 | 174 |
| 419 | 3300046462 | Ga0495651_0002255 | Ga0495651_0002255_8782_9315 | 174 |
| 420 | 3300046477 | Ga0495664_0135702 | Ga0495664_0135702_676_1209 | 174 |
| 421 | 3300046516 | Ga0495628_0010353 | Ga0495628_0010353_3732_4265 | 174 |
| 422 | 3300046529 | Ga0495652_0010947 | Ga0495652_0010947_992_1525 | 174 |
| 423 | 3300046543 | Ga0495645_0054714 | Ga0495645_0054714_1381_1914 | 174 |
| 424 | 3300046679 | Ga0495623_0274297 | Ga0495623_0274297_28_561 | 174 |
| 425 | 3300046680 | Ga0495646_0299653 | Ga0495646_0299653_123_647 | 174 |
| 426 | 3300048088 | Ga0495602_0880768 | Ga0495602_0880768_37_570 | 174 |
| 427 | 3300048903 | Ga0496100_0028049 | Ga0496100_0028049_337_861 | 174 |
| 428 | 3300048924 | Ga0496121_0023565 | Ga0496121_0023565_2324_2848 | 174 |
| 429 | 3300048927 | Ga0496124_0342524 | Ga0496124_0342524_97_621 | 174 |
| 430 | 3300053140 | Ga0500573_0066479 | Ga0500573_0066479_57_593 | 174 |
| 431 | 3300028573 | Ga0265334_10003345 | Ga0265334_100033453 | 175 |
| 432 | 3300028794 | Ga0307515_10239470 | Ga0307515_102394702 | 175 |
| 433 | 3300031995 | Ga0307409_100841718 | Ga0307409_1008417182 | 175 |
| 434 | 3300046462 | Ga0495651_0549699 | Ga0495651_0549699_86_724 | 175 |
| 435 | 3300048929 | Ga0496126_0013491 | Ga0496126_0013491_2414_2956 | 175 |
| 436 | 3300053083 | Ga0495655_0051788 | Ga0495655_0051788_113_640 | 175 |
| 437 | iso_pu_bacteria | 2867346516 | 2867350653 | 175 |
| 438 | 3300001990 | JGI24737J22298_10128887 | JGI24737J22298_101288872 | 176 |
| 439 | 3300025932 | Ga0207690_10972111 | Ga0207690_109721112 | 176 |
| 440 | 3300025935 | Ga0207709_10183047 | Ga0207709_101830472 | 176 |
| 441 | 3300037853 | Ga0436364_1106144 | Ga0436364_1106144_680_1210 | 176 |
| 442 | 3300041453 | Ga0451797_0847368 | Ga0451797_0847368_56_586 | 176 |
| 443 | 3300041491 | Ga0451833_1468257 | Ga0451833_1468257_106_636 | 176 |
| 444 | 3300044694 | Ga0466963_0467742 | Ga0466963_0467742_230_760 | 176 |
| 445 | 3300045049 | Ga0466959_0801513 | Ga0466959_0801513_80_610 | 176 |
| 446 | 3300045836 | Ga0466958_0182795 | Ga0466958_0182795_442_972 | 176 |
| 447 | 3300045976 | Ga0466967_0302113 | Ga0466967_0302113_280_810 | 176 |
| 448 | 3300046453 | Ga0495627_124216 | Ga0495627_124216_171_716 | 176 |
| 449 | 3300048917 | Ga0496114_0067272 | Ga0496114_0067272_2057_2587 | 176 |
| 450 | 3300005458 | Ga0070681_10082039 | Ga0070681_100820394 | 177 |
| 451 | 3300005843 | Ga0068860_100000571 | Ga0068860_10000057135 | 177 |
| 452 | 3300009092 | Ga0105250_10147845 | Ga0105250_101478452 | 177 |
| 453 | 3300013308 | Ga0157375_10730200 | Ga0157375_107302001 | 177 |
| 454 | 3300014326 | Ga0157380_10833528 | Ga0157380_108335282 | 177 |
| 455 | 3300025711 | Ga0207696_1098850 | Ga0207696_10988502 | 177 |
| 456 | 3300025912 | Ga0207707_10390494 | Ga0207707_103904942 | 177 |
| 457 | 3300028381 | Ga0268264_10000573 | Ga0268264_100005738 | 177 |
| 458 | 3300044694 | Ga0466963_0355428 | Ga0466963_0355428_210_758 | 177 |
| 459 | 3300045976 | Ga0466967_0045146 | Ga0466967_0045146_1501_2049 | 177 |
| 460 | 3300046455 | Ga0495603_0003497 | Ga0495603_0003497_1223_1756 | 177 |
| 461 | 3300046459 | Ga0495629_0132414 | Ga0495629_0132414_736_1269 | 177 |
| 462 | 3300046476 | Ga0495662_0009605 | Ga0495662_0009605_2745_3278 | 177 |
| 463 | 3300046499 | Ga0495594_0011704 | Ga0495594_0011704_2937_3470 | 177 |
| 464 | 3300046557 | Ga0495622_0065637 | Ga0495622_0065637_321_854 | 177 |
| 465 | 3300046663 | Ga0495635_0088184 | Ga0495635_0088184_1116_1649 | 177 |
| 466 | 3300046674 | Ga0495588_0038616 | Ga0495588_0038616_169_702 | 177 |
| 467 | 3300046675 | Ga0495657_0002058 | Ga0495657_0002058_6126_6659 | 177 |
| 468 | 3300046689 | Ga0495613_0004186 | Ga0495613_0004186_4329_4862 | 177 |
| 469 | 3300047315 | Ga0495581_0025921 | Ga0495581_0025921_657_1190 | 177 |
| 470 | 3300047318 | Ga0495636_0011349 | Ga0495636_0011349_1708_2241 | 177 |
| 471 | 3300047447 | Ga0495685_095976 | Ga0495685_095976_238_771 | 177 |
