F482123

General Info

Members Datasets Scaffolds Average Seq Length
818 321 1636 125

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_101700502|Ga0070707_1017005021
Length 154
Sequence MLLEADVSLHRRLSDWYYVGAIYQRKENFMAHQHPPRFLKIVDDARSRIHETNVDEVKKRIDRGDKLLLVDVREESEYAKDHLPGAIHLGKGVIERDIEARVPDLSKEMILYCGGGFRSALAADNLQKMGYTNVISMDGGIRDWREKGFPLVKD

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
126 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
127 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
128 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
198 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
214 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
221 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
223 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
271 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
320 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 5.62
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 24.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_101700502 3300005468 Bacteria 598
2 MRS1b_contig_316497 2162886011 Bacteria 1307
3 MBSR1b_contig_11250795 2162886012 Unclassified 2556
4 MBSR1b_contig_2671148 2162886012 Unclassified 3250
5 JGI24752J21851_1007270 3300001976 Bacteria 1444
6 JGI24738J21930_10047428 3300002075 Unclassified 874
7 JGI24034J26672_10000848 3300002239 Unclassified 3976
8 JGI24751J29686_10001755 3300002459 Bacteria 4458
9 Ga0065704_10166826 3300005289 Bacteria 1317
10 Ga0065712_10164061 3300005290 Bacteria 1248
11 Ga0065712_10781874 3300005290 Bacteria 518
12 Ga0065715_10131267 3300005293 Bacteria 2011
13 Ga0065707_10291745 3300005295 Bacteria 1023
14 Ga0070658_10038250 3300005327 Bacteria 3870
15 Ga0070658_11834514 3300005327 Bacteria 524
16 Ga0070676_10291746 3300005328 Unclassified 1102
17 Ga0070683_100015024 3300005329 Bacteria 6792
18 Ga0070683_100087072 3300005329 Unclassified 2929
19 Ga0070690_100286650 3300005330 Unclassified 1176
20 Ga0070690_100991829 3300005330 Unclassified 661
21 Ga0070670_100112644 3300005331 Bacteria 2345
22 Ga0070670_100132044 3300005331 Bacteria 2157
23 Ga0070670_100228026 3300005331 Bacteria 1621
24 Ga0070677_10004017 3300005333 Unclassified 4777
25 Ga0070677_10172617 3300005333 Unclassified 1023
26 Ga0068869_100046481 3300005334 Bacteria 3130
27 Ga0070666_10054759 3300005335 Unclassified 2691
28 Ga0070666_10057347 3300005335 Bacteria 2631
29 Ga0070666_10158711 3300005335 Bacteria 1580
30 Ga0070666_10735820 3300005335 Bacteria 724
31 Ga0070666_10774402 3300005335 Bacteria 706
32 Ga0070680_100662151 3300005336 Bacteria 897
33 Ga0070682_100008604 3300005337 Bacteria 5761
34 Ga0070682_100092598 3300005337 Bacteria 1980
35 Ga0068868_100001799 3300005338 Bacteria 14724
36 Ga0068868_100151227 3300005338 Unclassified 1911
37 Ga0068868_100284011 3300005338 Unclassified 1402
38 Ga0070660_101870811 3300005339 Bacteria 511
39 Ga0070689_102106746 3300005340 Unclassified 516
40 Ga0070687_100009236 3300005343 Unclassified 4216
41 Ga0070661_100022965 3300005344 Unclassified 4468
42 Ga0070661_100027423 3300005344 Bacteria 4101
43 Ga0070692_10118265 3300005345 Bacteria 1474
44 Ga0070668_100030698 3300005347 Bacteria 4088
45 Ga0070668_100056503 3300005347 Unclassified 3031
46 Ga0070669_100002345 3300005353 Bacteria 13686
47 Ga0070669_100027509 3300005353 Bacteria 4092
48 Ga0070669_100269778 3300005353 Bacteria 1360
49 Ga0070675_100138673 3300005354 Unclassified 2077
50 Ga0070675_100327982 3300005354 Bacteria 1353
51 Ga0070675_101239171 3300005354 Unclassified 687
52 Ga0070671_100042048 3300005355 Bacteria 3799
53 Ga0070671_100070314 3300005355 Bacteria 2920
54 Ga0070671_100695920 3300005355 Unclassified 881
55 Ga0070671_101043481 3300005355 Bacteria 717
56 Ga0070671_101741420 3300005355 Bacteria 553
57 Ga0070674_100018594 3300005356 Unclassified 4398
58 Ga0070673_100054905 3300005364 Unclassified 3136
59 Ga0070673_100412764 3300005364 Bacteria 1209
60 Ga0070673_100434277 3300005364 Unclassified 1179
61 Ga0070688_100020721 3300005365 Unclassified 3828
62 Ga0070659_100043270 3300005366 Bacteria 3522
63 Ga0070659_100069464 3300005366 Unclassified 2796
64 Ga0070659_100104137 3300005366 Bacteria 2286
65 Ga0070659_100624716 3300005366 Bacteria 927
66 Ga0070667_100325029 3300005367 Bacteria 1389
67 Ga0070667_100677516 3300005367 Unclassified 953
68 Ga0070667_100684660 3300005367 Bacteria 948
69 Ga0070667_101149872 3300005367 Unclassified 726
70 Ga0070709_10020987 3300005434 Bacteria 3801
71 Ga0070709_10033505 3300005434 Unclassified 3107
72 Ga0070709_10165947 3300005434 Bacteria 1539
73 Ga0070709_10290988 3300005434 Bacteria 1190
74 Ga0070709_10852912 3300005434 Unclassified 718
75 Ga0070709_11235397 3300005434 Bacteria 601
76 Ga0070714_100003152 3300005435 Bacteria 12244
77 Ga0070714_100103459 3300005435 Bacteria 2512
78 Ga0070714_100194377 3300005435 Bacteria 1853
79 Ga0070714_100870163 3300005435 Unclassified 874
80 Ga0070713_100000078 3300005436 Bacteria 60357
81 Ga0070713_100004392 3300005436 Bacteria 9475
82 Ga0070713_100009108 3300005436 Bacteria 7081
83 Ga0070713_100046576 3300005436 Bacteria 3559
84 Ga0070713_100050736 3300005436 Unclassified 3428
85 Ga0070713_100181091 3300005436 Bacteria 1894
86 Ga0070713_100228922 3300005436 Bacteria 1689
87 Ga0070713_100261006 3300005436 Bacteria 1583
88 Ga0070713_100276539 3300005436 Bacteria 1539
89 Ga0070713_100334033 3300005436 Bacteria 1402
90 Ga0070713_100568610 3300005436 Bacteria 1075
91 Ga0070713_101134528 3300005436 Unclassified 756
92 Ga0070713_101156320 3300005436 Unclassified 749
93 Ga0070713_101785931 3300005436 Unclassified 597
94 Ga0070710_10021208 3300005437 Bacteria 3382
95 Ga0070710_10099693 3300005437 Bacteria 1728
96 Ga0070710_10301286 3300005437 Unclassified 1046
97 Ga0070710_10704858 3300005437 Unclassified 713
98 Ga0070710_11182211 3300005437 Unclassified 565
99 Ga0070710_11503088 3300005437 Unclassified 506
100 Ga0070701_10066268 3300005438 Unclassified 1918
101 Ga0070701_10407381 3300005438 Bacteria 863
102 Ga0070711_100000386 3300005439 Bacteria 22753
103 Ga0070711_100000754 3300005439 Bacteria 16905
104 Ga0070711_100008257 3300005439 Bacteria 6370
105 Ga0070711_100009243 3300005439 Bacteria 6060
106 Ga0070711_100165671 3300005439 Bacteria 1680
107 Ga0070711_100455151 3300005439 Unclassified 1048
108 Ga0070711_101075693 3300005439 Unclassified 692
109 Ga0070711_101096488 3300005439 Unclassified 686
110 Ga0070711_101917423 3300005439 Unclassified 521
111 Ga0070705_101191562 3300005440 Unclassified 627
112 Ga0070694_100150959 3300005444 Bacteria 1697
113 Ga0070708_100000165 3300005445 Bacteria 47190
114 Ga0070708_100005858 3300005445 Bacteria 9762
115 Ga0070708_101119098 3300005445 Unclassified 737
116 Ga0070663_100018963 3300005455 Bacteria 4523
117 Ga0070663_100215521 3300005455 Unclassified 1505
118 Ga0070678_100184191 3300005456 Bacteria 1712
119 Ga0070678_101524007 3300005456 Bacteria 626
120 Ga0070662_100011873 3300005457 Bacteria 5759
121 Ga0070662_100039843 3300005457 Unclassified 3343
122 Ga0070681_10041227 3300005458 Unclassified 4626
123 Ga0070681_10247282 3300005458 Unclassified 1696
124 Ga0070681_10448866 3300005458 Bacteria 1201
125 Ga0070681_11807142 3300005458 Bacteria 538
126 Ga0068867_100002889 3300005459 Bacteria 12087
127 Ga0068867_100091884 3300005459 Bacteria 2304
128 Ga0068867_100399796 3300005459 Unclassified 1158
129 Ga0068867_100855657 3300005459 Bacteria 815
130 Ga0070685_10005238 3300005466 Bacteria 6580
131 Ga0070706_100021652 3300005467 Bacteria 5921
132 Ga0070706_100037008 3300005467 Bacteria 4508
133 Ga0070706_100053457 3300005467 Bacteria 3728
134 Ga0070706_100692183 3300005467 Unclassified 945
135 Ga0070707_100000237 3300005468 Bacteria 55304
136 Ga0070707_100004396 3300005468 Bacteria 13205
