F482123
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 818 | 321 | 1636 | 125 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_101700502|Ga0070707_1017005021 |
| Length | 154 |
| Sequence | MLLEADVSLHRRLSDWYYVGAIYQRKENFMAHQHPPRFLKIVDDARSRIHETNVDEVKKRIDRGDKLLLVDVREESEYAKDHLPGAIHLGKGVIERDIEARVPDLSKEMILYCGGGFRSALAADNLQKMGYTNVISMDGGIRDWREKGFPLVKD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 125 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 126 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 127 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 128 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 203 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 204 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 214 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 223 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 288 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 289 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.27 |
| Metatranscriptomes | 0.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 5.62 |
| Rhizosphere | 93.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 24.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_101700502 | 3300005468 | Bacteria | 598 |
| 2 | MRS1b_contig_316497 | 2162886011 | Bacteria | 1307 |
| 3 | MBSR1b_contig_11250795 | 2162886012 | Unclassified | 2556 |
| 4 | MBSR1b_contig_2671148 | 2162886012 | Unclassified | 3250 |
| 5 | JGI24752J21851_1007270 | 3300001976 | Bacteria | 1444 |
| 6 | JGI24738J21930_10047428 | 3300002075 | Unclassified | 874 |
| 7 | JGI24034J26672_10000848 | 3300002239 | Unclassified | 3976 |
| 8 | JGI24751J29686_10001755 | 3300002459 | Bacteria | 4458 |
| 9 | Ga0065704_10166826 | 3300005289 | Bacteria | 1317 |
| 10 | Ga0065712_10164061 | 3300005290 | Bacteria | 1248 |
| 11 | Ga0065712_10781874 | 3300005290 | Bacteria | 518 |
| 12 | Ga0065715_10131267 | 3300005293 | Bacteria | 2011 |
| 13 | Ga0065707_10291745 | 3300005295 | Bacteria | 1023 |
| 14 | Ga0070658_10038250 | 3300005327 | Bacteria | 3870 |
| 15 | Ga0070658_11834514 | 3300005327 | Bacteria | 524 |
| 16 | Ga0070676_10291746 | 3300005328 | Unclassified | 1102 |
| 17 | Ga0070683_100015024 | 3300005329 | Bacteria | 6792 |
| 18 | Ga0070683_100087072 | 3300005329 | Unclassified | 2929 |
| 19 | Ga0070690_100286650 | 3300005330 | Unclassified | 1176 |
| 20 | Ga0070690_100991829 | 3300005330 | Unclassified | 661 |
| 21 | Ga0070670_100112644 | 3300005331 | Bacteria | 2345 |
| 22 | Ga0070670_100132044 | 3300005331 | Bacteria | 2157 |
| 23 | Ga0070670_100228026 | 3300005331 | Bacteria | 1621 |
| 24 | Ga0070677_10004017 | 3300005333 | Unclassified | 4777 |
| 25 | Ga0070677_10172617 | 3300005333 | Unclassified | 1023 |
| 26 | Ga0068869_100046481 | 3300005334 | Bacteria | 3130 |
| 27 | Ga0070666_10054759 | 3300005335 | Unclassified | 2691 |
| 28 | Ga0070666_10057347 | 3300005335 | Bacteria | 2631 |
| 29 | Ga0070666_10158711 | 3300005335 | Bacteria | 1580 |
| 30 | Ga0070666_10735820 | 3300005335 | Bacteria | 724 |
| 31 | Ga0070666_10774402 | 3300005335 | Bacteria | 706 |
| 32 | Ga0070680_100662151 | 3300005336 | Bacteria | 897 |
| 33 | Ga0070682_100008604 | 3300005337 | Bacteria | 5761 |
| 34 | Ga0070682_100092598 | 3300005337 | Bacteria | 1980 |
| 35 | Ga0068868_100001799 | 3300005338 | Bacteria | 14724 |
| 36 | Ga0068868_100151227 | 3300005338 | Unclassified | 1911 |
| 37 | Ga0068868_100284011 | 3300005338 | Unclassified | 1402 |
| 38 | Ga0070660_101870811 | 3300005339 | Bacteria | 511 |
| 39 | Ga0070689_102106746 | 3300005340 | Unclassified | 516 |
| 40 | Ga0070687_100009236 | 3300005343 | Unclassified | 4216 |
| 41 | Ga0070661_100022965 | 3300005344 | Unclassified | 4468 |
| 42 | Ga0070661_100027423 | 3300005344 | Bacteria | 4101 |
| 43 | Ga0070692_10118265 | 3300005345 | Bacteria | 1474 |
| 44 | Ga0070668_100030698 | 3300005347 | Bacteria | 4088 |
| 45 | Ga0070668_100056503 | 3300005347 | Unclassified | 3031 |
| 46 | Ga0070669_100002345 | 3300005353 | Bacteria | 13686 |
| 47 | Ga0070669_100027509 | 3300005353 | Bacteria | 4092 |
| 48 | Ga0070669_100269778 | 3300005353 | Bacteria | 1360 |
| 49 | Ga0070675_100138673 | 3300005354 | Unclassified | 2077 |
| 50 | Ga0070675_100327982 | 3300005354 | Bacteria | 1353 |
| 51 | Ga0070675_101239171 | 3300005354 | Unclassified | 687 |
| 52 | Ga0070671_100042048 | 3300005355 | Bacteria | 3799 |
| 53 | Ga0070671_100070314 | 3300005355 | Bacteria | 2920 |
| 54 | Ga0070671_100695920 | 3300005355 | Unclassified | 881 |
| 55 | Ga0070671_101043481 | 3300005355 | Bacteria | 717 |
| 56 | Ga0070671_101741420 | 3300005355 | Bacteria | 553 |
| 57 | Ga0070674_100018594 | 3300005356 | Unclassified | 4398 |
| 58 | Ga0070673_100054905 | 3300005364 | Unclassified | 3136 |
| 59 | Ga0070673_100412764 | 3300005364 | Bacteria | 1209 |
| 60 | Ga0070673_100434277 | 3300005364 | Unclassified | 1179 |
| 61 | Ga0070688_100020721 | 3300005365 | Unclassified | 3828 |
| 62 | Ga0070659_100043270 | 3300005366 | Bacteria | 3522 |
| 63 | Ga0070659_100069464 | 3300005366 | Unclassified | 2796 |
| 64 | Ga0070659_100104137 | 3300005366 | Bacteria | 2286 |
| 65 | Ga0070659_100624716 | 3300005366 | Bacteria | 927 |
| 66 | Ga0070667_100325029 | 3300005367 | Bacteria | 1389 |
| 67 | Ga0070667_100677516 | 3300005367 | Unclassified | 953 |
| 68 | Ga0070667_100684660 | 3300005367 | Bacteria | 948 |
| 69 | Ga0070667_101149872 | 3300005367 | Unclassified | 726 |
| 70 | Ga0070709_10020987 | 3300005434 | Bacteria | 3801 |
| 71 | Ga0070709_10033505 | 3300005434 | Unclassified | 3107 |
| 72 | Ga0070709_10165947 | 3300005434 | Bacteria | 1539 |
| 73 | Ga0070709_10290988 | 3300005434 | Bacteria | 1190 |
| 74 | Ga0070709_10852912 | 3300005434 | Unclassified | 718 |
| 75 | Ga0070709_11235397 | 3300005434 | Bacteria | 601 |
| 76 | Ga0070714_100003152 | 3300005435 | Bacteria | 12244 |
| 77 | Ga0070714_100103459 | 3300005435 | Bacteria | 2512 |
| 78 | Ga0070714_100194377 | 3300005435 | Bacteria | 1853 |
| 79 | Ga0070714_100870163 | 3300005435 | Unclassified | 874 |
| 80 | Ga0070713_100000078 | 3300005436 | Bacteria | 60357 |
| 81 | Ga0070713_100004392 | 3300005436 | Bacteria | 9475 |
| 82 | Ga0070713_100009108 | 3300005436 | Bacteria | 7081 |
| 83 | Ga0070713_100046576 | 3300005436 | Bacteria | 3559 |
| 84 | Ga0070713_100050736 | 3300005436 | Unclassified | 3428 |
| 85 | Ga0070713_100181091 | 3300005436 | Bacteria | 1894 |
| 86 | Ga0070713_100228922 | 3300005436 | Bacteria | 1689 |
| 87 | Ga0070713_100261006 | 3300005436 | Bacteria | 1583 |
| 88 | Ga0070713_100276539 | 3300005436 | Bacteria | 1539 |
| 89 | Ga0070713_100334033 | 3300005436 | Bacteria | 1402 |
| 90 | Ga0070713_100568610 | 3300005436 | Bacteria | 1075 |
| 91 | Ga0070713_101134528 | 3300005436 | Unclassified | 756 |
| 92 | Ga0070713_101156320 | 3300005436 | Unclassified | 749 |
| 93 | Ga0070713_101785931 | 3300005436 | Unclassified | 597 |
| 94 | Ga0070710_10021208 | 3300005437 | Bacteria | 3382 |
| 95 | Ga0070710_10099693 | 3300005437 | Bacteria | 1728 |
| 96 | Ga0070710_10301286 | 3300005437 | Unclassified | 1046 |
| 97 | Ga0070710_10704858 | 3300005437 | Unclassified | 713 |
| 98 | Ga0070710_11182211 | 3300005437 | Unclassified | 565 |
| 99 | Ga0070710_11503088 | 3300005437 | Unclassified | 506 |
| 100 | Ga0070701_10066268 | 3300005438 | Unclassified | 1918 |
| 101 | Ga0070701_10407381 | 3300005438 | Bacteria | 863 |
| 102 | Ga0070711_100000386 | 3300005439 | Bacteria | 22753 |
| 103 | Ga0070711_100000754 | 3300005439 | Bacteria | 16905 |
| 104 | Ga0070711_100008257 | 3300005439 | Bacteria | 6370 |
| 105 | Ga0070711_100009243 | 3300005439 | Bacteria | 6060 |
| 106 | Ga0070711_100165671 | 3300005439 | Bacteria | 1680 |
| 107 | Ga0070711_100455151 | 3300005439 | Unclassified | 1048 |
| 108 | Ga0070711_101075693 | 3300005439 | Unclassified | 692 |
| 109 | Ga0070711_101096488 | 3300005439 | Unclassified | 686 |
| 110 | Ga0070711_101917423 | 3300005439 | Unclassified | 521 |
| 111 | Ga0070705_101191562 | 3300005440 | Unclassified | 627 |
| 112 | Ga0070694_100150959 | 3300005444 | Bacteria | 1697 |
| 113 | Ga0070708_100000165 | 3300005445 | Bacteria | 47190 |
| 114 | Ga0070708_100005858 | 3300005445 | Bacteria | 9762 |
| 115 | Ga0070708_101119098 | 3300005445 | Unclassified | 737 |
| 116 | Ga0070663_100018963 | 3300005455 | Bacteria | 4523 |
| 117 | Ga0070663_100215521 | 3300005455 | Unclassified | 1505 |
| 118 | Ga0070678_100184191 | 3300005456 | Bacteria | 1712 |
| 119 | Ga0070678_101524007 | 3300005456 | Bacteria | 626 |
| 120 | Ga0070662_100011873 | 3300005457 | Bacteria | 5759 |
| 121 | Ga0070662_100039843 | 3300005457 | Unclassified | 3343 |
| 122 | Ga0070681_10041227 | 3300005458 | Unclassified | 4626 |
| 123 | Ga0070681_10247282 | 3300005458 | Unclassified | 1696 |
| 124 | Ga0070681_10448866 | 3300005458 | Bacteria | 1201 |
| 125 | Ga0070681_11807142 | 3300005458 | Bacteria | 538 |
| 126 | Ga0068867_100002889 | 3300005459 | Bacteria | 12087 |
| 127 | Ga0068867_100091884 | 3300005459 | Bacteria | 2304 |
| 128 | Ga0068867_100399796 | 3300005459 | Unclassified | 1158 |
| 129 | Ga0068867_100855657 | 3300005459 | Bacteria | 815 |
| 130 | Ga0070685_10005238 | 3300005466 | Bacteria | 6580 |
| 131 | Ga0070706_100021652 | 3300005467 | Bacteria | 5921 |
| 132 | Ga0070706_100037008 | 3300005467 | Bacteria | 4508 |
| 133 | Ga0070706_100053457 | 3300005467 | Bacteria | 3728 |
| 134 | Ga0070706_100692183 | 3300005467 | Unclassified | 945 |
| 135 | Ga0070707_100000237 | 3300005468 | Bacteria | 55304 |
| 136 | Ga0070707_100004396 | 3300005468 | Bacteria | 13205 |
| 137 | Ga0070707_100209273 | 3300005468 | Bacteria | 1901 |
| 138 | Ga0070707_100320020 | 3300005468 | Bacteria | 1507 |
| 139 | Ga0070698_100001730 | 3300005471 | Bacteria | 24348 |
| 140 | Ga0070698_100283454 | 3300005471 | Bacteria | 1588 |
| 141 | Ga0070699_100001358 | 3300005518 | Bacteria | 22522 |
| 142 | Ga0070699_100220592 | 3300005518 | Unclassified | 1689 |
| 143 | Ga0070699_101059018 | 3300005518 | Bacteria | 744 |
| 144 | Ga0070679_100192621 | 3300005530 | Unclassified | 2007 |