| 472 | 3300048911 | Ga0496108_0045273 | Ga0496108_0045273_1152_1685 | 177 |
| 473 | 3300048912 | Ga0496109_0013758 | Ga0496109_0013758_5317_5850 | 177 |
| 474 | 3300048913 | Ga0496110_0682966 | Ga0496110_0682966_245_778 | 177 |
| 475 | 3300048917 | Ga0496114_0635220 | Ga0496114_0635220_358_900 | 177 |
| 476 | 3300048918 | Ga0496115_0142055 | Ga0496115_0142055_237_770 | 177 |
| 477 | 3300049588 | Ga0501072_1146013 | Ga0501072_1146013_13_546 | 177 |
| 478 | 3300006038 | Ga0075365_10176126 | Ga0075365_101761262 | 178 |
| 479 | 3300006038 | Ga0075365_10481819 | Ga0075365_104818192 | 178 |
| 480 | 3300006048 | Ga0075363_100119192 | Ga0075363_1001191922 | 178 |
| 481 | 3300006051 | Ga0075364_10128574 | Ga0075364_101285742 | 178 |
| 482 | 3300006353 | Ga0075370_10068654 | Ga0075370_100686543 | 178 |
| 483 | 3300014325 | Ga0163163_10315748 | Ga0163163_103157482 | 178 |
| 484 | 3300025932 | Ga0207690_10920098 | Ga0207690_109200982 | 178 |
| 485 | 3300031824 | Ga0307413_10561387 | Ga0307413_105613871 | 178 |
| 486 | 3300031995 | Ga0307409_100552750 | Ga0307409_1005527502 | 178 |
| 487 | 3300032002 | Ga0307416_100369602 | Ga0307416_1003696022 | 178 |
| 488 | 3300049568 | Ga0501031_0098159 | Ga0501031_0098159_125_664 | 178 |
| 489 | 3300049569 | Ga0501032_0254095 | Ga0501032_0254095_431_970 | 178 |
| 490 | 3300049572 | Ga0501036_0052771 | Ga0501036_0052771_2267_2806 | 178 |
| 491 | 3300049573 | Ga0501037_0172794 | Ga0501037_0172794_308_847 | 178 |
| 492 | 3300049574 | Ga0501038_0814077 | Ga0501038_0814077_96_635 | 178 |
| 493 | 3300049575 | Ga0501039_0021000 | Ga0501039_0021000_4411_4950 | 178 |
| 494 | 3300049577 | Ga0501041_0090643 | Ga0501041_0090643_766_1305 | 178 |
| 495 | 3300049578 | Ga0501042_0602855 | Ga0501042_0602855_207_746 | 178 |
| 496 | 3300049579 | Ga0501043_0247622 | Ga0501043_0247622_492_1031 | 178 |
| 497 | 3300049580 | Ga0501046_0076146 | Ga0501046_0076146_1738_2277 | 178 |
| 498 | 3300049582 | Ga0501048_0090672 | Ga0501048_0090672_886_1425 | 178 |
| 499 | 3300049586 | Ga0501070_0170676 | Ga0501070_0170676_419_958 | 178 |
| 500 | 3300049587 | Ga0501071_0051099 | Ga0501071_0051099_661_1200 | 178 |
| 501 | 3300049588 | Ga0501072_0165450 | Ga0501072_0165450_755_1294 | 178 |
| 502 | 3300049589 | Ga0501073_0113746 | Ga0501073_0113746_208_747 | 178 |
| 503 | 3300049591 | Ga0501075_0267043 | Ga0501075_0267043_393_932 | 178 |
| 504 | 3300049592 | Ga0501076_0187038 | Ga0501076_0187038_938_1477 | 178 |
| 505 | 3300049593 | Ga0501077_0025068 | Ga0501077_0025068_1112_1651 | 178 |
| 506 | 3300049741 | Ga0501079_0466005 | Ga0501079_0466005_90_629 | 178 |
| 507 | 3300049742 | Ga0501080_0180353 | Ga0501080_0180353_267_806 | 178 |
| 508 | 3300049743 | Ga0501081_0093130 | Ga0501081_0093130_950_1489 | 178 |
| 509 | 3300049822 | Ga0501035_0351537 | Ga0501035_0351537_580_1119 | 178 |
| 510 | 3300049824 | Ga0501045_0068393 | Ga0501045_0068393_352_891 | 178 |
| 511 | 3300050491 | nmdc:mga00v17_414792_c1 | nmdc:mga00v17_414792_c1_120_656 | 178 |
| 512 | 3300050491 | nmdc:mga00v17_487595_c1 | nmdc:mga00v17_487595_c1_137_673 | 178 |
| 513 | 3300050495 | nmdc:mga04h51_223715_c1 | nmdc:mga04h51_223715_c1_171_707 | 178 |
| 514 | 3300050496 | nmdc:mga07m45_250553_c1 | nmdc:mga07m45_250553_c1_474_1010 | 178 |
| 515 | 3300054114 | Ga0501084_0062212 | Ga0501084_0062212_1681_2220 | 178 |
| 516 | 3300060353 | Ga0501082_0060248 | Ga0501082_0060248_2100_2639 | 178 |
| 517 | 3300061734 | Ga0530510_0005493 | Ga0530510_0005493_541_1080 | 178 |
| 518 | 3300025909 | Ga0207705_10095065 | Ga0207705_100950652 | 179 |
| 519 | 3300025924 | Ga0207694_10599830 | Ga0207694_105998302 | 179 |
| 520 | 3300048911 | Ga0496108_0362213 | Ga0496108_0362213_552_1091 | 179 |
| 521 | 3300048913 | Ga0496110_0508563 | Ga0496110_0508563_367_906 | 179 |
| 522 | 3300048914 | Ga0496111_0193736 | Ga0496111_0193736_960_1499 | 179 |