137 Ga0070707_100209273 3300005468 Bacteria 1901
138 Ga0070707_100320020 3300005468 Bacteria 1507
139 Ga0070698_100001730 3300005471 Bacteria 24348
140 Ga0070698_100283454 3300005471 Bacteria 1588
141 Ga0070699_100001358 3300005518 Bacteria 22522
142 Ga0070699_100220592 3300005518 Unclassified 1689
143 Ga0070699_101059018 3300005518 Bacteria 744
144 Ga0070679_100192621 3300005530 Unclassified 2007
145 Ga0070679_100233728 3300005530 Bacteria 1797
146 Ga0070684_100009310 3300005535 Bacteria 7733
147 Ga0070684_100216105 3300005535 Bacteria 1748
148 Ga0070684_100669964 3300005535 Bacteria 966
149 Ga0070697_100000219 3300005536 Bacteria 47258
150 Ga0070697_100000255 3300005536 Bacteria 43116
151 Ga0070697_100004137 3300005536 Bacteria 11119
152 Ga0070697_100144506 3300005536 Bacteria 2002
153 Ga0070697_102118571 3300005536 Unclassified 503
154 Ga0068853_100063545 3300005539 Bacteria 3198
155 Ga0068853_102105746 3300005539 Bacteria 547
156 Ga0070672_100054517 3300005543 Unclassified 3130
157 Ga0070672_100337778 3300005543 Unclassified 1282
158 Ga0070686_100010469 3300005544 Bacteria 5231
159 Ga0070686_100134840 3300005544 Bacteria 1712
160 Ga0070686_100337064 3300005544 Unclassified 1129
161 Ga0070695_100415891 3300005545 Unclassified 1023
162 Ga0070695_100855180 3300005545 Bacteria 732
163 Ga0070696_100607112 3300005546 Unclassified 883
164 Ga0070696_100727756 3300005546 Bacteria 811
165 Ga0070693_100034412 3300005547 Bacteria 2803
166 Ga0070693_100366782 3300005547 Unclassified 990
167 Ga0070693_101503052 3300005547 Unclassified 526
168 Ga0070665_100024537 3300005548 Bacteria 6075
169 Ga0070665_100250121 3300005548 Bacteria 1773
170 Ga0070665_101201100 3300005548 Bacteria 769
171 Ga0070704_100356958 3300005549 Bacteria 1235
172 Ga0070704_100636932 3300005549 Bacteria 940
173 Ga0070704_100946030 3300005549 Bacteria 777
174 Ga0068855_100044277 3300005563 Bacteria 5267
175 Ga0068855_100125691 3300005563 Bacteria 2932
176 Ga0068855_100677752 3300005563 Bacteria 1105
177 Ga0068855_101028626 3300005563 Bacteria 864
178 Ga0070664_100055516 3300005564 Bacteria 3363
179 Ga0070664_100074770 3300005564 Unclassified 2908
180 Ga0070664_100238243 3300005564 Bacteria 1633
181 Ga0070664_100489734 3300005564 Bacteria 1132
182 Ga0068857_100009256 3300005577 Bacteria 8545
183 Ga0068857_100021553 3300005577 Bacteria 5670
184 Ga0068857_100924726 3300005577 Unclassified 837
185 Ga0068854_100000789 3300005578 Bacteria 18846
186 Ga0068854_100012581 3300005578 Bacteria 5544
187 Ga0068856_100003171 3300005614 Bacteria 16740
188 Ga0068856_100013107 3300005614 Bacteria 8030
189 Ga0068856_100041231 3300005614 Bacteria 4536
190 Ga0068856_101013736 3300005614 Unclassified 848
191 Ga0068856_101077299 3300005614 Unclassified 821
192 Ga0068856_101117617 3300005614 Bacteria 805
193 Ga0068856_102399896 3300005614 Unclassified 535
194 Ga0070702_100002231 3300005615 Bacteria 8270
195 Ga0070702_100579803 3300005615 Unclassified 837
196 Ga0068852_100003988 3300005616 Bacteria 10375
197 Ga0068852_100039180 3300005616 Bacteria 3989
198 Ga0068852_100823304 3300005616 Bacteria 943
199 Ga0068859_100186287 3300005617 Bacteria 2159
200 Ga0068859_101107534 3300005617 Bacteria 871
201 Ga0068864_100017709 3300005618 Bacteria 5943
202 Ga0068864_100030716 3300005618 Bacteria 4555
203 Ga0068864_100129429 3300005618 Bacteria 2266
204 Ga0068866_10013563 3300005718 Bacteria 3580
205 Ga0068866_10077914 3300005718 Bacteria 1772
206 Ga0068866_10228789 3300005718 Unclassified 1126
207 Ga0068866_10640111 3300005718 Unclassified 723
208 Ga0068861_100017290 3300005719 Bacteria 5116
209 Ga0068861_100095205 3300005719 Bacteria 2358
210 Ga0068851_10002806 3300005834 Bacteria 7680
211 Ga0068851_10019123 3300005834 Bacteria 3308
212 Ga0068851_10191828 3300005834 Unclassified 1136
213 Ga0068863_100009036 3300005841 Bacteria 9732
214 Ga0068863_100024318 3300005841 Bacteria 5777
215 Ga0068863_100029719 3300005841 Bacteria 5218
216 Ga0068863_100058963 3300005841 Unclassified 3632
217 Ga0068863_100642106 3300005841 Unclassified 1052
218 Ga0068858_100040727 3300005842 Bacteria 4309
219 Ga0068858_100066333 3300005842 Bacteria 3341
220 Ga0068858_100996084 3300005842 Bacteria 821
221 Ga0068860_100110092 3300005843 Unclassified 2632
222 Ga0068860_100176431 3300005843 Bacteria 2065
223 Ga0068860_100303695 3300005843 Unclassified 1564
224 Ga0068860_101063902 3300005843 Unclassified 828
225 Ga0068862_100021905 3300005844 Bacteria 5344
226 Ga0068862_100025552 3300005844 Bacteria 4958
227 Ga0068862_101116400 3300005844 Unclassified 784
228 Ga0081540_1071536 3300005983 Unclassified 1602
229 Ga0070717_10001788 3300006028 Bacteria 14986
230 Ga0070717_10001810 3300006028 Bacteria 14936
231 Ga0070717_10003192 3300006028 Bacteria 11711
232 Ga0070717_10008829 3300006028 Bacteria 7548
233 Ga0070717_10015935 3300006028 Bacteria 5818
234 Ga0070717_10025374 3300006028 Bacteria 4712
235 Ga0070717_10032861 3300006028 Bacteria 4182
236 Ga0070717_10052783 3300006028 Bacteria 3350
237 Ga0070717_10061951 3300006028 Bacteria 3101
238 Ga0070717_10202369 3300006028 Bacteria 1740
239 Ga0070717_10432732 3300006028 Bacteria 1184
240 Ga0070717_10494520 3300006028 Bacteria 1105
241 Ga0070717_10729339 3300006028 Unclassified 901
242 Ga0070717_10849705 3300006028 Bacteria 831
243 Ga0070717_10920840 3300006028 Unclassified 796
244 Ga0070715_10001686 3300006163 Bacteria 6564
245 Ga0070715_10008384 3300006163 Bacteria 3599
246 Ga0070715_10138833 3300006163 Bacteria 1178
247 Ga0070715_10183766 3300006163 Bacteria 1050
248 Ga0070716_100000288 3300006173 Bacteria 20376
249 Ga0070716_100000356 3300006173 Bacteria 18763
250 Ga0070716_100060898 3300006173 Unclassified 2182
251 Ga0070716_100090148 3300006173 Bacteria 1854
252 Ga0070716_100149460 3300006173 Bacteria 1500
253 Ga0070716_100195395 3300006173 Bacteria 1340
254 Ga0070716_100205282 3300006173 Bacteria 1313
255 Ga0070716_100669238 3300006173 Bacteria 789
256 Ga0070716_101168239 3300006173 Bacteria 617
257 Ga0070712_100000122 3300006175 Bacteria 40912
258 Ga0070712_100000856 3300006175 Bacteria 18132
259 Ga0070712_100001565 3300006175 Bacteria 13997
260 Ga0070712_100019012 3300006175 Bacteria 4471
261 Ga0070712_100030354 3300006175 Bacteria 3631
262 Ga0070712_100209273 3300006175 Bacteria 1537
263 Ga0070712_100388223 3300006175 Bacteria 1151
264 Ga0070712_100443237 3300006175 Bacteria 1080
265 Ga0070712_100923654 3300006175 Unclassified 753
266 Ga0097621_100000357 3300006237 Bacteria 31608
267 Ga0097621_100049800 3300006237 Bacteria 3405
268 Ga0097621_100056451 3300006237 Bacteria 3208
269 Ga0097621_100066331 3300006237 Bacteria 2972
270 Ga0097621_100895424 3300006237 Unclassified 826
271 Ga0068871_100002520 3300006358 Bacteria 12489
272 Ga0068871_100008262 3300006358 Bacteria 7483
273 Ga0068871_100012801 3300006358 Bacteria 6207
274 Ga0068871_100041414 3300006358 Bacteria 3694
275 Ga0068871_100195450 3300006358 Unclassified 1744
276 Ga0075433_10035246 3300006852 Unclassified 4302
277 Ga0075434_100000226 3300006871 Bacteria 38665
278 Ga0075434_100005438 3300006871 Bacteria 11599
279 Ga0075434_100216732 3300006871 Unclassified 1934
280 Ga0068865_100016983 3300006881 Unclassified 4671
281 Ga0068865_100206001 3300006881 Bacteria 1530
282 Ga0068865_100807854 3300006881 Bacteria 809
283 Ga0075436_100021337 3300006914 Bacteria 4447
284 Ga0075436_100331226 3300006914 Unclassified 1095
285 Ga0075436_100567313 3300006914 Bacteria 834
286 Ga0097620_100186292 3300006931 Bacteria 2159
287 Ga0097620_101107490 3300006931 Bacteria 871
288 Ga0075435_100000168 3300007076 Bacteria 38177
289 Ga0075435_100129735 3300007076 Unclassified 2109
290 Ga0075435_100914950 3300007076 Unclassified 765
291 Ga0105250_10041069 3300009092 Bacteria 1855
292 Ga0105250_10513747 3300009092 Bacteria 545