| 145 | Ga0070679_100233728 | 3300005530 | Bacteria | 1797 |
| 146 | Ga0070684_100009310 | 3300005535 | Bacteria | 7733 |
| 147 | Ga0070684_100216105 | 3300005535 | Bacteria | 1748 |
| 148 | Ga0070684_100669964 | 3300005535 | Bacteria | 966 |
| 149 | Ga0070697_100000219 | 3300005536 | Bacteria | 47258 |
| 150 | Ga0070697_100000255 | 3300005536 | Bacteria | 43116 |
| 151 | Ga0070697_100004137 | 3300005536 | Bacteria | 11119 |
| 152 | Ga0070697_100144506 | 3300005536 | Bacteria | 2002 |
| 153 | Ga0070697_102118571 | 3300005536 | Unclassified | 503 |
| 154 | Ga0068853_100063545 | 3300005539 | Bacteria | 3198 |
| 155 | Ga0068853_102105746 | 3300005539 | Bacteria | 547 |
| 156 | Ga0070672_100054517 | 3300005543 | Unclassified | 3130 |
| 157 | Ga0070672_100337778 | 3300005543 | Unclassified | 1282 |
| 158 | Ga0070686_100010469 | 3300005544 | Bacteria | 5231 |
| 159 | Ga0070686_100134840 | 3300005544 | Bacteria | 1712 |
| 160 | Ga0070686_100337064 | 3300005544 | Unclassified | 1129 |
| 161 | Ga0070695_100415891 | 3300005545 | Unclassified | 1023 |
| 162 | Ga0070695_100855180 | 3300005545 | Bacteria | 732 |
| 163 | Ga0070696_100607112 | 3300005546 | Unclassified | 883 |
| 164 | Ga0070696_100727756 | 3300005546 | Bacteria | 811 |
| 165 | Ga0070693_100034412 | 3300005547 | Bacteria | 2803 |
| 166 | Ga0070693_100366782 | 3300005547 | Unclassified | 990 |
| 167 | Ga0070693_101503052 | 3300005547 | Unclassified | 526 |
| 168 | Ga0070665_100024537 | 3300005548 | Bacteria | 6075 |
| 169 | Ga0070665_100250121 | 3300005548 | Bacteria | 1773 |
| 170 | Ga0070665_101201100 | 3300005548 | Bacteria | 769 |
| 171 | Ga0070704_100356958 | 3300005549 | Bacteria | 1235 |
| 172 | Ga0070704_100636932 | 3300005549 | Bacteria | 940 |
| 173 | Ga0070704_100946030 | 3300005549 | Bacteria | 777 |
| 174 | Ga0068855_100044277 | 3300005563 | Bacteria | 5267 |
| 175 | Ga0068855_100125691 | 3300005563 | Bacteria | 2932 |
| 176 | Ga0068855_100677752 | 3300005563 | Bacteria | 1105 |
| 177 | Ga0068855_101028626 | 3300005563 | Bacteria | 864 |
| 178 | Ga0070664_100055516 | 3300005564 | Bacteria | 3363 |
| 179 | Ga0070664_100074770 | 3300005564 | Unclassified | 2908 |
| 180 | Ga0070664_100238243 | 3300005564 | Bacteria | 1633 |
| 181 | Ga0070664_100489734 | 3300005564 | Bacteria | 1132 |
| 182 | Ga0068857_100009256 | 3300005577 | Bacteria | 8545 |
| 183 | Ga0068857_100021553 | 3300005577 | Bacteria | 5670 |
| 184 | Ga0068857_100924726 | 3300005577 | Unclassified | 837 |
| 185 | Ga0068854_100000789 | 3300005578 | Bacteria | 18846 |
| 186 | Ga0068854_100012581 | 3300005578 | Bacteria | 5544 |
| 187 | Ga0068856_100003171 | 3300005614 | Bacteria | 16740 |
| 188 | Ga0068856_100013107 | 3300005614 | Bacteria | 8030 |
| 189 | Ga0068856_100041231 | 3300005614 | Bacteria | 4536 |
| 190 | Ga0068856_101013736 | 3300005614 | Unclassified | 848 |
| 191 | Ga0068856_101077299 | 3300005614 | Unclassified | 821 |
| 192 | Ga0068856_101117617 | 3300005614 | Bacteria | 805 |
| 193 | Ga0068856_102399896 | 3300005614 | Unclassified | 535 |
| 194 | Ga0070702_100002231 | 3300005615 | Bacteria | 8270 |
| 195 | Ga0070702_100579803 | 3300005615 | Unclassified | 837 |
| 196 | Ga0068852_100003988 | 3300005616 | Bacteria | 10375 |
| 197 | Ga0068852_100039180 | 3300005616 | Bacteria | 3989 |
| 198 | Ga0068852_100823304 | 3300005616 | Bacteria | 943 |
| 199 | Ga0068859_100186287 | 3300005617 | Bacteria | 2159 |
| 200 | Ga0068859_101107534 | 3300005617 | Bacteria | 871 |
| 201 | Ga0068864_100017709 | 3300005618 | Bacteria | 5943 |
| 202 | Ga0068864_100030716 | 3300005618 | Bacteria | 4555 |
| 203 | Ga0068864_100129429 | 3300005618 | Bacteria | 2266 |
| 204 | Ga0068866_10013563 | 3300005718 | Bacteria | 3580 |
| 205 | Ga0068866_10077914 | 3300005718 | Bacteria | 1772 |
| 206 | Ga0068866_10228789 | 3300005718 | Unclassified | 1126 |
| 207 | Ga0068866_10640111 | 3300005718 | Unclassified | 723 |
| 208 | Ga0068861_100017290 | 3300005719 | Bacteria | 5116 |
| 209 | Ga0068861_100095205 | 3300005719 | Bacteria | 2358 |
| 210 | Ga0068851_10002806 | 3300005834 | Bacteria | 7680 |
| 211 | Ga0068851_10019123 | 3300005834 | Bacteria | 3308 |
| 212 | Ga0068851_10191828 | 3300005834 | Unclassified | 1136 |
| 213 | Ga0068863_100009036 | 3300005841 | Bacteria | 9732 |
| 214 | Ga0068863_100024318 | 3300005841 | Bacteria | 5777 |
| 215 | Ga0068863_100029719 | 3300005841 | Bacteria | 5218 |
| 216 | Ga0068863_100058963 | 3300005841 | Unclassified | 3632 |
| 217 | Ga0068863_100642106 | 3300005841 | Unclassified | 1052 |
| 218 | Ga0068858_100040727 | 3300005842 | Bacteria | 4309 |
| 219 | Ga0068858_100066333 | 3300005842 | Bacteria | 3341 |
| 220 | Ga0068858_100996084 | 3300005842 | Bacteria | 821 |
| 221 | Ga0068860_100110092 | 3300005843 | Unclassified | 2632 |
| 222 | Ga0068860_100176431 | 3300005843 | Bacteria | 2065 |
| 223 | Ga0068860_100303695 | 3300005843 | Unclassified | 1564 |
| 224 | Ga0068860_101063902 | 3300005843 | Unclassified | 828 |
| 225 | Ga0068862_100021905 | 3300005844 | Bacteria | 5344 |
| 226 | Ga0068862_100025552 | 3300005844 | Bacteria | 4958 |
| 227 | Ga0068862_101116400 | 3300005844 | Unclassified | 784 |
| 228 | Ga0081540_1071536 | 3300005983 | Unclassified | 1602 |
| 229 | Ga0070717_10001788 | 3300006028 | Bacteria | 14986 |
| 230 | Ga0070717_10001810 | 3300006028 | Bacteria | 14936 |
| 231 | Ga0070717_10003192 | 3300006028 | Bacteria | 11711 |
| 232 | Ga0070717_10008829 | 3300006028 | Bacteria | 7548 |
| 233 | Ga0070717_10015935 | 3300006028 | Bacteria | 5818 |
| 234 | Ga0070717_10025374 | 3300006028 | Bacteria | 4712 |
| 235 | Ga0070717_10032861 | 3300006028 | Bacteria | 4182 |
| 236 | Ga0070717_10052783 | 3300006028 | Bacteria | 3350 |
| 237 | Ga0070717_10061951 | 3300006028 | Bacteria | 3101 |
| 238 | Ga0070717_10202369 | 3300006028 | Bacteria | 1740 |
| 239 | Ga0070717_10432732 | 3300006028 | Bacteria | 1184 |
| 240 | Ga0070717_10494520 | 3300006028 | Bacteria | 1105 |
| 241 | Ga0070717_10729339 | 3300006028 | Unclassified | 901 |
| 242 | Ga0070717_10849705 | 3300006028 | Bacteria | 831 |
| 243 | Ga0070717_10920840 | 3300006028 | Unclassified | 796 |
| 244 | Ga0070715_10001686 | 3300006163 | Bacteria | 6564 |
| 245 | Ga0070715_10008384 | 3300006163 | Bacteria | 3599 |
| 246 | Ga0070715_10138833 | 3300006163 | Bacteria | 1178 |
| 247 | Ga0070715_10183766 | 3300006163 | Bacteria | 1050 |
| 248 | Ga0070716_100000288 | 3300006173 | Bacteria | 20376 |
| 249 | Ga0070716_100000356 | 3300006173 | Bacteria | 18763 |
| 250 | Ga0070716_100060898 | 3300006173 | Unclassified | 2182 |
| 251 | Ga0070716_100090148 | 3300006173 | Bacteria | 1854 |
| 252 | Ga0070716_100149460 | 3300006173 | Bacteria | 1500 |
| 253 | Ga0070716_100195395 | 3300006173 | Bacteria | 1340 |
| 254 | Ga0070716_100205282 | 3300006173 | Bacteria | 1313 |
| 255 | Ga0070716_100669238 | 3300006173 | Bacteria | 789 |
| 256 | Ga0070716_101168239 | 3300006173 | Bacteria | 617 |
| 257 | Ga0070712_100000122 | 3300006175 | Bacteria | 40912 |
| 258 | Ga0070712_100000856 | 3300006175 | Bacteria | 18132 |
| 259 | Ga0070712_100001565 | 3300006175 | Bacteria | 13997 |
| 260 | Ga0070712_100019012 | 3300006175 | Bacteria | 4471 |
| 261 | Ga0070712_100030354 | 3300006175 | Bacteria | 3631 |
| 262 | Ga0070712_100209273 | 3300006175 | Bacteria | 1537 |
| 263 | Ga0070712_100388223 | 3300006175 | Bacteria | 1151 |
| 264 | Ga0070712_100443237 | 3300006175 | Bacteria | 1080 |
| 265 | Ga0070712_100923654 | 3300006175 | Unclassified | 753 |
| 266 | Ga0097621_100000357 | 3300006237 | Bacteria | 31608 |
| 267 | Ga0097621_100049800 | 3300006237 | Bacteria | 3405 |
| 268 | Ga0097621_100056451 | 3300006237 | Bacteria | 3208 |
| 269 | Ga0097621_100066331 | 3300006237 | Bacteria | 2972 |
| 270 | Ga0097621_100895424 | 3300006237 | Unclassified | 826 |
| 271 | Ga0068871_100002520 | 3300006358 | Bacteria | 12489 |
| 272 | Ga0068871_100008262 | 3300006358 | Bacteria | 7483 |
| 273 | Ga0068871_100012801 | 3300006358 | Bacteria | 6207 |
| 274 | Ga0068871_100041414 | 3300006358 | Bacteria | 3694 |
| 275 | Ga0068871_100195450 | 3300006358 | Unclassified | 1744 |
| 276 | Ga0075433_10035246 | 3300006852 | Unclassified | 4302 |
| 277 | Ga0075434_100000226 | 3300006871 | Bacteria | 38665 |
| 278 | Ga0075434_100005438 | 3300006871 | Bacteria | 11599 |
| 279 | Ga0075434_100216732 | 3300006871 | Unclassified | 1934 |
| 280 | Ga0068865_100016983 | 3300006881 | Unclassified | 4671 |
| 281 | Ga0068865_100206001 | 3300006881 | Bacteria | 1530 |
| 282 | Ga0068865_100807854 | 3300006881 | Bacteria | 809 |
| 283 | Ga0075436_100021337 | 3300006914 | Bacteria | 4447 |
| 284 | Ga0075436_100331226 | 3300006914 | Unclassified | 1095 |
| 285 | Ga0075436_100567313 | 3300006914 | Bacteria | 834 |
| 286 | Ga0097620_100186292 | 3300006931 | Bacteria | 2159 |
| 287 | Ga0097620_101107490 | 3300006931 | Bacteria | 871 |
| 288 | Ga0075435_100000168 | 3300007076 | Bacteria | 38177 |
| 289 | Ga0075435_100129735 | 3300007076 | Unclassified | 2109 |
| 290 | Ga0075435_100914950 | 3300007076 | Unclassified | 765 |
| 291 | Ga0105250_10041069 | 3300009092 | Bacteria | 1855 |
| 292 | Ga0105250_10513747 | 3300009092 | Bacteria | 545 |
| 293 | Ga0105240_10023277 | 3300009093 | Bacteria | 8197 |
| 294 | Ga0105240_10037314 | 3300009093 | Bacteria | 6246 |
| 295 | Ga0105240_10091094 | 3300009093 | Bacteria | 3726 |
| 296 | Ga0105240_10102006 | 3300009093 | Bacteria | 3488 |
| 297 | Ga0105240_10126190 | 3300009093 | Bacteria | 3075 |
| 298 | Ga0105240_11787203 | 3300009093 | Unclassified | 641 |
| 299 | Ga0105245_10004274 | 3300009098 | Bacteria | 12665 |
| 300 | Ga0105245_10018930 | 3300009098 | Bacteria | 6026 |
| 301 | Ga0105245_10026018 | 3300009098 | Bacteria | 5149 |
| 302 | Ga0105245_10108037 | 3300009098 | Bacteria | 2584 |
| 303 | Ga0105245_10803906 | 3300009098 | Unclassified | 978 |
| 304 | Ga0105247_10002806 | 3300009101 | Bacteria | 11651 |
| 305 | Ga0105247_10016109 | 3300009101 | Bacteria | 4478 |
| 306 | Ga0105247_10066124 | 3300009101 | Bacteria | 2251 |
| 307 | Ga0105241_10063350 | 3300009174 | Bacteria | 2852 |