| 523 | 3300049568 | Ga0501031_0320427 | Ga0501031_0320427_115_654 | 179 |
| 524 | 3300049572 | Ga0501036_0545845 | Ga0501036_0545845_216_755 | 179 |
| 525 | 3300049574 | Ga0501038_0026723 | Ga0501038_0026723_1976_2548 | 179 |
| 526 | 3300049575 | Ga0501039_0024627 | Ga0501039_0024627_2664_3236 | 179 |
| 527 | 3300049575 | Ga0501039_0515647 | Ga0501039_0515647_95_634 | 179 |
| 528 | 3300049576 | Ga0501040_0003702 | Ga0501040_0003702_7199_7771 | 179 |
| 529 | 3300049577 | Ga0501041_0010911 | Ga0501041_0010911_2765_3337 | 179 |
| 530 | 3300049578 | Ga0501042_0009588 | Ga0501042_0009588_1824_2396 | 179 |
| 531 | 3300049578 | Ga0501042_0220267 | Ga0501042_0220267_807_1346 | 179 |
| 532 | 3300049579 | Ga0501043_0142364 | Ga0501043_0142364_394_966 | 179 |
| 533 | 3300049580 | Ga0501046_0003883 | Ga0501046_0003883_2150_2722 | 179 |
| 534 | 3300049582 | Ga0501048_0004420 | Ga0501048_0004420_8211_8783 | 179 |
| 535 | 3300049586 | Ga0501070_0104510 | Ga0501070_0104510_182_754 | 179 |
| 536 | 3300049587 | Ga0501071_0052358 | Ga0501071_0052358_328_900 | 179 |
| 537 | 3300049588 | Ga0501072_0004450 | Ga0501072_0004450_2145_2717 | 179 |
| 538 | 3300049590 | Ga0501074_0012053 | Ga0501074_0012053_2859_3431 | 179 |
| 539 | 3300049591 | Ga0501075_0002801 | Ga0501075_0002801_2360_2932 | 179 |
| 540 | 3300049592 | Ga0501076_0010097 | Ga0501076_0010097_2122_2694 | 179 |
| 541 | 3300049593 | Ga0501077_0019963 | Ga0501077_0019963_3014_3586 | 179 |
| 542 | 3300049741 | Ga0501079_0043461 | Ga0501079_0043461_1825_2397 | 179 |
| 543 | 3300049742 | Ga0501080_0111948 | Ga0501080_0111948_1700_2272 | 179 |
| 544 | 3300049743 | Ga0501081_0001208 | Ga0501081_0001208_9162_9734 | 179 |
| 545 | 3300049744 | Ga0501083_0143535 | Ga0501083_0143535_364_936 | 179 |
| 546 | 3300049823 | Ga0501044_0209272 | Ga0501044_0209272_1070_1642 | 179 |
| 547 | 3300049824 | Ga0501045_0002030 | Ga0501045_0002030_11062_11634 | 179 |
| 548 | 3300049824 | Ga0501045_0704738 | Ga0501045_0704738_163_702 | 179 |
| 549 | 3300054114 | Ga0501084_0036510 | Ga0501084_0036510_1866_2438 | 179 |
| 550 | 3300060353 | Ga0501082_0027018 | Ga0501082_0027018_2015_2587 | 179 |
| 551 | 3300061734 | Ga0530510_0003870 | Ga0530510_0003870_1858_2430 | 179 |
| 552 | 3300037466 | Ga0395898_0131033 | Ga0395898_0131033_1267_1821 | 180 |
| 553 | 3300037471 | Ga0395905_0562886 | Ga0395905_0562886_194_748 | 180 |
| 554 | 3300041459 | Ga0451800_1652997 | Ga0451800_1652997_110_658 | 180 |
| 555 | 3300049571 | Ga0501034_0378456 | Ga0501034_0378456_719_1279 | 180 |
| 556 | 3300049579 | Ga0501043_0435751 | Ga0501043_0435751_37_582 | 180 |
| 557 | 3300005329 | Ga0070683_100253818 | Ga0070683_1002538182 | 181 |
| 558 | 3300005331 | Ga0070670_100147157 | Ga0070670_1001471572 | 181 |
| 559 | 3300005337 | Ga0070682_100012388 | Ga0070682_1000123884 | 181 |
| 560 | 3300005340 | Ga0070689_100277565 | Ga0070689_1002775651 | 181 |
| 561 | 3300005345 | Ga0070692_10003754 | Ga0070692_100037544 | 181 |
| 562 | 3300005347 | Ga0070668_100167002 | Ga0070668_1001670022 | 181 |
| 563 | 3300005354 | Ga0070675_100039563 | Ga0070675_1000395633 | 181 |
| 564 | 3300005356 | Ga0070674_100802746 | Ga0070674_1008027462 | 181 |
| 565 | 3300005365 | Ga0070688_100049376 | Ga0070688_1000493763 | 181 |
| 566 | 3300005366 | Ga0070659_100279038 | Ga0070659_1002790382 | 181 |
| 567 | 3300005438 | Ga0070701_10053918 | Ga0070701_100539182 | 181 |
| 568 | 3300005441 | Ga0070700_100030853 | Ga0070700_1000308532 | 181 |
| 569 | 3300005459 | Ga0068867_100014530 | Ga0068867_1000145305 | 181 |
| 570 | 3300005466 | Ga0070685_10121005 | Ga0070685_101210052 | 181 |
| 571 | 3300005535 | Ga0070684_100013533 | Ga0070684_1000135332 | 181 |
| 572 | 3300005578 | Ga0068854_100053392 | Ga0068854_1000533922 | 181 |
| 573 | 3300005615 | Ga0070702_100259467 | Ga0070702_1002594671 | 181 |
| 574 | 3300005718 | Ga0068866_10117038 | Ga0068866_101170382 | 181 |
| 575 | 3300005719 | Ga0068861_100009494 | Ga0068861_1000094945 | 181 |