293 Ga0105240_10023277 3300009093 Bacteria 8197
294 Ga0105240_10037314 3300009093 Bacteria 6246
295 Ga0105240_10091094 3300009093 Bacteria 3726
296 Ga0105240_10102006 3300009093 Bacteria 3488
297 Ga0105240_10126190 3300009093 Bacteria 3075
298 Ga0105240_11787203 3300009093 Unclassified 641
299 Ga0105245_10004274 3300009098 Bacteria 12665
300 Ga0105245_10018930 3300009098 Bacteria 6026
301 Ga0105245_10026018 3300009098 Bacteria 5149
302 Ga0105245_10108037 3300009098 Bacteria 2584
303 Ga0105245_10803906 3300009098 Unclassified 978
304 Ga0105247_10002806 3300009101 Bacteria 11651
305 Ga0105247_10016109 3300009101 Bacteria 4478
306 Ga0105247_10066124 3300009101 Bacteria 2251
307 Ga0105241_10063350 3300009174 Bacteria 2852
308 Ga0105241_10154906 3300009174 Bacteria 1878
309 Ga0105241_10173823 3300009174 Bacteria 1781
310 Ga0105241_10872625 3300009174 Unclassified 834
311 Ga0105242_10015341 3300009176 Bacteria 5950
312 Ga0105242_10030649 3300009176 Unclassified 4295
313 Ga0105242_10031689 3300009176 Bacteria 4225
314 Ga0105242_10217991 3300009176 Bacteria 1704
315 Ga0105242_10966369 3300009176 Bacteria 857
316 Ga0105248_10069448 3300009177 Unclassified 3955
317 Ga0105248_10189958 3300009177 Bacteria 2314
318 Ga0105248_11113251 3300009177 Bacteria 893
319 Ga0105248_11418973 3300009177 Unclassified 786
320 Ga0105237_10037403 3300009545 Bacteria 4906
321 Ga0105237_10256780 3300009545 Bacteria 1750
322 Ga0105237_10296808 3300009545 Unclassified 1619
323 Ga0105237_10977898 3300009545 Bacteria 853
324 Ga0105237_11149668 3300009545 Unclassified 783
325 Ga0105237_11833730 3300009545 Bacteria 614
326 Ga0105237_12087010 3300009545 Bacteria 576
327 Ga0105238_10128329 3300009551 Bacteria 2514
328 Ga0105238_10151964 3300009551 Unclassified 2290
329 Ga0105238_10514723 3300009551 Bacteria 1199
330 Ga0105238_12654493 3300009551 Bacteria 537
331 Ga0105249_10069419 3300009553 Bacteria 3252
332 Ga0105239_10021589 3300010375 Bacteria 7100
333 Ga0105239_10106738 3300010375 Bacteria 3102
334 Ga0105246_10003125 3300011119 Bacteria 10051
335 Ga0105246_10010046 3300011119 Bacteria 5841
336 Ga0105246_10204126 3300011119 Bacteria 1539
337 Ga0157315_1011868 3300012508 Unclassified 794
338 Ga0157373_10008912 3300013100 Bacteria 7424
339 Ga0157373_10134686 3300013100 Bacteria 1737
340 Ga0157371_10004902 3300013102 Bacteria 11495
341 Ga0157371_10015784 3300013102 Bacteria 5651
342 Ga0157370_10262317 3300013104 Bacteria 1597
343 Ga0157370_11721224 3300013104 Bacteria 563
344 Ga0157369_10020489 3300013105 Bacteria 7392
345 Ga0157369_10137478 3300013105 Bacteria 2586
346 Ga0157369_10206668 3300013105 Bacteria 2059
347 Ga0157369_11461986 3300013105 Unclassified 695
348 Ga0157374_10005829 3300013296 Bacteria 10407
349 Ga0157374_10022318 3300013296 Bacteria 5645
350 Ga0157374_10043071 3300013296 Bacteria 4167
351 Ga0157374_10082094 3300013296 Bacteria 3060
352 Ga0157374_11020099 3300013296 Unclassified 847
353 Ga0157374_11428465 3300013296 Unclassified 715
354 Ga0157374_12357158 3300013296 Bacteria 559
355 Ga0157378_10000800 3300013297 Bacteria 29301
356 Ga0157378_10022475 3300013297 Bacteria 5551
357 Ga0157378_10136455 3300013297 Unclassified 2275
358 Ga0157378_10235044 3300013297 Unclassified 1748
359 Ga0163162_10004807 3300013306 Bacteria 13032
360 Ga0163162_10006725 3300013306 Bacteria 11152
361 Ga0163162_10087941 3300013306 Unclassified 3186
362 Ga0163162_10158077 3300013306 Unclassified 2387
363 Ga0163162_10237409 3300013306 Unclassified 1953
364 Ga0157372_10002533 3300013307 Bacteria 19823
365 Ga0157372_10002813 3300013307 Bacteria 18797
366 Ga0157372_10017457 3300013307 Bacteria 7704
367 Ga0157372_10052308 3300013307 Unclassified 4547
368 Ga0157372_10054817 3300013307 Bacteria 4450
369 Ga0157372_10122014 3300013307 Unclassified 2994
370 Ga0157372_11583909 3300013307 Bacteria 754
371 Ga0157375_10004437 3300013308 Bacteria 12187
372 Ga0157375_10097633 3300013308 Bacteria 3013
373 Ga0157375_10104072 3300013308 Unclassified 2927
374 Ga0163163_10043265 3300014325 Bacteria 4415
375 Ga0163163_10156945 3300014325 Unclassified 2320
376 Ga0163163_10314026 3300014325 Bacteria 1620
377 Ga0163163_10490003 3300014325 Bacteria 1291
378 Ga0157380_10079557 3300014326 Unclassified 2677
379 Ga0157377_10053915 3300014745 Unclassified 2275
380 Ga0157379_10005802 3300014968 Bacteria 10624
381 Ga0157379_10087830 3300014968 Unclassified 2787
382 Ga0157379_11125050 3300014968 Unclassified 753
383 Ga0157379_11987589 3300014968 Unclassified 574
384 Ga0157376_10030437 3300014969 Bacteria 4310
385 Ga0157376_10085011 3300014969 Unclassified 2725
386 Ga0157376_10091625 3300014969 Bacteria 2634
387 Ga0157376_10157945 3300014969 Unclassified 2052
388 Ga0157376_10200968 3300014969 Bacteria 1834
389 Ga0182007_10188148 3300015262 Bacteria 717
390 Ga0163161_10022315 3300017792 Unclassified 4456
391 Ga0213876_10151738 3300021384 Unclassified 1232
392 Ga0224569_100043 3300022732 Bacteria 7860
393 Ga0224569_106812 3300022732 Bacteria 832
394 Ga0224571_102676 3300022734 Bacteria 1134
395 Ga0224572_1018284 3300024225 Bacteria 1347
396 Ga0228598_1000208 3300024227 Bacteria 10902
397 Ga0228598_1000381 3300024227 Bacteria 8892
398 Ga0207697_10001848 3300025315 Bacteria 11325
399 Ga0207656_10015800 3300025321 Bacteria 2927
400 Ga0207682_10023115 3300025893 Unclassified 2454
401 Ga0207692_10048718 3300025898 Bacteria 2135
402 Ga0207692_10077445 3300025898 Bacteria 1769
403 Ga0207692_10126961 3300025898 Bacteria 1436
404 Ga0207692_10336307 3300025898 Unclassified 927
405 Ga0207692_10366786 3300025898 Unclassified 891
406 Ga0207642_10024098 3300025899 Unclassified 2442
407 Ga0207642_10041421 3300025899 Bacteria 2016
408 Ga0207642_10383712 3300025899 Unclassified 837
409 Ga0207710_10058089 3300025900 Bacteria 1748
410 Ga0207688_10004671 3300025901 Bacteria 7464
411 Ga0207680_10203231 3300025903 Bacteria 1351
412 Ga0207680_10294411 3300025903 Unclassified 1130
413 Ga0207647_10019456 3300025904 Bacteria 4566
414 Ga0207647_10038958 3300025904 Bacteria 3002
415 Ga0207685_10044828 3300025905 Bacteria 1674
416 Ga0207685_10084469 3300025905 Unclassified 1322
417 Ga0207685_10102705 3300025905 Bacteria 1225
418 Ga0207699_10041622 3300025906 Bacteria 2655
419 Ga0207699_10046173 3300025906 Bacteria 2546
420 Ga0207699_10094811 3300025906 Unclassified 1880
421 Ga0207699_10103928 3300025906 Bacteria 1808
422 Ga0207699_10122850 3300025906 Bacteria 1682
423 Ga0207699_10913738 3300025906 Unclassified 648
424 Ga0207699_11056978 3300025906 Bacteria 601
425 Ga0207645_10001098 3300025907 Bacteria 22307
426 Ga0207645_10030387 3300025907 Bacteria 3480
427 Ga0207643_10001772 3300025908 Bacteria 12042
428 Ga0207705_11436308 3300025909 Bacteria 524
429 Ga0207684_10000948 3300025910 Bacteria 32649
430 Ga0207684_10009358 3300025910 Bacteria 8655
431 Ga0207684_10044251 3300025910 Bacteria 3775
432 Ga0207684_10517361 3300025910 Unclassified 1022
433 Ga0207654_10075701 3300025911 Unclassified 2012
434 Ga0207654_10135112 3300025911 Bacteria 1566
435 Ga0207654_10955021 3300025911 Unclassified 622
436 Ga0207707_10080337 3300025912 Bacteria 2847
437 Ga0207707_10083763 3300025912 Unclassified 2784
438 Ga0207707_10431636 3300025912 Bacteria 1128
439 Ga0207695_10029850 3300025913 Bacteria 6015
440 Ga0207695_10050228 3300025913 Bacteria 4389
441 Ga0207695_10137998 3300025913 Bacteria 2390
442 Ga0207671_10092049 3300025914 Unclassified 2286
443 Ga0207671_11089466 3300025914 Bacteria 628
444 Ga0207693_10000291 3300025915 Bacteria 46501
445 Ga0207693_10000329 3300025915 Bacteria 43804
446 Ga0207693_10003500 3300025915 Bacteria 13400
447 Ga0207693_10007344 3300025915 Bacteria 9061
448 Ga0207693_10060885 3300025915 Bacteria 2957
449 Ga0207693_10863689 3300025915 Bacteria 695
450 Ga0207693_11483078 3300025915 Bacteria 501
451 Ga0207663_10000255 3300025916 Bacteria 23196
452 Ga0207663_10039702 3300025916 Bacteria 2854
453 Ga0207663_10046890 3300025916 Bacteria 2665
454 Ga0207663_10180531 3300025916 Bacteria 1507
455 Ga0207663_10301231 3300025916 Unclassified 1198
456 Ga0207663_10532453 3300025916 Bacteria 916
457 Ga0207663_10559602 3300025916 Unclassified 895
458 Ga0207663_10832924 3300025916 Bacteria 736
459 Ga0207663_10858286 3300025916 Unclassified 725
460 Ga0207662_10001367 3300025918 Bacteria 11792
461 Ga0207657_10000565 3300025919 Bacteria 39272
462 Ga0207657_10001923 3300025919 Bacteria 22431
463 Ga0207657_10541530 3300025919 Bacteria 910
464 Ga0207649_10002266 3300025920 Bacteria 10837
465 Ga0207649_10011638 3300025920 Bacteria 4859
466 Ga0207652_10177814 3300025921 Unclassified 1911
467 Ga0207646_10002093 3300025922 Bacteria 23946
468 Ga0207646_10041715 3300025922 Bacteria 4124
469 Ga0207646_10175215 3300025922 Bacteria 1937
470 Ga0207681_10025449 3300025923 Bacteria 3807
471 Ga0207694_10066362 3300025924 Bacteria 2815
472 Ga0207694_10268493 3300025924 Bacteria 1399
473 Ga0207694_10372425 3300025924 Bacteria 1184
474 Ga0207650_10000024 3300025925 Bacteria 299184
475 Ga0207659_10410370 3300025926 Bacteria 1134
476 Ga0207659_10781280 3300025926 Bacteria 820
477 Ga0207659_11507729 3300025926 Bacteria 575
478 Ga0207687_10003046 3300025927 Bacteria 11366
479 Ga0207687_10028681 3300025927 Unclassified 3740
480 Ga0207687_10476342 3300025927 Bacteria 1039
481 Ga0207700_10000090 3300025928 Bacteria 55960
482 Ga0207700_10094623 3300025928 Unclassified 2368
483 Ga0207700_10122615 3300025928 Unclassified 2110
484 Ga0207700_10139958 3300025928 Unclassified 1987
485 Ga0207700_10186491 3300025928 Bacteria 1740
486 Ga0207700_10255559 3300025928 Bacteria 1498
487 Ga0207700_10282069 3300025928 Unclassified 1429
488 Ga0207664_10000033 3300025929 Bacteria 176549
489 Ga0207664_10013251 3300025929 Bacteria 5910
490 Ga0207664_10023579 3300025929 Bacteria 4613
491 Ga0207664_10329922 3300025929 Unclassified 1347
492 Ga0207664_10494844 3300025929 Bacteria 1094
493 Ga0207644_10031006 3300025931 Bacteria 3723
494 Ga0207644_10786921 3300025931 Bacteria 795
495 Ga0207690_10563342 3300025932 Bacteria 927
496 Ga0207706_10000258 3300025933 Bacteria 57913
497 Ga0207706_10000504 3300025933 Bacteria 41549
498 Ga0207686_10055306 3300025934 Bacteria 2489
499 Ga0207709_10253842 3300025935 Bacteria 1286
500 Ga0207670_10006308 3300025936 Bacteria 6569
501 Ga0207669_10169654 3300025937 Bacteria 1552
502 Ga0207704_10010046 3300025938 Bacteria 4596
503 Ga0207704_10430155 3300025938 Bacteria 1049
504 Ga0207665_10000189 3300025939 Bacteria 41548
505 Ga0207665_10029454 3300025939 Bacteria 3629
506 Ga0207665_10039540 3300025939 Bacteria 3144
507 Ga0207665_10090189 3300025939 Bacteria 2124
508 Ga0207665_10121700 3300025939 Bacteria 1844
509 Ga0207665_10156114 3300025939 Bacteria 1638
510 Ga0207665_10165565 3300025939 Bacteria 1593
511 Ga0207691_10000683 3300025940 Bacteria 33513
512 Ga0207691_10248110 3300025940 Unclassified 1537
513 Ga0207691_11203641 3300025940 Bacteria 628
514 Ga0207711_10007967 3300025941 Bacteria 8862
515 Ga0207711_10320375 3300025941 Bacteria 1432
516 Ga0207711_10470932 3300025941 Bacteria 1170
517 Ga0207711_10750188 3300025941 Bacteria 910
518 Ga0207689_10000570 3300025942 Bacteria 35269
519 Ga0207661_10053532 3300025944 Bacteria 3230
520 Ga0207679_10000327 3300025945 Bacteria 35497
521 Ga0207679_10055409 3300025945 Bacteria 2922
522 Ga0207679_10327795 3300025945 Bacteria 1328
523 Ga0207679_10577726 3300025945 Bacteria 1011
524 Ga0207667_10032052 3300025949 Bacteria 5666
525 Ga0207667_10571837 3300025949 Bacteria 1142
526 Ga0207667_10653419 3300025949 Bacteria 1057
527 Ga0207651_10237474 3300025960 Unclassified 1483
528 Ga0207651_10371747 3300025960 Bacteria 1209
529 Ga0207651_10389492 3300025960 Bacteria 1183
530 Ga0207651_11497136 3300025960 Unclassified 608
531 Ga0207712_10032531 3300025961 Bacteria 3521
532 Ga0207668_10040917 3300025972 Bacteria 3130
533 Ga0207640_10011062 3300025981 Bacteria 5098
534 Ga0207640_10034094 3300025981 Bacteria 3174
535 Ga0207640_10673827 3300025981 Unclassified 884
536 Ga0207658_10006164 3300025986 Bacteria 8185
537 Ga0207658_10553040 3300025986 Bacteria 1030
538 Ga0207677_10027086 3300026023 Bacteria 3605
539 Ga0207677_10046561 3300026023 Bacteria 2905
540 Ga0207703_10248118 3300026035 Bacteria 1603
541 Ga0207703_10355748 3300026035 Unclassified 1349
542 Ga0207703_10642859 3300026035 Bacteria 1006
543 Ga0207639_10059623 3300026041 Bacteria 2941
544 Ga0207678_10001570 3300026067 Bacteria 21013
545 Ga0207678_10016090 3300026067 Bacteria 6568
546 Ga0207678_10744387 3300026067 Bacteria 864
547 Ga0207702_10001662 3300026078 Bacteria 21972
548 Ga0207702_10017140 3300026078 Bacteria 5992
549 Ga0207702_10303728 3300026078 Bacteria 1515
550 Ga0207702_10805655 3300026078 Bacteria 928
551 Ga0207702_11667536 3300026078 Bacteria 630
552 Ga0207702_11750635 3300026078 Unclassified 614
553 Ga0207641_10000317 3300026088 Bacteria 59841
554 Ga0207641_10049391 3300026088 Bacteria 3555
555 Ga0207641_10348170 3300026088 Bacteria 1411
556 Ga0207641_10356393 3300026088 Unclassified 1395
557 Ga0207641_12362393 3300026088 Unclassified 531
558 Ga0207648_10000031 3300026089 Bacteria 129124
559 Ga0207648_10010760 3300026089 Bacteria 8643
560 Ga0207648_10715521 3300026089 Unclassified 928
561 Ga0207676_10000334 3300026095 Bacteria 40515
562 Ga0207676_10067135 3300026095 Bacteria 2864
563 Ga0207676_11277541 3300026095 Unclassified 728
564 Ga0207674_10000150 3300026116 Bacteria 81671
565 Ga0207674_10016677 3300026116 Bacteria 8027
566 Ga0207674_10022627 3300026116 Bacteria 6746
567 Ga0207675_100025403 3300026118 Bacteria 5514
568 Ga0207675_100915587 3300026118 Unclassified 893
569 Ga0207683_10010134 3300026121 Bacteria 8041
570 Ga0207683_10085192 3300026121 Bacteria 2809
571 Ga0207683_11206249 3300026121 Bacteria 701
572 Ga0207698_10155577 3300026142 Bacteria 1991
573 Ga0207698_10281598 3300026142 Bacteria 1538
574 Ga0207698_11442376 3300026142 Bacteria 703
575 Ga0268266_10023113 3300028379 Bacteria 5292
576 Ga0268266_10179115 3300028379 Bacteria 1929
577 Ga0268266_10262285 3300028379 Unclassified 1601
578 Ga0268266_10876124 3300028379 Bacteria 868
579 Ga0268266_11643365 3300028379 Bacteria 618
580 Ga0268265_10031193 3300028380 Bacteria 3847
581 Ga0268265_10569846 3300028380 Unclassified 1077
582 Ga0268264_10047973 3300028381 Bacteria 3551
583 Ga0268264_10057809 3300028381 Unclassified 3245
584 Ga0268264_10351971 3300028381 Unclassified 1402
585 Ga0268264_10535614 3300028381 Unclassified 1147
586 Ga0268264_10662405 3300028381 Bacteria 1034
587 Ga0268264_10705210 3300028381 Unclassified 1002
588 Ga0268264_11101990 3300028381 Bacteria 802
589 Ga0265319_1142153 3300028563 Unclassified 744
590 Ga0265336_10132448 3300028666 Unclassified 742
591 Ga0265338_10022509 3300028800 Bacteria 6521
592 Ga0265338_10022779 3300028800 Bacteria 6467
593 Ga0265338_10088705 3300028800 Unclassified 2565
594 Ga0265338_10185204 3300028800 Bacteria 1583
595 Ga0265338_10212832 3300028800 Bacteria 1449
596 Ga0265338_10218171 3300028800 Bacteria 1426
597 Ga0265338_11103488 3300028800 Bacteria 534
598 Ga0265762_1001035 3300030760 Unclassified 4995
599 Ga0265760_10000724 3300031090 Bacteria 9406
600 Ga0265760_10001114 3300031090 Bacteria 7798
601 Ga0265760_10002930 3300031090 Bacteria 4988
602 Ga0265760_10008011 3300031090 Bacteria 3017
603 Ga0265760_10174131 3300031090 Bacteria 716
604 Ga0265325_10010702 3300031241 Bacteria 5297
605 Ga0265325_10011849 3300031241 Bacteria 5000
606 Ga0265325_10496471 3300031241 Unclassified 529
607 Ga0265340_10112195 3300031247 Bacteria 1260
608 Ga0265340_10116832 3300031247 Bacteria 1229
609 Ga0265340_10534722 3300031247 Unclassified 516
610 Ga0265339_10018791 3300031249 Bacteria 4069
611 Ga0265339_10030999 3300031249 Bacteria 3024
612 Ga0265339_10052569 3300031249 Bacteria 2218
613 Ga0265339_10381650 3300031249 Unclassified 660
614 Ga0265316_10030314 3300031344 Bacteria 4435
615 Ga0265316_10621264 3300031344 Bacteria 765
616 Ga0265314_10077458 3300031711 Bacteria 2205
617 Ga0265314_10189368 3300031711 Bacteria 1226
618 Ga0307410_10069786 3300031852 Bacteria 2432
619 Ga0307407_10168170 3300031903 Bacteria 1441
620 Ga0307409_100025319 3300031995 Bacteria 4159
621 Ga0307416_100201127 3300032002 Bacteria 1890
622 Ga0307411_10012210 3300032005 Bacteria 4675
623 Ga0307411_11823139 3300032005 Bacteria 565
624 Ga0307415_100099832 3300032126 Bacteria 2126
625 Ga0316214_1018888 3300033545 Unclassified 959
626 Ga0373948_0169268 3300034817 Unclassified 555
627 Ga0373928_0131560 3300035084 Unclassified 679
628 Ga0373934_0226399 3300035086 Bacteria 772
629 Ga0373944_0048144 3300035089 Bacteria 1337
630 Ga0373951_0023935 3300035091 Bacteria 1413
631 Ga0373923_0167627 3300035111 Bacteria 1005
632 Ga0373932_0122036 3300035112 Unclassified 870
633 Ga0373936_0002336 3300035113 Bacteria 7110
634 Ga0373936_0015053 3300035113 Bacteria 2962
635 Ga0373936_0578276 3300035113 Bacteria 526
636 Ga0373939_0027939 3300035114 Unclassified 1602
637 Ga0373941_0346944 3300035115 Unclassified 603
638 Ga0373953_0102670 3300035117 Bacteria 1204
639 Ga0373954_0414201 3300035118 Bacteria 666
640 Ga0373956_0087845 3300035119 Bacteria 1432
641 Ga0373956_0239304 3300035119 Bacteria 863
642 Ga0373957_0123837 3300035120 Bacteria 1048
643 Ga0373957_0295970 3300035120 Bacteria 686
644 Ga0373960_0011325 3300035121 Unclassified 2196
645 Ga0373943_0000235 3300035170 Bacteria 22708
646 Ga0373943_0032085 3300035170 Bacteria 2495
647 Ga0373943_0372904 3300035170 Unclassified 821
648 Ga0373946_0127086 3300035171 Bacteria 1169
649 Ga0373924_0041007 3300035410 Bacteria 1896
650 Ga0373931_0066319 3300035691 Bacteria 1958
651 Ga0373935_0000363 3300035692 Bacteria 23142
652 Ga0373935_0015574 3300035692 Bacteria 4597
653 Ga0373935_0235963 3300035692 Bacteria 1275
654 Ga0373935_0446191 3300035692 Bacteria 934
655 Ga0373935_0560022 3300035692 Bacteria 834
656 Ga0373927_0000635 3300035695 Bacteria 26605
657 Ga0373927_1190462 3300035695 Bacteria 503
658 Ga0373933_0060508 3300035724 Bacteria 2283
659 Ga0373933_0140352 3300035724 Bacteria 1525
660 Ga0373947_0001002 3300035725 Bacteria 17225
661 Ga0373947_0534967 3300035725 Bacteria 797
662 Ga0373937_0058535 3300036401 Bacteria 3540
663 Ga0373937_0129895 3300036401 Bacteria 2352
664 Ga0373937_0147282 3300036401 Bacteria 2204
665 Ga0373937_0147789 3300036401 Bacteria 2201
666 Ga0373937_1085070 3300036401 Bacteria 749
667 Ga0373925_0000661 3300037068 Bacteria 32361
668 Ga0373925_0004968 3300037068 Bacteria 9987
669 Ga0373925_0013012 3300037068 Bacteria 6026
670 Ga0373925_0035408 3300037068 Bacteria 3683
671 Ga0373925_0086919 3300037068 Bacteria 2386
672 Ga0436365_0269346 3300039437 Unclassified 1165
673 Ga0436365_0763510 3300039437 Bacteria 1397
674 Ga0436360_0206578 3300039438 Unclassified 543
675 Ga0436363_0736475 3300039450 Bacteria 606
676 Ga0436362_0741755 3300039453 Unclassified 545
677 Ga0451839_0117572 3300041496 Unclassified 560
678 Ga0466966_0954510 3300044684 Unclassified 517
679 Ga0453684_1468510 3300044712 Bacteria 705
680 Ga0451576_0696526 3300045051 Bacteria 1067
681 Ga0451576_0856493 3300045051 Bacteria 954
682 Ga0451576_2365277 3300045051 Bacteria 544
683 Ga0466967_0346256 3300045976 Bacteria 1438
684 Ga0495603_0404144 3300046455 Bacteria 783
685 Ga0495629_0077081 3300046459 Bacteria 2327
686 Ga0495641_0119626 3300046461 Bacteria 1175
687 Ga0495653_0197930 3300046463 Bacteria 1366
688 Ga0495580_0000505 3300046472 Bacteria 32817
689 Ga0495580_0032001 3300046472 Bacteria 3797
690 Ga0495580_0033323 3300046472 Bacteria 3713
691 Ga0495580_0199768 3300046472 Bacteria 1378
692 Ga0495580_0458910 3300046472 Bacteria 854
693 Ga0495580_0526718 3300046472 Unclassified 787
694 Ga0495580_0734963 3300046472 Unclassified 644
695 Ga0495582_0009508 3300046473 Bacteria 5356
696 Ga0495664_0006351 3300046477 Bacteria 6531
697 Ga0495664_0335413 3300046477 Bacteria 911
698 Ga0495584_0051997 3300046491 Bacteria 2062
699 Ga0495585_0334841 3300046492 Bacteria 738
700 Ga0495628_0277235 3300046516 Bacteria 1246
701 Ga0495628_0427647 3300046516 Bacteria 964
702 Ga0495630_0008873 3300046517 Bacteria 7219
703 Ga0495630_0224103 3300046517 Unclassified 1436
704 Ga0495630_0231352 3300046517 Bacteria 1412
705 Ga0495630_0280352 3300046517 Bacteria 1273
706 Ga0495666_0482932 3300046526 Bacteria 554
707 Ga0495652_0337981 3300046529 Bacteria 1083
708 Ga0495665_0337874 3300046531 Unclassified 768
709 Ga0495640_0159246 3300046533 Bacteria 1448
710 Ga0495640_0461086 3300046533 Bacteria 775
711 Ga0495645_0122760 3300046543 Bacteria 1827
712 Ga0495645_0190748 3300046543 Bacteria 1397
713 Ga0495667_0629988 3300046559 Bacteria 667
714 Ga0495656_0729327 3300046615 Unclassified 534
715 Ga0495635_0184929 3300046663 Bacteria 1416
716 Ga0495635_0451054 3300046663 Bacteria 850
717 Ga0495657_0391801 3300046675 Bacteria 818
718 Ga0495657_0439563 3300046675 Unclassified 765
719 Ga0495599_0186519 3300046678 Bacteria 1277
720 Ga0495646_0327128 3300046680 Bacteria 806
721 Ga0495646_0513102 3300046680 Bacteria 615
722 Ga0495647_0046257 3300046681 Bacteria 1675
723 Ga0495658_0038130 3300046683 Bacteria 2660
724 Ga0495658_0046900 3300046683 Bacteria 2431
725 Ga0495669_0009884 3300046684 Unclassified 4032
726 Ga0495613_0038012 3300046689 Bacteria 3568
727 Ga0495624_0042625 3300046690 Bacteria 2900
728 Ga0495624_0596081 3300046690 Bacteria 659
729 Ga0495581_0148052 3300047315 Bacteria 1371
730 Ga0495604_0074477 3300047317 Bacteria 2559
731 Ga0495674_0018727 3300047319 Bacteria 6443
732 Ga0495674_0024534 3300047319 Bacteria 5539
733 Ga0495674_1129682 3300047319 Bacteria 595
734 Ga0495674_1211505 3300047319 Bacteria 570
735 Ga0495676_1071544 3300047321 Unclassified 513
736 Ga0495676_1085442 3300047321 Bacteria 509
737 Ga0495680_0279040 3300047322 Bacteria 1178
738 Ga0495684_0300431 3300047471 Bacteria 1153
739 Ga0495593_0139032 3300047673 Bacteria 1231
740 Ga0495602_0106818 3300048088 Bacteria 2284
741 Ga0495602_0141735 3300048088 Bacteria 1902
742 Ga0496100_0007632 3300048903 Bacteria 5982
743 Ga0496100_0036840 3300048903 Bacteria 3089
744 Ga0496100_0082280 3300048903 Bacteria 2177
745 Ga0496100_0682880 3300048903 Bacteria 801
746 Ga0496100_0852867 3300048903 Unclassified 715
747 Ga0496101_0105125 3300048904 Bacteria 2118
748 Ga0496101_0286374 3300048904 Unclassified 1289
749 Ga0496102_0054491 3300048905 Bacteria 3647
750 Ga0496102_0173275 3300048905 Bacteria 2031
751 Ga0496102_0362356 3300048905 Bacteria 1365
752 Ga0496103_0416707 3300048906 Unclassified 862
753 Ga0496104_0134896 3300048907 Bacteria 2371
754 Ga0496104_0309346 3300048907 Bacteria 1493
755 Ga0496104_0462440 3300048907 Bacteria 1180
756 Ga0496104_1150572 3300048907 Bacteria 679
757 Ga0496105_0144432 3300048908 Bacteria 1957
758 Ga0496105_0908610 3300048908 Bacteria 663
759 Ga0496106_0081921 3300048909 Unclassified 2480
760 Ga0496106_0111187 3300048909 Bacteria 2133
761 Ga0496107_0119902 3300048910 Bacteria 1938
762 Ga0496107_0177602 3300048910 Bacteria 1581
763 Ga0496107_0447065 3300048910 Bacteria 960
764 Ga0496107_0896136 3300048910 Bacteria 647
765 Ga0496108_0004968 3300048911 Bacteria 10746
766 Ga0496108_0077923 3300048911 Bacteria 2805
767 Ga0496108_1187826 3300048911 Bacteria 645
768 Ga0496109_0000600 3300048912 Bacteria 30126
769 Ga0496109_0022461 3300048912 Bacteria 5588
770 Ga0496109_0270485 3300048912 Bacteria 1601
771 Ga0496110_0001952 3300048913 Bacteria 15301
772 Ga0496110_1608854 3300048913 Unclassified 560
773 Ga0496111_0008792 3300048914 Bacteria 6707
774 Ga0496112_0000097 3300048915 Bacteria 56970
775 Ga0496112_0029629 3300048915 Bacteria 5294
776 Ga0496112_0086339 3300048915 Bacteria 3104
777 Ga0496112_0131742 3300048915 Bacteria 2471
778 Ga0496112_0398618 3300048915 Bacteria 1316
779 Ga0496112_1192467 3300048915 Bacteria 678
780 Ga0496113_0002729 3300048916 Bacteria 10374
781 Ga0496113_0194894 3300048916 Bacteria 1609
782 Ga0496113_0391210 3300048916 Bacteria 1116
783 Ga0496114_0004185 3300048917 Bacteria 11171
784 Ga0496114_0516995 3300048917 Unclassified 1056
785 Ga0496115_0006677 3300048918 Bacteria 8466
786 Ga0496115_0770355 3300048918 Unclassified 751
787 Ga0496115_0967880 3300048918 Bacteria 652
788 Ga0501032_0107557 3300049569 Bacteria 1847
789 Ga0501034_0287049 3300049571 Bacteria 1584
790 Ga0501037_0248445 3300049573 Bacteria 1245
791 Ga0501047_0017245 3300049581 Bacteria 6914
792 Ga0501048_0642383 3300049582 Bacteria 762
793 Ga0501069_0019127 3300049585 Bacteria 3700
794 Ga0501070_0000101 3300049586 Bacteria 74887
795 Ga0501070_1237747 3300049586 Bacteria 572
796 Ga0501073_0021980 3300049589 Bacteria 4596
797 Ga0501073_0065808 3300049589 Bacteria 2527
798 Ga0501073_0298568 3300049589 Bacteria 1111
799 Ga0501074_1324275 3300049590 Bacteria 505
800 Ga0501077_0204317 3300049593 Bacteria 1255
801 Ga0501079_0239562 3300049741 Bacteria 1417
802 Ga0501080_0001683 3300049742 Bacteria 18846
803 Ga0501083_0020629 3300049744 Bacteria 4583
804 Ga0501083_0715908 3300049744 Bacteria 651
805 Ga0501044_0013496 3300049823 Bacteria 8835
806 nmdc:mga03683_15942_c1 3300050489 Bacteria 1436
807 nmdc:mga06z11_184351_c1 3300050494 Unclassified 1205
808 nmdc:mga0n895_26261_c1 3300050512 Bacteria 5513
809 nmdc:mga0n895_462121_c1 3300050512 Unclassified 1281
810 nmdc:mga0rr50_113854_c1 3300050513 Unclassified 2144
811 nmdc:mga0rr50_1225237_c1 3300050513 Bacteria 637
812 nmdc:mga08x19_302653_c1 3300050514 Unclassified 1111
813 Ga0495601_0046423 3300053077 Bacteria 2734
814 Ga0495601_0685481 3300053077 Bacteria 654
815 Ga0495612_0313563 3300053078 Bacteria 705
816 Ga0495619_0266103 3300053085 Bacteria 1188
817 Ga0495619_1016132 3300053085 Bacteria 554
818 Ga0501082_0221841 3300060353 Unclassified 1645
819 Ga0070707_101700502
820 MRS1b_contig_316497
821 MBSR1b_contig_11250795
822 MBSR1b_contig_2671148
823 JGI24752J21851_1007270
824 JGI24738J21930_10047428
825 JGI24034J26672_10000848
826 JGI24751J29686_10001755
827 Ga0065704_10166826
828 Ga0065712_10164061
829 Ga0065712_10781874
830 Ga0065715_10131267
831 Ga0065707_10291745
832 Ga0070658_10038250
833 Ga0070658_11834514
834 Ga0070676_10291746
835 Ga0070683_100015024
836 Ga0070683_100087072
837 Ga0070690_100286650
838 Ga0070690_100991829
839 Ga0070670_100112644
840 Ga0070670_100132044
841 Ga0070670_100228026
842 Ga0070677_10004017
843 Ga0070677_10172617
844 Ga0068869_100046481
845 Ga0070666_10054759
846 Ga0070666_10057347
847 Ga0070666_10158711
848 Ga0070666_10735820
849 Ga0070666_10774402
850 Ga0070680_100662151
851 Ga0070682_100008604
852 Ga0070682_100092598
853 Ga0068868_100001799
854 Ga0068868_100151227
855 Ga0068868_100284011
856 Ga0070660_101870811
857 Ga0070689_102106746
858 Ga0070687_100009236
859 Ga0070661_100022965
860 Ga0070661_100027423
861 Ga0070692_10118265
862 Ga0070668_100030698
863 Ga0070668_100056503
864 Ga0070669_100002345
865 Ga0070669_100027509
866 Ga0070669_100269778
867 Ga0070675_100138673
868 Ga0070675_100327982
869 Ga0070675_101239171
870 Ga0070671_100042048
871 Ga0070671_100070314
872 Ga0070671_100695920
873 Ga0070671_101043481
874 Ga0070671_101741420
875 Ga0070674_100018594
876 Ga0070673_100054905
877 Ga0070673_100412764
878 Ga0070673_100434277
879 Ga0070688_100020721
880 Ga0070659_100043270
881 Ga0070659_100069464
882 Ga0070659_100104137
883 Ga0070659_100624716
884 Ga0070667_100325029
885 Ga0070667_100677516
886 Ga0070667_100684660
887 Ga0070667_101149872
888 Ga0070709_10020987
889 Ga0070709_10033505
890 Ga0070709_10165947
891 Ga0070709_10290988
892 Ga0070709_10852912
893 Ga0070709_11235397
894 Ga0070714_100003152
895 Ga0070714_100103459
896 Ga0070714_100194377
897 Ga0070714_100870163
898 Ga0070713_100000078
899 Ga0070713_100004392
900 Ga0070713_100009108
901 Ga0070713_100046576
902 Ga0070713_100050736
903 Ga0070713_100181091
904 Ga0070713_100228922
905 Ga0070713_100261006
906 Ga0070713_100276539
907 Ga0070713_100334033
908 Ga0070713_100568610
909 Ga0070713_101134528
910 Ga0070713_101156320
911 Ga0070713_101785931
912 Ga0070710_10021208
913 Ga0070710_10099693
914 Ga0070710_10301286
915 Ga0070710_10704858
916 Ga0070710_11182211
917 Ga0070710_11503088
918 Ga0070701_10066268
919 Ga0070701_10407381
920 Ga0070711_100000386
921 Ga0070711_100000754
922 Ga0070711_100008257
923 Ga0070711_100009243
924 Ga0070711_100165671
925 Ga0070711_100455151
926 Ga0070711_101075693
927 Ga0070711_101096488
928 Ga0070711_101917423
929 Ga0070705_101191562
930 Ga0070694_100150959
931 Ga0070708_100000165
932 Ga0070708_100005858
933 Ga0070708_101119098
934 Ga0070663_100018963
935 Ga0070663_100215521
936 Ga0070678_100184191
937 Ga0070678_101524007
938 Ga0070662_100011873
939 Ga0070662_100039843
940 Ga0070681_10041227
941 Ga0070681_10247282
942 Ga0070681_10448866
943 Ga0070681_11807142
944 Ga0068867_100002889
945 Ga0068867_100091884
946 Ga0068867_100399796
947 Ga0068867_100855657
948 Ga0070685_10005238
949 Ga0070706_100021652
950 Ga0070706_100037008
951 Ga0070706_100053457
952 Ga0070706_100692183
953 Ga0070707_100000237
954 Ga0070707_100004396
955 Ga0070707_100209273
956 Ga0070707_100320020
957 Ga0070698_100001730
958 Ga0070698_100283454
959 Ga0070699_100001358
960 Ga0070699_100220592
961 Ga0070699_101059018
962 Ga0070679_100192621
963 Ga0070679_100233728
964 Ga0070684_100009310
965 Ga0070684_100216105
966 Ga0070684_100669964
967 Ga0070697_100000219
968 Ga0070697_100000255
969 Ga0070697_100004137
970 Ga0070697_100144506
971 Ga0070697_102118571
972 Ga0068853_100063545
973 Ga0068853_102105746
974 Ga0070672_100054517
975 Ga0070672_100337778
976 Ga0070686_100010469
977 Ga0070686_100134840
978 Ga0070686_100337064
979 Ga0070695_100415891
980 Ga0070695_100855180
981 Ga0070696_100607112
982 Ga0070696_100727756
983 Ga0070693_100034412
984 Ga0070693_100366782
985 Ga0070693_101503052
986 Ga0070665_100024537
987 Ga0070665_100250121
988 Ga0070665_101201100
989 Ga0070704_100356958
990 Ga0070704_100636932
991 Ga0070704_100946030
992 Ga0068855_100044277
993 Ga0068855_100125691
994 Ga0068855_100677752
995 Ga0068855_101028626
996 Ga0070664_100055516
997 Ga0070664_100074770
998 Ga0070664_100238243
999 Ga0070664_100489734
1000 Ga0068857_100009256
1001 Ga0068857_100021553
1002 Ga0068857_100924726
1003 Ga0068854_100000789
1004 Ga0068854_100012581
1005 Ga0068856_100003171
1006 Ga0068856_100013107
1007 Ga0068856_100041231
1008 Ga0068856_101013736
1009 Ga0068856_101077299
1010 Ga0068856_101117617
1011 Ga0068856_102399896
1012 Ga0070702_100002231
1013 Ga0070702_100579803
1014 Ga0068852_100003988
1015 Ga0068852_100039180
1016 Ga0068852_100823304
1017 Ga0068859_100186287
1018 Ga0068859_101107534
1019 Ga0068864_100017709
1020 Ga0068864_100030716
1021 Ga0068864_100129429
1022 Ga0068866_10013563
1023 Ga0068866_10077914
1024 Ga0068866_10228789
1025 Ga0068866_10640111
1026 Ga0068861_100017290
1027 Ga0068861_100095205
1028 Ga0068851_10002806
1029 Ga0068851_10019123
1030 Ga0068851_10191828
1031 Ga0068863_100009036
1032 Ga0068863_100024318
1033 Ga0068863_100029719
1034 Ga0068863_100058963
1035 Ga0068863_100642106
1036 Ga0068858_100040727
1037 Ga0068858_100066333
1038 Ga0068858_100996084
1039 Ga0068860_100110092
1040 Ga0068860_100176431
1041 Ga0068860_100303695
1042 Ga0068860_101063902
1043 Ga0068862_100021905
1044 Ga0068862_100025552
1045 Ga0068862_101116400
1046 Ga0081540_1071536
1047 Ga0070717_10001788
1048 Ga0070717_10001810
1049 Ga0070717_10003192
1050 Ga0070717_10008829
1051 Ga0070717_10015935
1052 Ga0070717_10025374
1053 Ga0070717_10032861
1054 Ga0070717_10052783
1055 Ga0070717_10061951
1056 Ga0070717_10202369
1057 Ga0070717_10432732
1058 Ga0070717_10494520
1059 Ga0070717_10729339
1060 Ga0070717_10849705
1061 Ga0070717_10920840
1062 Ga0070715_10001686
1063 Ga0070715_10008384
1064 Ga0070715_10138833
1065 Ga0070715_10183766
1066 Ga0070716_100000288
1067 Ga0070716_100000356
1068 Ga0070716_100060898
1069 Ga0070716_100090148
1070 Ga0070716_100149460
1071 Ga0070716_100195395
1072 Ga0070716_100205282
1073 Ga0070716_100669238
1074 Ga0070716_101168239
1075 Ga0070712_100000122
1076 Ga0070712_100000856
1077 Ga0070712_100001565
1078 Ga0070712_100019012
1079 Ga0070712_100030354
1080 Ga0070712_100209273
1081 Ga0070712_100388223
1082 Ga0070712_100443237
1083 Ga0070712_100923654
1084 Ga0097621_100000357
1085 Ga0097621_100049800
1086 Ga0097621_100056451
1087 Ga0097621_100066331
1088 Ga0097621_100895424
1089 Ga0068871_100002520
1090 Ga0068871_100008262
1091 Ga0068871_100012801
1092 Ga0068871_100041414
1093 Ga0068871_100195450
1094 Ga0075433_10035246
1095 Ga0075434_100000226
1096 Ga0075434_100005438
1097 Ga0075434_100216732
1098 Ga0068865_100016983
1099 Ga0068865_100206001
1100 Ga0068865_100807854
1101 Ga0075436_100021337
1102 Ga0075436_100331226
1103 Ga0075436_100567313
1104 Ga0097620_100186292
1105 Ga0097620_101107490
1106 Ga0075435_100000168
1107 Ga0075435_100129735
1108 Ga0075435_100914950
1109 Ga0105250_10041069
1110 Ga0105250_10513747
1111 Ga0105240_10023277
1112 Ga0105240_10037314
1113 Ga0105240_10091094
1114 Ga0105240_10102006
1115 Ga0105240_10126190
1116 Ga0105240_11787203
1117 Ga0105245_10004274
1118 Ga0105245_10018930
1119 Ga0105245_10026018
1120 Ga0105245_10108037
1121 Ga0105245_10803906
1122 Ga0105247_10002806
1123 Ga0105247_10016109
1124 Ga0105247_10066124
1125 Ga0105241_10063350
1126 Ga0105241_10154906
1127 Ga0105241_10173823
1128 Ga0105241_10872625
1129 Ga0105242_10015341
1130 Ga0105242_10030649
1131 Ga0105242_10031689
1132 Ga0105242_10217991
1133 Ga0105242_10966369
1134 Ga0105248_10069448
1135 Ga0105248_10189958
1136 Ga0105248_11113251
1137 Ga0105248_11418973
1138 Ga0105237_10037403
1139 Ga0105237_10256780
1140 Ga0105237_10296808
1141 Ga0105237_10977898
1142 Ga0105237_11149668
1143 Ga0105237_11833730
1144 Ga0105237_12087010
1145 Ga0105238_10128329
1146 Ga0105238_10151964
1147 Ga0105238_10514723
1148 Ga0105238_12654493
1149 Ga0105249_10069419
1150 Ga0105239_10021589
1151 Ga0105239_10106738
1152 Ga0105246_10003125
1153 Ga0105246_10010046
1154 Ga0105246_10204126
1155 Ga0157315_1011868
1156 Ga0157373_10008912
1157 Ga0157373_10134686
1158 Ga0157371_10004902
1159 Ga0157371_10015784
1160 Ga0157370_10262317
1161 Ga0157370_11721224
1162 Ga0157369_10020489
1163 Ga0157369_10137478
1164 Ga0157369_10206668
1165 Ga0157369_11461986
1166 Ga0157374_10005829
1167 Ga0157374_10022318
1168 Ga0157374_10043071
1169 Ga0157374_10082094
1170 Ga0157374_11020099
1171 Ga0157374_11428465
1172 Ga0157374_12357158
1173 Ga0157378_10000800
1174 Ga0157378_10022475
1175 Ga0157378_10136455
1176 Ga0157378_10235044
1177 Ga0163162_10004807
1178 Ga0163162_10006725
1179 Ga0163162_10087941
1180 Ga0163162_10158077
1181 Ga0163162_10237409
1182 Ga0157372_10002533
1183 Ga0157372_10002813
1184 Ga0157372_10017457
1185 Ga0157372_10052308
1186 Ga0157372_10054817
1187 Ga0157372_10122014
1188 Ga0157372_11583909
1189 Ga0157375_10004437
1190 Ga0157375_10097633
1191 Ga0157375_10104072
1192 Ga0163163_10043265
1193 Ga0163163_10156945
1194 Ga0163163_10314026
1195 Ga0163163_10490003
1196 Ga0157380_10079557
1197 Ga0157377_10053915
1198 Ga0157379_10005802
1199 Ga0157379_10087830
1200 Ga0157379_11125050
1201 Ga0157379_11987589
1202 Ga0157376_10030437
1203 Ga0157376_10085011
1204 Ga0157376_10091625
1205 Ga0157376_10157945
1206 Ga0157376_10200968
1207 Ga0182007_10188148
1208 Ga0163161_10022315
1209 Ga0213876_10151738
1210 Ga0224569_100043
1211 Ga0224569_106812
1212 Ga0224571_102676
1213 Ga0224572_1018284
1214 Ga0228598_1000208
1215 Ga0228598_1000381
1216 Ga0207697_10001848
1217 Ga0207656_10015800
1218 Ga0207682_10023115
1219 Ga0207692_10048718
1220 Ga0207692_10077445
1221 Ga0207692_10126961
1222 Ga0207692_10336307
1223 Ga0207692_10366786
1224 Ga0207642_10024098
1225 Ga0207642_10041421
1226 Ga0207642_10383712
1227 Ga0207710_10058089
1228 Ga0207688_10004671
1229 Ga0207680_10203231
1230 Ga0207680_10294411
1231 Ga0207647_10019456
1232 Ga0207647_10038958
1233 Ga0207685_10044828
1234 Ga0207685_10084469
1235 Ga0207685_10102705
1236 Ga0207699_10041622
1237 Ga0207699_10046173
1238 Ga0207699_10094811
1239 Ga0207699_10103928
1240 Ga0207699_10122850
1241 Ga0207699_10913738
1242 Ga0207699_11056978
1243 Ga0207645_10001098
1244 Ga0207645_10030387
1245 Ga0207643_10001772
1246 Ga0207705_11436308
1247 Ga0207684_10000948
1248 Ga0207684_10009358
1249 Ga0207684_10044251
1250 Ga0207684_10517361
1251 Ga0207654_10075701
1252 Ga0207654_10135112
1253 Ga0207654_10955021
1254 Ga0207707_10080337
1255 Ga0207707_10083763
1256 Ga0207707_10431636
1257 Ga0207695_10029850
1258 Ga0207695_10050228
1259 Ga0207695_10137998
1260 Ga0207671_10092049
1261 Ga0207671_11089466
1262 Ga0207693_10000291
1263 Ga0207693_10000329
1264 Ga0207693_10003500
1265 Ga0207693_10007344
1266 Ga0207693_10060885
1267 Ga0207693_10863689
1268 Ga0207693_11483078
1269 Ga0207663_10000255
1270 Ga0207663_10039702
1271 Ga0207663_10046890
1272 Ga0207663_10180531
1273 Ga0207663_10301231
1274 Ga0207663_10532453
1275 Ga0207663_10559602
1276 Ga0207663_10832924
1277 Ga0207663_10858286
1278 Ga0207662_10001367
1279 Ga0207657_10000565
1280 Ga0207657_10001923
1281 Ga0207657_10541530
1282 Ga0207649_10002266
1283 Ga0207649_10011638
1284 Ga0207652_10177814
1285 Ga0207646_10002093
1286 Ga0207646_10041715
1287 Ga0207646_10175215
1288 Ga0207681_10025449
1289 Ga0207694_10066362
1290 Ga0207694_10268493
1291 Ga0207694_10372425
1292 Ga0207650_10000024
1293 Ga0207659_10410370
1294 Ga0207659_10781280
1295 Ga0207659_11507729
1296 Ga0207687_10003046
1297 Ga0207687_10028681
1298 Ga0207687_10476342
1299 Ga0207700_10000090
1300 Ga0207700_10094623
1301 Ga0207700_10122615
1302 Ga0207700_10139958
1303 Ga0207700_10186491
1304 Ga0207700_10255559
1305 Ga0207700_10282069
1306 Ga0207664_10000033
1307 Ga0207664_10013251
1308 Ga0207664_10023579
1309 Ga0207664_10329922
1310 Ga0207664_10494844
1311 Ga0207644_10031006
1312 Ga0207644_10786921
1313 Ga0207690_10563342
1314 Ga0207706_10000258
1315 Ga0207706_10000504
1316 Ga0207686_10055306
1317 Ga0207709_10253842
1318 Ga0207670_10006308
1319 Ga0207669_10169654
1320 Ga0207704_10010046
1321 Ga0207704_10430155
1322 Ga0207665_10000189
1323 Ga0207665_10029454
1324 Ga0207665_10039540
1325 Ga0207665_10090189
1326 Ga0207665_10121700
1327 Ga0207665_10156114
1328 Ga0207665_10165565
1329 Ga0207691_10000683
1330 Ga0207691_10248110
1331 Ga0207691_11203641
1332 Ga0207711_10007967
1333 Ga0207711_10320375
1334 Ga0207711_10470932
1335 Ga0207711_10750188
1336 Ga0207689_10000570
1337 Ga0207661_10053532
1338 Ga0207679_10000327
1339 Ga0207679_10055409
1340 Ga0207679_10327795
1341 Ga0207679_10577726
1342 Ga0207667_10032052
1343 Ga0207667_10571837
1344 Ga0207667_10653419
1345 Ga0207651_10237474
1346 Ga0207651_10371747
1347 Ga0207651_10389492
1348 Ga0207651_11497136
1349 Ga0207712_10032531
1350 Ga0207668_10040917
1351 Ga0207640_10011062
1352 Ga0207640_10034094
1353 Ga0207640_10673827
1354 Ga0207658_10006164
1355 Ga0207658_10553040
1356 Ga0207677_10027086
1357 Ga0207677_10046561
1358 Ga0207703_10248118
1359 Ga0207703_10355748
1360 Ga0207703_10642859
1361 Ga0207639_10059623
1362 Ga0207678_10001570
1363 Ga0207678_10016090
1364 Ga0207678_10744387
1365 Ga0207702_10001662
1366 Ga0207702_10017140
1367 Ga0207702_10303728
1368 Ga0207702_10805655
1369 Ga0207702_11667536
1370 Ga0207702_11750635
1371 Ga0207641_10000317
1372 Ga0207641_10049391
1373 Ga0207641_10348170
1374 Ga0207641_10356393
1375 Ga0207641_12362393
1376 Ga0207648_10000031
1377 Ga0207648_10010760
1378 Ga0207648_10715521
1379 Ga0207676_10000334
1380 Ga0207676_10067135
1381 Ga0207676_11277541
1382 Ga0207674_10000150
1383 Ga0207674_10016677
1384 Ga0207674_10022627
1385 Ga0207675_100025403
1386 Ga0207675_100915587
1387 Ga0207683_10010134
1388 Ga0207683_10085192
1389 Ga0207683_11206249
1390 Ga0207698_10155577
1391 Ga0207698_10281598
1392 Ga0207698_11442376
1393 Ga0268266_10023113
1394 Ga0268266_10179115
1395 Ga0268266_10262285
1396 Ga0268266_10876124
1397 Ga0268266_11643365
1398 Ga0268265_10031193
1399 Ga0268265_10569846
1400 Ga0268264_10047973
1401 Ga0268264_10057809
1402 Ga0268264_10351971
1403 Ga0268264_10535614
1404 Ga0268264_10662405
1405 Ga0268264_10705210
1406 Ga0268264_11101990
1407 Ga0265319_1142153
1408 Ga0265336_10132448
1409 Ga0265338_10022509
1410 Ga0265338_10022779
1411 Ga0265338_10088705
1412 Ga0265338_10185204
1413 Ga0265338_10212832
1414 Ga0265338_10218171
1415 Ga0265338_11103488
1416 Ga0265762_1001035
1417 Ga0265760_10000724
1418 Ga0265760_10001114
1419 Ga0265760_10002930
1420 Ga0265760_10008011
1421 Ga0265760_10174131
1422 Ga0265325_10010702
1423 Ga0265325_10011849
1424 Ga0265325_10496471
1425 Ga0265340_10112195
1426 Ga0265340_10116832
1427 Ga0265340_10534722
1428 Ga0265339_10018791
1429 Ga0265339_10030999
1430 Ga0265339_10052569
1431 Ga0265339_10381650
1432 Ga0265316_10030314
1433 Ga0265316_10621264
1434 Ga0265314_10077458
1435 Ga0265314_10189368
1436 Ga0307410_10069786
1437 Ga0307407_10168170
1438 Ga0307409_100025319
1439 Ga0307416_100201127
1440 Ga0307411_10012210
1441 Ga0307411_11823139
1442 Ga0307415_100099832
1443 Ga0316214_1018888
1444 Ga0373948_0169268
1445 Ga0373928_0131560
1446 Ga0373934_0226399
1447 Ga0373944_0048144
1448 Ga0373951_0023935
1449 Ga0373923_0167627
1450 Ga0373932_0122036
1451 Ga0373936_0002336
1452 Ga0373936_0015053
1453 Ga0373936_0578276
1454 Ga0373939_0027939
1455 Ga0373941_0346944
1456 Ga0373953_0102670
1457 Ga0373954_0414201
1458 Ga0373956_0087845
1459 Ga0373956_0239304
1460 Ga0373957_0123837
1461 Ga0373957_0295970
1462 Ga0373960_0011325
1463 Ga0373943_0000235
1464 Ga0373943_0032085
1465 Ga0373943_0372904
1466 Ga0373946_0127086
1467 Ga0373924_0041007
1468 Ga0373931_0066319
1469 Ga0373935_0000363
1470 Ga0373935_0015574
1471 Ga0373935_0235963
1472 Ga0373935_0446191
1473 Ga0373935_0560022
1474 Ga0373927_0000635
1475 Ga0373927_1190462
1476 Ga0373933_0060508
1477 Ga0373933_0140352
1478 Ga0373947_0001002
1479 Ga0373947_0534967
1480 Ga0373937_0058535
1481 Ga0373937_0129895
1482 Ga0373937_0147282
1483 Ga0373937_0147789
1484 Ga0373937_1085070
1485 Ga0373925_0000661
1486 Ga0373925_0004968
1487 Ga0373925_0013012
1488 Ga0373925_0035408
1489 Ga0373925_0086919
1490 Ga0436365_0269346
1491 Ga0436365_0763510
1492 Ga0436360_0206578
1493 Ga0436363_0736475
1494 Ga0436362_0741755
1495 Ga0451839_0117572
1496 Ga0466966_0954510
1497 Ga0453684_1468510
1498 Ga0451576_0696526
1499 Ga0451576_0856493
1500 Ga0451576_2365277
1501 Ga0466967_0346256
1502 Ga0495603_0404144
1503 Ga0495629_0077081
1504 Ga0495641_0119626
1505 Ga0495653_0197930
1506 Ga0495580_0000505
1507 Ga0495580_0032001
1508 Ga0495580_0033323
1509 Ga0495580_0199768
1510 Ga0495580_0458910
1511 Ga0495580_0526718
1512 Ga0495580_0734963
1513 Ga0495582_0009508
1514 Ga0495664_0006351
1515 Ga0495664_0335413
1516 Ga0495584_0051997
1517 Ga0495585_0334841
1518 Ga0495628_0277235
1519 Ga0495628_0427647
1520 Ga0495630_0008873
1521 Ga0495630_0224103
1522 Ga0495630_0231352
1523 Ga0495630_0280352
1524 Ga0495666_0482932
1525 Ga0495652_0337981
1526 Ga0495665_0337874
1527 Ga0495640_0159246
1528 Ga0495640_0461086
1529 Ga0495645_0122760
1530 Ga0495645_0190748
1531 Ga0495667_0629988
1532 Ga0495656_0729327
1533 Ga0495635_0184929
1534 Ga0495635_0451054
1535 Ga0495657_0391801
1536 Ga0495657_0439563
1537 Ga0495599_0186519
1538 Ga0495646_0327128
1539 Ga0495646_0513102
1540 Ga0495647_0046257
1541 Ga0495658_0038130
1542 Ga0495658_0046900
1543 Ga0495669_0009884
1544 Ga0495613_0038012
1545 Ga0495624_0042625
1546 Ga0495624_0596081
1547 Ga0495581_0148052
1548 Ga0495604_0074477
1549 Ga0495674_0018727
1550 Ga0495674_0024534
1551 Ga0495674_1129682
1552 Ga0495674_1211505
1553 Ga0495676_1071544
1554 Ga0495676_1085442
1555 Ga0495680_0279040
1556 Ga0495684_0300431
1557 Ga0495593_0139032
1558 Ga0495602_0106818
1559 Ga0495602_0141735
1560 Ga0496100_0007632
1561 Ga0496100_0036840
1562 Ga0496100_0082280
1563 Ga0496100_0682880
1564 Ga0496100_0852867
1565 Ga0496101_0105125
1566 Ga0496101_0286374
1567 Ga0496102_0054491
1568 Ga0496102_0173275
1569 Ga0496102_0362356
1570 Ga0496103_0416707
1571 Ga0496104_0134896
1572 Ga0496104_0309346
1573 Ga0496104_0462440
1574 Ga0496104_1150572
1575 Ga0496105_0144432
1576 Ga0496105_0908610
1577 Ga0496106_0081921
1578 Ga0496106_0111187
1579 Ga0496107_0119902
1580 Ga0496107_0177602
1581 Ga0496107_0447065
1582 Ga0496107_0896136
1583 Ga0496108_0004968
1584 Ga0496108_0077923
1585 Ga0496108_1187826
1586 Ga0496109_0000600
1587 Ga0496109_0022461
1588 Ga0496109_0270485
1589 Ga0496110_0001952
1590 Ga0496110_1608854
1591 Ga0496111_0008792
1592 Ga0496112_0000097
1593 Ga0496112_0029629
1594 Ga0496112_0086339
1595 Ga0496112_0131742
1596 Ga0496112_0398618
1597 Ga0496112_1192467
1598 Ga0496113_0002729
1599 Ga0496113_0194894
1600 Ga0496113_0391210
1601 Ga0496114_0004185
1602 Ga0496114_0516995
1603 Ga0496115_0006677
1604 Ga0496115_0770355
1605 Ga0496115_0967880
1606 Ga0501032_0107557
1607 Ga0501034_0287049
1608 Ga0501037_0248445
1609 Ga0501047_0017245
1610 Ga0501048_0642383
1611 Ga0501069_0019127
1612 Ga0501070_0000101
1613 Ga0501070_1237747
1614 Ga0501073_0021980
1615 Ga0501073_0065808
1616 Ga0501073_0298568
1617 Ga0501074_1324275
1618 Ga0501077_0204317
1619 Ga0501079_0239562
1620 Ga0501080_0001683
1621 Ga0501083_0020629
1622 Ga0501083_0715908
1623 Ga0501044_0013496
1624 nmdc:mga03683_15942_c1
1625 nmdc:mga06z11_184351_c1
1626 nmdc:mga0n895_26261_c1
1627 nmdc:mga0n895_462121_c1
1628 nmdc:mga0rr50_113854_c1
1629 nmdc:mga0rr50_1225237_c1
1630 nmdc:mga08x19_302653_c1
1631 Ga0495601_0046423
1632 Ga0495601_0685481
1633 Ga0495612_0313563
1634 Ga0495619_0266103
1635 Ga0495619_1016132
1636 Ga0501082_0221841

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

53

147

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.9557 4 124
6mxv-assembly1.cif.gz_A the crystal structure of a rhodanese-like family protein from francisella tularensis subsp. tularensis schu s4 0.9261 4 124
2kl3-assembly1.cif.gz_A solution nmr structure of the rhodanese-like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437a 0.923 22 123
3hix-assembly1.cif.gz_A crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.91 37 123
3ilm-assembly1.cif.gz_A crystal structure of the alr3790 protein from anabaena sp. northeast structural genomics consortium target nsr437h 0.9076 23 123
ID Description Score Start End Superfamily
2kl3A01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9226 22 124 3.40.250.10
af_Q38853_56_181_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9027 20 123 3.40.250.10
3fojA00 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8967 21 113 3.40.250.10
af_I1LP77_2_120_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8951 20 121 3.40.250.10
2kl3A01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8898 22 124 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A7V1DRG1-F1-model_v4 Sulfurtransferase 0.9856 4 124 GO:0004792
AF-Q2JQJ5-F1-model_v4 Rhodanese domain protein 0.9836 1 124 GO:0004792
AF-A0A7T9KBQ0-F1-model_v4 deleted 0.9835 5 124
AF-A0A2G8PGV8-F1-model_v4 Sulfurtransferase 0.9834 1 124 GO:0016740
AF-A0A532EQX9-F1-model_v4 Sulfurtransferase 0.9827 4 110 GO:0016740

Map