| 308 | Ga0105241_10154906 | 3300009174 | Bacteria | 1878 |
| 309 | Ga0105241_10173823 | 3300009174 | Bacteria | 1781 |
| 310 | Ga0105241_10872625 | 3300009174 | Unclassified | 834 |
| 311 | Ga0105242_10015341 | 3300009176 | Bacteria | 5950 |
| 312 | Ga0105242_10030649 | 3300009176 | Unclassified | 4295 |
| 313 | Ga0105242_10031689 | 3300009176 | Bacteria | 4225 |
| 314 | Ga0105242_10217991 | 3300009176 | Bacteria | 1704 |
| 315 | Ga0105242_10966369 | 3300009176 | Bacteria | 857 |
| 316 | Ga0105248_10069448 | 3300009177 | Unclassified | 3955 |
| 317 | Ga0105248_10189958 | 3300009177 | Bacteria | 2314 |
| 318 | Ga0105248_11113251 | 3300009177 | Bacteria | 893 |
| 319 | Ga0105248_11418973 | 3300009177 | Unclassified | 786 |
| 320 | Ga0105237_10037403 | 3300009545 | Bacteria | 4906 |
| 321 | Ga0105237_10256780 | 3300009545 | Bacteria | 1750 |
| 322 | Ga0105237_10296808 | 3300009545 | Unclassified | 1619 |
| 323 | Ga0105237_10977898 | 3300009545 | Bacteria | 853 |
| 324 | Ga0105237_11149668 | 3300009545 | Unclassified | 783 |
| 325 | Ga0105237_11833730 | 3300009545 | Bacteria | 614 |
| 326 | Ga0105237_12087010 | 3300009545 | Bacteria | 576 |
| 327 | Ga0105238_10128329 | 3300009551 | Bacteria | 2514 |
| 328 | Ga0105238_10151964 | 3300009551 | Unclassified | 2290 |
| 329 | Ga0105238_10514723 | 3300009551 | Bacteria | 1199 |
| 330 | Ga0105238_12654493 | 3300009551 | Bacteria | 537 |
| 331 | Ga0105249_10069419 | 3300009553 | Bacteria | 3252 |
| 332 | Ga0105239_10021589 | 3300010375 | Bacteria | 7100 |
| 333 | Ga0105239_10106738 | 3300010375 | Bacteria | 3102 |
| 334 | Ga0105246_10003125 | 3300011119 | Bacteria | 10051 |
| 335 | Ga0105246_10010046 | 3300011119 | Bacteria | 5841 |
| 336 | Ga0105246_10204126 | 3300011119 | Bacteria | 1539 |
| 337 | Ga0157315_1011868 | 3300012508 | Unclassified | 794 |
| 338 | Ga0157373_10008912 | 3300013100 | Bacteria | 7424 |
| 339 | Ga0157373_10134686 | 3300013100 | Bacteria | 1737 |
| 340 | Ga0157371_10004902 | 3300013102 | Bacteria | 11495 |
| 341 | Ga0157371_10015784 | 3300013102 | Bacteria | 5651 |
| 342 | Ga0157370_10262317 | 3300013104 | Bacteria | 1597 |
| 343 | Ga0157370_11721224 | 3300013104 | Bacteria | 563 |
| 344 | Ga0157369_10020489 | 3300013105 | Bacteria | 7392 |
| 345 | Ga0157369_10137478 | 3300013105 | Bacteria | 2586 |
| 346 | Ga0157369_10206668 | 3300013105 | Bacteria | 2059 |
| 347 | Ga0157369_11461986 | 3300013105 | Unclassified | 695 |
| 348 | Ga0157374_10005829 | 3300013296 | Bacteria | 10407 |
| 349 | Ga0157374_10022318 | 3300013296 | Bacteria | 5645 |
| 350 | Ga0157374_10043071 | 3300013296 | Bacteria | 4167 |
| 351 | Ga0157374_10082094 | 3300013296 | Bacteria | 3060 |
| 352 | Ga0157374_11020099 | 3300013296 | Unclassified | 847 |
| 353 | Ga0157374_11428465 | 3300013296 | Unclassified | 715 |
| 354 | Ga0157374_12357158 | 3300013296 | Bacteria | 559 |
| 355 | Ga0157378_10000800 | 3300013297 | Bacteria | 29301 |
| 356 | Ga0157378_10022475 | 3300013297 | Bacteria | 5551 |
| 357 | Ga0157378_10136455 | 3300013297 | Unclassified | 2275 |
| 358 | Ga0157378_10235044 | 3300013297 | Unclassified | 1748 |
| 359 | Ga0163162_10004807 | 3300013306 | Bacteria | 13032 |
| 360 | Ga0163162_10006725 | 3300013306 | Bacteria | 11152 |
| 361 | Ga0163162_10087941 | 3300013306 | Unclassified | 3186 |
| 362 | Ga0163162_10158077 | 3300013306 | Unclassified | 2387 |
| 363 | Ga0163162_10237409 | 3300013306 | Unclassified | 1953 |
| 364 | Ga0157372_10002533 | 3300013307 | Bacteria | 19823 |
| 365 | Ga0157372_10002813 | 3300013307 | Bacteria | 18797 |
| 366 | Ga0157372_10017457 | 3300013307 | Bacteria | 7704 |
| 367 | Ga0157372_10052308 | 3300013307 | Unclassified | 4547 |
| 368 | Ga0157372_10054817 | 3300013307 | Bacteria | 4450 |
| 369 | Ga0157372_10122014 | 3300013307 | Unclassified | 2994 |
| 370 | Ga0157372_11583909 | 3300013307 | Bacteria | 754 |
| 371 | Ga0157375_10004437 | 3300013308 | Bacteria | 12187 |
| 372 | Ga0157375_10097633 | 3300013308 | Bacteria | 3013 |
| 373 | Ga0157375_10104072 | 3300013308 | Unclassified | 2927 |
| 374 | Ga0163163_10043265 | 3300014325 | Bacteria | 4415 |
| 375 | Ga0163163_10156945 | 3300014325 | Unclassified | 2320 |
| 376 | Ga0163163_10314026 | 3300014325 | Bacteria | 1620 |
| 377 | Ga0163163_10490003 | 3300014325 | Bacteria | 1291 |
| 378 | Ga0157380_10079557 | 3300014326 | Unclassified | 2677 |
| 379 | Ga0157377_10053915 | 3300014745 | Unclassified | 2275 |
| 380 | Ga0157379_10005802 | 3300014968 | Bacteria | 10624 |
| 381 | Ga0157379_10087830 | 3300014968 | Unclassified | 2787 |
| 382 | Ga0157379_11125050 | 3300014968 | Unclassified | 753 |
| 383 | Ga0157379_11987589 | 3300014968 | Unclassified | 574 |
| 384 | Ga0157376_10030437 | 3300014969 | Bacteria | 4310 |
| 385 | Ga0157376_10085011 | 3300014969 | Unclassified | 2725 |
| 386 | Ga0157376_10091625 | 3300014969 | Bacteria | 2634 |
| 387 | Ga0157376_10157945 | 3300014969 | Unclassified | 2052 |
| 388 | Ga0157376_10200968 | 3300014969 | Bacteria | 1834 |
| 389 | Ga0182007_10188148 | 3300015262 | Bacteria | 717 |
| 390 | Ga0163161_10022315 | 3300017792 | Unclassified | 4456 |
| 391 | Ga0213876_10151738 | 3300021384 | Unclassified | 1232 |
| 392 | Ga0224569_100043 | 3300022732 | Bacteria | 7860 |
| 393 | Ga0224569_106812 | 3300022732 | Bacteria | 832 |
| 394 | Ga0224571_102676 | 3300022734 | Bacteria | 1134 |
| 395 | Ga0224572_1018284 | 3300024225 | Bacteria | 1347 |
| 396 | Ga0228598_1000208 | 3300024227 | Bacteria | 10902 |
| 397 | Ga0228598_1000381 | 3300024227 | Bacteria | 8892 |
| 398 | Ga0207697_10001848 | 3300025315 | Bacteria | 11325 |
| 399 | Ga0207656_10015800 | 3300025321 | Bacteria | 2927 |
| 400 | Ga0207682_10023115 | 3300025893 | Unclassified | 2454 |
| 401 | Ga0207692_10048718 | 3300025898 | Bacteria | 2135 |
| 402 | Ga0207692_10077445 | 3300025898 | Bacteria | 1769 |
| 403 | Ga0207692_10126961 | 3300025898 | Bacteria | 1436 |
| 404 | Ga0207692_10336307 | 3300025898 | Unclassified | 927 |
| 405 | Ga0207692_10366786 | 3300025898 | Unclassified | 891 |
| 406 | Ga0207642_10024098 | 3300025899 | Unclassified | 2442 |
| 407 | Ga0207642_10041421 | 3300025899 | Bacteria | 2016 |
| 408 | Ga0207642_10383712 | 3300025899 | Unclassified | 837 |
| 409 | Ga0207710_10058089 | 3300025900 | Bacteria | 1748 |
| 410 | Ga0207688_10004671 | 3300025901 | Bacteria | 7464 |
| 411 | Ga0207680_10203231 | 3300025903 | Bacteria | 1351 |
| 412 | Ga0207680_10294411 | 3300025903 | Unclassified | 1130 |
| 413 | Ga0207647_10019456 | 3300025904 | Bacteria | 4566 |
| 414 | Ga0207647_10038958 | 3300025904 | Bacteria | 3002 |
| 415 | Ga0207685_10044828 | 3300025905 | Bacteria | 1674 |
| 416 | Ga0207685_10084469 | 3300025905 | Unclassified | 1322 |
| 417 | Ga0207685_10102705 | 3300025905 | Bacteria | 1225 |
| 418 | Ga0207699_10041622 | 3300025906 | Bacteria | 2655 |
| 419 | Ga0207699_10046173 | 3300025906 | Bacteria | 2546 |
| 420 | Ga0207699_10094811 | 3300025906 | Unclassified | 1880 |
| 421 | Ga0207699_10103928 | 3300025906 | Bacteria | 1808 |
| 422 | Ga0207699_10122850 | 3300025906 | Bacteria | 1682 |
| 423 | Ga0207699_10913738 | 3300025906 | Unclassified | 648 |
| 424 | Ga0207699_11056978 | 3300025906 | Bacteria | 601 |
| 425 | Ga0207645_10001098 | 3300025907 | Bacteria | 22307 |
| 426 | Ga0207645_10030387 | 3300025907 | Bacteria | 3480 |
| 427 | Ga0207643_10001772 | 3300025908 | Bacteria | 12042 |
| 428 | Ga0207705_11436308 | 3300025909 | Bacteria | 524 |
| 429 | Ga0207684_10000948 | 3300025910 | Bacteria | 32649 |
| 430 | Ga0207684_10009358 | 3300025910 | Bacteria | 8655 |
| 431 | Ga0207684_10044251 | 3300025910 | Bacteria | 3775 |
| 432 | Ga0207684_10517361 | 3300025910 | Unclassified | 1022 |
| 433 | Ga0207654_10075701 | 3300025911 | Unclassified | 2012 |
| 434 | Ga0207654_10135112 | 3300025911 | Bacteria | 1566 |
| 435 | Ga0207654_10955021 | 3300025911 | Unclassified | 622 |
| 436 | Ga0207707_10080337 | 3300025912 | Bacteria | 2847 |
| 437 | Ga0207707_10083763 | 3300025912 | Unclassified | 2784 |
| 438 | Ga0207707_10431636 | 3300025912 | Bacteria | 1128 |
| 439 | Ga0207695_10029850 | 3300025913 | Bacteria | 6015 |
| 440 | Ga0207695_10050228 | 3300025913 | Bacteria | 4389 |
| 441 | Ga0207695_10137998 | 3300025913 | Bacteria | 2390 |
| 442 | Ga0207671_10092049 | 3300025914 | Unclassified | 2286 |
| 443 | Ga0207671_11089466 | 3300025914 | Bacteria | 628 |
| 444 | Ga0207693_10000291 | 3300025915 | Bacteria | 46501 |
| 445 | Ga0207693_10000329 | 3300025915 | Bacteria | 43804 |
| 446 | Ga0207693_10003500 | 3300025915 | Bacteria | 13400 |
| 447 | Ga0207693_10007344 | 3300025915 | Bacteria | 9061 |
| 448 | Ga0207693_10060885 | 3300025915 | Bacteria | 2957 |
| 449 | Ga0207693_10863689 | 3300025915 | Bacteria | 695 |
| 450 | Ga0207693_11483078 | 3300025915 | Bacteria | 501 |
| 451 | Ga0207663_10000255 | 3300025916 | Bacteria | 23196 |
| 452 | Ga0207663_10039702 | 3300025916 | Bacteria | 2854 |
| 453 | Ga0207663_10046890 | 3300025916 | Bacteria | 2665 |
| 454 | Ga0207663_10180531 | 3300025916 | Bacteria | 1507 |
| 455 | Ga0207663_10301231 | 3300025916 | Unclassified | 1198 |
| 456 | Ga0207663_10532453 | 3300025916 | Bacteria | 916 |
| 457 | Ga0207663_10559602 | 3300025916 | Unclassified | 895 |
| 458 | Ga0207663_10832924 | 3300025916 | Bacteria | 736 |
| 459 | Ga0207663_10858286 | 3300025916 | Unclassified | 725 |
| 460 | Ga0207662_10001367 | 3300025918 | Bacteria | 11792 |
| 461 | Ga0207657_10000565 | 3300025919 | Bacteria | 39272 |
| 462 | Ga0207657_10001923 | 3300025919 | Bacteria | 22431 |
| 463 | Ga0207657_10541530 | 3300025919 | Bacteria | 910 |
| 464 | Ga0207649_10002266 | 3300025920 | Bacteria | 10837 |
| 465 | Ga0207649_10011638 | 3300025920 | Bacteria | 4859 |
| 466 | Ga0207652_10177814 | 3300025921 | Unclassified | 1911 |
| 467 | Ga0207646_10002093 | 3300025922 | Bacteria | 23946 |
| 468 | Ga0207646_10041715 | 3300025922 | Bacteria | 4124 |
| 469 | Ga0207646_10175215 | 3300025922 | Bacteria | 1937 |
| 470 | Ga0207681_10025449 | 3300025923 | Bacteria | 3807 |
| 471 | Ga0207694_10066362 | 3300025924 | Bacteria | 2815 |
| 472 | Ga0207694_10268493 | 3300025924 | Bacteria | 1399 |