| 576 | 3300005840 | Ga0068870_10005167 | Ga0068870_100051679 | 181 |
| 577 | 3300005842 | Ga0068858_100572605 | Ga0068858_1005726052 | 181 |
| 578 | 3300006881 | Ga0068865_100022210 | Ga0068865_1000222104 | 181 |
| 579 | 3300009094 | Ga0111539_10529903 | Ga0111539_105299032 | 181 |
| 580 | 3300009101 | Ga0105247_10288677 | Ga0105247_102886772 | 181 |
| 581 | 3300009148 | Ga0105243_10034369 | Ga0105243_100343693 | 181 |
| 582 | 3300009148 | Ga0105243_10328869 | Ga0105243_103288692 | 181 |
| 583 | 3300009553 | Ga0105249_10094239 | Ga0105249_100942392 | 181 |
| 584 | 3300013296 | Ga0157374_10932484 | Ga0157374_109324842 | 181 |
| 585 | 3300013307 | Ga0157372_10086249 | Ga0157372_100862492 | 181 |
| 586 | 3300014326 | Ga0157380_10005423 | Ga0157380_100054237 | 181 |
| 587 | 3300014326 | Ga0157380_10272752 | Ga0157380_102727522 | 181 |
| 588 | 3300014969 | Ga0157376_10527304 | Ga0157376_105273042 | 181 |
| 589 | 3300025901 | Ga0207688_10023517 | Ga0207688_100235173 | 181 |
| 590 | 3300025908 | Ga0207643_10002721 | Ga0207643_100027218 | 181 |
| 591 | 3300025919 | Ga0207657_10373636 | Ga0207657_103736362 | 181 |
| 592 | 3300025927 | Ga0207687_10027783 | Ga0207687_100277834 | 181 |
| 593 | 3300025935 | Ga0207709_10299212 | Ga0207709_102992122 | 181 |
| 594 | 3300025940 | Ga0207691_10005262 | Ga0207691_100052624 | 181 |
| 595 | 3300025960 | Ga0207651_10514744 | Ga0207651_105147442 | 181 |
| 596 | 3300025961 | Ga0207712_10652502 | Ga0207712_106525022 | 181 |
| 597 | 3300025972 | Ga0207668_10503883 | Ga0207668_105038832 | 181 |
| 598 | 3300026075 | Ga0207708_10001377 | Ga0207708_100013773 | 181 |
| 599 | 3300026089 | Ga0207648_10003123 | Ga0207648_100031232 | 181 |
| 600 | 3300026118 | Ga0207675_100002328 | Ga0207675_1000023286 | 181 |
| 601 | 3300026142 | Ga0207698_10061313 | Ga0207698_100613133 | 181 |
| 602 | 3300028381 | Ga0268264_10247008 | Ga0268264_102470082 | 181 |
| 603 | 3300048909 | Ga0496106_0210448 | Ga0496106_0210448_958_1503 | 181 |
| 604 | 3300048911 | Ga0496108_0672651 | Ga0496108_0672651_108_653 | 181 |
| 605 | 3300048912 | Ga0496109_0223772 | Ga0496109_0223772_233_778 | 181 |
| 606 | 3300049569 | Ga0501032_0038218 | Ga0501032_0038218_1941_2501 | 181 |
| 607 | 3300049571 | Ga0501034_0013772 | Ga0501034_0013772_6237_6797 | 181 |
| 608 | 3300049572 | Ga0501036_0170547 | Ga0501036_0170547_865_1425 | 181 |
| 609 | 3300049573 | Ga0501037_0005801 | Ga0501037_0005801_7095_7655 | 181 |
| 610 | 3300049574 | Ga0501038_0010056 | Ga0501038_0010056_194_754 | 181 |
| 611 | 3300049575 | Ga0501039_0122273 | Ga0501039_0122273_772_1332 | 181 |
| 612 | 3300049579 | Ga0501043_0391717 | Ga0501043_0391717_82_642 | 181 |
| 613 | 3300049581 | Ga0501047_0070038 | Ga0501047_0070038_1524_2084 | 181 |
| 614 | 3300049582 | Ga0501048_0012968 | Ga0501048_0012968_408_968 | 181 |
| 615 | 3300049586 | Ga0501070_0047959 | Ga0501070_0047959_1683_2243 | 181 |
| 616 | 3300049589 | Ga0501073_0130731 | Ga0501073_0130731_115_675 | 181 |
| 617 | 3300049741 | Ga0501079_0308180 | Ga0501079_0308180_209_769 | 181 |
| 618 | 3300049823 | Ga0501044_0035058 | Ga0501044_0035058_1523_2083 | 181 |
| 619 | 3300049824 | Ga0501045_0008210 | Ga0501045_0008210_1271_1831 | 181 |
| 620 | 3300050511 | nmdc:mga08y16_727562_c1 | nmdc:mga08y16_727562_c1_224_769 | 181 |
| 621 | 3300048925 | Ga0496122_0000575 | Ga0496122_0000575_16629_17195 | 183 |
| 622 | 3300048926 | Ga0496123_0000333 | Ga0496123_0000333_43403_43969 | 183 |
| 623 | 3300048927 | Ga0496124_0002355 | Ga0496124_0002355_5755_6321 | 183 |
| 624 | 3300005456 | Ga0070678_100252038 | Ga0070678_1002520382 | 184 |
| 625 | 3300011119 | Ga0105246_10079286 | Ga0105246_100792862 | 184 |
| 626 | 3300026121 | Ga0207683_10585721 | Ga0207683_105857212 | 184 |
| 627 | 3300044694 | Ga0466963_0035011 | Ga0466963_0035011_1138_1707 | 184 |
| 628 | 3300044706 | Ga0466964_0025375 | Ga0466964_0025375_1065_1634 | 184 |
| 629 | 3300044719 | Ga0466971_0081272 | Ga0466971_0081272_29_598 | 184 |
| 630 | 3300044765 | Ga0466970_0168949 | Ga0466970_0168949_363_932 | 184 |
| 631 | 3300044842 | Ga0466957_0047977 | Ga0466957_0047977_769_1338 | 184 |
| 632 | 3300049590 | Ga0501074_0148269 | Ga0501074_0148269_1023_1586 | 184 |
| 633 | 3300049741 | Ga0501079_0325869 | Ga0501079_0325869_62_625 | 184 |
| 634 | 3300049742 | Ga0501080_0148074 | Ga0501080_0148074_1008_1571 | 184 |
| 635 | 3300050491 | nmdc:mga00v17_13678_c1 | nmdc:mga00v17_13678_c1_2910_3473 | 184 |
| 636 | 3300050494 | nmdc:mga06z11_227417_c1 | nmdc:mga06z11_227417_c1_229_792 | 184 |
| 637 | 3300050496 | nmdc:mga07m45_9571_c1 | nmdc:mga07m45_9571_c1_4386_4949 | 184 |
| 638 | 3300032002 | Ga0307416_100919229 | Ga0307416_1009192292 | 188 |
| 639 | 2162886012 | MBSR1b_contig_11460553 | MBSR1b_0351.00007770 | 191 |
| 640 | 3300001904 | JGI24736J21556_1031421 | JGI24736J21556_10314212 | 191 |
| 641 | 3300001978 | JGI24747J21853_1001272 | JGI24747J21853_10012722 | 191 |
| 642 | 3300002070 | JGI24750J21931_1010170 | JGI24750J21931_10101702 | 191 |
| 643 | 3300002073 | JGI24745J21846_1002280 | JGI24745J21846_10022802 | 191 |
| 644 | 3300002076 | JGI24749J21850_1001787 | JGI24749J21850_10017873 | 191 |
| 645 | 3300002239 | JGI24034J26672_10012218 | JGI24034J26672_100122182 | 191 |
| 646 | 3300002459 | JGI24751J29686_10021542 | JGI24751J29686_100215422 | 191 |
| 647 | 3300005293 | Ga0065715_10170299 | Ga0065715_101702992 | 191 |
| 648 | 3300005295 | Ga0065707_10099990 | Ga0065707_100999903 | 191 |
| 649 | 3300005327 | Ga0070658_10000182 | Ga0070658_1000018210 | 191 |
| 650 | 3300005328 | Ga0070676_10000569 | Ga0070676_100005699 | 191 |
| 651 | 3300005329 | Ga0070683_100002426 | Ga0070683_1000024263 | 191 |
| 652 | 3300005330 | Ga0070690_100000724 | Ga0070690_1000007247 | 191 |
| 653 | 3300005331 | Ga0070670_100013501 | Ga0070670_1000135013 | 191 |
| 654 | 3300005333 | Ga0070677_10000089 | Ga0070677_100000899 | 191 |
| 655 | 3300005334 | Ga0068869_100000722 | Ga0068869_1000007229 | 191 |
| 656 | 3300005335 | Ga0070666_10019805 | Ga0070666_100198055 | 191 |
| 657 | 3300005338 | Ga0068868_100001079 | Ga0068868_1000010799 | 191 |
| 658 | 3300005339 | Ga0070660_100000514 | Ga0070660_10000051414 | 191 |
| 659 | 3300005340 | Ga0070689_100001136 | Ga0070689_1000011364 | 191 |
| 660 | 3300005341 | Ga0070691_10021525 | Ga0070691_100215252 | 191 |
| 661 | 3300005343 | Ga0070687_100000027 | Ga0070687_1000000279 | 191 |
| 662 | 3300005344 | Ga0070661_100001599 | Ga0070661_1000015993 | 191 |
| 663 | 3300005344 | Ga0070661_100002829 | Ga0070661_1000028293 | 191 |
| 664 | 3300005345 | Ga0070692_10001590 | Ga0070692_100015908 | 191 |
| 665 | 3300005347 | Ga0070668_100000852 | Ga0070668_10000085212 | 191 |
| 666 | 3300005353 | Ga0070669_100000180 | Ga0070669_10000018038 | 191 |
| 667 | 3300005354 | Ga0070675_100002254 | Ga0070675_1000022549 | 191 |
| 668 | 3300005355 | Ga0070671_100000129 | Ga0070671_10000012939 | 191 |
| 669 | 3300005356 | Ga0070674_100001566 | Ga0070674_1000015668 | 191 |
| 670 | 3300005364 | Ga0070673_100000805 | Ga0070673_1000008056 | 191 |
| 671 | 3300005365 | Ga0070688_100000146 | Ga0070688_10000014620 | 191 |
| 672 | 3300005366 | Ga0070659_100000665 | Ga0070659_1000006659 | 191 |
| 673 | 3300005367 | Ga0070667_100004504 | Ga0070667_10000450411 | 191 |
| 674 | 3300005438 | Ga0070701_10000764 | Ga0070701_1000076412 | 191 |
| 675 | 3300005439 | Ga0070711_100173052 | Ga0070711_1001730522 | 191 |
| 676 | 3300005440 | Ga0070705_100000359 | Ga0070705_1000003592 | 191 |
| 677 | 3300005455 | Ga0070663_100001822 | Ga0070663_1000018229 | 191 |
| 678 | 3300005456 | Ga0070678_100000484 | Ga0070678_1000004846 | 191 |
| 679 | 3300005457 | Ga0070662_100001061 | Ga0070662_1000010619 | 191 |
| 680 | 3300005459 | Ga0068867_100001778 | Ga0068867_1000017782 | 191 |
| 681 | 3300005466 | Ga0070685_10000749 | Ga0070685_100007499 | 191 |