| 473 | Ga0207694_10372425 | 3300025924 | Bacteria | 1184 |
| 474 | Ga0207650_10000024 | 3300025925 | Bacteria | 299184 |
| 475 | Ga0207659_10410370 | 3300025926 | Bacteria | 1134 |
| 476 | Ga0207659_10781280 | 3300025926 | Bacteria | 820 |
| 477 | Ga0207659_11507729 | 3300025926 | Bacteria | 575 |
| 478 | Ga0207687_10003046 | 3300025927 | Bacteria | 11366 |
| 479 | Ga0207687_10028681 | 3300025927 | Unclassified | 3740 |
| 480 | Ga0207687_10476342 | 3300025927 | Bacteria | 1039 |
| 481 | Ga0207700_10000090 | 3300025928 | Bacteria | 55960 |
| 482 | Ga0207700_10094623 | 3300025928 | Unclassified | 2368 |
| 483 | Ga0207700_10122615 | 3300025928 | Unclassified | 2110 |
| 484 | Ga0207700_10139958 | 3300025928 | Unclassified | 1987 |
| 485 | Ga0207700_10186491 | 3300025928 | Bacteria | 1740 |
| 486 | Ga0207700_10255559 | 3300025928 | Bacteria | 1498 |
| 487 | Ga0207700_10282069 | 3300025928 | Unclassified | 1429 |
| 488 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 489 | Ga0207664_10013251 | 3300025929 | Bacteria | 5910 |
| 490 | Ga0207664_10023579 | 3300025929 | Bacteria | 4613 |
| 491 | Ga0207664_10329922 | 3300025929 | Unclassified | 1347 |
| 492 | Ga0207664_10494844 | 3300025929 | Bacteria | 1094 |
| 493 | Ga0207644_10031006 | 3300025931 | Bacteria | 3723 |
| 494 | Ga0207644_10786921 | 3300025931 | Bacteria | 795 |
| 495 | Ga0207690_10563342 | 3300025932 | Bacteria | 927 |
| 496 | Ga0207706_10000258 | 3300025933 | Bacteria | 57913 |
| 497 | Ga0207706_10000504 | 3300025933 | Bacteria | 41549 |
| 498 | Ga0207686_10055306 | 3300025934 | Bacteria | 2489 |
| 499 | Ga0207709_10253842 | 3300025935 | Bacteria | 1286 |
| 500 | Ga0207670_10006308 | 3300025936 | Bacteria | 6569 |
| 501 | Ga0207669_10169654 | 3300025937 | Bacteria | 1552 |
| 502 | Ga0207704_10010046 | 3300025938 | Bacteria | 4596 |
| 503 | Ga0207704_10430155 | 3300025938 | Bacteria | 1049 |
| 504 | Ga0207665_10000189 | 3300025939 | Bacteria | 41548 |
| 505 | Ga0207665_10029454 | 3300025939 | Bacteria | 3629 |
| 506 | Ga0207665_10039540 | 3300025939 | Bacteria | 3144 |
| 507 | Ga0207665_10090189 | 3300025939 | Bacteria | 2124 |
| 508 | Ga0207665_10121700 | 3300025939 | Bacteria | 1844 |
| 509 | Ga0207665_10156114 | 3300025939 | Bacteria | 1638 |
| 510 | Ga0207665_10165565 | 3300025939 | Bacteria | 1593 |
| 511 | Ga0207691_10000683 | 3300025940 | Bacteria | 33513 |
| 512 | Ga0207691_10248110 | 3300025940 | Unclassified | 1537 |
| 513 | Ga0207691_11203641 | 3300025940 | Bacteria | 628 |
| 514 | Ga0207711_10007967 | 3300025941 | Bacteria | 8862 |
| 515 | Ga0207711_10320375 | 3300025941 | Bacteria | 1432 |
| 516 | Ga0207711_10470932 | 3300025941 | Bacteria | 1170 |
| 517 | Ga0207711_10750188 | 3300025941 | Bacteria | 910 |
| 518 | Ga0207689_10000570 | 3300025942 | Bacteria | 35269 |
| 519 | Ga0207661_10053532 | 3300025944 | Bacteria | 3230 |
| 520 | Ga0207679_10000327 | 3300025945 | Bacteria | 35497 |
| 521 | Ga0207679_10055409 | 3300025945 | Bacteria | 2922 |
| 522 | Ga0207679_10327795 | 3300025945 | Bacteria | 1328 |
| 523 | Ga0207679_10577726 | 3300025945 | Bacteria | 1011 |
| 524 | Ga0207667_10032052 | 3300025949 | Bacteria | 5666 |
| 525 | Ga0207667_10571837 | 3300025949 | Bacteria | 1142 |
| 526 | Ga0207667_10653419 | 3300025949 | Bacteria | 1057 |
| 527 | Ga0207651_10237474 | 3300025960 | Unclassified | 1483 |
| 528 | Ga0207651_10371747 | 3300025960 | Bacteria | 1209 |
| 529 | Ga0207651_10389492 | 3300025960 | Bacteria | 1183 |
| 530 | Ga0207651_11497136 | 3300025960 | Unclassified | 608 |
| 531 | Ga0207712_10032531 | 3300025961 | Bacteria | 3521 |
| 532 | Ga0207668_10040917 | 3300025972 | Bacteria | 3130 |
| 533 | Ga0207640_10011062 | 3300025981 | Bacteria | 5098 |
| 534 | Ga0207640_10034094 | 3300025981 | Bacteria | 3174 |
| 535 | Ga0207640_10673827 | 3300025981 | Unclassified | 884 |
| 536 | Ga0207658_10006164 | 3300025986 | Bacteria | 8185 |
| 537 | Ga0207658_10553040 | 3300025986 | Bacteria | 1030 |
| 538 | Ga0207677_10027086 | 3300026023 | Bacteria | 3605 |
| 539 | Ga0207677_10046561 | 3300026023 | Bacteria | 2905 |
| 540 | Ga0207703_10248118 | 3300026035 | Bacteria | 1603 |
| 541 | Ga0207703_10355748 | 3300026035 | Unclassified | 1349 |
| 542 | Ga0207703_10642859 | 3300026035 | Bacteria | 1006 |
| 543 | Ga0207639_10059623 | 3300026041 | Bacteria | 2941 |
| 544 | Ga0207678_10001570 | 3300026067 | Bacteria | 21013 |
| 545 | Ga0207678_10016090 | 3300026067 | Bacteria | 6568 |
| 546 | Ga0207678_10744387 | 3300026067 | Bacteria | 864 |
| 547 | Ga0207702_10001662 | 3300026078 | Bacteria | 21972 |
| 548 | Ga0207702_10017140 | 3300026078 | Bacteria | 5992 |
| 549 | Ga0207702_10303728 | 3300026078 | Bacteria | 1515 |
| 550 | Ga0207702_10805655 | 3300026078 | Bacteria | 928 |
| 551 | Ga0207702_11667536 | 3300026078 | Bacteria | 630 |
| 552 | Ga0207702_11750635 | 3300026078 | Unclassified | 614 |
| 553 | Ga0207641_10000317 | 3300026088 | Bacteria | 59841 |
| 554 | Ga0207641_10049391 | 3300026088 | Bacteria | 3555 |
| 555 | Ga0207641_10348170 | 3300026088 | Bacteria | 1411 |
| 556 | Ga0207641_10356393 | 3300026088 | Unclassified | 1395 |
| 557 | Ga0207641_12362393 | 3300026088 | Unclassified | 531 |
| 558 | Ga0207648_10000031 | 3300026089 | Bacteria | 129124 |
| 559 | Ga0207648_10010760 | 3300026089 | Bacteria | 8643 |
| 560 | Ga0207648_10715521 | 3300026089 | Unclassified | 928 |
| 561 | Ga0207676_10000334 | 3300026095 | Bacteria | 40515 |
| 562 | Ga0207676_10067135 | 3300026095 | Bacteria | 2864 |
| 563 | Ga0207676_11277541 | 3300026095 | Unclassified | 728 |
| 564 | Ga0207674_10000150 | 3300026116 | Bacteria | 81671 |
| 565 | Ga0207674_10016677 | 3300026116 | Bacteria | 8027 |
| 566 | Ga0207674_10022627 | 3300026116 | Bacteria | 6746 |
| 567 | Ga0207675_100025403 | 3300026118 | Bacteria | 5514 |
| 568 | Ga0207675_100915587 | 3300026118 | Unclassified | 893 |
| 569 | Ga0207683_10010134 | 3300026121 | Bacteria | 8041 |
| 570 | Ga0207683_10085192 | 3300026121 | Bacteria | 2809 |
| 571 | Ga0207683_11206249 | 3300026121 | Bacteria | 701 |
| 572 | Ga0207698_10155577 | 3300026142 | Bacteria | 1991 |
| 573 | Ga0207698_10281598 | 3300026142 | Bacteria | 1538 |
| 574 | Ga0207698_11442376 | 3300026142 | Bacteria | 703 |
| 575 | Ga0268266_10023113 | 3300028379 | Bacteria | 5292 |
| 576 | Ga0268266_10179115 | 3300028379 | Bacteria | 1929 |
| 577 | Ga0268266_10262285 | 3300028379 | Unclassified | 1601 |
| 578 | Ga0268266_10876124 | 3300028379 | Bacteria | 868 |
| 579 | Ga0268266_11643365 | 3300028379 | Bacteria | 618 |
| 580 | Ga0268265_10031193 | 3300028380 | Bacteria | 3847 |
| 581 | Ga0268265_10569846 | 3300028380 | Unclassified | 1077 |
| 582 | Ga0268264_10047973 | 3300028381 | Bacteria | 3551 |
| 583 | Ga0268264_10057809 | 3300028381 | Unclassified | 3245 |
| 584 | Ga0268264_10351971 | 3300028381 | Unclassified | 1402 |
| 585 | Ga0268264_10535614 | 3300028381 | Unclassified | 1147 |
| 586 | Ga0268264_10662405 | 3300028381 | Bacteria | 1034 |
| 587 | Ga0268264_10705210 | 3300028381 | Unclassified | 1002 |
| 588 | Ga0268264_11101990 | 3300028381 | Bacteria | 802 |
| 589 | Ga0265319_1142153 | 3300028563 | Unclassified | 744 |
| 590 | Ga0265336_10132448 | 3300028666 | Unclassified | 742 |
| 591 | Ga0265338_10022509 | 3300028800 | Bacteria | 6521 |
| 592 | Ga0265338_10022779 | 3300028800 | Bacteria | 6467 |
| 593 | Ga0265338_10088705 | 3300028800 | Unclassified | 2565 |
| 594 | Ga0265338_10185204 | 3300028800 | Bacteria | 1583 |
| 595 | Ga0265338_10212832 | 3300028800 | Bacteria | 1449 |
| 596 | Ga0265338_10218171 | 3300028800 | Bacteria | 1426 |
| 597 | Ga0265338_11103488 | 3300028800 | Bacteria | 534 |
| 598 | Ga0265762_1001035 | 3300030760 | Unclassified | 4995 |
| 599 | Ga0265760_10000724 | 3300031090 | Bacteria | 9406 |
| 600 | Ga0265760_10001114 | 3300031090 | Bacteria | 7798 |
| 601 | Ga0265760_10002930 | 3300031090 | Bacteria | 4988 |
| 602 | Ga0265760_10008011 | 3300031090 | Bacteria | 3017 |
| 603 | Ga0265760_10174131 | 3300031090 | Bacteria | 716 |
| 604 | Ga0265325_10010702 | 3300031241 | Bacteria | 5297 |
| 605 | Ga0265325_10011849 | 3300031241 | Bacteria | 5000 |
| 606 | Ga0265325_10496471 | 3300031241 | Unclassified | 529 |
| 607 | Ga0265340_10112195 | 3300031247 | Bacteria | 1260 |
| 608 | Ga0265340_10116832 | 3300031247 | Bacteria | 1229 |
| 609 | Ga0265340_10534722 | 3300031247 | Unclassified | 516 |
| 610 | Ga0265339_10018791 | 3300031249 | Bacteria | 4069 |
| 611 | Ga0265339_10030999 | 3300031249 | Bacteria | 3024 |
| 612 | Ga0265339_10052569 | 3300031249 | Bacteria | 2218 |
| 613 | Ga0265339_10381650 | 3300031249 | Unclassified | 660 |
| 614 | Ga0265316_10030314 | 3300031344 | Bacteria | 4435 |
| 615 | Ga0265316_10621264 | 3300031344 | Bacteria | 765 |
| 616 | Ga0265314_10077458 | 3300031711 | Bacteria | 2205 |
| 617 | Ga0265314_10189368 | 3300031711 | Bacteria | 1226 |
| 618 | Ga0307410_10069786 | 3300031852 | Bacteria | 2432 |
| 619 | Ga0307407_10168170 | 3300031903 | Bacteria | 1441 |
| 620 | Ga0307409_100025319 | 3300031995 | Bacteria | 4159 |
| 621 | Ga0307416_100201127 | 3300032002 | Bacteria | 1890 |
| 622 | Ga0307411_10012210 | 3300032005 | Bacteria | 4675 |
| 623 | Ga0307411_11823139 | 3300032005 | Bacteria | 565 |
| 624 | Ga0307415_100099832 | 3300032126 | Bacteria | 2126 |
| 625 | Ga0316214_1018888 | 3300033545 | Unclassified | 959 |
| 626 | Ga0373948_0169268 | 3300034817 | Unclassified | 555 |
| 627 | Ga0373928_0131560 | 3300035084 | Unclassified | 679 |
| 628 | Ga0373934_0226399 | 3300035086 | Bacteria | 772 |
| 629 | Ga0373944_0048144 | 3300035089 | Bacteria | 1337 |
| 630 | Ga0373951_0023935 | 3300035091 | Bacteria | 1413 |
| 631 | Ga0373923_0167627 | 3300035111 | Bacteria | 1005 |
| 632 | Ga0373932_0122036 | 3300035112 | Unclassified | 870 |
| 633 | Ga0373936_0002336 | 3300035113 | Bacteria | 7110 |
| 634 | Ga0373936_0015053 | 3300035113 | Bacteria | 2962 |
| 635 | Ga0373936_0578276 | 3300035113 | Bacteria | 526 |
| 636 | Ga0373939_0027939 | 3300035114 | Unclassified | 1602 |
| 637 | Ga0373941_0346944 | 3300035115 | Unclassified | 603 |