| 682 | 3300005530 | Ga0070679_100035378 | Ga0070679_1000353785 | 191 |
| 683 | 3300005535 | Ga0070684_100020868 | Ga0070684_1000208682 | 191 |
| 684 | 3300005535 | Ga0070684_100117504 | Ga0070684_1001175042 | 191 |
| 685 | 3300005539 | Ga0068853_100019372 | Ga0068853_1000193727 | 191 |
| 686 | 3300005543 | Ga0070672_100001357 | Ga0070672_1000013579 | 191 |
| 687 | 3300005544 | Ga0070686_100017067 | Ga0070686_1000170673 | 191 |
| 688 | 3300005548 | Ga0070665_100202691 | Ga0070665_1002026912 | 191 |
| 689 | 3300005549 | Ga0070704_100039056 | Ga0070704_1000390563 | 191 |
| 690 | 3300005563 | Ga0068855_100000320 | Ga0068855_10000032044 | 191 |
| 691 | 3300005564 | Ga0070664_100001107 | Ga0070664_1000011073 | 191 |
| 692 | 3300005564 | Ga0070664_100003364 | Ga0070664_1000033644 | 191 |
| 693 | 3300005577 | Ga0068857_100001857 | Ga0068857_10000185711 | 191 |
| 694 | 3300005577 | Ga0068857_100006286 | Ga0068857_1000062862 | 191 |
| 695 | 3300005578 | Ga0068854_100001176 | Ga0068854_1000011769 | 191 |
| 696 | 3300005614 | Ga0068856_100085158 | Ga0068856_1000851582 | 191 |
| 697 | 3300005615 | Ga0070702_100014349 | Ga0070702_1000143494 | 191 |
| 698 | 3300005616 | Ga0068852_100000158 | Ga0068852_10000015838 | 191 |
| 699 | 3300005617 | Ga0068859_100020605 | Ga0068859_1000206053 | 191 |
| 700 | 3300005618 | Ga0068864_100001189 | Ga0068864_1000011899 | 191 |
| 701 | 3300005718 | Ga0068866_10000414 | Ga0068866_1000041411 | 191 |
| 702 | 3300005719 | Ga0068861_100000079 | Ga0068861_10000007940 | 191 |
| 703 | 3300005834 | Ga0068851_10004904 | Ga0068851_100049044 | 191 |
| 704 | 3300005840 | Ga0068870_10000320 | Ga0068870_100003206 | 191 |
| 705 | 3300005841 | Ga0068863_100000361 | Ga0068863_10000036140 | 191 |
| 706 | 3300005842 | Ga0068858_100003786 | Ga0068858_1000037867 | 191 |
| 707 | 3300005843 | Ga0068860_100017431 | Ga0068860_1000174313 | 191 |
| 708 | 3300005844 | Ga0068862_100001958 | Ga0068862_1000019589 | 191 |
| 709 | 3300005983 | Ga0081540_1000073 | Ga0081540_100007319 | 191 |
| 710 | 3300005983 | Ga0081540_1000149 | Ga0081540_100014938 | 191 |
| 711 | 3300006175 | Ga0070712_100099419 | Ga0070712_1000994193 | 191 |
| 712 | 3300006237 | Ga0097621_100001336 | Ga0097621_1000013369 | 191 |
| 713 | 3300006237 | Ga0097621_100103784 | Ga0097621_1001037843 | 191 |
| 714 | 3300006358 | Ga0068871_100000398 | Ga0068871_1000003989 | 191 |
| 715 | 3300006358 | Ga0068871_100077582 | Ga0068871_1000775823 | 191 |
| 716 | 3300006880 | Ga0075429_100811309 | Ga0075429_1008113092 | 191 |
| 717 | 3300006881 | Ga0068865_100013937 | Ga0068865_1000139374 | 191 |
| 718 | 3300006931 | Ga0097620_100020605 | Ga0097620_1000206053 | 191 |
| 719 | 3300007076 | Ga0075435_100272641 | Ga0075435_1002726412 | 191 |
| 720 | 3300009092 | Ga0105250_10051770 | Ga0105250_100517702 | 191 |
| 721 | 3300009093 | Ga0105240_10002584 | Ga0105240_1000258415 | 191 |
| 722 | 3300009094 | Ga0111539_11096885 | Ga0111539_110968853 | 191 |
| 723 | 3300009098 | Ga0105245_10000137 | Ga0105245_1000013757 | 191 |
| 724 | 3300009101 | Ga0105247_10000106 | Ga0105247_1000010669 | 191 |
| 725 | 3300009148 | Ga0105243_10004158 | Ga0105243_100041589 | 191 |
| 726 | 3300009174 | Ga0105241_10002148 | Ga0105241_100021483 | 191 |
| 727 | 3300009176 | Ga0105242_10001041 | Ga0105242_1000104114 | 191 |
| 728 | 3300009177 | Ga0105248_10001344 | Ga0105248_1000134417 | 191 |
| 729 | 3300009545 | Ga0105237_10000599 | Ga0105237_100005999 | 191 |
| 730 | 3300009551 | Ga0105238_10000994 | Ga0105238_1000099415 | 191 |
| 731 | 3300009553 | Ga0105249_10000275 | Ga0105249_1000027517 | 191 |
| 732 | 3300010375 | Ga0105239_10003587 | Ga0105239_100035879 | 191 |
| 733 | 3300011119 | Ga0105246_10025541 | Ga0105246_100255414 | 191 |
| 734 | 3300013100 | Ga0157373_10005362 | Ga0157373_100053628 | 191 |
| 735 | 3300013102 | Ga0157371_10001570 | Ga0157371_100015704 | 191 |
| 736 | 3300013105 | Ga0157369_10000816 | Ga0157369_1000081630 | 191 |
| 737 | 3300013296 | Ga0157374_10002351 | Ga0157374_100023516 | 191 |
| 738 | 3300013297 | Ga0157378_10001420 | Ga0157378_100014209 | 191 |
| 739 | 3300013306 | Ga0163162_10000729 | Ga0163162_1000072921 | 191 |
| 740 | 3300013307 | Ga0157372_10000520 | Ga0157372_1000052017 | 191 |
| 741 | 3300013308 | Ga0157375_10003665 | Ga0157375_100036659 | 191 |
| 742 | 3300014325 | Ga0163163_10030863 | Ga0163163_100308633 | 191 |
| 743 | 3300014745 | Ga0157377_10000281 | Ga0157377_100002819 | 191 |
| 744 | 3300014968 | Ga0157379_10000385 | Ga0157379_100003859 | 191 |
| 745 | 3300014969 | Ga0157376_10001076 | Ga0157376_100010768 | 191 |
| 746 | 3300014969 | Ga0157376_10016729 | Ga0157376_100167295 | 191 |
| 747 | 3300017792 | Ga0163161_10002375 | Ga0163161_1000237510 | 191 |
| 748 | 3300025315 | Ga0207697_10000433 | Ga0207697_100004339 | 191 |
| 749 | 3300025321 | Ga0207656_10000538 | Ga0207656_1000053810 | 191 |
| 750 | 3300025893 | Ga0207682_10000118 | Ga0207682_1000011816 | 191 |
| 751 | 3300025899 | Ga0207642_10000709 | Ga0207642_100007097 | 191 |
| 752 | 3300025900 | Ga0207710_10003842 | Ga0207710_100038426 | 191 |
| 753 | 3300025901 | Ga0207688_10000174 | Ga0207688_1000017411 | 191 |
| 754 | 3300025903 | Ga0207680_10000198 | Ga0207680_1000019810 | 191 |
| 755 | 3300025904 | Ga0207647_10000568 | Ga0207647_1000056823 | 191 |
| 756 | 3300025907 | Ga0207645_10000053 | Ga0207645_1000005316 | 191 |
| 757 | 3300025908 | Ga0207643_10000013 | Ga0207643_1000001347 | 191 |
| 758 | 3300025911 | Ga0207654_10000934 | Ga0207654_1000093410 | 191 |
| 759 | 3300025913 | Ga0207695_10016806 | Ga0207695_100168067 | 191 |
| 760 | 3300025914 | Ga0207671_10008894 | Ga0207671_100088945 | 191 |
| 761 | 3300025918 | Ga0207662_10000009 | Ga0207662_1000000984 | 191 |
| 762 | 3300025919 | Ga0207657_10000042 | Ga0207657_1000004215 | 191 |
| 763 | 3300025920 | Ga0207649_10000765 | Ga0207649_100007659 | 191 |
| 764 | 3300025920 | Ga0207649_10001685 | Ga0207649_100016859 | 191 |
| 765 | 3300025921 | Ga0207652_10105629 | Ga0207652_101056292 | 191 |
| 766 | 3300025923 | Ga0207681_10000933 | Ga0207681_100009338 | 191 |
| 767 | 3300025924 | Ga0207694_10009688 | Ga0207694_100096887 | 191 |
| 768 | 3300025925 | Ga0207650_10000245 | Ga0207650_1000024516 | 191 |
| 769 | 3300025926 | Ga0207659_10000115 | Ga0207659_1000011517 | 191 |
| 770 | 3300025927 | Ga0207687_10002436 | Ga0207687_100024369 | 191 |
| 771 | 3300025931 | Ga0207644_10000201 | Ga0207644_100002016 | 191 |
| 772 | 3300025932 | Ga0207690_10001478 | Ga0207690_100014789 | 191 |
| 773 | 3300025933 | Ga0207706_10000046 | Ga0207706_1000004615 | 191 |
| 774 | 3300025934 | Ga0207686_10002723 | Ga0207686_100027232 | 191 |
| 775 | 3300025935 | Ga0207709_10004072 | Ga0207709_100040726 | 191 |
| 776 | 3300025936 | Ga0207670_10000295 | Ga0207670_100002959 | 191 |
| 777 | 3300025937 | Ga0207669_10000636 | Ga0207669_100006366 | 191 |
| 778 | 3300025938 | Ga0207704_10000747 | Ga0207704_100007476 | 191 |
| 779 | 3300025940 | Ga0207691_10000314 | Ga0207691_1000031411 | 191 |
| 780 | 3300025941 | Ga0207711_10000234 | Ga0207711_1000023416 | 191 |
| 781 | 3300025942 | Ga0207689_10000071 | Ga0207689_1000007115 | 191 |
| 782 | 3300025944 | Ga0207661_10005312 | Ga0207661_100053128 | 191 |
| 783 | 3300025945 | Ga0207679_10000111 | Ga0207679_100001119 | 191 |
| 784 | 3300025945 | Ga0207679_10000530 | Ga0207679_1000053019 | 191 |
| 785 | 3300025949 | Ga0207667_10003794 | Ga0207667_100037949 | 191 |
| 786 | 3300025960 | Ga0207651_10000270 | Ga0207651_1000027010 | 191 |
| 787 | 3300025961 | Ga0207712_10000329 | Ga0207712_100003297 | 191 |
| 788 | 3300025972 | Ga0207668_10003034 | Ga0207668_100030343 | 191 |
| 789 | 3300025981 | Ga0207640_10002320 | Ga0207640_100023206 | 191 |
| 790 | 3300025986 | Ga0207658_10000980 | Ga0207658_1000098012 | 191 |
| 791 | 3300026023 | Ga0207677_10000181 | Ga0207677_1000018144 | 191 |