| 638 | Ga0373953_0102670 | 3300035117 | Bacteria | 1204 |
| 639 | Ga0373954_0414201 | 3300035118 | Bacteria | 666 |
| 640 | Ga0373956_0087845 | 3300035119 | Bacteria | 1432 |
| 641 | Ga0373956_0239304 | 3300035119 | Bacteria | 863 |
| 642 | Ga0373957_0123837 | 3300035120 | Bacteria | 1048 |
| 643 | Ga0373957_0295970 | 3300035120 | Bacteria | 686 |
| 644 | Ga0373960_0011325 | 3300035121 | Unclassified | 2196 |
| 645 | Ga0373943_0000235 | 3300035170 | Bacteria | 22708 |
| 646 | Ga0373943_0032085 | 3300035170 | Bacteria | 2495 |
| 647 | Ga0373943_0372904 | 3300035170 | Unclassified | 821 |
| 648 | Ga0373946_0127086 | 3300035171 | Bacteria | 1169 |
| 649 | Ga0373924_0041007 | 3300035410 | Bacteria | 1896 |
| 650 | Ga0373931_0066319 | 3300035691 | Bacteria | 1958 |
| 651 | Ga0373935_0000363 | 3300035692 | Bacteria | 23142 |
| 652 | Ga0373935_0015574 | 3300035692 | Bacteria | 4597 |
| 653 | Ga0373935_0235963 | 3300035692 | Bacteria | 1275 |
| 654 | Ga0373935_0446191 | 3300035692 | Bacteria | 934 |
| 655 | Ga0373935_0560022 | 3300035692 | Bacteria | 834 |
| 656 | Ga0373927_0000635 | 3300035695 | Bacteria | 26605 |
| 657 | Ga0373927_1190462 | 3300035695 | Bacteria | 503 |
| 658 | Ga0373933_0060508 | 3300035724 | Bacteria | 2283 |
| 659 | Ga0373933_0140352 | 3300035724 | Bacteria | 1525 |
| 660 | Ga0373947_0001002 | 3300035725 | Bacteria | 17225 |
| 661 | Ga0373947_0534967 | 3300035725 | Bacteria | 797 |
| 662 | Ga0373937_0058535 | 3300036401 | Bacteria | 3540 |
| 663 | Ga0373937_0129895 | 3300036401 | Bacteria | 2352 |
| 664 | Ga0373937_0147282 | 3300036401 | Bacteria | 2204 |
| 665 | Ga0373937_0147789 | 3300036401 | Bacteria | 2201 |
| 666 | Ga0373937_1085070 | 3300036401 | Bacteria | 749 |
| 667 | Ga0373925_0000661 | 3300037068 | Bacteria | 32361 |
| 668 | Ga0373925_0004968 | 3300037068 | Bacteria | 9987 |
| 669 | Ga0373925_0013012 | 3300037068 | Bacteria | 6026 |
| 670 | Ga0373925_0035408 | 3300037068 | Bacteria | 3683 |
| 671 | Ga0373925_0086919 | 3300037068 | Bacteria | 2386 |
| 672 | Ga0436365_0269346 | 3300039437 | Unclassified | 1165 |
| 673 | Ga0436365_0763510 | 3300039437 | Bacteria | 1397 |
| 674 | Ga0436360_0206578 | 3300039438 | Unclassified | 543 |
| 675 | Ga0436363_0736475 | 3300039450 | Bacteria | 606 |
| 676 | Ga0436362_0741755 | 3300039453 | Unclassified | 545 |
| 677 | Ga0451839_0117572 | 3300041496 | Unclassified | 560 |
| 678 | Ga0466966_0954510 | 3300044684 | Unclassified | 517 |
| 679 | Ga0453684_1468510 | 3300044712 | Bacteria | 705 |
| 680 | Ga0451576_0696526 | 3300045051 | Bacteria | 1067 |
| 681 | Ga0451576_0856493 | 3300045051 | Bacteria | 954 |
| 682 | Ga0451576_2365277 | 3300045051 | Bacteria | 544 |
| 683 | Ga0466967_0346256 | 3300045976 | Bacteria | 1438 |
| 684 | Ga0495603_0404144 | 3300046455 | Bacteria | 783 |
| 685 | Ga0495629_0077081 | 3300046459 | Bacteria | 2327 |
| 686 | Ga0495641_0119626 | 3300046461 | Bacteria | 1175 |
| 687 | Ga0495653_0197930 | 3300046463 | Bacteria | 1366 |
| 688 | Ga0495580_0000505 | 3300046472 | Bacteria | 32817 |
| 689 | Ga0495580_0032001 | 3300046472 | Bacteria | 3797 |
| 690 | Ga0495580_0033323 | 3300046472 | Bacteria | 3713 |
| 691 | Ga0495580_0199768 | 3300046472 | Bacteria | 1378 |
| 692 | Ga0495580_0458910 | 3300046472 | Bacteria | 854 |
| 693 | Ga0495580_0526718 | 3300046472 | Unclassified | 787 |
| 694 | Ga0495580_0734963 | 3300046472 | Unclassified | 644 |
| 695 | Ga0495582_0009508 | 3300046473 | Bacteria | 5356 |
| 696 | Ga0495664_0006351 | 3300046477 | Bacteria | 6531 |
| 697 | Ga0495664_0335413 | 3300046477 | Bacteria | 911 |
| 698 | Ga0495584_0051997 | 3300046491 | Bacteria | 2062 |
| 699 | Ga0495585_0334841 | 3300046492 | Bacteria | 738 |
| 700 | Ga0495628_0277235 | 3300046516 | Bacteria | 1246 |
| 701 | Ga0495628_0427647 | 3300046516 | Bacteria | 964 |
| 702 | Ga0495630_0008873 | 3300046517 | Bacteria | 7219 |
| 703 | Ga0495630_0224103 | 3300046517 | Unclassified | 1436 |
| 704 | Ga0495630_0231352 | 3300046517 | Bacteria | 1412 |
| 705 | Ga0495630_0280352 | 3300046517 | Bacteria | 1273 |
| 706 | Ga0495666_0482932 | 3300046526 | Bacteria | 554 |
| 707 | Ga0495652_0337981 | 3300046529 | Bacteria | 1083 |
| 708 | Ga0495665_0337874 | 3300046531 | Unclassified | 768 |
| 709 | Ga0495640_0159246 | 3300046533 | Bacteria | 1448 |
| 710 | Ga0495640_0461086 | 3300046533 | Bacteria | 775 |
| 711 | Ga0495645_0122760 | 3300046543 | Bacteria | 1827 |
| 712 | Ga0495645_0190748 | 3300046543 | Bacteria | 1397 |
| 713 | Ga0495667_0629988 | 3300046559 | Bacteria | 667 |
| 714 | Ga0495656_0729327 | 3300046615 | Unclassified | 534 |
| 715 | Ga0495635_0184929 | 3300046663 | Bacteria | 1416 |
| 716 | Ga0495635_0451054 | 3300046663 | Bacteria | 850 |
| 717 | Ga0495657_0391801 | 3300046675 | Bacteria | 818 |
| 718 | Ga0495657_0439563 | 3300046675 | Unclassified | 765 |
| 719 | Ga0495599_0186519 | 3300046678 | Bacteria | 1277 |
| 720 | Ga0495646_0327128 | 3300046680 | Bacteria | 806 |
| 721 | Ga0495646_0513102 | 3300046680 | Bacteria | 615 |
| 722 | Ga0495647_0046257 | 3300046681 | Bacteria | 1675 |
| 723 | Ga0495658_0038130 | 3300046683 | Bacteria | 2660 |
| 724 | Ga0495658_0046900 | 3300046683 | Bacteria | 2431 |
| 725 | Ga0495669_0009884 | 3300046684 | Unclassified | 4032 |
| 726 | Ga0495613_0038012 | 3300046689 | Bacteria | 3568 |
| 727 | Ga0495624_0042625 | 3300046690 | Bacteria | 2900 |
| 728 | Ga0495624_0596081 | 3300046690 | Bacteria | 659 |
| 729 | Ga0495581_0148052 | 3300047315 | Bacteria | 1371 |
| 730 | Ga0495604_0074477 | 3300047317 | Bacteria | 2559 |
| 731 | Ga0495674_0018727 | 3300047319 | Bacteria | 6443 |
| 732 | Ga0495674_0024534 | 3300047319 | Bacteria | 5539 |
| 733 | Ga0495674_1129682 | 3300047319 | Bacteria | 595 |
| 734 | Ga0495674_1211505 | 3300047319 | Bacteria | 570 |
| 735 | Ga0495676_1071544 | 3300047321 | Unclassified | 513 |
| 736 | Ga0495676_1085442 | 3300047321 | Bacteria | 509 |
| 737 | Ga0495680_0279040 | 3300047322 | Bacteria | 1178 |
| 738 | Ga0495684_0300431 | 3300047471 | Bacteria | 1153 |
| 739 | Ga0495593_0139032 | 3300047673 | Bacteria | 1231 |
| 740 | Ga0495602_0106818 | 3300048088 | Bacteria | 2284 |
| 741 | Ga0495602_0141735 | 3300048088 | Bacteria | 1902 |
| 742 | Ga0496100_0007632 | 3300048903 | Bacteria | 5982 |
| 743 | Ga0496100_0036840 | 3300048903 | Bacteria | 3089 |
| 744 | Ga0496100_0082280 | 3300048903 | Bacteria | 2177 |
| 745 | Ga0496100_0682880 | 3300048903 | Bacteria | 801 |
| 746 | Ga0496100_0852867 | 3300048903 | Unclassified | 715 |
| 747 | Ga0496101_0105125 | 3300048904 | Bacteria | 2118 |
| 748 | Ga0496101_0286374 | 3300048904 | Unclassified | 1289 |
| 749 | Ga0496102_0054491 | 3300048905 | Bacteria | 3647 |
| 750 | Ga0496102_0173275 | 3300048905 | Bacteria | 2031 |
| 751 | Ga0496102_0362356 | 3300048905 | Bacteria | 1365 |
| 752 | Ga0496103_0416707 | 3300048906 | Unclassified | 862 |
| 753 | Ga0496104_0134896 | 3300048907 | Bacteria | 2371 |
| 754 | Ga0496104_0309346 | 3300048907 | Bacteria | 1493 |
| 755 | Ga0496104_0462440 | 3300048907 | Bacteria | 1180 |
| 756 | Ga0496104_1150572 | 3300048907 | Bacteria | 679 |
| 757 | Ga0496105_0144432 | 3300048908 | Bacteria | 1957 |
| 758 | Ga0496105_0908610 | 3300048908 | Bacteria | 663 |
| 759 | Ga0496106_0081921 | 3300048909 | Unclassified | 2480 |
| 760 | Ga0496106_0111187 | 3300048909 | Bacteria | 2133 |
| 761 | Ga0496107_0119902 | 3300048910 | Bacteria | 1938 |
| 762 | Ga0496107_0177602 | 3300048910 | Bacteria | 1581 |
| 763 | Ga0496107_0447065 | 3300048910 | Bacteria | 960 |
| 764 | Ga0496107_0896136 | 3300048910 | Bacteria | 647 |
| 765 | Ga0496108_0004968 | 3300048911 | Bacteria | 10746 |
| 766 | Ga0496108_0077923 | 3300048911 | Bacteria | 2805 |
| 767 | Ga0496108_1187826 | 3300048911 | Bacteria | 645 |
| 768 | Ga0496109_0000600 | 3300048912 | Bacteria | 30126 |
| 769 | Ga0496109_0022461 | 3300048912 | Bacteria | 5588 |
| 770 | Ga0496109_0270485 | 3300048912 | Bacteria | 1601 |
| 771 | Ga0496110_0001952 | 3300048913 | Bacteria | 15301 |
| 772 | Ga0496110_1608854 | 3300048913 | Unclassified | 560 |
| 773 | Ga0496111_0008792 | 3300048914 | Bacteria | 6707 |
| 774 | Ga0496112_0000097 | 3300048915 | Bacteria | 56970 |
| 775 | Ga0496112_0029629 | 3300048915 | Bacteria | 5294 |
| 776 | Ga0496112_0086339 | 3300048915 | Bacteria | 3104 |
| 777 | Ga0496112_0131742 | 3300048915 | Bacteria | 2471 |
| 778 | Ga0496112_0398618 | 3300048915 | Bacteria | 1316 |
| 779 | Ga0496112_1192467 | 3300048915 | Bacteria | 678 |
| 780 | Ga0496113_0002729 | 3300048916 | Bacteria | 10374 |
| 781 | Ga0496113_0194894 | 3300048916 | Bacteria | 1609 |
| 782 | Ga0496113_0391210 | 3300048916 | Bacteria | 1116 |
| 783 | Ga0496114_0004185 | 3300048917 | Bacteria | 11171 |
| 784 | Ga0496114_0516995 | 3300048917 | Unclassified | 1056 |
| 785 | Ga0496115_0006677 | 3300048918 | Bacteria | 8466 |
| 786 | Ga0496115_0770355 | 3300048918 | Unclassified | 751 |
| 787 | Ga0496115_0967880 | 3300048918 | Bacteria | 652 |
| 788 | Ga0501032_0107557 | 3300049569 | Bacteria | 1847 |
| 789 | Ga0501034_0287049 | 3300049571 | Bacteria | 1584 |
| 790 | Ga0501037_0248445 | 3300049573 | Bacteria | 1245 |
| 791 | Ga0501047_0017245 | 3300049581 | Bacteria | 6914 |
| 792 | Ga0501048_0642383 | 3300049582 | Bacteria | 762 |
| 793 | Ga0501069_0019127 | 3300049585 | Bacteria | 3700 |
| 794 | Ga0501070_0000101 | 3300049586 | Bacteria | 74887 |
| 795 | Ga0501070_1237747 | 3300049586 | Bacteria | 572 |
| 796 | Ga0501073_0021980 | 3300049589 | Bacteria | 4596 |
| 797 | Ga0501073_0065808 | 3300049589 | Bacteria | 2527 |
| 798 | Ga0501073_0298568 | 3300049589 | Bacteria | 1111 |
| 799 | Ga0501074_1324275 | 3300049590 | Bacteria | 505 |
| 800 | Ga0501077_0204317 | 3300049593 | Bacteria | 1255 |
| 801 | Ga0501079_0239562 | 3300049741 | Bacteria | 1417 |
| 802 | Ga0501080_0001683 | 3300049742 | Bacteria | 18846 |
| 803 | Ga0501083_0020629 | 3300049744 | Bacteria | 4583 |
| 804 | Ga0501083_0715908 | 3300049744 | Bacteria | 651 |
| 805 | Ga0501044_0013496 | 3300049823 | Bacteria | 8835 |
| 806 | nmdc:mga03683_15942_c1 | 3300050489 | Bacteria | 1436 |
| 807 | nmdc:mga06z11_184351_c1 | 3300050494 | Unclassified | 1205 |
| 808 | nmdc:mga0n895_26261_c1 | 3300050512 | Bacteria | 5513 |
| 809 | nmdc:mga0n895_462121_c1 | 3300050512 | Unclassified | 1281 |
| 810 | nmdc:mga0rr50_113854_c1 | 3300050513 | Unclassified | 2144 |
| 811 | nmdc:mga0rr50_1225237_c1 | 3300050513 | Bacteria | 637 |
| 812 | nmdc:mga08x19_302653_c1 | 3300050514 | Unclassified | 1111 |
| 813 | Ga0495601_0046423 | 3300053077 | Bacteria | 2734 |
| 814 | Ga0495601_0685481 | 3300053077 | Bacteria | 654 |
| 815 | Ga0495612_0313563 | 3300053078 | Bacteria | 705 |
| 816 | Ga0495619_0266103 | 3300053085 | Bacteria | 1188 |
| 817 | Ga0495619_1016132 | 3300053085 | Bacteria | 554 |
| 818 | Ga0501082_0221841 | 3300060353 | Unclassified | 1645 |
| 819 | Ga0070707_101700502 | |||
| 820 | MRS1b_contig_316497 | |||
| 821 | MBSR1b_contig_11250795 | |||
| 822 | MBSR1b_contig_2671148 | |||
| 823 | JGI24752J21851_1007270 | |||
| 824 | JGI24738J21930_10047428 | |||
| 825 | JGI24034J26672_10000848 | |||
| 826 | JGI24751J29686_10001755 | |||
| 827 | Ga0065704_10166826 | |||
| 828 | Ga0065712_10164061 | |||
| 829 | Ga0065712_10781874 | |||
| 830 | Ga0065715_10131267 | |||
| 831 | Ga0065707_10291745 | |||
| 832 | Ga0070658_10038250 | |||
| 833 | Ga0070658_11834514 | |||
| 834 | Ga0070676_10291746 | |||
| 835 | Ga0070683_100015024 | |||
| 836 | Ga0070683_100087072 | |||
| 837 | Ga0070690_100286650 | |||
| 838 | Ga0070690_100991829 | |||
| 839 | Ga0070670_100112644 | |||
| 840 | Ga0070670_100132044 | |||
| 841 | Ga0070670_100228026 | |||
| 842 | Ga0070677_10004017 | |||
| 843 | Ga0070677_10172617 | |||
| 844 | Ga0068869_100046481 | |||
| 845 | Ga0070666_10054759 | |||
| 846 | Ga0070666_10057347 | |||
| 847 | Ga0070666_10158711 | |||
| 848 | Ga0070666_10735820 | |||
| 849 | Ga0070666_10774402 | |||
| 850 | Ga0070680_100662151 | |||
| 851 | Ga0070682_100008604 | |||
| 852 | Ga0070682_100092598 | |||
| 853 | Ga0068868_100001799 | |||
| 854 | Ga0068868_100151227 | |||
| 855 | Ga0068868_100284011 | |||
| 856 | Ga0070660_101870811 | |||
| 857 | Ga0070689_102106746 | |||
| 858 | Ga0070687_100009236 | |||
| 859 | Ga0070661_100022965 | |||
| 860 | Ga0070661_100027423 | |||
| 861 | Ga0070692_10118265 | |||
| 862 | Ga0070668_100030698 | |||
| 863 | Ga0070668_100056503 | |||
| 864 | Ga0070669_100002345 | |||
| 865 | Ga0070669_100027509 | |||
| 866 | Ga0070669_100269778 | |||
| 867 | Ga0070675_100138673 | |||
| 868 | Ga0070675_100327982 | |||
| 869 | Ga0070675_101239171 | |||
| 870 | Ga0070671_100042048 | |||
| 871 | Ga0070671_100070314 | |||
| 872 | Ga0070671_100695920 | |||
| 873 | Ga0070671_101043481 | |||
| 874 | Ga0070671_101741420 | |||
| 875 | Ga0070674_100018594 | |||
| 876 | Ga0070673_100054905 | |||
| 877 | Ga0070673_100412764 | |||
| 878 | Ga0070673_100434277 | |||
| 879 | Ga0070688_100020721 | |||
| 880 | Ga0070659_100043270 | |||
| 881 | Ga0070659_100069464 | |||
| 882 | Ga0070659_100104137 | |||
| 883 | Ga0070659_100624716 | |||
| 884 | Ga0070667_100325029 | |||
| 885 | Ga0070667_100677516 | |||
| 886 | Ga0070667_100684660 | |||
| 887 | Ga0070667_101149872 | |||
| 888 | Ga0070709_10020987 | |||
| 889 | Ga0070709_10033505 | |||
| 890 | Ga0070709_10165947 | |||
| 891 | Ga0070709_10290988 | |||
| 892 | Ga0070709_10852912 | |||
| 893 | Ga0070709_11235397 | |||
| 894 | Ga0070714_100003152 | |||
| 895 | Ga0070714_100103459 | |||
| 896 | Ga0070714_100194377 | |||
| 897 | Ga0070714_100870163 | |||
| 898 | Ga0070713_100000078 | |||
| 899 | Ga0070713_100004392 | |||
| 900 | Ga0070713_100009108 | |||
| 901 | Ga0070713_100046576 | |||
| 902 | Ga0070713_100050736 | |||
| 903 | Ga0070713_100181091 | |||
| 904 | Ga0070713_100228922 | |||
| 905 | Ga0070713_100261006 | |||
| 906 | Ga0070713_100276539 | |||
| 907 | Ga0070713_100334033 | |||
| 908 | Ga0070713_100568610 | |||
| 909 | Ga0070713_101134528 | |||
| 910 | Ga0070713_101156320 | |||
| 911 | Ga0070713_101785931 | |||
| 912 | Ga0070710_10021208 | |||
| 913 | Ga0070710_10099693 | |||
| 914 | Ga0070710_10301286 | |||
| 915 | Ga0070710_10704858 | |||
| 916 | Ga0070710_11182211 | |||
| 917 | Ga0070710_11503088 | |||
| 918 | Ga0070701_10066268 | |||
| 919 | Ga0070701_10407381 | |||
| 920 | Ga0070711_100000386 | |||
| 921 | Ga0070711_100000754 | |||
| 922 | Ga0070711_100008257 | |||
| 923 | Ga0070711_100009243 | |||
| 924 | Ga0070711_100165671 | |||
| 925 | Ga0070711_100455151 | |||
| 926 | Ga0070711_101075693 | |||
| 927 | Ga0070711_101096488 | |||
| 928 | Ga0070711_101917423 | |||
| 929 | Ga0070705_101191562 | |||
| 930 | Ga0070694_100150959 | |||
| 931 | Ga0070708_100000165 | |||
| 932 | Ga0070708_100005858 | |||
| 933 | Ga0070708_101119098 | |||
| 934 | Ga0070663_100018963 | |||
| 935 | Ga0070663_100215521 | |||
| 936 | Ga0070678_100184191 | |||
| 937 | Ga0070678_101524007 | |||
| 938 | Ga0070662_100011873 | |||
| 939 | Ga0070662_100039843 | |||
| 940 | Ga0070681_10041227 | |||
| 941 | Ga0070681_10247282 | |||
| 942 | Ga0070681_10448866 | |||
| 943 | Ga0070681_11807142 | |||
| 944 | Ga0068867_100002889 | |||
| 945 | Ga0068867_100091884 | |||
| 946 | Ga0068867_100399796 | |||
| 947 | Ga0068867_100855657 | |||
| 948 | Ga0070685_10005238 | |||
| 949 | Ga0070706_100021652 | |||
| 950 | Ga0070706_100037008 | |||
| 951 | Ga0070706_100053457 | |||
| 952 | Ga0070706_100692183 | |||
| 953 | Ga0070707_100000237 | |||
| 954 | Ga0070707_100004396 | |||
| 955 | Ga0070707_100209273 | |||
| 956 | Ga0070707_100320020 | |||
| 957 | Ga0070698_100001730 | |||
| 958 | Ga0070698_100283454 | |||
| 959 | Ga0070699_100001358 | |||
| 960 | Ga0070699_100220592 | |||
| 961 | Ga0070699_101059018 | |||
| 962 | Ga0070679_100192621 | |||
| 963 | Ga0070679_100233728 | |||
| 964 | Ga0070684_100009310 | |||
| 965 | Ga0070684_100216105 | |||
| 966 | Ga0070684_100669964 | |||
| 967 | Ga0070697_100000219 | |||
| 968 | Ga0070697_100000255 | |||
| 969 | Ga0070697_100004137 | |||
| 970 | Ga0070697_100144506 | |||
| 971 | Ga0070697_102118571 | |||
| 972 | Ga0068853_100063545 | |||
| 973 | Ga0068853_102105746 | |||
| 974 | Ga0070672_100054517 | |||
| 975 | Ga0070672_100337778 | |||
| 976 | Ga0070686_100010469 | |||
| 977 | Ga0070686_100134840 | |||
| 978 | Ga0070686_100337064 | |||
| 979 | Ga0070695_100415891 | |||
| 980 | Ga0070695_100855180 | |||
| 981 | Ga0070696_100607112 | |||
| 982 | Ga0070696_100727756 | |||
| 983 | Ga0070693_100034412 | |||
| 984 | Ga0070693_100366782 | |||
| 985 | Ga0070693_101503052 | |||
| 986 | Ga0070665_100024537 | |||
| 987 | Ga0070665_100250121 | |||
| 988 | Ga0070665_101201100 | |||
| 989 | Ga0070704_100356958 | |||
| 990 | Ga0070704_100636932 | |||
| 991 | Ga0070704_100946030 | |||
| 992 | Ga0068855_100044277 | |||
| 993 | Ga0068855_100125691 | |||
| 994 | Ga0068855_100677752 | |||
| 995 | Ga0068855_101028626 | |||
| 996 | Ga0070664_100055516 | |||
| 997 | Ga0070664_100074770 | |||
| 998 | Ga0070664_100238243 | |||
| 999 | Ga0070664_100489734 | |||
| 1000 | Ga0068857_100009256 | |||
| 1001 | Ga0068857_100021553 | |||
| 1002 | Ga0068857_100924726 | |||
| 1003 | Ga0068854_100000789 | |||
| 1004 | Ga0068854_100012581 | |||
| 1005 | Ga0068856_100003171 | |||
| 1006 | Ga0068856_100013107 | |||
| 1007 | Ga0068856_100041231 | |||
| 1008 | Ga0068856_101013736 | |||
| 1009 | Ga0068856_101077299 | |||
| 1010 | Ga0068856_101117617 | |||
| 1011 | Ga0068856_102399896 | |||
| 1012 | Ga0070702_100002231 | |||
| 1013 | Ga0070702_100579803 | |||
| 1014 | Ga0068852_100003988 | |||
| 1015 | Ga0068852_100039180 | |||
| 1016 | Ga0068852_100823304 | |||
| 1017 | Ga0068859_100186287 | |||
| 1018 | Ga0068859_101107534 | |||
| 1019 | Ga0068864_100017709 | |||
| 1020 | Ga0068864_100030716 | |||
| 1021 | Ga0068864_100129429 | |||
| 1022 | Ga0068866_10013563 | |||
| 1023 | Ga0068866_10077914 | |||
| 1024 | Ga0068866_10228789 | |||
| 1025 | Ga0068866_10640111 | |||
| 1026 | Ga0068861_100017290 | |||
| 1027 | Ga0068861_100095205 | |||
| 1028 | Ga0068851_10002806 | |||
| 1029 | Ga0068851_10019123 | |||
| 1030 | Ga0068851_10191828 | |||
| 1031 | Ga0068863_100009036 | |||
| 1032 | Ga0068863_100024318 | |||
| 1033 | Ga0068863_100029719 | |||
| 1034 | Ga0068863_100058963 | |||
| 1035 | Ga0068863_100642106 | |||
| 1036 | Ga0068858_100040727 | |||
| 1037 | Ga0068858_100066333 | |||
| 1038 | Ga0068858_100996084 | |||
| 1039 | Ga0068860_100110092 | |||
| 1040 | Ga0068860_100176431 | |||
| 1041 | Ga0068860_100303695 | |||
| 1042 | Ga0068860_101063902 | |||
| 1043 | Ga0068862_100021905 | |||
| 1044 | Ga0068862_100025552 | |||
| 1045 | Ga0068862_101116400 | |||
| 1046 | Ga0081540_1071536 | |||
| 1047 | Ga0070717_10001788 | |||
| 1048 | Ga0070717_10001810 | |||
| 1049 | Ga0070717_10003192 | |||
| 1050 | Ga0070717_10008829 | |||
| 1051 | Ga0070717_10015935 | |||
| 1052 | Ga0070717_10025374 | |||
| 1053 | Ga0070717_10032861 | |||
| 1054 | Ga0070717_10052783 | |||
| 1055 | Ga0070717_10061951 | |||
| 1056 | Ga0070717_10202369 | |||
| 1057 | Ga0070717_10432732 | |||
| 1058 | Ga0070717_10494520 | |||
| 1059 | Ga0070717_10729339 | |||
| 1060 | Ga0070717_10849705 | |||
| 1061 | Ga0070717_10920840 | |||
| 1062 | Ga0070715_10001686 | |||
| 1063 | Ga0070715_10008384 | |||
| 1064 | Ga0070715_10138833 | |||
| 1065 | Ga0070715_10183766 | |||
| 1066 | Ga0070716_100000288 | |||
| 1067 | Ga0070716_100000356 | |||
| 1068 | Ga0070716_100060898 | |||
| 1069 | Ga0070716_100090148 | |||
| 1070 | Ga0070716_100149460 | |||
| 1071 | Ga0070716_100195395 | |||
| 1072 | Ga0070716_100205282 | |||
| 1073 | Ga0070716_100669238 | |||
| 1074 | Ga0070716_101168239 | |||
| 1075 | Ga0070712_100000122 | |||
| 1076 | Ga0070712_100000856 | |||
| 1077 | Ga0070712_100001565 | |||
| 1078 | Ga0070712_100019012 | |||
| 1079 | Ga0070712_100030354 | |||
| 1080 | Ga0070712_100209273 | |||
| 1081 | Ga0070712_100388223 | |||
| 1082 | Ga0070712_100443237 | |||
| 1083 | Ga0070712_100923654 | |||
| 1084 | Ga0097621_100000357 | |||
| 1085 | Ga0097621_100049800 | |||
| 1086 | Ga0097621_100056451 | |||
| 1087 | Ga0097621_100066331 | |||
| 1088 | Ga0097621_100895424 | |||
| 1089 | Ga0068871_100002520 | |||
| 1090 | Ga0068871_100008262 | |||
| 1091 | Ga0068871_100012801 | |||
| 1092 | Ga0068871_100041414 | |||
| 1093 | Ga0068871_100195450 | |||
| 1094 | Ga0075433_10035246 | |||
| 1095 | Ga0075434_100000226 | |||
| 1096 | Ga0075434_100005438 | |||
| 1097 | Ga0075434_100216732 | |||
| 1098 | Ga0068865_100016983 | |||
| 1099 | Ga0068865_100206001 | |||
| 1100 | Ga0068865_100807854 | |||
| 1101 | Ga0075436_100021337 | |||
| 1102 | Ga0075436_100331226 | |||
| 1103 | Ga0075436_100567313 | |||
| 1104 | Ga0097620_100186292 | |||
| 1105 | Ga0097620_101107490 | |||
| 1106 | Ga0075435_100000168 | |||
| 1107 | Ga0075435_100129735 | |||
| 1108 | Ga0075435_100914950 | |||
| 1109 | Ga0105250_10041069 | |||
| 1110 | Ga0105250_10513747 | |||
| 1111 | Ga0105240_10023277 | |||
| 1112 | Ga0105240_10037314 | |||
| 1113 | Ga0105240_10091094 | |||
| 1114 | Ga0105240_10102006 | |||
| 1115 | Ga0105240_10126190 | |||
| 1116 | Ga0105240_11787203 | |||
| 1117 | Ga0105245_10004274 | |||
| 1118 | Ga0105245_10018930 | |||
| 1119 | Ga0105245_10026018 | |||
| 1120 | Ga0105245_10108037 | |||
| 1121 | Ga0105245_10803906 | |||
| 1122 | Ga0105247_10002806 | |||
| 1123 | Ga0105247_10016109 | |||
| 1124 | Ga0105247_10066124 | |||
| 1125 | Ga0105241_10063350 | |||
| 1126 | Ga0105241_10154906 | |||
| 1127 | Ga0105241_10173823 | |||
| 1128 | Ga0105241_10872625 | |||
| 1129 | Ga0105242_10015341 | |||
| 1130 | Ga0105242_10030649 | |||
| 1131 | Ga0105242_10031689 | |||
| 1132 | Ga0105242_10217991 | |||
| 1133 | Ga0105242_10966369 | |||
| 1134 | Ga0105248_10069448 | |||
| 1135 | Ga0105248_10189958 | |||
| 1136 | Ga0105248_11113251 | |||
| 1137 | Ga0105248_11418973 | |||
| 1138 | Ga0105237_10037403 | |||
| 1139 | Ga0105237_10256780 | |||
| 1140 | Ga0105237_10296808 | |||
| 1141 | Ga0105237_10977898 | |||
| 1142 | Ga0105237_11149668 | |||
| 1143 | Ga0105237_11833730 | |||
| 1144 | Ga0105237_12087010 | |||
| 1145 | Ga0105238_10128329 | |||
| 1146 | Ga0105238_10151964 | |||
| 1147 | Ga0105238_10514723 | |||
| 1148 | Ga0105238_12654493 | |||
| 1149 | Ga0105249_10069419 | |||
| 1150 | Ga0105239_10021589 | |||
| 1151 | Ga0105239_10106738 | |||
| 1152 | Ga0105246_10003125 | |||
| 1153 | Ga0105246_10010046 | |||
| 1154 | Ga0105246_10204126 | |||
| 1155 | Ga0157315_1011868 | |||
| 1156 | Ga0157373_10008912 | |||
| 1157 | Ga0157373_10134686 | |||
| 1158 | Ga0157371_10004902 | |||
| 1159 | Ga0157371_10015784 | |||
| 1160 | Ga0157370_10262317 | |||
| 1161 | Ga0157370_11721224 | |||
| 1162 | Ga0157369_10020489 | |||
| 1163 | Ga0157369_10137478 | |||
| 1164 | Ga0157369_10206668 | |||
| 1165 | Ga0157369_11461986 | |||
| 1166 | Ga0157374_10005829 | |||
| 1167 | Ga0157374_10022318 | |||
| 1168 | Ga0157374_10043071 | |||
| 1169 | Ga0157374_10082094 | |||
| 1170 | Ga0157374_11020099 | |||
| 1171 | Ga0157374_11428465 | |||
| 1172 | Ga0157374_12357158 | |||
| 1173 | Ga0157378_10000800 | |||
| 1174 | Ga0157378_10022475 | |||
| 1175 | Ga0157378_10136455 | |||
| 1176 | Ga0157378_10235044 | |||
| 1177 | Ga0163162_10004807 | |||
| 1178 | Ga0163162_10006725 | |||
| 1179 | Ga0163162_10087941 | |||
| 1180 | Ga0163162_10158077 | |||
| 1181 | Ga0163162_10237409 | |||
| 1182 | Ga0157372_10002533 | |||
| 1183 | Ga0157372_10002813 | |||
| 1184 | Ga0157372_10017457 | |||
| 1185 | Ga0157372_10052308 | |||
| 1186 | Ga0157372_10054817 | |||
| 1187 | Ga0157372_10122014 | |||
| 1188 | Ga0157372_11583909 | |||
| 1189 | Ga0157375_10004437 | |||
| 1190 | Ga0157375_10097633 | |||
| 1191 | Ga0157375_10104072 | |||
| 1192 | Ga0163163_10043265 | |||
| 1193 | Ga0163163_10156945 | |||
| 1194 | Ga0163163_10314026 | |||
| 1195 | Ga0163163_10490003 | |||
| 1196 | Ga0157380_10079557 | |||
| 1197 | Ga0157377_10053915 | |||
| 1198 | Ga0157379_10005802 | |||
| 1199 | Ga0157379_10087830 | |||
| 1200 | Ga0157379_11125050 | |||
| 1201 | Ga0157379_11987589 | |||
| 1202 | Ga0157376_10030437 | |||
| 1203 | Ga0157376_10085011 | |||
| 1204 | Ga0157376_10091625 | |||
| 1205 | Ga0157376_10157945 | |||
| 1206 | Ga0157376_10200968 | |||
| 1207 | Ga0182007_10188148 | |||
| 1208 | Ga0163161_10022315 | |||
| 1209 | Ga0213876_10151738 | |||
| 1210 | Ga0224569_100043 | |||
| 1211 | Ga0224569_106812 | |||
| 1212 | Ga0224571_102676 | |||
| 1213 | Ga0224572_1018284 | |||
| 1214 | Ga0228598_1000208 | |||
| 1215 | Ga0228598_1000381 | |||
| 1216 | Ga0207697_10001848 | |||
| 1217 | Ga0207656_10015800 | |||
| 1218 | Ga0207682_10023115 | |||
| 1219 | Ga0207692_10048718 | |||
| 1220 | Ga0207692_10077445 | |||
| 1221 | Ga0207692_10126961 | |||
| 1222 | Ga0207692_10336307 | |||
| 1223 | Ga0207692_10366786 | |||
| 1224 | Ga0207642_10024098 | |||
| 1225 | Ga0207642_10041421 | |||
| 1226 | Ga0207642_10383712 | |||
| 1227 | Ga0207710_10058089 | |||
| 1228 | Ga0207688_10004671 | |||
| 1229 | Ga0207680_10203231 | |||
| 1230 | Ga0207680_10294411 | |||
| 1231 | Ga0207647_10019456 | |||
| 1232 | Ga0207647_10038958 | |||
| 1233 | Ga0207685_10044828 | |||
| 1234 | Ga0207685_10084469 | |||
| 1235 | Ga0207685_10102705 | |||
| 1236 | Ga0207699_10041622 | |||
| 1237 | Ga0207699_10046173 | |||
| 1238 | Ga0207699_10094811 | |||
| 1239 | Ga0207699_10103928 | |||
| 1240 | Ga0207699_10122850 | |||
| 1241 | Ga0207699_10913738 | |||
| 1242 | Ga0207699_11056978 | |||
| 1243 | Ga0207645_10001098 | |||
| 1244 | Ga0207645_10030387 | |||
| 1245 | Ga0207643_10001772 | |||
| 1246 | Ga0207705_11436308 | |||
| 1247 | Ga0207684_10000948 | |||
| 1248 | Ga0207684_10009358 | |||
| 1249 | Ga0207684_10044251 | |||
| 1250 | Ga0207684_10517361 | |||
| 1251 | Ga0207654_10075701 | |||
| 1252 | Ga0207654_10135112 | |||
| 1253 | Ga0207654_10955021 | |||
| 1254 | Ga0207707_10080337 | |||
| 1255 | Ga0207707_10083763 | |||
| 1256 | Ga0207707_10431636 | |||
| 1257 | Ga0207695_10029850 | |||
| 1258 | Ga0207695_10050228 | |||
| 1259 | Ga0207695_10137998 | |||
| 1260 | Ga0207671_10092049 | |||
| 1261 | Ga0207671_11089466 | |||
| 1262 | Ga0207693_10000291 | |||
| 1263 | Ga0207693_10000329 | |||
| 1264 | Ga0207693_10003500 | |||
| 1265 | Ga0207693_10007344 | |||
| 1266 | Ga0207693_10060885 | |||
| 1267 | Ga0207693_10863689 | |||
| 1268 | Ga0207693_11483078 | |||
| 1269 | Ga0207663_10000255 | |||
| 1270 | Ga0207663_10039702 | |||
| 1271 | Ga0207663_10046890 | |||
| 1272 | Ga0207663_10180531 | |||
| 1273 | Ga0207663_10301231 | |||
| 1274 | Ga0207663_10532453 | |||
| 1275 | Ga0207663_10559602 | |||
| 1276 | Ga0207663_10832924 | |||
| 1277 | Ga0207663_10858286 | |||
| 1278 | Ga0207662_10001367 | |||
| 1279 | Ga0207657_10000565 | |||
| 1280 | Ga0207657_10001923 | |||
| 1281 | Ga0207657_10541530 | |||
| 1282 | Ga0207649_10002266 | |||
| 1283 | Ga0207649_10011638 | |||
| 1284 | Ga0207652_10177814 | |||
| 1285 | Ga0207646_10002093 | |||
| 1286 | Ga0207646_10041715 | |||
| 1287 | Ga0207646_10175215 | |||
| 1288 | Ga0207681_10025449 | |||
| 1289 | Ga0207694_10066362 | |||
| 1290 | Ga0207694_10268493 | |||
| 1291 | Ga0207694_10372425 | |||
| 1292 | Ga0207650_10000024 | |||
| 1293 | Ga0207659_10410370 | |||
| 1294 | Ga0207659_10781280 | |||
| 1295 | Ga0207659_11507729 | |||
| 1296 | Ga0207687_10003046 | |||
| 1297 | Ga0207687_10028681 | |||
| 1298 | Ga0207687_10476342 | |||
| 1299 | Ga0207700_10000090 | |||
| 1300 | Ga0207700_10094623 | |||
| 1301 | Ga0207700_10122615 | |||
| 1302 | Ga0207700_10139958 | |||
| 1303 | Ga0207700_10186491 | |||
| 1304 | Ga0207700_10255559 | |||
| 1305 | Ga0207700_10282069 | |||
| 1306 | Ga0207664_10000033 | |||
| 1307 | Ga0207664_10013251 | |||
| 1308 | Ga0207664_10023579 | |||
| 1309 | Ga0207664_10329922 | |||
| 1310 | Ga0207664_10494844 | |||
| 1311 | Ga0207644_10031006 | |||
| 1312 | Ga0207644_10786921 | |||
| 1313 | Ga0207690_10563342 | |||
| 1314 | Ga0207706_10000258 | |||
| 1315 | Ga0207706_10000504 | |||
| 1316 | Ga0207686_10055306 | |||
| 1317 | Ga0207709_10253842 | |||
| 1318 | Ga0207670_10006308 | |||
| 1319 | Ga0207669_10169654 | |||
| 1320 | Ga0207704_10010046 | |||
| 1321 | Ga0207704_10430155 | |||
| 1322 | Ga0207665_10000189 | |||
| 1323 | Ga0207665_10029454 | |||
| 1324 | Ga0207665_10039540 | |||
| 1325 | Ga0207665_10090189 | |||
| 1326 | Ga0207665_10121700 | |||
| 1327 | Ga0207665_10156114 | |||
| 1328 | Ga0207665_10165565 | |||
| 1329 | Ga0207691_10000683 | |||
| 1330 | Ga0207691_10248110 | |||
| 1331 | Ga0207691_11203641 | |||
| 1332 | Ga0207711_10007967 | |||
| 1333 | Ga0207711_10320375 | |||
| 1334 | Ga0207711_10470932 | |||
| 1335 | Ga0207711_10750188 | |||
| 1336 | Ga0207689_10000570 | |||
| 1337 | Ga0207661_10053532 | |||
| 1338 | Ga0207679_10000327 | |||
| 1339 | Ga0207679_10055409 | |||
| 1340 | Ga0207679_10327795 | |||
| 1341 | Ga0207679_10577726 | |||
| 1342 | Ga0207667_10032052 | |||
| 1343 | Ga0207667_10571837 | |||
| 1344 | Ga0207667_10653419 | |||
| 1345 | Ga0207651_10237474 | |||
| 1346 | Ga0207651_10371747 | |||
| 1347 | Ga0207651_10389492 | |||
| 1348 | Ga0207651_11497136 | |||
| 1349 | Ga0207712_10032531 | |||
| 1350 | Ga0207668_10040917 | |||
| 1351 | Ga0207640_10011062 | |||
| 1352 | Ga0207640_10034094 | |||
| 1353 | Ga0207640_10673827 | |||
| 1354 | Ga0207658_10006164 | |||
| 1355 | Ga0207658_10553040 | |||
| 1356 | Ga0207677_10027086 | |||
| 1357 | Ga0207677_10046561 | |||
| 1358 | Ga0207703_10248118 | |||
| 1359 | Ga0207703_10355748 | |||
| 1360 | Ga0207703_10642859 | |||
| 1361 | Ga0207639_10059623 | |||
| 1362 | Ga0207678_10001570 | |||
| 1363 | Ga0207678_10016090 | |||
| 1364 | Ga0207678_10744387 | |||
| 1365 | Ga0207702_10001662 | |||
| 1366 | Ga0207702_10017140 | |||
| 1367 | Ga0207702_10303728 | |||
| 1368 | Ga0207702_10805655 | |||
| 1369 | Ga0207702_11667536 | |||
| 1370 | Ga0207702_11750635 | |||
| 1371 | Ga0207641_10000317 | |||
| 1372 | Ga0207641_10049391 | |||
| 1373 | Ga0207641_10348170 | |||
| 1374 | Ga0207641_10356393 | |||
| 1375 | Ga0207641_12362393 | |||
| 1376 | Ga0207648_10000031 | |||
| 1377 | Ga0207648_10010760 | |||
| 1378 | Ga0207648_10715521 | |||
| 1379 | Ga0207676_10000334 | |||
| 1380 | Ga0207676_10067135 | |||
| 1381 | Ga0207676_11277541 | |||
| 1382 | Ga0207674_10000150 | |||
| 1383 | Ga0207674_10016677 | |||
| 1384 | Ga0207674_10022627 | |||
| 1385 | Ga0207675_100025403 | |||
| 1386 | Ga0207675_100915587 | |||
| 1387 | Ga0207683_10010134 | |||
| 1388 | Ga0207683_10085192 | |||
| 1389 | Ga0207683_11206249 | |||
| 1390 | Ga0207698_10155577 | |||
| 1391 | Ga0207698_10281598 | |||
| 1392 | Ga0207698_11442376 | |||
| 1393 | Ga0268266_10023113 | |||
| 1394 | Ga0268266_10179115 | |||
| 1395 | Ga0268266_10262285 | |||
| 1396 | Ga0268266_10876124 | |||
| 1397 | Ga0268266_11643365 | |||
| 1398 | Ga0268265_10031193 | |||
| 1399 | Ga0268265_10569846 | |||
| 1400 | Ga0268264_10047973 | |||
| 1401 | Ga0268264_10057809 | |||
| 1402 | Ga0268264_10351971 | |||
| 1403 | Ga0268264_10535614 | |||
| 1404 | Ga0268264_10662405 | |||
| 1405 | Ga0268264_10705210 | |||
| 1406 | Ga0268264_11101990 | |||
| 1407 | Ga0265319_1142153 | |||
| 1408 | Ga0265336_10132448 | |||
| 1409 | Ga0265338_10022509 | |||
| 1410 | Ga0265338_10022779 | |||
| 1411 | Ga0265338_10088705 | |||
| 1412 | Ga0265338_10185204 | |||
| 1413 | Ga0265338_10212832 | |||
| 1414 | Ga0265338_10218171 | |||
| 1415 | Ga0265338_11103488 | |||
| 1416 | Ga0265762_1001035 | |||
| 1417 | Ga0265760_10000724 | |||
| 1418 | Ga0265760_10001114 | |||
| 1419 | Ga0265760_10002930 | |||
| 1420 | Ga0265760_10008011 | |||
| 1421 | Ga0265760_10174131 | |||
| 1422 | Ga0265325_10010702 | |||
| 1423 | Ga0265325_10011849 | |||
| 1424 | Ga0265325_10496471 | |||
| 1425 | Ga0265340_10112195 | |||
| 1426 | Ga0265340_10116832 | |||
| 1427 | Ga0265340_10534722 | |||
| 1428 | Ga0265339_10018791 | |||
| 1429 | Ga0265339_10030999 | |||
| 1430 | Ga0265339_10052569 | |||
| 1431 | Ga0265339_10381650 | |||
| 1432 | Ga0265316_10030314 | |||
| 1433 | Ga0265316_10621264 | |||
| 1434 | Ga0265314_10077458 | |||
| 1435 | Ga0265314_10189368 | |||
| 1436 | Ga0307410_10069786 | |||
| 1437 | Ga0307407_10168170 | |||
| 1438 | Ga0307409_100025319 | |||
| 1439 | Ga0307416_100201127 | |||
| 1440 | Ga0307411_10012210 | |||
| 1441 | Ga0307411_11823139 | |||
| 1442 | Ga0307415_100099832 | |||
| 1443 | Ga0316214_1018888 | |||
| 1444 | Ga0373948_0169268 | |||
| 1445 | Ga0373928_0131560 | |||
| 1446 | Ga0373934_0226399 | |||
| 1447 | Ga0373944_0048144 | |||
| 1448 | Ga0373951_0023935 | |||
| 1449 | Ga0373923_0167627 | |||
| 1450 | Ga0373932_0122036 | |||
| 1451 | Ga0373936_0002336 | |||
| 1452 | Ga0373936_0015053 | |||
| 1453 | Ga0373936_0578276 | |||
| 1454 | Ga0373939_0027939 | |||
| 1455 | Ga0373941_0346944 | |||
| 1456 | Ga0373953_0102670 | |||
| 1457 | Ga0373954_0414201 | |||
| 1458 | Ga0373956_0087845 | |||
| 1459 | Ga0373956_0239304 | |||
| 1460 | Ga0373957_0123837 | |||
| 1461 | Ga0373957_0295970 | |||
| 1462 | Ga0373960_0011325 | |||
| 1463 | Ga0373943_0000235 | |||
| 1464 | Ga0373943_0032085 | |||
| 1465 | Ga0373943_0372904 | |||
| 1466 | Ga0373946_0127086 | |||
| 1467 | Ga0373924_0041007 | |||
| 1468 | Ga0373931_0066319 | |||
| 1469 | Ga0373935_0000363 | |||
| 1470 | Ga0373935_0015574 | |||
| 1471 | Ga0373935_0235963 | |||
| 1472 | Ga0373935_0446191 | |||
| 1473 | Ga0373935_0560022 | |||
| 1474 | Ga0373927_0000635 | |||
| 1475 | Ga0373927_1190462 | |||
| 1476 | Ga0373933_0060508 | |||
| 1477 | Ga0373933_0140352 | |||
| 1478 | Ga0373947_0001002 | |||
| 1479 | Ga0373947_0534967 | |||
| 1480 | Ga0373937_0058535 | |||
| 1481 | Ga0373937_0129895 | |||
| 1482 | Ga0373937_0147282 | |||
| 1483 | Ga0373937_0147789 | |||
| 1484 | Ga0373937_1085070 | |||
| 1485 | Ga0373925_0000661 | |||
| 1486 | Ga0373925_0004968 | |||
| 1487 | Ga0373925_0013012 | |||
| 1488 | Ga0373925_0035408 | |||
| 1489 | Ga0373925_0086919 | |||
| 1490 | Ga0436365_0269346 | |||
| 1491 | Ga0436365_0763510 | |||
| 1492 | Ga0436360_0206578 | |||
| 1493 | Ga0436363_0736475 | |||
| 1494 | Ga0436362_0741755 | |||
| 1495 | Ga0451839_0117572 | |||
| 1496 | Ga0466966_0954510 | |||
| 1497 | Ga0453684_1468510 | |||
| 1498 | Ga0451576_0696526 | |||
| 1499 | Ga0451576_0856493 | |||
| 1500 | Ga0451576_2365277 | |||
| 1501 | Ga0466967_0346256 | |||
| 1502 | Ga0495603_0404144 | |||
| 1503 | Ga0495629_0077081 | |||
| 1504 | Ga0495641_0119626 | |||
| 1505 | Ga0495653_0197930 | |||
| 1506 | Ga0495580_0000505 | |||
| 1507 | Ga0495580_0032001 | |||
| 1508 | Ga0495580_0033323 | |||
| 1509 | Ga0495580_0199768 | |||
| 1510 | Ga0495580_0458910 | |||
| 1511 | Ga0495580_0526718 | |||
| 1512 | Ga0495580_0734963 | |||
| 1513 | Ga0495582_0009508 | |||
| 1514 | Ga0495664_0006351 | |||
| 1515 | Ga0495664_0335413 | |||
| 1516 | Ga0495584_0051997 | |||
| 1517 | Ga0495585_0334841 | |||
| 1518 | Ga0495628_0277235 | |||
| 1519 | Ga0495628_0427647 | |||
| 1520 | Ga0495630_0008873 | |||
| 1521 | Ga0495630_0224103 | |||
| 1522 | Ga0495630_0231352 | |||
| 1523 | Ga0495630_0280352 | |||
| 1524 | Ga0495666_0482932 | |||
| 1525 | Ga0495652_0337981 | |||
| 1526 | Ga0495665_0337874 | |||
| 1527 | Ga0495640_0159246 | |||
| 1528 | Ga0495640_0461086 | |||
| 1529 | Ga0495645_0122760 | |||
| 1530 | Ga0495645_0190748 | |||
| 1531 | Ga0495667_0629988 | |||
| 1532 | Ga0495656_0729327 | |||
| 1533 | Ga0495635_0184929 | |||
| 1534 | Ga0495635_0451054 | |||
| 1535 | Ga0495657_0391801 | |||
| 1536 | Ga0495657_0439563 | |||
| 1537 | Ga0495599_0186519 | |||
| 1538 | Ga0495646_0327128 | |||
| 1539 | Ga0495646_0513102 | |||
| 1540 | Ga0495647_0046257 | |||
| 1541 | Ga0495658_0038130 | |||
| 1542 | Ga0495658_0046900 | |||
| 1543 | Ga0495669_0009884 | |||
| 1544 | Ga0495613_0038012 | |||
| 1545 | Ga0495624_0042625 | |||
| 1546 | Ga0495624_0596081 | |||
| 1547 | Ga0495581_0148052 | |||
| 1548 | Ga0495604_0074477 | |||
| 1549 | Ga0495674_0018727 | |||
| 1550 | Ga0495674_0024534 | |||
| 1551 | Ga0495674_1129682 | |||
| 1552 | Ga0495674_1211505 | |||
| 1553 | Ga0495676_1071544 | |||
| 1554 | Ga0495676_1085442 | |||
| 1555 | Ga0495680_0279040 | |||
| 1556 | Ga0495684_0300431 | |||
| 1557 | Ga0495593_0139032 | |||
| 1558 | Ga0495602_0106818 | |||
| 1559 | Ga0495602_0141735 | |||
| 1560 | Ga0496100_0007632 | |||
| 1561 | Ga0496100_0036840 | |||
| 1562 | Ga0496100_0082280 | |||
| 1563 | Ga0496100_0682880 | |||
| 1564 | Ga0496100_0852867 | |||
| 1565 | Ga0496101_0105125 | |||
| 1566 | Ga0496101_0286374 | |||
| 1567 | Ga0496102_0054491 | |||
| 1568 | Ga0496102_0173275 | |||
| 1569 | Ga0496102_0362356 | |||
| 1570 | Ga0496103_0416707 | |||
| 1571 | Ga0496104_0134896 | |||
| 1572 | Ga0496104_0309346 | |||
| 1573 | Ga0496104_0462440 | |||
| 1574 | Ga0496104_1150572 | |||
| 1575 | Ga0496105_0144432 | |||
| 1576 | Ga0496105_0908610 | |||
| 1577 | Ga0496106_0081921 | |||
| 1578 | Ga0496106_0111187 | |||
| 1579 | Ga0496107_0119902 | |||
| 1580 | Ga0496107_0177602 | |||
| 1581 | Ga0496107_0447065 | |||
| 1582 | Ga0496107_0896136 | |||
| 1583 | Ga0496108_0004968 | |||
| 1584 | Ga0496108_0077923 | |||
| 1585 | Ga0496108_1187826 | |||
| 1586 | Ga0496109_0000600 | |||
| 1587 | Ga0496109_0022461 | |||
| 1588 | Ga0496109_0270485 | |||
| 1589 | Ga0496110_0001952 | |||
| 1590 | Ga0496110_1608854 | |||
| 1591 | Ga0496111_0008792 | |||
| 1592 | Ga0496112_0000097 | |||
| 1593 | Ga0496112_0029629 | |||
| 1594 | Ga0496112_0086339 | |||
| 1595 | Ga0496112_0131742 | |||
| 1596 | Ga0496112_0398618 | |||
| 1597 | Ga0496112_1192467 | |||
| 1598 | Ga0496113_0002729 | |||
| 1599 | Ga0496113_0194894 | |||
| 1600 | Ga0496113_0391210 | |||
| 1601 | Ga0496114_0004185 | |||
| 1602 | Ga0496114_0516995 | |||
| 1603 | Ga0496115_0006677 | |||
| 1604 | Ga0496115_0770355 | |||
| 1605 | Ga0496115_0967880 | |||
| 1606 | Ga0501032_0107557 | |||
| 1607 | Ga0501034_0287049 | |||
| 1608 | Ga0501037_0248445 | |||
| 1609 | Ga0501047_0017245 | |||
| 1610 | Ga0501048_0642383 | |||
| 1611 | Ga0501069_0019127 | |||
| 1612 | Ga0501070_0000101 | |||
| 1613 | Ga0501070_1237747 | |||
| 1614 | Ga0501073_0021980 | |||
| 1615 | Ga0501073_0065808 | |||
| 1616 | Ga0501073_0298568 | |||
| 1617 | Ga0501074_1324275 | |||
| 1618 | Ga0501077_0204317 | |||
| 1619 | Ga0501079_0239562 | |||
| 1620 | Ga0501080_0001683 | |||
| 1621 | Ga0501083_0020629 | |||
| 1622 | Ga0501083_0715908 | |||
| 1623 | Ga0501044_0013496 | |||
| 1624 | nmdc:mga03683_15942_c1 | |||
| 1625 | nmdc:mga06z11_184351_c1 | |||
| 1626 | nmdc:mga0n895_26261_c1 | |||
| 1627 | nmdc:mga0n895_462121_c1 | |||
| 1628 | nmdc:mga0rr50_113854_c1 | |||
| 1629 | nmdc:mga0rr50_1225237_c1 | |||
| 1630 | nmdc:mga08x19_302653_c1 | |||
| 1631 | Ga0495601_0046423 | |||
| 1632 | Ga0495601_0685481 | |||
| 1633 | Ga0495612_0313563 | |||
| 1634 | Ga0495619_0266103 | |||
| 1635 | Ga0495619_1016132 | |||
| 1636 | Ga0501082_0221841 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6mxv-assembly1.cif.gz_A | the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 | 0.9557 | 4 | 124 |
| 6mxv-assembly1.cif.gz_A | the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 | 0.9261 | 4 | 124 |
| 2kl3-assembly1.cif.gz_A | solution nmr structure of the rhodanese-like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437a | 0.923 | 22 | 123 |
| 3hix-assembly1.cif.gz_A | crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i | 0.91 | 37 | 123 |
| 3ilm-assembly1.cif.gz_A | crystal structure of the alr3790 protein from anabaena sp. northeast structural genomics consortium target nsr437h | 0.9076 | 23 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kl3A01 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.9226 | 22 | 124 | 3.40.250.10 |
| af_Q38853_56_181_3.40.250.10 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.9027 | 20 | 123 | 3.40.250.10 |
| 3fojA00 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8967 | 21 | 113 | 3.40.250.10 |
| af_I1LP77_2_120_3.40.250.10 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8951 | 20 | 121 | 3.40.250.10 |
| 2kl3A01 | Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain | 0.8898 | 22 | 124 | 3.40.250.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V1DRG1-F1-model_v4 | Sulfurtransferase | 0.9856 | 4 | 124 |
GO:0004792
|
| AF-Q2JQJ5-F1-model_v4 | Rhodanese domain protein | 0.9836 | 1 | 124 |
GO:0004792
|
| AF-A0A7T9KBQ0-F1-model_v4 | deleted | 0.9835 | 5 | 124 |
|
| AF-A0A2G8PGV8-F1-model_v4 | Sulfurtransferase | 0.9834 | 1 | 124 |
GO:0016740
|
| AF-A0A532EQX9-F1-model_v4 | Sulfurtransferase | 0.9827 | 4 | 110 |
GO:0016740
|