| 792 | 3300026035 | Ga0207703_10001550 | Ga0207703_100015509 | 191 |
| 793 | 3300026041 | Ga0207639_10014494 | Ga0207639_100144947 | 191 |
| 794 | 3300026067 | Ga0207678_10000430 | Ga0207678_1000043025 | 191 |
| 795 | 3300026078 | Ga0207702_10000881 | Ga0207702_100008815 | 191 |
| 796 | 3300026088 | Ga0207641_10000652 | Ga0207641_1000065239 | 191 |
| 797 | 3300026089 | Ga0207648_10000302 | Ga0207648_1000030215 | 191 |
| 798 | 3300026095 | Ga0207676_10000642 | Ga0207676_1000064230 | 191 |
| 799 | 3300026116 | Ga0207674_10001952 | Ga0207674_1000195224 | 191 |
| 800 | 3300026118 | Ga0207675_100000165 | Ga0207675_10000016516 | 191 |
| 801 | 3300026121 | Ga0207683_10000211 | Ga0207683_100002116 | 191 |
| 802 | 3300026142 | Ga0207698_10000769 | Ga0207698_100007696 | 191 |
| 803 | 3300027907 | Ga0207428_10842035 | Ga0207428_108420351 | 191 |
| 804 | 3300028379 | Ga0268266_10001501 | Ga0268266_1000150117 | 191 |
| 805 | 3300028380 | Ga0268265_10000394 | Ga0268265_1000039430 | 191 |
| 806 | 3300028381 | Ga0268264_10000191 | Ga0268264_10000191108 | 191 |
| 807 | 3300039450 | Ga0436363_1179098 | Ga0436363_1179098_2442_3017 | 191 |
| 808 | 3300042005 | Ga0439448_0022702 | Ga0439448_0022702_713_1288 | 191 |
| 809 | 3300042012 | Ga0439455_0008314 | Ga0439455_0008314_1048_1623 | 191 |
| 810 | 3300045051 | Ga0451576_0041703 | Ga0451576_0041703_1552_2127 | 191 |
| 811 | 3300048905 | Ga0496102_0001137 | Ga0496102_0001137_3677_4252 | 191 |
| 812 | 3300048909 | Ga0496106_0001297 | Ga0496106_0001297_15650_16225 | 191 |
| 813 | 3300048911 | Ga0496108_0217179 | Ga0496108_0217179_260_835 | 191 |
| 814 | 3300048912 | Ga0496109_0002194 | Ga0496109_0002194_4360_4935 | 191 |
| 815 | 3300048914 | Ga0496111_0062566 | Ga0496111_0062566_1153_1728 | 191 |
| 816 | 3300048915 | Ga0496112_0017179 | Ga0496112_0017179_2142_2717 | 191 |
| 817 | 3300048916 | Ga0496113_0602811 | Ga0496113_0602811_55_630 | 191 |
| 818 | 3300050511 | nmdc:mga08y16_351843_c2 | nmdc:mga08y16_351843_c2_30_605 | 191 |
| 819 | 3300050513 | nmdc:mga0rr50_473858_c1 | nmdc:mga0rr50_473858_c1_229_804 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.7383 | 47 | 186 |
| 5vg9-assembly1.cif.gz_A | structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody | 0.7291 | 47 | 169 |
| 7bw1-assembly1.cif.gz_A | crystal structure of steroid 5-alpha-reductase 2 in complex with finasteride | 0.6312 | 55 | 171 |
| 7c83-assembly1.cif.gz_A | crystal structure of an integral membrane steroid 5-alpha-reductase pbsrd5a | 0.5828 | 79 | 184 |
| 5v7p-assembly1.cif.gz_A | atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody | 0.5576 | 47 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06539_1_164_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9885 | 8 | 170 | 1.20.120.1630 |
| af_O06539_1_164_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9766 | 8 | 170 | 1.20.120.1630 |
| af_Q2G1E3_21_189_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9345 | 1 | 170 | 1.20.120.1630 |
| af_Q2G1E3_21_189_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.9292 | 1 | 170 | 1.20.120.1630 |
| af_O60725_93_277_1.20.120.1630 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.828 | 49 | 176 | 1.20.120.1630 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S7UZI4-F1-model_v4 | Isoprenylcysteine carboxyl methyltransferase (Icmt) family | 0.9984 | 1 | 166 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A1I4FJJ8-F1-model_v4 | Alkylresorcinol O-methyltransferase | 0.9967 | 8 | 169 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A3G8ZK48-F1-model_v4 | Alkylresorcinol O-methyltransferase | 0.9949 | 5 | 169 |
GO:0004671
GO:0016020 |
| AF-A0A1H8J5B9-F1-model_v4 | Alkylresorcinol O-methyltransferase | 0.9932 | 6 | 169 |
GO:0004671
GO:0016020 GO:0032259 |
| AF-A0A561BW06-F1-model_v4 | Alkylresorcinol O-methyltransferase | 0.9927 | 4 | 169 |
GO:0004671
GO:0016020 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar