F482103

General Info

Members Datasets Scaffolds Average Seq Length
817 270 817 347

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0012099|Ga0495580_0012099_3180_4313
Length 377
Sequence MKTGIIGLPQVGKTSLFRILTKAHLAPSRANPREAHVGVAKVPDDRLDRLAAMYSPKKLTHASVEYVDLGAIGQEALKESGYLGHLRQVDAVAHVVRAFEDDSIPHAGPIDPLRDIKNVEFDLMVSDLGQIEKRLERVXXXXKKMRSADLEKEFELLNRAKAHLETERPLRELEMTPEDKKRFRGFMFLSEKPILYVLNISESGELGKDLENAVAKYRLADLASGHAGTGDLARRAEQGSAVRTTGATAICGKVEAELAEMSDADAAEFLASYGLQESGLTRLIRTTYALLGLISFFTAGEDECRAWTIPVNTRAVQAAGAIHSDLEKHFIRAETIRWDQLLDAGSEANARAKGTLRLEGKDYIVQDGDVMHIRHSG

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
114 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
115 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
116 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
185 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
186 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
187 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
256 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.77
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000030 3300000546 Bacteria 18811
2 Ga0058861_11655845 3300004800 Bacteria 1233
3 Ga0065712_10082696 3300005290 Bacteria 2893
4 Ga0065715_10005347 3300005293 Bacteria 6194
5 Ga0070658_10008281 3300005327 Bacteria 8363
6 Ga0070658_10246905 3300005327 Bacteria 1514
7 Ga0070683_100019036 3300005329 Bacteria 6092
8 Ga0070683_100023745 3300005329 Bacteria 5487
9 Ga0070683_100073509 3300005329 Bacteria 3192
10 Ga0070683_100079545 3300005329 Unclassified 3068
11 Ga0070683_100124847 3300005329 Unclassified 2433
12 Ga0070690_100019152 3300005330 Bacteria 4148
13 Ga0070670_100010165 3300005331 Bacteria 8030
14 Ga0068869_100006004 3300005334 Bacteria 7680
15 Ga0068869_100011803 3300005334 Bacteria 5746
16 Ga0070666_10017390 3300005335 Bacteria 4610
17 Ga0070680_100025342 3300005336 Bacteria 4740
18 Ga0070680_100053741 3300005336 Bacteria 3287
19 Ga0070680_100113688 3300005336 Bacteria 2255
20 Ga0070680_100212776 3300005336 Bacteria 1631
21 Ga0070682_100025404 3300005337 Bacteria 3534
22 Ga0070682_100062799 3300005337 Bacteria 2353
23 Ga0070682_100072094 3300005337 Unclassified 2213
24 Ga0068868_100003271 3300005338 Bacteria 11281
25 Ga0068868_100008303 3300005338 Bacteria 7436
26 Ga0068868_100015841 3300005338 Bacteria 5586
27 Ga0068868_100054352 3300005338 Unclassified 3155
28 Ga0068868_100144157 3300005338 Bacteria 1957
29 Ga0070660_100017960 3300005339 Bacteria 5161
30 Ga0070689_100095177 3300005340 Bacteria 2352
31 Ga0070689_100104284 3300005340 Bacteria 2248
32 Ga0070687_100060624 3300005343 Bacteria 1997
33 Ga0070661_100013208 3300005344 Bacteria 5797
34 Ga0070661_100022341 3300005344 Bacteria 4529
35 Ga0070692_10063076 3300005345 Bacteria 1957
36 Ga0070668_100002952 3300005347 Bacteria 12572
37 Ga0070669_100003693 3300005353 Bacteria 11041
38 Ga0070675_100008700 3300005354 Bacteria 7884
39 Ga0070659_100001774 3300005366 Bacteria 15504
40 Ga0070659_100047742 3300005366 Bacteria 3360
41 Ga0070659_100141844 3300005366 Bacteria 1956
42 Ga0070659_100180081 3300005366 Unclassified 1734
43 Ga0070667_100016724 3300005367 Bacteria 6071
44 Ga0070667_100102915 3300005367 Bacteria 2468
45 Ga0070709_10005350 3300005434 Bacteria 6953
46 Ga0070709_10007780 3300005434 Bacteria 5884
47 Ga0070709_10010577 3300005434 Bacteria 5114
48 Ga0070709_10014189 3300005434 Bacteria 4501
49 Ga0070709_10060592 3300005434 Bacteria 2406
50 Ga0070709_10099898 3300005434 Unclassified 1931
51 Ga0070709_10159034 3300005434 Unclassified 1569
52 Ga0070714_100000230 3300005435 Bacteria 44146
53 Ga0070714_100015460 3300005435 Bacteria 6141
54 Ga0070714_100064192 3300005435 Unclassified 3159
55 Ga0070714_100344965 3300005435 Bacteria 1397
56 Ga0070713_100001829 3300005436 Bacteria 13725
57 Ga0070713_100002368 3300005436 Bacteria 12291
58 Ga0070713_100004328 3300005436 Bacteria 9522
59 Ga0070713_100014463 3300005436 Bacteria 5863
60 Ga0070713_100021008 3300005436 Bacteria 5012
61 Ga0070713_100035935 3300005436 Unclassified 3994
62 Ga0070713_100072481 3300005436 Bacteria 2913
63 Ga0070713_100099889 3300005436 Bacteria 2511
64 Ga0070713_100114568 3300005436 Bacteria 2355
65 Ga0070713_100278395 3300005436 Unclassified 1534
66 Ga0070710_10011166 3300005437 Bacteria 4431
67 Ga0070710_10023173 3300005437 Bacteria 3259
68 Ga0070710_10041347 3300005437 Bacteria 2545
69 Ga0070710_10067125 3300005437 Bacteria 2058
70 Ga0070710_10069700 3300005437 Bacteria 2023
71 Ga0070710_10089722 3300005437 Bacteria 1811
72 Ga0070711_100000853 3300005439 Bacteria 16045
73 Ga0070711_100003707 3300005439 Bacteria 8949
74 Ga0070711_100006707 3300005439 Bacteria 6964
75 Ga0070711_100028176 3300005439 Bacteria 3694
76 Ga0070711_100052769 3300005439 Bacteria 2799
77 Ga0070708_100001236 3300005445 Bacteria 19665
78 Ga0070708_100001868 3300005445 Bacteria 16174
79 Ga0070708_100003294 3300005445 Bacteria 12615
80 Ga0070708_100006227 3300005445 Bacteria 9484
81 Ga0070708_100007704 3300005445 Bacteria 8630
82 Ga0070708_100009412 3300005445 Bacteria 7877
83 Ga0070708_100020455 3300005445 Bacteria 5580
84 Ga0070708_100026741 3300005445 Bacteria 4943
85 Ga0070708_100056408 3300005445 Unclassified 3494
86 Ga0070708_100089685 3300005445 Bacteria 2797
87 Ga0070708_100109116 3300005445 Unclassified 2542
88 Ga0070708_100133693 3300005445 Bacteria 2297
89 Ga0070708_100249424 3300005445 Bacteria 1667
90 Ga0070663_100029925 3300005455 Bacteria 3726
91 Ga0070663_100285823 3300005455 Bacteria 1316
92 Ga0070662_100003783 3300005457 Bacteria 9469
93 Ga0070681_10001660 3300005458 Bacteria 19882
94 Ga0070681_10004825 3300005458 Bacteria 12927
95 Ga0070681_10015071 3300005458 Bacteria 7689
96 Ga0070681_10025150 3300005458 Bacteria 5991
97 Ga0070681_10029017 3300005458 Bacteria 5555
98 Ga0070681_10037474 3300005458 Bacteria 4865
99 Ga0070681_10043735 3300005458 Bacteria 4484
100 Ga0070681_10065484 3300005458 Bacteria 3602
101 Ga0070681_10080793 3300005458 Bacteria 3207
102 Ga0070681_10183321 3300005458 Bacteria 2015
103 Ga0070681_10279990 3300005458 Bacteria 1578
104 Ga0068867_100013280 3300005459 Bacteria 5834
105 Ga0068867_100072982 3300005459 Unclassified 2570
106 Ga0070685_10015057 3300005466 Bacteria 4105
107 Ga0070685_10039985 3300005466 Unclassified 2667
108 Ga0070706_100001027 3300005467 Bacteria 30296
109 Ga0070706_100028767 3300005467 Bacteria 5118
110 Ga0070706_100037461 3300005467 Bacteria 4479
111 Ga0070706_100089843 3300005467 Bacteria 2848
112 Ga0070706_100121889 3300005467 Unclassified 2430
113 Ga0070706_100299435 3300005467 Bacteria 1501
114 Ga0070707_100001517 3300005468 Bacteria 22621
115 Ga0070707_100004884 3300005468 Bacteria 12565
116 Ga0070707_100039011 3300005468 Bacteria 4538
117 Ga0070707_100068216 3300005468 Unclassified 3422
118 Ga0070707_100165504 3300005468 Unclassified 2155
119 Ga0070707_100192129 3300005468 Bacteria 1991
120 Ga0070707_100291535 3300005468 Bacteria 1586
121 Ga0070707_100401036 3300005468 Bacteria 1331
122 Ga0070698_100000822 3300005471 Bacteria 33956
123 Ga0070698_100071416 3300005471 Unclassified 3481
124 Ga0070698_100071711 3300005471 Bacteria 3473
125 Ga0070698_100108039 3300005471 Bacteria 2750
126 Ga0070699_100000132 3300005518 Bacteria 69186
127 Ga0070699_100005299 3300005518 Bacteria 11311
128 Ga0070699_100053060 3300005518 Bacteria 3509
129 Ga0070699_100307950 3300005518 Unclassified 1422
130 Ga0070679_100015016 3300005530 Bacteria 7441
131 Ga0070679_100015059 3300005530 Bacteria 7430
132 Ga0070679_100026608 3300005530 Bacteria 5687
133 Ga0070679_100063208 3300005530 Bacteria 3690
134 Ga0070679_100099621 3300005530 Bacteria 2893
135 Ga0070679_100214731 3300005530 Bacteria 1886
136 Ga0070679_100226295 3300005530 Unclassified 1830
137 Ga0070684_100001478 3300005535 Bacteria 16951
138 Ga0070684_100019101 3300005535 Bacteria 5665
139 Ga0070684_100022812 3300005535 Bacteria 5226
140 Ga0070697_100000124 3300005536 Bacteria 61236
141 Ga0070697_100001757 3300005536 Bacteria 16539
142 Ga0070697_100002074 3300005536 Bacteria 15321
143 Ga0070697_100009348 3300005536 Bacteria 7661
144 Ga0070697_100047734 3300005536 Unclassified 3471
145 Ga0070697_100085042 3300005536 Bacteria 2610
146 Ga0070697_100100092 3300005536 Bacteria 2407
147 Ga0070697_100104297 3300005536 Unclassified 2357
148 Ga0068853_100000037 3300005539 Bacteria 108329
149 Ga0068853_100056031 3300005539 Bacteria 3398
150 Ga0068853_100239117 3300005539 Bacteria 1664
151 Ga0068853_100368596 3300005539 Bacteria 1339
152 Ga0070686_100036911 3300005544 Bacteria 3028
153 Ga0070695_100072842 3300005545 Unclassified 2253
154 Ga0070696_100016775 3300005546 Bacteria 4941
155 Ga0070696_100077242 3300005546 Bacteria 2353
156 Ga0070693_100196767 3300005547 Bacteria 1307
157 Ga0070665_100018526 3300005548 Bacteria 6977
158 Ga0070665_100278789 3300005548 Bacteria 1673
159 Ga0070704_100023033 3300005549 Bacteria 4060
160 Ga0068855_100001040 3300005563 Bacteria 34520
161 Ga0068855_100008242 3300005563 Bacteria 12597
162 Ga0068855_100021781 3300005563 Bacteria 7687
163 Ga0068855_100048418 3300005563 Bacteria 5016
164 Ga0068855_100052813 3300005563 Bacteria 4784
165 Ga0068855_100171575 3300005563 Unclassified 2456
166 Ga0068855_100185937 3300005563 Bacteria 2346
167 Ga0070664_100002133 3300005564 Bacteria 15847
168 Ga0070664_100047668 3300005564 Bacteria 3620
169 Ga0068857_100008259 3300005577 Bacteria 8995
170 Ga0068857_100010504 3300005577 Bacteria 8047
171 Ga0068854_100000033 3300005578 Bacteria 105647
172 Ga0068854_100008660 3300005578 Bacteria 6549
173 Ga0068854_100009406 3300005578 Bacteria 6311
174 Ga0068854_100013918 3300005578 Bacteria 5292
175 Ga0068854_100022767 3300005578 Bacteria 4274
176 Ga0068854_100188415 3300005578 Unclassified 1615
177 Ga0068856_100002913 3300005614 Bacteria 17522
178 Ga0068856_100003671 3300005614 Bacteria 15394
179 Ga0068856_100004326 3300005614 Bacteria 14169
180 Ga0068856_100017943 3300005614 Bacteria 6861
181 Ga0068856_100081233 3300005614 Bacteria 3216
182 Ga0068856_100338431 3300005614 Bacteria 1523
183 Ga0068856_100402010 3300005614 Bacteria 1389
184 Ga0070702_100058774 3300005615 Bacteria 2229
185 Ga0070702_100059105 3300005615 Bacteria 2223
186 Ga0068852_100027695 3300005616 Bacteria 4622
187 Ga0068852_100064376 3300005616 Bacteria 3196
188 Ga0068852_100078716 3300005616 Bacteria 2917
189 Ga0068852_100145987 3300005616 Bacteria 2194
190 Ga0068852_100207791 3300005616 Bacteria 1856
191 Ga0068852_100306362 3300005616 Unclassified 1539
192 Ga0068852_100362686 3300005616 Bacteria 1418
193 Ga0068852_100489488 3300005616 Bacteria 1223
194 Ga0068859_100000033 3300005617 Bacteria 172869
195 Ga0068859_100002934 3300005617 Bacteria 17324
196 Ga0068859_100003344 3300005617 Bacteria 16313
197 Ga0068864_100005210 3300005618 Bacteria 10654
198 Ga0068864_100007227 3300005618 Bacteria 9125
199 Ga0068866_10001612 3300005718 Bacteria 9561
200 Ga0068866_10057988 3300005718 Bacteria 1998
201 Ga0068851_10015181 3300005834 Bacteria 3666
202 Ga0068870_10040515 3300005840 Bacteria 2416
203 Ga0068863_100057530 3300005841 Unclassified 3680
204 Ga0068863_100133922 3300005841 Bacteria 2367
205 Ga0068858_100000231 3300005842 Bacteria 60174
206 Ga0068858_100030966 3300005842 Bacteria 4969
207 Ga0068858_100046492 3300005842 Bacteria 4023
208 Ga0068858_100145915 3300005842 Bacteria 2222
209 Ga0068860_100032528 3300005843 Bacteria 5010
210 Ga0068860_100084794 3300005843 Bacteria 3013
211 Ga0068860_100133300 3300005843 Bacteria 2385
212 Ga0068862_100006541 3300005844 Bacteria 9672
213 Ga0068862_100120387 3300005844 Bacteria 2313
214 Ga0081538_10011454 3300005981 Bacteria 7182
215 Ga0081538_10014162 3300005981 Bacteria 6265
216 Ga0081538_10053514 3300005981 Bacteria 2399
217 Ga0081540_1011204 3300005983 Bacteria 6012
218 Ga0070717_10005131 3300006028 Bacteria 9551
219 Ga0070717_10006272 3300006028 Bacteria 8733
220 Ga0070717_10017409 3300006028 Bacteria 5592
221 Ga0070717_10025624 3300006028 Bacteria 4693
222 Ga0070717_10055041 3300006028 Bacteria 3282
223 Ga0070717_10092640 3300006028 Unclassified 2553
224 Ga0070717_10110458 3300006028 Bacteria 2345
225 Ga0070717_10205012 3300006028 Bacteria 1729
226 Ga0070717_10214419 3300006028 Bacteria 1690
227 Ga0070717_10299424 3300006028 Bacteria 1430
228 Ga0070715_10001303 3300006163 Bacteria 7171
229 Ga0070715_10001715 3300006163 Bacteria 6515
230 Ga0070715_10011808 3300006163 Bacteria 3156
231 Ga0070716_100000452 3300006173 Bacteria 16970
232 Ga0070716_100009209 3300006173 Bacteria 4918
233 Ga0070716_100131101 3300006173 Bacteria 1585
234 Ga0070712_100001256 3300006175 Bacteria 15333
235 Ga0070712_100001507 3300006175 Bacteria 14198
236 Ga0070712_100001608 3300006175 Bacteria 13807
237 Ga0070712_100005436 3300006175 Bacteria 7888
238 Ga0070712_100006793 3300006175 Bacteria 7120
239 Ga0070712_100008495 3300006175 Bacteria 6458
240 Ga0070712_100024297 3300006175 Bacteria 4014
241 Ga0097621_100001938 3300006237 Bacteria 14120
242 Ga0097621_100002920 3300006237 Bacteria 11745
243 Ga0097621_100002940 3300006237 Bacteria 11708
244 Ga0097621_100018133 3300006237 Bacteria 5368
245 Ga0068871_100000486 3300006358 Bacteria 27151
246 Ga0068871_100004726 3300006358 Bacteria 9529
247 Ga0068871_100007176 3300006358 Bacteria 7948
248 Ga0068871_100035453 3300006358 Bacteria 3965
249 Ga0068871_100037824 3300006358 Bacteria 3851
250 Ga0068871_100090482 3300006358 Bacteria 2549
251 Ga0068871_100183082 3300006358 Bacteria 1801
252 Ga0068871_100393766 3300006358 Unclassified 1233
253 Ga0075431_100365843 3300006847 Bacteria 1448
254 Ga0075434_100020485 3300006871 Bacteria 6416
255 Ga0075434_100094472 3300006871 Bacteria 2995
256 Ga0068865_100015548 3300006881 Bacteria 4854
257 Ga0068865_100062392 3300006881 Bacteria 2616
258 Ga0068865_100098197 3300006881 Bacteria 2139
259 Ga0068865_100107932 3300006881 Bacteria 2048
260 Ga0068865_100139110 3300006881 Bacteria 1829
261 Ga0075436_100002558 3300006914 Bacteria 12524
262 Ga0075436_100010271 3300006914 Bacteria 6410
263 Ga0075436_100025900 3300006914 Bacteria 4037
264 Ga0075436_100053075 3300006914 Bacteria 2798
265 Ga0075436_100150972 3300006914 Bacteria 1635
266 Ga0097620_100000033 3300006931 Bacteria 172869
267 Ga0097620_100002934 3300006931 Bacteria 17324
268 Ga0097620_100003344 3300006931 Bacteria 16313
269 Ga0075435_100006189 3300007076 Bacteria 8442
270 Ga0099795_10003515 3300007788 Bacteria 3891
271 Ga0105240_10002547 3300009093 Bacteria 29224
272 Ga0105240_10011585 3300009093 Bacteria 12270
273 Ga0105240_10025905 3300009093 Bacteria 7701
274 Ga0105240_10029156 3300009093 Bacteria 7196
275 Ga0105240_10042044 3300009093 Bacteria 5827
276 Ga0105240_10061795 3300009093 Bacteria 4667
277 Ga0105240_10062461 3300009093 Unclassified 4637
278 Ga0111539_10159041 3300009094 Bacteria 2643
279 Ga0105245_10004753 3300009098 Bacteria 11990
280 Ga0105245_10005718 3300009098 Bacteria 10920
281 Ga0105245_10013541 3300009098 Bacteria 7103
282 Ga0105245_10095823 3300009098 Bacteria 2738
283 Ga0105247_10002535 3300009101 Bacteria 12400
284 Ga0105247_10073600 3300009101 Bacteria 2141
285 Ga0114129_10166826 3300009147 Unclassified 3004
286 Ga0105243_10124235 3300009148 Bacteria 2180
287 Ga0105241_10010670 3300009174 Bacteria 6739
288 Ga0105241_10015408 3300009174 Bacteria 5598
289 Ga0105241_10016057 3300009174 Bacteria 5489
290 Ga0105241_10021542 3300009174 Bacteria 4766
291 Ga0105241_10025045 3300009174 Bacteria 4434
292 Ga0105241_10067128 3300009174 Bacteria 2776
293 Ga0105241_10271480 3300009174 Unclassified 1445
294 Ga0105242_10016491 3300009176 Bacteria 5744
295 Ga0105242_10269628 3300009176 Bacteria 1541
296 Ga0105248_10006181 3300009177 Bacteria 13124
297 Ga0105248_10014835 3300009177 Bacteria 8582
298 Ga0105248_10035273 3300009177 Bacteria 5595
299 Ga0105248_10206362 3300009177 Bacteria 2214
300 Ga0105248_10224396 3300009177 Unclassified 2115
301 Ga0105237_10006540 3300009545 Bacteria 12890
302 Ga0105237_10010441 3300009545 Bacteria 9876
303 Ga0105237_10016823 3300009545 Bacteria 7591
304 Ga0105237_10111196 3300009545 Unclassified 2731
305 Ga0105237_10123375 3300009545 Bacteria 2585
306 Ga0105237_10241614 3300009545 Bacteria 1807
307 Ga0105237_10368531 3300009545 Bacteria 1441
308 Ga0105238_10001815 3300009551 Bacteria 21408
309 Ga0105238_10016889 3300009551 Bacteria 7405
310 Ga0105238_10042543 3300009551 Unclassified 4599
311 Ga0105238_10054425 3300009551 Bacteria 4018
312 Ga0105238_10079079 3300009551 Bacteria 3278
313 Ga0105238_10319411 3300009551 Bacteria 1538
314 Ga0105249_10004362 3300009553 Bacteria 12232
315 Ga0105249_10052427 3300009553 Bacteria 3725
316 Ga0099796_10009816 3300010159 Bacteria 2606
317 Ga0105239_10012680 3300010375 Bacteria 9377
318 Ga0105239_10219030 3300010375 Bacteria 2134
319 Ga0105239_10424000 3300010375 Bacteria 1507
320 Ga0105246_10032222 3300011119 Bacteria 3475
321 Ga0105246_10051038 3300011119 Bacteria 2839
322 Ga0157373_10004970 3300013100 Bacteria 9992
323 Ga0157373_10025405 3300013100 Bacteria 4285
324 Ga0157373_10028127 3300013100 Bacteria 4056
325 Ga0157373_10059034 3300013100 Bacteria 2718
326 Ga0157373_10238716 3300013100 Bacteria 1285
327 Ga0157371_10008726 3300013102 Bacteria 8045
328 Ga0157371_10010962 3300013102 Bacteria 7026
329 Ga0157371_10105234 3300013102 Bacteria 2002
330 Ga0157370_10010916 3300013104 Bacteria 9538
331 Ga0157370_10091105 3300013104 Bacteria 2863
332 Ga0157370_10174924 3300013104 Bacteria 1995
333 Ga0157369_10000300 3300013105 Bacteria 66166
334 Ga0157369_10002843 3300013105 Bacteria 20667
335 Ga0157369_10029189 3300013105 Bacteria 6098
336 Ga0157369_10031833 3300013105 Bacteria 5804
337 Ga0157369_10072894 3300013105 Bacteria 3685
338 Ga0157369_10081084 3300013105 Bacteria 3473
339 Ga0157369_10172108 3300013105 Bacteria 2281
340 Ga0157369_10189975 3300013105 Unclassified 2158
341 Ga0157369_10301322 3300013105 Bacteria 1667
342 Ga0157374_10002248 3300013296 Bacteria 16256
343 Ga0157374_10002617 3300013296 Bacteria 15184
344 Ga0157374_10015624 3300013296 Bacteria 6664
345 Ga0157374_10019485 3300013296 Bacteria 6004
346 Ga0157374_10023556 3300013296 Bacteria 5509
347 Ga0157374_10050863 3300013296 Bacteria 3853
348 Ga0157374_10058827 3300013296 Bacteria 3592
349 Ga0157374_10230224 3300013296 Bacteria 1820
350 Ga0157374_10272348 3300013296 Bacteria 1670
351 Ga0157378_10000532 3300013297 Bacteria 36169
352 Ga0157378_10001506 3300013297 Bacteria 21092
353 Ga0157378_10006631 3300013297 Bacteria 10119
354 Ga0157378_10052854 3300013297 Bacteria 3615
355 Ga0157378_10065433 3300013297 Bacteria 3254
356 Ga0157378_10095798 3300013297 Bacteria 2704
357 Ga0157378_10110162 3300013297 Bacteria 2523
358 Ga0163162_10000661 3300013306 Bacteria 31916
359 Ga0163162_10003102 3300013306 Bacteria 15861
360 Ga0163162_10004705 3300013306 Bacteria 13161
361 Ga0163162_10189242 3300013306 Bacteria 2185
362 Ga0163162_10256934 3300013306 Bacteria 1879
363 Ga0157372_10000282 3300013307 Bacteria 56474
364 Ga0157372_10002600 3300013307 Bacteria 19545
365 Ga0157372_10002936 3300013307 Bacteria 18395
366 Ga0157372_10004156 3300013307 Bacteria 15491
367 Ga0157372_10012590 3300013307 Bacteria 9008
368 Ga0157372_10013627 3300013307 Bacteria 8688
369 Ga0157372_10019219 3300013307 Bacteria 7357
370 Ga0157372_10022103 3300013307 Bacteria 6880
371 Ga0157372_10049067 3300013307 Bacteria 4693
372 Ga0157372_10243736 3300013307 Unclassified 2086
373 Ga0157375_10013927 3300013308 Bacteria 7170
374 Ga0163163_10002219 3300014325 Bacteria 16344
375 Ga0163163_10018353 3300014325 Bacteria 6546
376 Ga0157380_10061173 3300014326 Bacteria 3012
377 Ga0182008_10010743 3300014497 Unclassified 4892
378 Ga0157379_10006386 3300014968 Bacteria 10154
379 Ga0157379_10108889 3300014968 Bacteria 2488
380 Ga0157376_10024100 3300014969 Unclassified 4773
381 Ga0157376_10308334 3300014969 Bacteria 1501
382 Ga0182006_1021302 3300015261 Unclassified 2704
383 Ga0182007_10004386 3300015262 Bacteria 6405
384 Ga0163161_10000643 3300017792 Bacteria 27887
385 Ga0213874_10002144 3300021377 Bacteria 4189
386 Ga0224570_100894 3300022730 Bacteria 2368
387 Ga0224569_100300 3300022732 Bacteria 4139
388 Ga0224572_1008666 3300024225 Bacteria 1884
389 Ga0228598_1001285 3300024227 Bacteria 5520
390 Ga0207656_10016535 3300025321 Bacteria 2873
391 Ga0207692_10009693 3300025898 Bacteria 4032
392 Ga0207692_10018779 3300025898 Bacteria 3111
393 Ga0207692_10176548 3300025898 Bacteria 1242
394 Ga0207642_10009662 3300025899 Bacteria 3366
395 Ga0207642_10016834 3300025899 Unclassified 2765
396 Ga0207642_10018490 3300025899 Bacteria 2676
397 Ga0207642_10047143 3300025899 Unclassified 1925
398 Ga0207688_10189705 3300025901 Bacteria 1229
399 Ga0207680_10016488 3300025903 Bacteria 3879
400 Ga0207647_10002745 3300025904 Bacteria 13286
401 Ga0207647_10003491 3300025904 Bacteria 11788
402 Ga0207685_10002829 3300025905 Bacteria 4075
403 Ga0207699_10003324 3300025906 Bacteria 7667
404 Ga0207699_10011770 3300025906 Bacteria 4431
405 Ga0207699_10028174 3300025906 Bacteria 3119
406 Ga0207699_10137136 3300025906 Unclassified 1604
407 Ga0207699_10153623 3300025906 Bacteria 1525
408 Ga0207699_10160927 3300025906 Bacteria 1494
409 Ga0207645_10067112 3300025907 Bacteria 2293
410 Ga0207645_10153156 3300025907 Unclassified 1506
411 Ga0207643_10022301 3300025908 Bacteria 3485
412 Ga0207705_10192255 3300025909 Bacteria 1544
413 Ga0207684_10004409 3300025910 Bacteria 13259
414 Ga0207684_10019417 3300025910 Bacteria 5817
415 Ga0207684_10024082 3300025910 Bacteria 5194
416 Ga0207684_10031935 3300025910 Bacteria 4480
417 Ga0207684_10056542 3300025910 Unclassified 3328
418 Ga0207684_10260967 3300025910 Bacteria 1495
419 Ga0207684_10299446 3300025910 Bacteria 1386
420 Ga0207654_10004737 3300025911 Bacteria 6886
421 Ga0207654_10015966 3300025911 Bacteria 3905
422 Ga0207654_10020770 3300025911 Bacteria 3487
423 Ga0207654_10057178 3300025911 Bacteria 2266
424 Ga0207707_10014891 3300025912 Bacteria 6773
425 Ga0207707_10026426 3300025912 Bacteria 5074
426 Ga0207707_10027675 3300025912 Bacteria 4957
427 Ga0207707_10085534 3300025912 Bacteria 2755
428 Ga0207707_10087837 3300025912 Bacteria 2716
429 Ga0207707_10102596 3300025912 Bacteria 2500
430 Ga0207707_10126789 3300025912 Bacteria 2232
431 Ga0207707_10135761 3300025912 Bacteria 2151
432 Ga0207695_10006448 3300025913 Bacteria 15237
433 Ga0207695_10010387 3300025913 Bacteria 11391
434 Ga0207695_10012954 3300025913 Bacteria 9969
435 Ga0207695_10029044 3300025913 Bacteria 6119
436 Ga0207695_10036849 3300025913 Bacteria 5282
437 Ga0207695_10038078 3300025913 Bacteria 5183
438 Ga0207695_10111607 3300025913 Bacteria 2713
439 Ga0207695_10162095 3300025913 Bacteria 2167
440 Ga0207695_10386953 3300025913 Bacteria 1284
441 Ga0207671_10011449 3300025914 Bacteria 7221
442 Ga0207671_10145609 3300025914 Bacteria 1827
443 Ga0207671_10245044 3300025914 Bacteria 1408
444 Ga0207693_10000013 3300025915 Bacteria 154365
445 Ga0207693_10000304 3300025915 Bacteria 45833
446 Ga0207693_10003018 3300025915 Bacteria 14556
447 Ga0207693_10005944 3300025915 Bacteria 10128
448 Ga0207693_10053324 3300025915 Bacteria 3173
449 Ga0207693_10123031 3300025915 Unclassified 2038
450 Ga0207693_10177635 3300025915 Bacteria 1675
451 Ga0207663_10012437 3300025916 Unclassified 4602
452 Ga0207663_10015375 3300025916 Bacteria 4221
453 Ga0207663_10024839 3300025916 Bacteria 3456
454 Ga0207663_10060712 3300025916 Bacteria 2397
455 Ga0207663_10081116 3300025916 Bacteria 2123
456 Ga0207660_10000297 3300025917 Bacteria 32914
457 Ga0207660_10026730 3300025917 Bacteria 3932
458 Ga0207660_10042428 3300025917 Bacteria 3193
459 Ga0207660_10154570 3300025917 Bacteria 1765
460 Ga0207660_10283891 3300025917 Bacteria 1314
461 Ga0207662_10007835 3300025918 Bacteria 5820
462 Ga0207657_10001110 3300025919 Bacteria 28585
463 Ga0207657_10002518 3300025919 Bacteria 19813
464 Ga0207657_10006370 3300025919 Bacteria 12259
465 Ga0207657_10044099 3300025919 Bacteria 3923
466 Ga0207657_10094271 3300025919 Bacteria 2493
467 Ga0207649_10008330 3300025920 Bacteria 5650
468 Ga0207649_10038935 3300025920 Bacteria 2881
469 Ga0207652_10011210 3300025921 Bacteria 7221
470 Ga0207652_10020366 3300025921 Bacteria 5461
471 Ga0207652_10027282 3300025921 Bacteria 4757
472 Ga0207652_10052367 3300025921 Bacteria 3503
473 Ga0207646_10000194 3300025922 Bacteria 82991
474 Ga0207646_10000438 3300025922 Bacteria 55782
475 Ga0207646_10002543 3300025922 Bacteria 21532
476 Ga0207646_10044144 3300025922 Bacteria 4001
477 Ga0207646_10161287 3300025922 Bacteria 2023
478 Ga0207646_10274326 3300025922 Bacteria 1524
479 Ga0207681_10061641 3300025923 Bacteria 2579
480 Ga0207694_10002726 3300025924 Bacteria 14284
481 Ga0207694_10063235 3300025924 Bacteria 2883
482 Ga0207694_10236048 3300025924 Bacteria 1494
483 Ga0207650_10000155 3300025925 Bacteria 82859
484 Ga0207650_10058532 3300025925 Bacteria 2869
485 Ga0207650_10146490 3300025925 Bacteria 1860
486 Ga0207659_10035794 3300025926 Bacteria 3434
487 Ga0207659_10167216 3300025926 Bacteria 1732
488 Ga0207687_10006362 3300025927 Bacteria 7804
489 Ga0207687_10009622 3300025927 Bacteria 6318
490 Ga0207687_10074646 3300025927 Bacteria 2431
491 Ga0207687_10187666 3300025927 Bacteria 1606
492 Ga0207700_10001442 3300025928 Bacteria 13496
493 Ga0207700_10002926 3300025928 Bacteria 9850
494 Ga0207700_10003515 3300025928 Bacteria 9128
495 Ga0207700_10004676 3300025928 Bacteria 8108
496 Ga0207700_10041156 3300025928 Bacteria 3379
497 Ga0207700_10055668 3300025928 Bacteria 2974
498 Ga0207700_10084381 3300025928 Unclassified 2490
499 Ga0207700_10131786 3300025928 Bacteria 2042
500 Ga0207700_10309336 3300025928 Bacteria 1366
501 Ga0207700_10321106 3300025928 Unclassified 1342
502 Ga0207664_10000236 3300025929 Bacteria 41929
503 Ga0207664_10020593 3300025929 Bacteria 4892
504 Ga0207664_10039149 3300025929 Unclassified 3680
505 Ga0207664_10062377 3300025929 Bacteria 2977
506 Ga0207664_10074102 3300025929 Bacteria 2749
507 Ga0207664_10100369 3300025929 Bacteria 2390
508 Ga0207664_10180529 3300025929 Unclassified 1812
509 Ga0207664_10267852 3300025929 Bacteria 1496
510 Ga0207664_10383132 3300025929 Bacteria 1249
511 Ga0207644_10144761 3300025931 Bacteria 1834
512 Ga0207690_10011394 3300025932 Bacteria 5318
513 Ga0207690_10011497 3300025932 Bacteria 5291
514 Ga0207706_10002659 3300025933 Bacteria 17394
515 Ga0207706_10117637 3300025933 Bacteria 2337
516 Ga0207706_10154715 3300025933 Bacteria 2017
517 Ga0207706_10224380 3300025933 Bacteria 1645
518 Ga0207709_10146862 3300025935 Bacteria 1628
519 Ga0207704_10008613 3300025938 Bacteria 4886
520 Ga0207704_10031737 3300025938 Bacteria 2980
521 Ga0207704_10053412 3300025938 Bacteria 2456
522 Ga0207665_10000300 3300025939 Bacteria 34180
523 Ga0207665_10000962 3300025939 Bacteria 19516
524 Ga0207665_10019196 3300025939 Bacteria 4492
525 Ga0207665_10021434 3300025939 Bacteria 4249
526 Ga0207665_10061163 3300025939 Bacteria 2552
527 Ga0207665_10128839 3300025939 Bacteria 1794
528 Ga0207665_10220885 3300025939 Unclassified 1388
529 Ga0207665_10259687 3300025939 Bacteria 1286
530 Ga0207711_10000892 3300025941 Bacteria 28721
531 Ga0207711_10154254 3300025941 Unclassified 2074
532 Ga0207711_10385628 3300025941 Unclassified 1301
533 Ga0207689_10010511 3300025942 Bacteria 7970
534 Ga0207689_10011197 3300025942 Bacteria 7696
535 Ga0207661_10002010 3300025944 Bacteria 14012
536 Ga0207661_10008828 3300025944 Bacteria 7213
537 Ga0207661_10019265 3300025944 Bacteria 5084
538 Ga0207661_10036433 3300025944 Bacteria 3840
539 Ga0207661_10150762 3300025944 Bacteria 2009
540 Ga0207679_10000106 3300025945 Bacteria 68506
541 Ga0207679_10006373 3300025945 Bacteria 7456
542 Ga0207679_10126932 3300025945 Bacteria 2040
543 Ga0207667_10004320 3300025949 Bacteria 17402
544 Ga0207667_10004960 3300025949 Bacteria 16259
545 Ga0207667_10005735 3300025949 Bacteria 15149
546 Ga0207667_10022702 3300025949 Bacteria 6922
547 Ga0207667_10032158 3300025949 Bacteria 5656
548 Ga0207667_10172219 3300025949 Bacteria 2225
549 Ga0207667_10209862 3300025949 Bacteria 1996
550 Ga0207667_10308249 3300025949 Unclassified 1617
551 Ga0207651_10001643 3300025960 Bacteria 10271
552 Ga0207651_10012487 3300025960 Bacteria 4811
553 Ga0207712_10010691 3300025961 Bacteria 5829
554 Ga0207668_10017235 3300025972 Bacteria 4521
555 Ga0207640_10000001 3300025981 Bacteria 628778
556 Ga0207640_10006049 3300025981 Bacteria 6615
557 Ga0207640_10031466 3300025981 Bacteria 3279
558 Ga0207640_10227764 3300025981 Unclassified 1432
559 Ga0207658_10002109 3300025986 Bacteria 14801
560 Ga0207658_10055739 3300025986 Bacteria 2931
561 Ga0207677_10003082 3300026023 Bacteria 8798
562 Ga0207677_10005897 3300026023 Bacteria 6666
563 Ga0207677_10019289 3300026023 Unclassified 4116
564 Ga0207677_10041494 3300026023 Unclassified 3043
565 Ga0207677_10143506 3300026023 Bacteria 1832
566 Ga0207703_10001136 3300026035 Bacteria 25138
567 Ga0207703_10007386 3300026035 Bacteria 8731
568 Ga0207703_10064115 3300026035 Bacteria 3015
569 Ga0207639_10000060 3300026041 Bacteria 108336
570 Ga0207639_10077233 3300026041 Bacteria 2624
571 Ga0207639_10208694 3300026041 Bacteria 1680
572 Ga0207678_10002206 3300026067 Bacteria 17584
573 Ga0207678_10036947 3300026067 Unclassified 4252
574 Ga0207678_10087929 3300026067 Unclassified 2656
575 Ga0207702_10004124 3300026078 Bacteria 13029
576 Ga0207702_10004714 3300026078 Bacteria 12048
577 Ga0207702_10016530 3300026078 Bacteria 6107
578 Ga0207702_10021839 3300026078 Bacteria 5300
579 Ga0207702_10034765 3300026078 Bacteria 4215
580 Ga0207702_10044471 3300026078 Bacteria 3732
581 Ga0207702_10055944 3300026078 Bacteria 3348
582 Ga0207641_10000298 3300026088 Bacteria 62177
583 Ga0207641_10030130 3300026088 Bacteria 4493
584 Ga0207641_10037728 3300026088 Bacteria 4037
585 Ga0207648_10000385 3300026089 Bacteria 48932
586 Ga0207648_10009510 3300026089 Bacteria 9300
587 Ga0207648_10026797 3300026089 Bacteria 5119
588 Ga0207676_10000118 3300026095 Bacteria 69518
589 Ga0207676_10003201 3300026095 Bacteria 11658
590 Ga0207676_10215489 3300026095 Bacteria 1706
591 Ga0207674_10000048 3300026116 Bacteria 119394
592 Ga0207674_10013329 3300026116 Bacteria 9131
593 Ga0207674_10013634 3300026116 Bacteria 9002
594 Ga0207674_10023971 3300026116 Bacteria 6526
595 Ga0207674_10043568 3300026116 Bacteria 4627
596 Ga0207674_10097741 3300026116 Unclassified 2920
597 Ga0207674_10137621 3300026116 Bacteria 2403
598 Ga0207674_10200335 3300026116 Bacteria 1946
599 Ga0207683_10000718 3300026121 Bacteria 30120
600 Ga0207698_10062432 3300026142 Bacteria 2909
601 Ga0207698_10108539 3300026142 Bacteria 2320
602 Ga0265356_1000091 3300028017 Bacteria 15112
603 Ga0265356_1000870 3300028017 Bacteria 4956
604 Ga0265356_1002586 3300028017 Bacteria 2384
605 Ga0268266_10027246 3300028379 Bacteria 4861
606 Ga0268266_10170895 3300028379 Bacteria 1973
607 Ga0268265_10003986 3300028380 Bacteria 10398
608 Ga0268265_10015614 3300028380 Bacteria 5199
609 Ga0268265_10124270 3300028380 Bacteria 2132
610 Ga0268264_10031036 3300028381 Bacteria 4382
611 Ga0268264_10254732 3300028381 Bacteria 1632
612 Ga0265336_10005167 3300028666 Bacteria 4850
613 Ga0265336_10030293 3300028666 Bacteria 1686
614 Ga0265338_10002458 3300028800 Bacteria 27697
615 Ga0265338_10042423 3300028800 Bacteria 4236
616 Ga0265762_1000682 3300030760 Bacteria 5976
617 Ga0265760_10005583 3300031090 Bacteria 3600
618 Ga0265760_10008276 3300031090 Bacteria 2973
619 Ga0265330_10000232 3300031235 Bacteria 42060
620 Ga0265330_10008199 3300031235 Bacteria 5040
621 Ga0265330_10080489 3300031235 Bacteria 1403
622 Ga0265328_10018624 3300031239 Bacteria 2674
623 Ga0265325_10001176 3300031241 Bacteria 18668
624 Ga0265325_10005592 3300031241 Bacteria 7746
625 Ga0265325_10008190 3300031241 Bacteria 6191
626 Ga0265325_10012231 3300031241 Bacteria 4911
627 Ga0265325_10060656 3300031241 Bacteria 1921
628 Ga0265340_10004857 3300031247 Bacteria 7475
629 Ga0265340_10030192 3300031247 Bacteria 2718
630 Ga0265340_10062246 3300031247 Bacteria 1783
631 Ga0265340_10097635 3300031247 Bacteria 1368
632 Ga0265340_10098620 3300031247 Bacteria 1360
633 Ga0265339_10002498 3300031249 Bacteria 13139
634 Ga0265339_10003585 3300031249 Bacteria 10841
635 Ga0265339_10021166 3300031249 Bacteria 3789
636 Ga0265316_10001343 3300031344 Bacteria 26473
637 Ga0265316_10004348 3300031344 Bacteria 14121
638 Ga0265316_10009254 3300031344 Bacteria 9070
639 Ga0265316_10026349 3300031344 Bacteria 4837
640 Ga0265316_10185213 3300031344 Bacteria 1549
641 Ga0307408_100233932 3300031548 Bacteria 1506
642 Ga0265313_10007208 3300031595 Bacteria 7653
643 Ga0265314_10004443 3300031711 Bacteria 13019
644 Ga0265314_10130161 3300031711 Bacteria 1571
645 Ga0265342_10002002 3300031712 Bacteria 18146
646 Ga0265342_10002216 3300031712 Bacteria 17065
647 Ga0265342_10011488 3300031712 Bacteria 6059
648 Ga0307405_10060351 3300031731 Bacteria 2393
649 Ga0307410_10027211 3300031852 Bacteria 3612
650 Ga0307406_10010272 3300031901 Bacteria 5276
651 Ga0307409_100152228 3300031995 Bacteria 2010
652 Ga0307411_10080737 3300032005 Bacteria 2237
653 Ga0307415_100012094 3300032126 Bacteria 4976
654 Ga0373938_0014476 3300034957 Bacteria 1515
655 Ga0373926_0000844 3300035083 Bacteria 8716
656 Ga0373926_0013203 3300035083 Bacteria 2799
657 Ga0373936_0000415 3300035113 Bacteria 14386
658 Ga0373936_0028326 3300035113 Bacteria 2202
659 Ga0373936_0046086 3300035113 Bacteria 1757
660 Ga0373936_0100436 3300035113 Bacteria 1220
661 Ga0373945_0004899 3300035116 Bacteria 4264
662 Ga0373956_0030158 3300035119 Bacteria 2369
663 Ga0373956_0038528 3300035119 Unclassified 2115
664 Ga0373956_0096162 3300035119 Unclassified 1370
665 Ga0373943_0000008 3300035170 Bacteria 69214
666 Ga0373943_0001473 3300035170 Bacteria 10661
667 Ga0373943_0019598 3300035170 Unclassified 3111
668 Ga0373943_0101616 3300035170 Unclassified 1505
669 Ga0373946_0025051 3300035171 Bacteria 2344
670 Ga0373946_0071447 3300035171 Bacteria 1500
671 Ga0373962_0049590 3300035242 Bacteria 1207
672 Ga0373924_0000042 3300035410 Bacteria 32998
673 Ga0373931_0021534 3300035691 Bacteria 3236
674 Ga0373931_0027649 3300035691 Bacteria 2897
675 Ga0373935_0009541 3300035692 Bacteria 5808
676 Ga0373935_0049826 3300035692 Bacteria 2656
677 Ga0373935_0115779 3300035692 Bacteria 1785
678 Ga0373927_0002504 3300035695 Bacteria 13411
679 Ga0373927_0007025 3300035695 Bacteria 7642
680 Ga0373933_0021455 3300035724 Bacteria 3669
681 Ga0373947_0000210 3300035725 Bacteria 32754
682 Ga0373947_0003427 3300035725 Bacteria 9386
683 Ga0373947_0003826 3300035725 Bacteria 8865
684 Ga0373947_0010928 3300035725 Bacteria 5212
685 Ga0373947_0058231 3300035725 Bacteria 2341
686 Ga0373947_0144803 3300035725 Bacteria 1527
687 Ga0373947_0190382 3300035725 Bacteria 1338
688 Ga0373937_0000648 3300036401 Bacteria 30543
689 Ga0373937_0036379 3300036401 Bacteria 4486
690 Ga0373937_0107164 3300036401 Unclassified 2598
691 Ga0373937_0177730 3300036401 Bacteria 1998
692 Ga0373925_0001100 3300037068 Bacteria 24202
693 Ga0373925_0019849 3300037068 Bacteria 4889
694 Ga0373925_0069116 3300037068 Bacteria 2667
695 Ga0373925_0109594 3300037068 Bacteria 2131
696 Ga0373925_0146327 3300037068 Unclassified 1852
697 Ga0373925_0271834 3300037068 Bacteria 1363
698 Ga0395898_0019750 3300037466 Bacteria 6852
699 Ga0395905_0005868 3300037471 Bacteria 12470
700 Ga0395905_0153843 3300037471 Bacteria 2163
701 Ga0436360_0213845 3300039438 Bacteria 5479
702 Ga0436360_0324039 3300039438 Bacteria 2259
703 Ga0436360_0669763 3300039438 Bacteria 2246
704 Ga0436361_0251067 3300039447 Archaea 5683
705 Ga0436363_0241926 3300039450 Bacteria 9886
706 Ga0436363_0281651 3300039450 Bacteria 2588
707 Ga0436363_0630469 3300039450 Bacteria 3569
708 Ga0451577_0000290 3300042876 Bacteria 97706
709 Ga0453683_0041843 3300044673 Bacteria 2877
710 Ga0466963_0011405 3300044694 Bacteria 5412
711 Ga0466963_0138548 3300044694 Bacteria 1685
712 Ga0466957_0000292 3300044842 Bacteria 24570
713 Ga0466959_0003455 3300045049 Bacteria 10340
714 Ga0451576_0182885 3300045051 Bacteria 2188
715 Ga0466967_0012591 3300045976 Bacteria 6481
716 Ga0466967_0014317 3300045976 Bacteria 6173
717 Ga0466967_0022966 3300045976 Bacteria 5103
718 Ga0466967_0178766 3300045976 Bacteria 2000
719 Ga0495629_0004259 3300046459 Bacteria 10727
720 Ga0495651_0172481 3300046462 Bacteria 1539
721 Ga0495651_0211020 3300046462 Unclassified 1351
722 Ga0495653_0170997 3300046463 Bacteria 1500
723 Ga0495580_0000030 3300046472 Bacteria 78710
724 Ga0495580_0000136 3300046472 Bacteria 51924
725 Ga0495580_0000176 3300046472 Bacteria 47717
726 Ga0495580_0000228 3300046472 Bacteria 43816
727 Ga0495580_0008064 3300046472 Bacteria 8404
728 Ga0495580_0008352 3300046472 Bacteria 8236
729 Ga0495580_0012099 3300046472 Bacteria 6641
730 Ga0495580_0013162 3300046472 Bacteria 6333
731 Ga0495580_0014601 3300046472 Bacteria 5953
732 Ga0495580_0017538 3300046472 Bacteria 5352
733 Ga0495580_0018388 3300046472 Bacteria 5204
734 Ga0495580_0063547 3300046472 Bacteria 2589
735 Ga0495580_0097030 3300046472 Bacteria 2050
736 Ga0495580_0163177 3300046472 Bacteria 1542
737 Ga0495580_0360780 3300046472 Bacteria 983
738 Ga0495582_0030688 3300046473 Bacteria 2952
739 Ga0495582_0235973 3300046473 Bacteria 1047
740 Ga0495662_0061711 3300046476 Bacteria 1811
741 Ga0495630_0126265 3300046517 Bacteria 1941
742 Ga0495652_0235316 3300046529 Bacteria 1367
743 Ga0495665_0005649 3300046531 Bacteria 6747
744 Ga0495665_0058776 3300046531 Bacteria 2030
745 Ga0495586_0102828 3300046535 Bacteria 1586
746 Ga0495587_0074666 3300046536 Unclassified 1969
747 Ga0495645_0116461 3300046543 Bacteria 1886
748 Ga0495667_0091170 3300046559 Bacteria 1974
749 Ga0495635_0030503 3300046663 Bacteria 3747
750 Ga0495659_0028465 3300046664 Bacteria 1934
751 Ga0495599_0093240 3300046678 Bacteria 1879
752 Ga0495623_0154345 3300046679 Bacteria 1354
753 Ga0495647_0001185 3300046681 Bacteria 8020
754 Ga0495647_0022524 3300046681 Bacteria 2276
755 Ga0495658_0007219 3300046683 Bacteria 5490
756 Ga0495658_0147555 3300046683 Bacteria 1443
757 Ga0495669_0024760 3300046684 Bacteria 2614
758 Ga0495669_0098135 3300046684 Bacteria 1359
759 Ga0495624_0053189 3300046690 Bacteria 2557
760 Ga0495624_0097789 3300046690 Bacteria 1808
761 Ga0495581_0033780 3300047315 Bacteria 2961
762 Ga0495581_0035520 3300047315 Bacteria 2884
763 Ga0495674_0010257 3300047319 Bacteria 8873
764 Ga0495674_0012423 3300047319 Bacteria 8025
765 Ga0495674_0238612 3300047319 Bacteria 1499
766 Ga0495675_0073077 3300047444 Bacteria 2163
767 Ga0495684_0125650 3300047471 Bacteria 1930
768 Ga0495602_0012288 3300048088 Bacteria 8812
769 Ga0495602_0103407 3300048088 Bacteria 2332
770 Ga0495602_0164402 3300048088 Bacteria 1729
771 Ga0496102_0064028 3300048905 Bacteria 3367
772 Ga0496102_0203500 3300048905 Bacteria 1866
773 Ga0496103_0015234 3300048906 Bacteria 4572
774 Ga0496103_0044890 3300048906 Unclassified 2725
775 Ga0496103_0075671 3300048906 Bacteria 2112
776 Ga0496104_0061976 3300048907 Unclassified 3546
777 Ga0496104_0088178 3300048907 Bacteria 2964
778 Ga0496104_0098604 3300048907 Bacteria 2797
779 Ga0496104_0145363 3300048907 Unclassified 2277
780 Ga0496105_0003734 3300048908 Bacteria 11340
781 Ga0496106_0096381 3300048909 Bacteria 2289
782 Ga0496106_0153272 3300048909 Bacteria 1819
783 Ga0496106_0516952 3300048909 Bacteria 959
784 Ga0496108_0000116 3300048911 Bacteria 79135
785 Ga0496108_0207131 3300048911 Bacteria 1702
786 Ga0496109_0000265 3300048912 Bacteria 50463
787 Ga0496109_0296985 3300048912 Bacteria 1523
788 Ga0496110_0000239 3300048913 Bacteria 35620
789 Ga0496110_0102424 3300048913 Unclassified 2568
790 Ga0496110_0207667 3300048913 Unclassified 1780
791 Ga0496111_0001607 3300048914 Bacteria 13076
792 Ga0496111_0066135 3300048914 Bacteria 2624
793 Ga0496112_0001222 3300048915 Bacteria 19333
794 Ga0496112_0002498 3300048915 Bacteria 14837
795 Ga0496112_0002814 3300048915 Bacteria 14127
796 Ga0496112_0016160 3300048915 Bacteria 6982
797 Ga0496112_0027607 3300048915 Bacteria 5474
798 Ga0496112_0040910 3300048915 Bacteria 4533
799 Ga0496112_0094621 3300048915 Bacteria 2958
800 Ga0496113_0000435 3300048916 Bacteria 20283
801 Ga0496113_0014564 3300048916 Bacteria 5370
802 Ga0496113_0050186 3300048916 Bacteria 3110
803 Ga0496113_0205920 3300048916 Bacteria 1565
804 Ga0496114_0237597 3300048917 Bacteria 1602
805 Ga0496115_0083457 3300048918 Bacteria 2604
806 Ga0496115_0103391 3300048918 Bacteria 2337
807 Ga0496115_0124740 3300048918 Bacteria 2121
808 Ga0496115_0156511 3300048918 Bacteria 1883
809 Ga0496115_0220761 3300048918 Bacteria 1564
810 nmdc:mga05p37_305361_c1 3300050507 Unclassified 1888
811 nmdc:mga0n895_46507_c1 3300050512 Bacteria 4240
812 nmdc:mga0n895_93913_c1 3300050512 Bacteria 3003
813 nmdc:mga0rr50_374258_c1 3300050513 Unclassified 1200
814 nmdc:mga08x19_1929_c1 3300050514 Bacteria 12682
815 nmdc:mga08x19_4136_c1 3300050514 Bacteria 8606
816 nmdc:mga08x19_57764_c1 3300050514 Bacteria 2509
817 Ga0495601_0014941 3300053077 Bacteria 4687

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0360780 Ga0495580_0360780_11_895 251
2 3300047471 Ga0495684_0125650 Ga0495684_0125650_1004_1888 251
3 3300048909 Ga0496106_0516952 Ga0496106_0516952_23_907 251
4 3300013105 Ga0157369_10172108 Ga0157369_101721081 278
5 3300025913 Ga0207695_10111607 Ga0207695_101116072 281
6 3300050512 nmdc:mga0n895_46507_c1 nmdc:mga0n895_46507_c1_484_1533 287
7 3300025939 Ga0207665_10128839 Ga0207665_101288392 288
8 3300005434 Ga0070709_10005350 Ga0070709_100053503 289
9 3300005434 Ga0070709_10014189 Ga0070709_100141895 289
10 3300005436 Ga0070713_100014463 Ga0070713_1000144632 289
11 3300005436 Ga0070713_100099889 Ga0070713_1000998891 289
12 3300005437 Ga0070710_10041347 Ga0070710_100413472 289
13 3300005437 Ga0070710_10089722 Ga0070710_100897222 289
14 3300005439 Ga0070711_100052769 Ga0070711_1000527692 289
15 3300006173 Ga0070716_100009209 Ga0070716_1000092093 289
16 3300006175 Ga0070712_100001256 Ga0070712_1000012567 289
17 3300006175 Ga0070712_100006793 Ga0070712_1000067934 289
18 3300025898 Ga0207692_10009693 Ga0207692_100096932 289
19 3300025906 Ga0207699_10003324 Ga0207699_100033244 289
20 3300025906 Ga0207699_10011770 Ga0207699_100117702 289
21 3300025915 Ga0207693_10003018 Ga0207693_100030187 289
22 3300025915 Ga0207693_10177635 Ga0207693_101776352 289
23 3300025916 Ga0207663_10081116 Ga0207663_100811162 289
24 3300025928 Ga0207700_10003515 Ga0207700_100035155 289
25 3300046472 Ga0495580_0017538 Ga0495580_0017538_156_1241 289
26 3300046517 Ga0495630_0126265 Ga0495630_0126265_359_1438 289
27 3300013105 Ga0157369_10000300 Ga0157369_1000030023 297
28 3300045051 Ga0451576_0182885 Ga0451576_0182885_920_1969 297
29 3300046473 Ga0495582_0235973 Ga0495582_0235973_11_1033 297
30 3300025927 Ga0207687_10074646 Ga0207687_100746462 298
31 3300025926 Ga0207659_10167216 Ga0207659_101672162 299
32 3300046472 Ga0495580_0163177 Ga0495580_0163177_482_1513 300
33 3300046472 Ga0495580_0097030 Ga0495580_0097030_620_1702 304
34 3300045976 Ga0466967_0178766 Ga0466967_0178766_640_1725 305
35 3300013296 Ga0157374_10272348 Ga0157374_102723482 307
36 3300035725 Ga0373947_0058231 Ga0373947_0058231_134_1186 307
37 3300031235 Ga0265330_10000232 Ga0265330_1000023216 309
38 3300031241 Ga0265325_10001176 Ga0265325_100011766 309
39 3300031249 Ga0265339_10002498 Ga0265339_1000249810 309
40 3300031344 Ga0265316_10004348 Ga0265316_100043483 309
41 3300031595 Ga0265313_10007208 Ga0265313_100072082 309
42 3300031712 Ga0265342_10002002 Ga0265342_100020029 309
43 3300005336 Ga0070680_100212776 Ga0070680_1002127762 310
44 3300005445 Ga0070708_100109116 Ga0070708_1001091163 310
45 3300005458 Ga0070681_10037474 Ga0070681_100374742 310
46 3300005530 Ga0070679_100099621 Ga0070679_1000996213 310
47 3300025917 Ga0207660_10026730 Ga0207660_100267302 310
48 3300026116 Ga0207674_10200335 Ga0207674_102003352 310
49 3300030760 Ga0265762_1000682 Ga0265762_10006824 310
50 3300031241 Ga0265325_10005592 Ga0265325_100055927 310
51 3300005468 Ga0070707_100004884 Ga0070707_1000048845 311
52 3300005468 Ga0070707_100192129 Ga0070707_1001921292 311
53 3300007788 Ga0099795_10003515 Ga0099795_100035151 311
54 3300009147 Ga0114129_10166826 Ga0114129_101668262 311
55 3300010159 Ga0099796_10009816 Ga0099796_100098163 311
56 3300025922 Ga0207646_10002543 Ga0207646_1000254321 311
57 3300031247 Ga0265340_10004857 Ga0265340_100048576 311
58 3300035083 Ga0373926_0013203 Ga0373926_0013203_766_1866 311
59 3300035725 Ga0373947_0144803 Ga0373947_0144803_306_1406 311
60 3300039438 Ga0436360_0324039 Ga0436360_0324039_949_2049 311
61 3300050507 nmdc:mga05p37_305361_c1 nmdc:mga05p37_305361_c1_437_1522 311
62 3300006028 Ga0070717_10092640 Ga0070717_100926403 312
63 3300025915 Ga0207693_10123031 Ga0207693_101230311 312
64 3300025939 Ga0207665_10019196 Ga0207665_100191961 312
65 3300005437 Ga0070710_10069700 Ga0070710_100697002 313
66 3300005445 Ga0070708_100020455 Ga0070708_1000204556 313
67 3300005536 Ga0070697_100000124 Ga0070697_10000012453 313
68 3300006028 Ga0070717_10205012 Ga0070717_102050122 313
69 3300028017 Ga0265356_1002586 Ga0265356_10025862 313
70 3300035170 Ga0373943_0101616 Ga0373943_0101616_237_1322 313
71 3300046472 Ga0495580_0000176 Ga0495580_0000176_32207_33289 313
72 3300046473 Ga0495582_0030688 Ga0495582_0030688_1087_2169 313
73 3300046531 Ga0495665_0058776 Ga0495665_0058776_574_1656 313
74 3300005435 Ga0070714_100064192 Ga0070714_1000641922 314
75 3300005436 Ga0070713_100004328 Ga0070713_1000043288 314
76 3300005436 Ga0070713_100021008 Ga0070713_1000210085 314
77 3300005536 Ga0070697_100104297 Ga0070697_1001042973 314
78 3300005546 Ga0070696_100077242 Ga0070696_1000772422 314
79 3300006914 Ga0075436_100002558 Ga0075436_1000025586 314
80 3300013104 Ga0157370_10091105 Ga0157370_100911052 314
81 3300013105 Ga0157369_10189975 Ga0157369_101899751 314
82 3300025913 Ga0207695_10036849 Ga0207695_100368494 314
83 3300025913 Ga0207695_10162095 Ga0207695_101620952 314
84 3300025928 Ga0207700_10041156 Ga0207700_100411562 314
85 3300025929 Ga0207664_10100369 Ga0207664_101003692 314
86 3300025929 Ga0207664_10267852 Ga0207664_102678521 314
87 3300031090 Ga0265760_10008276 Ga0265760_100082762 314
88 3300039450 Ga0436363_0630469 Ga0436363_0630469_241_1320 314
89 3300044673 Ga0453683_0041843 Ga0453683_0041843_768_1841 314
90 3300046472 Ga0495580_0008352 Ga0495580_0008352_172_1254 314
91 3300050513 nmdc:mga0rr50_374258_c1 nmdc:mga0rr50_374258_c1_28_1137 314
92 3300050514 nmdc:mga08x19_4136_c1 nmdc:mga08x19_4136_c1_3410_4519 314
93 3300005331 Ga0070670_100010165 Ga0070670_1000101659 315
94 3300005334 Ga0068869_100006004 Ga0068869_1000060041 315
95 3300005334 Ga0068869_100011803 Ga0068869_1000118033 315
96 3300005338 Ga0068868_100054352 Ga0068868_1000543523 315
97 3300005340 Ga0070689_100095177 Ga0070689_1000951772 315
98 3300005344 Ga0070661_100022341 Ga0070661_1000223412 315
99 3300005366 Ga0070659_100141844 Ga0070659_1001418441 315
100 3300005367 Ga0070667_100102915 Ga0070667_1001029152 315
101 3300005435 Ga0070714_100015460 Ga0070714_1000154604 315
102 3300005436 Ga0070713_100002368 Ga0070713_1000023689 315
103 3300005445 Ga0070708_100001868 Ga0070708_1000018683 315
104 3300005445 Ga0070708_100026741 Ga0070708_1000267414 315
105 3300005458 Ga0070681_10015071 Ga0070681_100150715 315
106 3300005459 Ga0068867_100072982 Ga0068867_1000729823 315
107 3300005466 Ga0070685_10039985 Ga0070685_100399852 315
108 3300005467 Ga0070706_100001027 Ga0070706_10000102712 315
109 3300005468 Ga0070707_100001517 Ga0070707_1000015177 315
110 3300005471 Ga0070698_100000822 Ga0070698_10000082215 315
111 3300005518 Ga0070699_100053060 Ga0070699_1000530603 315
112 3300005518 Ga0070699_100307950 Ga0070699_1003079501 315
113 3300005530 Ga0070679_100063208 Ga0070679_1000632083 315
114 3300005535 Ga0070684_100022812 Ga0070684_1000228125 315
115 3300005536 Ga0070697_100001757 Ga0070697_10000175714 315
116 3300005539 Ga0068853_100239117 Ga0068853_1002391172 315
117 3300005548 Ga0070665_100278789 Ga0070665_1002787892 315
118 3300005563 Ga0068855_100008242 Ga0068855_1000082428 315
119 3300005563 Ga0068855_100185937 Ga0068855_1001859371 315
120 3300005564 Ga0070664_100002133 Ga0070664_1000021333 315
121 3300005577 Ga0068857_100010504 Ga0068857_1000105042 315
122 3300005578 Ga0068854_100008660 Ga0068854_1000086602 315
123 3300005578 Ga0068854_100188415 Ga0068854_1001884151 315
124 3300005614 Ga0068856_100004326 Ga0068856_1000043268 315
125 3300005616 Ga0068852_100207791 Ga0068852_1002077912 315
126 3300005616 Ga0068852_100306362 Ga0068852_1003063622 315
127 3300005617 Ga0068859_100000033 Ga0068859_10000003397 315
128 3300005617 Ga0068859_100002934 Ga0068859_1000029344 315
129 3300005617 Ga0068859_100003344 Ga0068859_10000334411 315
130 3300005618 Ga0068864_100007227 Ga0068864_1000072276 315
131 3300005718 Ga0068866_10057988 Ga0068866_100579882 315
132 3300005841 Ga0068863_100057530 Ga0068863_1000575302 315
133 3300005842 Ga0068858_100000231 Ga0068858_10000023140 315
134 3300005842 Ga0068858_100030966 Ga0068858_1000309663 315
135 3300005843 Ga0068860_100032528 Ga0068860_1000325287 315
136 3300005843 Ga0068860_100133300 Ga0068860_1001333003 315
137 3300005844 Ga0068862_100120387 Ga0068862_1001203872 315
138 3300006028 Ga0070717_10017409 Ga0070717_100174094 315
139 3300006028 Ga0070717_10055041 Ga0070717_100550413 315
140 3300006237 Ga0097621_100002920 Ga0097621_10000292010 315
141 3300006358 Ga0068871_100007176 Ga0068871_1000071764 315
142 3300006358 Ga0068871_100183082 Ga0068871_1001830822 315
143 3300006881 Ga0068865_100062392 Ga0068865_1000623922 315
144 3300006881 Ga0068865_100107932 Ga0068865_1001079322 315
145 3300006931 Ga0097620_100000033 Ga0097620_10000003397 315
146 3300006931 Ga0097620_100002934 Ga0097620_10000293413 315
147 3300006931 Ga0097620_100003344 Ga0097620_10000334411 315
148 3300009098 Ga0105245_10095823 Ga0105245_100958233 315
149 3300009174 Ga0105241_10067128 Ga0105241_100671282 315
150 3300009177 Ga0105248_10206362 Ga0105248_102063621 315
151 3300009545 Ga0105237_10006540 Ga0105237_1000654011 315
152 3300009545 Ga0105237_10010441 Ga0105237_100104418 315
153 3300009551 Ga0105238_10016889 Ga0105238_100168891 315
154 3300011119 Ga0105246_10032222 Ga0105246_100322222 315
155 3300013102 Ga0157371_10008726 Ga0157371_100087262 315
156 3300013296 Ga0157374_10002617 Ga0157374_100026178 315
157 3300013296 Ga0157374_10023556 Ga0157374_100235563 315
158 3300013297 Ga0157378_10001506 Ga0157378_1000150614 315
159 3300013306 Ga0163162_10003102 Ga0163162_100031024 315
160 3300013307 Ga0157372_10002600 Ga0157372_100026008 315
161 3300025899 Ga0207642_10047143 Ga0207642_100471432 315
162 3300025904 Ga0207647_10002745 Ga0207647_100027455 315
163 3300025907 Ga0207645_10153156 Ga0207645_101531561 315
164 3300025910 Ga0207684_10019417 Ga0207684_100194172 315
165 3300025912 Ga0207707_10126789 Ga0207707_101267892 315
166 3300025914 Ga0207671_10145609 Ga0207671_101456092 315
167 3300025920 Ga0207649_10038935 Ga0207649_100389352 315
168 3300025921 Ga0207652_10052367 Ga0207652_100523672 315
169 3300025922 Ga0207646_10000438 Ga0207646_1000043818 315
170 3300025924 Ga0207694_10236048 Ga0207694_102360481 315
171 3300025925 Ga0207650_10058532 Ga0207650_100585323 315
172 3300025927 Ga0207687_10187666 Ga0207687_101876662 315
173 3300025928 Ga0207700_10004676 Ga0207700_100046765 315
174 3300025928 Ga0207700_10321106 Ga0207700_103211061 315
175 3300025929 Ga0207664_10020593 Ga0207664_100205935 315
176 3300025933 Ga0207706_10224380 Ga0207706_102243802 315
177 3300025935 Ga0207709_10146862 Ga0207709_101468622 315
178 3300025938 Ga0207704_10031737 Ga0207704_100317372 315
179 3300025941 Ga0207711_10385628 Ga0207711_103856281 315
180 3300025942 Ga0207689_10010511 Ga0207689_100105115 315
181 3300025942 Ga0207689_10011197 Ga0207689_100111979 315
182 3300025944 Ga0207661_10019265 Ga0207661_100192651 315
183 3300025945 Ga0207679_10006373 Ga0207679_100063736 315
184 3300025949 Ga0207667_10022702 Ga0207667_100227025 315
185 3300025949 Ga0207667_10172219 Ga0207667_101722192 315
186 3300025960 Ga0207651_10012487 Ga0207651_100124872 315
187 3300025981 Ga0207640_10227764 Ga0207640_102277641 315
188 3300025986 Ga0207658_10055739 Ga0207658_100557392 315
189 3300026023 Ga0207677_10003082 Ga0207677_100030822 315
190 3300026023 Ga0207677_10041494 Ga0207677_100414944 315
191 3300026035 Ga0207703_10001136 Ga0207703_1000113610 315
192 3300026035 Ga0207703_10064115 Ga0207703_100641153 315
193 3300026041 Ga0207639_10208694 Ga0207639_102086941 315
194 3300026078 Ga0207702_10016530 Ga0207702_100165305 315
195 3300026088 Ga0207641_10037728 Ga0207641_100377284 315
196 3300026089 Ga0207648_10026797 Ga0207648_100267976 315
197 3300026095 Ga0207676_10003201 Ga0207676_100032016 315
198 3300026116 Ga0207674_10013329 Ga0207674_100133293 315
199 3300028017 Ga0265356_1000870 Ga0265356_10008703 315
200 3300028379 Ga0268266_10170895 Ga0268266_101708953 315
201 3300028380 Ga0268265_10124270 Ga0268265_101242702 315
202 3300028381 Ga0268264_10031036 Ga0268264_100310361 315
203 3300028666 Ga0265336_10030293 Ga0265336_100302932 315
204 3300031344 Ga0265316_10026349 Ga0265316_100263492 315
205 3300036401 Ga0373937_0107164 Ga0373937_0107164_225_1301 315
206 3300036401 Ga0373937_0177730 Ga0373937_0177730_226_1302 315
207 3300045976 Ga0466967_0014317 Ga0466967_0014317_516_1595 315
208 3300046536 Ga0495587_0074666 Ga0495587_0074666_95_1171 315
209 3300047319 Ga0495674_0238612 Ga0495674_0238612_48_1124 315
210 3300048915 Ga0496112_0002498 Ga0496112_0002498_9136_10221 315
211 3300048915 Ga0496112_0094621 Ga0496112_0094621_1050_2183 315
212 3300004800 Ga0058861_11655845 Ga0058861_116558451 316
213 3300005327 Ga0070658_10246905 Ga0070658_102469052 316
214 3300005329 Ga0070683_100079545 Ga0070683_1000795453 316
215 3300005335 Ga0070666_10017390 Ga0070666_100173903 316
216 3300005336 Ga0070680_100053741 Ga0070680_1000537413 316
217 3300005337 Ga0070682_100062799 Ga0070682_1000627991 316
218 3300005338 Ga0068868_100008303 Ga0068868_1000083035 316
219 3300005343 Ga0070687_100060624 Ga0070687_1000606241 316
220 3300005347 Ga0070668_100002952 Ga0070668_1000029526 316
221 3300005353 Ga0070669_100003693 Ga0070669_1000036936 316
222 3300005354 Ga0070675_100008700 Ga0070675_1000087007 316
223 3300005434 Ga0070709_10060592 Ga0070709_100605923 316
224 3300005436 Ga0070713_100114568 Ga0070713_1001145682 316
225 3300005437 Ga0070710_10067125 Ga0070710_100671252 316
226 3300005445 Ga0070708_100006227 Ga0070708_1000062274 316
227 3300005458 Ga0070681_10004825 Ga0070681_1000482511 316
228 3300005459 Ga0068867_100013280 Ga0068867_1000132804 316
229 3300005466 Ga0070685_10015057 Ga0070685_100150571 316
230 3300005467 Ga0070706_100028767 Ga0070706_1000287674 316
231 3300005467 Ga0070706_100299435 Ga0070706_1002994352 316
232 3300005530 Ga0070679_100015016 Ga0070679_1000150162 316
233 3300005530 Ga0070679_100214731 Ga0070679_1002147312 316
234 3300005535 Ga0070684_100001478 Ga0070684_1000014789 316
235 3300005536 Ga0070697_100085042 Ga0070697_1000850422 316
236 3300005544 Ga0070686_100036911 Ga0070686_1000369113 316
237 3300005563 Ga0068855_100052813 Ga0068855_1000528135 316
238 3300005578 Ga0068854_100009406 Ga0068854_1000094063 316
239 3300005614 Ga0068856_100402010 Ga0068856_1004020101 316
240 3300005615 Ga0070702_100059105 Ga0070702_1000591051 316
241 3300005616 Ga0068852_100145987 Ga0068852_1001459873 316
242 3300005618 Ga0068864_100005210 Ga0068864_1000052107 316
243 3300005718 Ga0068866_10001612 Ga0068866_100016127 316
244 3300005840 Ga0068870_10040515 Ga0068870_100405152 316
245 3300005844 Ga0068862_100006541 Ga0068862_1000065413 316
246 3300005983 Ga0081540_1011204 Ga0081540_10112045 316
247 3300006028 Ga0070717_10110458 Ga0070717_101104582 316
248 3300006028 Ga0070717_10299424 Ga0070717_102994242 316
249 3300006173 Ga0070716_100131101 Ga0070716_1001311012 316
250 3300006237 Ga0097621_100001938 Ga0097621_1000019386 316
251 3300006358 Ga0068871_100000486 Ga0068871_10000048612 316
252 3300006358 Ga0068871_100037824 Ga0068871_1000378244 316
253 3300006871 Ga0075434_100020485 Ga0075434_1000204852 316
254 3300006881 Ga0068865_100098197 Ga0068865_1000981972 316
255 3300006914 Ga0075436_100010271 Ga0075436_1000102716 316
256 3300006914 Ga0075436_100150972 Ga0075436_1001509722 316
257 3300007076 Ga0075435_100006189 Ga0075435_1000061894 316
258 3300009093 Ga0105240_10042044 Ga0105240_100420441 316
259 3300009094 Ga0111539_10159041 Ga0111539_101590412 316
260 3300009098 Ga0105245_10013541 Ga0105245_100135414 316
261 3300009101 Ga0105247_10002535 Ga0105247_100025352 316
262 3300009174 Ga0105241_10010670 Ga0105241_100106703 316
263 3300009174 Ga0105241_10271480 Ga0105241_102714801 316
264 3300009176 Ga0105242_10016491 Ga0105242_100164912 316
265 3300009176 Ga0105242_10269628 Ga0105242_102696282 316
266 3300009177 Ga0105248_10035273 Ga0105248_100352736 316
267 3300009545 Ga0105237_10016823 Ga0105237_100168234 316
268 3300009545 Ga0105237_10368531 Ga0105237_103685312 316
269 3300009553 Ga0105249_10052427 Ga0105249_100524274 316
270 3300010375 Ga0105239_10424000 Ga0105239_104240002 316
271 3300013100 Ga0157373_10004970 Ga0157373_100049706 316
272 3300013100 Ga0157373_10059034 Ga0157373_100590341 316
273 3300013104 Ga0157370_10174924 Ga0157370_101749242 316
274 3300013105 Ga0157369_10072894 Ga0157369_100728943 316
275 3300013105 Ga0157369_10081084 Ga0157369_100810842 316
276 3300013296 Ga0157374_10050863 Ga0157374_100508632 316
277 3300013297 Ga0157378_10000532 Ga0157378_1000053220 316
278 3300013306 Ga0163162_10189242 Ga0163162_101892423 316
279 3300013307 Ga0157372_10004156 Ga0157372_1000415614 316
280 3300013307 Ga0157372_10013627 Ga0157372_100136274 316
281 3300013307 Ga0157372_10022103 Ga0157372_100221033 316
282 3300013307 Ga0157372_10243736 Ga0157372_102437363 316
283 3300014326 Ga0157380_10061173 Ga0157380_100611732 316
284 3300015262 Ga0182007_10004386 Ga0182007_100043861 316
285 3300017792 Ga0163161_10000643 Ga0163161_1000064315 316
286 3300021377 Ga0213874_10002144 Ga0213874_100021444 316
287 3300022732 Ga0224569_100300 Ga0224569_1003003 316
288 3300025899 Ga0207642_10016834 Ga0207642_100168342 316
289 3300025899 Ga0207642_10018490 Ga0207642_100184902 316
290 3300025901 Ga0207688_10189705 Ga0207688_101897051 316
291 3300025904 Ga0207647_10003491 Ga0207647_100034918 316
292 3300025908 Ga0207643_10022301 Ga0207643_100223013 316
293 3300025909 Ga0207705_10192255 Ga0207705_101922551 316
294 3300025910 Ga0207684_10024082 Ga0207684_100240823 316
295 3300025910 Ga0207684_10299446 Ga0207684_102994461 316
296 3300025912 Ga0207707_10085534 Ga0207707_100855341 316
297 3300025914 Ga0207671_10245044 Ga0207671_102450441 316
298 3300025915 Ga0207693_10053324 Ga0207693_100533242 316
299 3300025916 Ga0207663_10060712 Ga0207663_100607121 316
300 3300025917 Ga0207660_10000297 Ga0207660_100002972 316
301 3300025917 Ga0207660_10154570 Ga0207660_101545702 316
302 3300025918 Ga0207662_10007835 Ga0207662_100078352 316
303 3300025919 Ga0207657_10044099 Ga0207657_100440992 316
304 3300025921 Ga0207652_10011210 Ga0207652_100112105 316
305 3300025923 Ga0207681_10061641 Ga0207681_100616412 316
306 3300025925 Ga0207650_10000155 Ga0207650_1000015519 316
307 3300025926 Ga0207659_10035794 Ga0207659_100357943 316
308 3300025927 Ga0207687_10009622 Ga0207687_100096224 316
309 3300025928 Ga0207700_10055668 Ga0207700_100556682 316
310 3300025929 Ga0207664_10074102 Ga0207664_100741023 316
311 3300025932 Ga0207690_10011394 Ga0207690_100113945 316
312 3300025933 Ga0207706_10154715 Ga0207706_101547152 316
313 3300025938 Ga0207704_10053412 Ga0207704_100534122 316
314 3300025939 Ga0207665_10000962 Ga0207665_1000096213 316
315 3300025944 Ga0207661_10002010 Ga0207661_100020104 316
316 3300025945 Ga0207679_10000106 Ga0207679_1000010656 316
317 3300025949 Ga0207667_10209862 Ga0207667_102098622 316
318 3300025960 Ga0207651_10001643 Ga0207651_100016435 316
319 3300025986 Ga0207658_10002109 Ga0207658_100021092 316
320 3300026023 Ga0207677_10019289 Ga0207677_100192892 316
321 3300026078 Ga0207702_10034765 Ga0207702_100347652 316
322 3300026088 Ga0207641_10000298 Ga0207641_1000029828 316
323 3300026089 Ga0207648_10000385 Ga0207648_1000038514 316
324 3300026095 Ga0207676_10000118 Ga0207676_1000011823 316
325 3300026116 Ga0207674_10000048 Ga0207674_1000004849 316
326 3300026121 Ga0207683_10000718 Ga0207683_1000071810 316
327 3300028380 Ga0268265_10015614 Ga0268265_100156143 316
328 3300028381 Ga0268264_10254732 Ga0268264_102547321 316
329 3300028666 Ga0265336_10005167 Ga0265336_100051673 316
330 3300028800 Ga0265338_10042423 Ga0265338_100424232 316
331 3300031235 Ga0265330_10008199 Ga0265330_100081992 316
332 3300031235 Ga0265330_10080489 Ga0265330_100804892 316
333 3300031241 Ga0265325_10008190 Ga0265325_100081904 316
334 3300031241 Ga0265325_10012231 Ga0265325_100122313 316
335 3300031247 Ga0265340_10030192 Ga0265340_100301922 316
336 3300031247 Ga0265340_10097635 Ga0265340_100976352 316
337 3300031247 Ga0265340_10098620 Ga0265340_100986201 316
338 3300031249 Ga0265339_10021166 Ga0265339_100211662 316
339 3300031344 Ga0265316_10009254 Ga0265316_100092547 316
340 3300031711 Ga0265314_10130161 Ga0265314_101301611 316
341 3300031712 Ga0265342_10002216 Ga0265342_100022165 316
342 3300031712 Ga0265342_10011488 Ga0265342_100114883 316
343 3300035113 Ga0373936_0046086 Ga0373936_0046086_273_1352 316
344 3300035119 Ga0373956_0096162 Ga0373956_0096162_120_1202 316
345 3300035695 Ga0373927_0007025 Ga0373927_0007025_3951_5030 316
346 3300035724 Ga0373933_0021455 Ga0373933_0021455_455_1537 316
347 3300035725 Ga0373947_0003826 Ga0373947_0003826_1223_2302 316
348 3300036401 Ga0373937_0036379 Ga0373937_0036379_835_1917 316
349 3300037068 Ga0373925_0019849 Ga0373925_0019849_3700_4779 316
350 3300037466 Ga0395898_0019750 Ga0395898_0019750_32_1111 316
351 3300039450 Ga0436363_0241926 Ga0436363_0241926_4566_5645 316
352 3300042876 Ga0451577_0000290 Ga0451577_0000290_36118_37197 316
353 3300044694 Ga0466963_0011405 Ga0466963_0011405_394_1473 316
354 3300045976 Ga0466967_0012591 Ga0466967_0012591_422_1501 316
355 3300046462 Ga0495651_0172481 Ga0495651_0172481_380_1462 316
356 3300046472 Ga0495580_0018388 Ga0495580_0018388_445_1524 316
357 3300046531 Ga0495665_0005649 Ga0495665_0005649_1397_2476 316
358 3300048907 Ga0496104_0088178 Ga0496104_0088178_34_1113 316
359 3300048911 Ga0496108_0000116 Ga0496108_0000116_43170_44249 316
360 3300048912 Ga0496109_0000265 Ga0496109_0000265_8642_9721 316
361 3300048913 Ga0496110_0000239 Ga0496110_0000239_15110_16189 316
362 3300048914 Ga0496111_0066135 Ga0496111_0066135_330_1409 316
363 3300048915 Ga0496112_0001222 Ga0496112_0001222_14503_15582 316
364 3300048915 Ga0496112_0016160 Ga0496112_0016160_2745_3824 316
365 3300048916 Ga0496113_0000435 Ga0496113_0000435_6731_7810 316
366 3300048917 Ga0496114_0237597 Ga0496114_0237597_88_1167 316
367 3300050514 nmdc:mga08x19_57764_c1 nmdc:mga08x19_57764_c1_34_1113 316
368 3300005329 Ga0070683_100019036 Ga0070683_1000190364 317
369 3300005336 Ga0070680_100025342 Ga0070680_1000253422 317
370 3300005336 Ga0070680_100113688 Ga0070680_1001136882 317
371 3300005338 Ga0068868_100015841 Ga0068868_1000158414 317
372 3300005434 Ga0070709_10007780 Ga0070709_100077801 317
373 3300005435 Ga0070714_100000230 Ga0070714_1000002306 317
374 3300005435 Ga0070714_100344965 Ga0070714_1003449652 317
375 3300005445 Ga0070708_100007704 Ga0070708_1000077045 317
376 3300005445 Ga0070708_100089685 Ga0070708_1000896853 317
377 3300005458 Ga0070681_10001660 Ga0070681_100016608 317
378 3300005458 Ga0070681_10025150 Ga0070681_100251503 317
379 3300005467 Ga0070706_100037461 Ga0070706_1000374613 317
380 3300005471 Ga0070698_100071711 Ga0070698_1000717112 317
381 3300005530 Ga0070679_100015059 Ga0070679_1000150591 317
382 3300005545 Ga0070695_100072842 Ga0070695_1000728421 317
383 3300005546 Ga0070696_100016775 Ga0070696_1000167751 317
384 3300005563 Ga0068855_100001040 Ga0068855_10000104029 317
385 3300005577 Ga0068857_100008259 Ga0068857_1000082596 317
386 3300005578 Ga0068854_100022767 Ga0068854_1000227674 317
387 3300005614 Ga0068856_100002913 Ga0068856_1000029133 317
388 3300005616 Ga0068852_100064376 Ga0068852_1000643762 317
389 3300005842 Ga0068858_100046492 Ga0068858_1000464923 317
390 3300006028 Ga0070717_10006272 Ga0070717_100062725 317
391 3300006237 Ga0097621_100002940 Ga0097621_10000294010 317
392 3300006358 Ga0068871_100004726 Ga0068871_1000047263 317
393 3300006914 Ga0075436_100025900 Ga0075436_1000259005 317
394 3300006914 Ga0075436_100053075 Ga0075436_1000530752 317
395 3300009093 Ga0105240_10002547 Ga0105240_100025473 317
396 3300009093 Ga0105240_10011585 Ga0105240_100115858 317
397 3300009093 Ga0105240_10061795 Ga0105240_100617953 317
398 3300009174 Ga0105241_10016057 Ga0105241_100160573 317
399 3300009177 Ga0105248_10014835 Ga0105248_100148355 317
400 3300009545 Ga0105237_10241614 Ga0105237_102416141 317
401 3300009551 Ga0105238_10001815 Ga0105238_1000181513 317
402 3300010375 Ga0105239_10012680 Ga0105239_100126807 317
403 3300013102 Ga0157371_10105234 Ga0157371_101052342 317
404 3300013105 Ga0157369_10002843 Ga0157369_1000284313 317
405 3300013296 Ga0157374_10002248 Ga0157374_100022482 317
406 3300013296 Ga0157374_10019485 Ga0157374_100194852 317
407 3300013297 Ga0157378_10006631 Ga0157378_100066315 317
408 3300013297 Ga0157378_10065433 Ga0157378_100654333 317
409 3300013307 Ga0157372_10000282 Ga0157372_1000028214 317
410 3300013307 Ga0157372_10002936 Ga0157372_1000293611 317
411 3300013307 Ga0157372_10049067 Ga0157372_100490674 317
412 3300014969 Ga0157376_10308334 Ga0157376_103083342 317
413 3300025898 Ga0207692_10176548 Ga0207692_101765481 317
414 3300025906 Ga0207699_10160927 Ga0207699_101609271 317
415 3300025910 Ga0207684_10031935 Ga0207684_100319352 317
416 3300025911 Ga0207654_10020770 Ga0207654_100207703 317
417 3300025912 Ga0207707_10014891 Ga0207707_100148914 317
418 3300025912 Ga0207707_10087837 Ga0207707_100878373 317
419 3300025912 Ga0207707_10102596 Ga0207707_101025962 317
420 3300025913 Ga0207695_10010387 Ga0207695_100103879 317
421 3300025913 Ga0207695_10012954 Ga0207695_100129544 317
422 3300025921 Ga0207652_10020366 Ga0207652_100203664 317
423 3300025924 Ga0207694_10002726 Ga0207694_1000272610 317
424 3300025928 Ga0207700_10131786 Ga0207700_101317861 317
425 3300025929 Ga0207664_10000236 Ga0207664_100002366 317
426 3300025929 Ga0207664_10383132 Ga0207664_103831322 317
427 3300025933 Ga0207706_10117637 Ga0207706_101176371 317
428 3300025944 Ga0207661_10008828 Ga0207661_100088285 317
429 3300025944 Ga0207661_10036433 Ga0207661_100364333 317
430 3300025945 Ga0207679_10126932 Ga0207679_101269322 317
431 3300025949 Ga0207667_10004960 Ga0207667_1000496014 317
432 3300025949 Ga0207667_10005735 Ga0207667_1000573510 317
433 3300025981 Ga0207640_10031466 Ga0207640_100314662 317
434 3300026023 Ga0207677_10005897 Ga0207677_100058975 317
435 3300026035 Ga0207703_10007386 Ga0207703_100073867 317
436 3300026078 Ga0207702_10004124 Ga0207702_100041249 317
437 3300026078 Ga0207702_10004714 Ga0207702_100047142 317
438 3300026088 Ga0207641_10030130 Ga0207641_100301302 317
439 3300026095 Ga0207676_10215489 Ga0207676_102154891 317
440 3300026116 Ga0207674_10013634 Ga0207674_100136344 317
441 3300026142 Ga0207698_10062432 Ga0207698_100624322 317
442 3300028800 Ga0265338_10002458 Ga0265338_1000245813 317
443 3300031239 Ga0265328_10018624 Ga0265328_100186241 317
444 3300031241 Ga0265325_10060656 Ga0265325_100606561 317
445 3300031249 Ga0265339_10003585 Ga0265339_100035855 317
446 3300031344 Ga0265316_10185213 Ga0265316_101852132 317
447 3300035113 Ga0373936_0000415 Ga0373936_0000415_8279_9361 317
448 3300035113 Ga0373936_0028326 Ga0373936_0028326_760_1845 317
449 3300035113 Ga0373936_0100436 Ga0373936_0100436_88_1170 317
450 3300035116 Ga0373945_0004899 Ga0373945_0004899_2732_3814 317
451 3300035119 Ga0373956_0030158 Ga0373956_0030158_1191_2273 317
452 3300035170 Ga0373943_0000008 Ga0373943_0000008_16348_17430 317
453 3300035170 Ga0373943_0019598 Ga0373943_0019598_1002_2084 317
454 3300035171 Ga0373946_0071447 Ga0373946_0071447_290_1372 317
455 3300035691 Ga0373931_0021534 Ga0373931_0021534_183_1265 317
456 3300035692 Ga0373935_0009541 Ga0373935_0009541_263_1348 317
457 3300035692 Ga0373935_0049826 Ga0373935_0049826_253_1335 317
458 3300035725 Ga0373947_0000210 Ga0373947_0000210_14262_15344 317
459 3300035725 Ga0373947_0003427 Ga0373947_0003427_5857_6939 317
460 3300035725 Ga0373947_0190382 Ga0373947_0190382_122_1204 317
461 3300037068 Ga0373925_0001100 Ga0373925_0001100_5060_6142 317
462 3300037068 Ga0373925_0069116 Ga0373925_0069116_210_1292 317
463 3300037068 Ga0373925_0109594 Ga0373925_0109594_57_1142 317
464 3300037471 Ga0395905_0005868 Ga0395905_0005868_10202_11284 317
465 3300037471 Ga0395905_0153843 Ga0395905_0153843_1050_2132 317
466 3300039438 Ga0436360_0213845 Ga0436360_0213845_3126_4211 317
467 3300039447 Ga0436361_0251067 Ga0436361_0251067_2161_3246 317
468 3300039450 Ga0436363_0281651 Ga0436363_0281651_898_1980 317
469 3300045049 Ga0466959_0003455 Ga0466959_0003455_828_1910 317
470 3300046459 Ga0495629_0004259 Ga0495629_0004259_927_2012 317
471 3300046463 Ga0495653_0170997 Ga0495653_0170997_267_1349 317
472 3300046472 Ga0495580_0000030 Ga0495580_0000030_18296_19381 317
473 3300046472 Ga0495580_0012099 Ga0495580_0012099_3180_4313 317
474 3300046472 Ga0495580_0014601 Ga0495580_0014601_4129_5211 317
475 3300046476 Ga0495662_0061711 Ga0495662_0061711_550_1632 317
476 3300046529 Ga0495652_0235316 Ga0495652_0235316_79_1164 317
477 3300046535 Ga0495586_0102828 Ga0495586_0102828_250_1332 317
478 3300046543 Ga0495645_0116461 Ga0495645_0116461_372_1454 317
479 3300046678 Ga0495599_0093240 Ga0495599_0093240_404_1489 317
480 3300046681 Ga0495647_0001185 Ga0495647_0001185_5614_6696 317
481 3300046681 Ga0495647_0022524 Ga0495647_0022524_86_1168 317
482 3300046683 Ga0495658_0007219 Ga0495658_0007219_1785_2870 317
483 3300046690 Ga0495624_0053189 Ga0495624_0053189_604_1686 317
484 3300046690 Ga0495624_0097789 Ga0495624_0097789_24_1106 317
485 3300047315 Ga0495581_0033780 Ga0495581_0033780_1572_2657 317
486 3300047319 Ga0495674_0010257 Ga0495674_0010257_7751_8833 317
487 3300047319 Ga0495674_0012423 Ga0495674_0012423_4068_5153 317
488 3300048088 Ga0495602_0012288 Ga0495602_0012288_6032_7114 317
489 3300048088 Ga0495602_0103407 Ga0495602_0103407_549_1682 317
490 3300048088 Ga0495602_0164402 Ga0495602_0164402_143_1225 317
491 3300048905 Ga0496102_0203500 Ga0496102_0203500_213_1295 317
492 3300048915 Ga0496112_0027607 Ga0496112_0027607_3093_4175 317
493 3300048916 Ga0496113_0205920 Ga0496113_0205920_327_1412 317
494 3300048918 Ga0496115_0103391 Ga0496115_0103391_220_1302 317
495 3300048918 Ga0496115_0124740 Ga0496115_0124740_119_1201 317
496 3300050514 nmdc:mga08x19_1929_c1 nmdc:mga08x19_1929_c1_2888_3970 317
497 3300053077 Ga0495601_0014941 Ga0495601_0014941_1083_2168 317
498 3300000546 LJNas_1000030 LJNas_100003011 318
499 3300005290 Ga0065712_10082696 Ga0065712_100826963 318
500 3300005293 Ga0065715_10005347 Ga0065715_100053475 318
501 3300005327 Ga0070658_10008281 Ga0070658_100082812 318
502 3300005329 Ga0070683_100023745 Ga0070683_1000237453 318
503 3300005329 Ga0070683_100073509 Ga0070683_1000735092 318
504 3300005329 Ga0070683_100124847 Ga0070683_1001248471 318
505 3300005330 Ga0070690_100019152 Ga0070690_1000191525 318
506 3300005337 Ga0070682_100025404 Ga0070682_1000254043 318
507 3300005337 Ga0070682_100072094 Ga0070682_1000720941 318
508 3300005338 Ga0068868_100003271 Ga0068868_1000032716 318
509 3300005338 Ga0068868_100144157 Ga0068868_1001441572 318
510 3300005339 Ga0070660_100017960 Ga0070660_1000179603 318
511 3300005340 Ga0070689_100104284 Ga0070689_1001042842 318
512 3300005344 Ga0070661_100013208 Ga0070661_1000132086 318
513 3300005345 Ga0070692_10063076 Ga0070692_100630763 318
514 3300005366 Ga0070659_100001774 Ga0070659_1000017747 318
515 3300005366 Ga0070659_100047742 Ga0070659_1000477423 318
516 3300005366 Ga0070659_100180081 Ga0070659_1001800812 318
517 3300005367 Ga0070667_100016724 Ga0070667_1000167243 318
518 3300005434 Ga0070709_10010577 Ga0070709_100105775 318
519 3300005434 Ga0070709_10099898 Ga0070709_100998983 318
520 3300005434 Ga0070709_10159034 Ga0070709_101590342 318
521 3300005436 Ga0070713_100001829 Ga0070713_1000018296 318
522 3300005436 Ga0070713_100035935 Ga0070713_1000359353 318
523 3300005436 Ga0070713_100072481 Ga0070713_1000724812 318
524 3300005436 Ga0070713_100278395 Ga0070713_1002783951 318
525 3300005437 Ga0070710_10011166 Ga0070710_100111663 318
526 3300005437 Ga0070710_10023173 Ga0070710_100231733 318
527 3300005439 Ga0070711_100000853 Ga0070711_10000085310 318
528 3300005439 Ga0070711_100003707 Ga0070711_1000037079 318
529 3300005439 Ga0070711_100006707 Ga0070711_1000067076 318
530 3300005439 Ga0070711_100028176 Ga0070711_1000281761 318
531 3300005445 Ga0070708_100001236 Ga0070708_10000123620 318
532 3300005445 Ga0070708_100003294 Ga0070708_10000329412 318
533 3300005445 Ga0070708_100009412 Ga0070708_1000094126 318
534 3300005445 Ga0070708_100056408 Ga0070708_1000564083 318
535 3300005445 Ga0070708_100133693 Ga0070708_1001336931 318
536 3300005445 Ga0070708_100249424 Ga0070708_1002494242 318
537 3300005455 Ga0070663_100029925 Ga0070663_1000299254 318
538 3300005455 Ga0070663_100285823 Ga0070663_1002858231 318
539 3300005457 Ga0070662_100003783 Ga0070662_1000037835 318
540 3300005458 Ga0070681_10029017 Ga0070681_100290173 318
541 3300005458 Ga0070681_10043735 Ga0070681_100437351 318
542 3300005458 Ga0070681_10065484 Ga0070681_100654843 318
543 3300005458 Ga0070681_10080793 Ga0070681_100807932 318
544 3300005458 Ga0070681_10183321 Ga0070681_101833212 318
545 3300005458 Ga0070681_10279990 Ga0070681_102799902 318
546 3300005467 Ga0070706_100089843 Ga0070706_1000898432 318
547 3300005467 Ga0070706_100121889 Ga0070706_1001218892 318
548 3300005468 Ga0070707_100039011 Ga0070707_1000390114 318
549 3300005468 Ga0070707_100068216 Ga0070707_1000682161 318
550 3300005468 Ga0070707_100165504 Ga0070707_1001655042 318
551 3300005468 Ga0070707_100291535 Ga0070707_1002915352 318
552 3300005468 Ga0070707_100401036 Ga0070707_1004010361 318
553 3300005471 Ga0070698_100071416 Ga0070698_1000714163 318
554 3300005471 Ga0070698_100108039 Ga0070698_1001080392 318
555 3300005518 Ga0070699_100000132 Ga0070699_10000013261 318
556 3300005518 Ga0070699_100005299 Ga0070699_1000052998 318
557 3300005530 Ga0070679_100026608 Ga0070679_1000266084 318
558 3300005530 Ga0070679_100226295 Ga0070679_1002262952 318
559 3300005535 Ga0070684_100019101 Ga0070684_1000191014 318
560 3300005536 Ga0070697_100002074 Ga0070697_1000020747 318
561 3300005536 Ga0070697_100009348 Ga0070697_1000093481 318
562 3300005536 Ga0070697_100047734 Ga0070697_1000477343 318
563 3300005536 Ga0070697_100100092 Ga0070697_1001000922 318
564 3300005539 Ga0068853_100000037 Ga0068853_10000003797 318
565 3300005539 Ga0068853_100056031 Ga0068853_1000560313 318
566 3300005539 Ga0068853_100368596 Ga0068853_1003685961 318
567 3300005547 Ga0070693_100196767 Ga0070693_1001967671 318
568 3300005548 Ga0070665_100018526 Ga0070665_1000185262 318
569 3300005549 Ga0070704_100023033 Ga0070704_1000230333 318
570 3300005563 Ga0068855_100021781 Ga0068855_1000217812 318
571 3300005563 Ga0068855_100048418 Ga0068855_1000484181 318
572 3300005563 Ga0068855_100171575 Ga0068855_1001715753 318
573 3300005564 Ga0070664_100047668 Ga0070664_1000476684 318
574 3300005578 Ga0068854_100000033 Ga0068854_10000003311 318
575 3300005578 Ga0068854_100013918 Ga0068854_1000139184 318
576 3300005614 Ga0068856_100003671 Ga0068856_1000036714 318
577 3300005614 Ga0068856_100017943 Ga0068856_1000179435 318
578 3300005614 Ga0068856_100081233 Ga0068856_1000812333 318
579 3300005614 Ga0068856_100338431 Ga0068856_1003384312 318
580 3300005615 Ga0070702_100058774 Ga0070702_1000587742 318
581 3300005616 Ga0068852_100027695 Ga0068852_1000276951 318
582 3300005616 Ga0068852_100078716 Ga0068852_1000787163 318
583 3300005616 Ga0068852_100362686 Ga0068852_1003626861 318
584 3300005616 Ga0068852_100489488 Ga0068852_1004894881 318
585 3300005834 Ga0068851_10015181 Ga0068851_100151814 318
586 3300005841 Ga0068863_100133922 Ga0068863_1001339222 318
587 3300005842 Ga0068858_100145915 Ga0068858_1001459153 318
588 3300005843 Ga0068860_100084794 Ga0068860_1000847943 318
589 3300005981 Ga0081538_10011454 Ga0081538_100114545 318
590 3300005981 Ga0081538_10014162 Ga0081538_100141623 318
591 3300005981 Ga0081538_10053514 Ga0081538_100535142 318
592 3300006028 Ga0070717_10005131 Ga0070717_100051314 318
593 3300006028 Ga0070717_10025624 Ga0070717_100256243 318
594 3300006028 Ga0070717_10214419 Ga0070717_102144192 318
595 3300006163 Ga0070715_10001303 Ga0070715_100013036 318
596 3300006163 Ga0070715_10001715 Ga0070715_100017153 318
597 3300006163 Ga0070715_10011808 Ga0070715_100118082 318
598 3300006173 Ga0070716_100000452 Ga0070716_1000004523 318
599 3300006175 Ga0070712_100001507 Ga0070712_1000015072 318
600 3300006175 Ga0070712_100001608 Ga0070712_1000016087 318
601 3300006175 Ga0070712_100005436 Ga0070712_1000054365 318
602 3300006175 Ga0070712_100008495 Ga0070712_1000084954 318
603 3300006175 Ga0070712_100024297 Ga0070712_1000242973 318
604 3300006237 Ga0097621_100018133 Ga0097621_1000181335 318
605 3300006358 Ga0068871_100035453 Ga0068871_1000354533 318
606 3300006358 Ga0068871_100090482 Ga0068871_1000904822 318
607 3300006358 Ga0068871_100393766 Ga0068871_1003937661 318
608 3300006847 Ga0075431_100365843 Ga0075431_1003658432 318
609 3300006871 Ga0075434_100094472 Ga0075434_1000944723 318
610 3300006881 Ga0068865_100015548 Ga0068865_1000155483 318
611 3300006881 Ga0068865_100139110 Ga0068865_1001391102 318
612 3300009093 Ga0105240_10025905 Ga0105240_100259052 318
613 3300009093 Ga0105240_10029156 Ga0105240_100291567 318
614 3300009093 Ga0105240_10062461 Ga0105240_100624614 318
615 3300009098 Ga0105245_10004753 Ga0105245_100047534 318
616 3300009098 Ga0105245_10005718 Ga0105245_100057184 318
617 3300009101 Ga0105247_10073600 Ga0105247_100736002 318
618 3300009148 Ga0105243_10124235 Ga0105243_101242353 318
619 3300009174 Ga0105241_10015408 Ga0105241_100154086 318
620 3300009174 Ga0105241_10021542 Ga0105241_100215421 318
621 3300009174 Ga0105241_10025045 Ga0105241_100250454 318
622 3300009177 Ga0105248_10006181 Ga0105248_1000618114 318
623 3300009177 Ga0105248_10224396 Ga0105248_102243962 318
624 3300009545 Ga0105237_10111196 Ga0105237_101111961 318
625 3300009545 Ga0105237_10123375 Ga0105237_101233753 318
626 3300009551 Ga0105238_10042543 Ga0105238_100425432 318
627 3300009551 Ga0105238_10054425 Ga0105238_100544253 318
628 3300009551 Ga0105238_10079079 Ga0105238_100790792 318
629 3300009551 Ga0105238_10319411 Ga0105238_103194112 318
630 3300009553 Ga0105249_10004362 Ga0105249_100043628 318
631 3300010375 Ga0105239_10219030 Ga0105239_102190303 318
632 3300011119 Ga0105246_10051038 Ga0105246_100510381 318
633 3300013100 Ga0157373_10025405 Ga0157373_100254054 318
634 3300013100 Ga0157373_10028127 Ga0157373_100281273 318
635 3300013100 Ga0157373_10238716 Ga0157373_102387161 318
636 3300013102 Ga0157371_10010962 Ga0157371_100109626 318
637 3300013104 Ga0157370_10010916 Ga0157370_100109167 318
638 3300013105 Ga0157369_10029189 Ga0157369_100291894 318
639 3300013105 Ga0157369_10031833 Ga0157369_100318333 318
640 3300013105 Ga0157369_10301322 Ga0157369_103013221 318
641 3300013296 Ga0157374_10015624 Ga0157374_100156245 318
642 3300013296 Ga0157374_10058827 Ga0157374_100588273 318
643 3300013296 Ga0157374_10230224 Ga0157374_102302242 318
644 3300013297 Ga0157378_10052854 Ga0157378_100528542 318
645 3300013297 Ga0157378_10095798 Ga0157378_100957981 318
646 3300013297 Ga0157378_10110162 Ga0157378_101101623 318
647 3300013306 Ga0163162_10000661 Ga0163162_1000066123 318
648 3300013306 Ga0163162_10004705 Ga0163162_100047059 318
649 3300013306 Ga0163162_10256934 Ga0163162_102569342 318
650 3300013307 Ga0157372_10012590 Ga0157372_100125904 318
651 3300013307 Ga0157372_10019219 Ga0157372_100192195 318
652 3300013308 Ga0157375_10013927 Ga0157375_100139274 318
653 3300014325 Ga0163163_10002219 Ga0163163_100022199 318
654 3300014325 Ga0163163_10018353 Ga0163163_100183531 318
655 3300014497 Ga0182008_10010743 Ga0182008_100107432 318
656 3300014968 Ga0157379_10006386 Ga0157379_100063865 318
657 3300014968 Ga0157379_10108889 Ga0157379_101088893 318
658 3300014969 Ga0157376_10024100 Ga0157376_100241006 318
659 3300015261 Ga0182006_1021302 Ga0182006_10213022 318
660 3300022730 Ga0224570_100894 Ga0224570_1008941 318
661 3300024225 Ga0224572_1008666 Ga0224572_10086662 318
662 3300024227 Ga0228598_1001285 Ga0228598_10012853 318
663 3300025321 Ga0207656_10016535 Ga0207656_100165353 318
664 3300025898 Ga0207692_10018779 Ga0207692_100187791 318
665 3300025899 Ga0207642_10009662 Ga0207642_100096624 318
666 3300025903 Ga0207680_10016488 Ga0207680_100164883 318
667 3300025905 Ga0207685_10002829 Ga0207685_100028294 318
668 3300025906 Ga0207699_10028174 Ga0207699_100281742 318
669 3300025906 Ga0207699_10137136 Ga0207699_101371362 318
670 3300025906 Ga0207699_10153623 Ga0207699_101536232 318
671 3300025907 Ga0207645_10067112 Ga0207645_100671123 318
672 3300025910 Ga0207684_10004409 Ga0207684_1000440911 318
673 3300025910 Ga0207684_10056542 Ga0207684_100565421 318
674 3300025910 Ga0207684_10260967 Ga0207684_102609671 318
675 3300025911 Ga0207654_10004737 Ga0207654_100047376 318
676 3300025911 Ga0207654_10015966 Ga0207654_100159663 318
677 3300025911 Ga0207654_10057178 Ga0207654_100571782 318
678 3300025912 Ga0207707_10026426 Ga0207707_100264265 318
679 3300025912 Ga0207707_10027675 Ga0207707_100276753 318
680 3300025912 Ga0207707_10135761 Ga0207707_101357612 318
681 3300025913 Ga0207695_10006448 Ga0207695_100064487 318
682 3300025913 Ga0207695_10029044 Ga0207695_100290444 318
683 3300025913 Ga0207695_10038078 Ga0207695_100380784 318
684 3300025913 Ga0207695_10386953 Ga0207695_103869531 318
685 3300025914 Ga0207671_10011449 Ga0207671_100114493 318
686 3300025915 Ga0207693_10000013 Ga0207693_1000001310 318
687 3300025915 Ga0207693_10000304 Ga0207693_1000030432 318
688 3300025915 Ga0207693_10005944 Ga0207693_100059445 318
689 3300025916 Ga0207663_10012437 Ga0207663_100124372 318
690 3300025916 Ga0207663_10015375 Ga0207663_100153754 318
691 3300025916 Ga0207663_10024839 Ga0207663_100248394 318
692 3300025917 Ga0207660_10042428 Ga0207660_100424284 318
693 3300025917 Ga0207660_10283891 Ga0207660_102838912 318
694 3300025919 Ga0207657_10001110 Ga0207657_1000111012 318
695 3300025919 Ga0207657_10002518 Ga0207657_100025186 318
696 3300025919 Ga0207657_10006370 Ga0207657_100063703 318
697 3300025919 Ga0207657_10094271 Ga0207657_100942712 318
698 3300025920 Ga0207649_10008330 Ga0207649_100083306 318
699 3300025921 Ga0207652_10027282 Ga0207652_100272823 318
700 3300025922 Ga0207646_10000194 Ga0207646_1000019487 318
701 3300025922 Ga0207646_10044144 Ga0207646_100441443 318
702 3300025922 Ga0207646_10161287 Ga0207646_101612871 318
703 3300025922 Ga0207646_10274326 Ga0207646_102743262 318
704 3300025924 Ga0207694_10063235 Ga0207694_100632353 318
705 3300025925 Ga0207650_10146490 Ga0207650_101464902 318
706 3300025927 Ga0207687_10006362 Ga0207687_100063623 318
707 3300025928 Ga0207700_10001442 Ga0207700_100014428 318
708 3300025928 Ga0207700_10002926 Ga0207700_100029268 318
709 3300025928 Ga0207700_10084381 Ga0207700_100843812 318
710 3300025928 Ga0207700_10309336 Ga0207700_103093361 318
711 3300025929 Ga0207664_10039149 Ga0207664_100391492 318
712 3300025929 Ga0207664_10062377 Ga0207664_100623771 318
713 3300025929 Ga0207664_10180529 Ga0207664_101805292 318
714 3300025931 Ga0207644_10144761 Ga0207644_101447612 318
715 3300025932 Ga0207690_10011497 Ga0207690_100114974 318
716 3300025933 Ga0207706_10002659 Ga0207706_100026593 318
717 3300025938 Ga0207704_10008613 Ga0207704_100086135 318
718 3300025939 Ga0207665_10000300 Ga0207665_100003005 318
719 3300025939 Ga0207665_10021434 Ga0207665_100214342 318
720 3300025939 Ga0207665_10061163 Ga0207665_100611633 318
721 3300025939 Ga0207665_10220885 Ga0207665_102208851 318
722 3300025939 Ga0207665_10259687 Ga0207665_102596871 318
723 3300025941 Ga0207711_10000892 Ga0207711_100008923 318
724 3300025941 Ga0207711_10154254 Ga0207711_101542542 318
725 3300025944 Ga0207661_10150762 Ga0207661_101507622 318
726 3300025949 Ga0207667_10004320 Ga0207667_100043206 318
727 3300025949 Ga0207667_10032158 Ga0207667_100321583 318
728 3300025949 Ga0207667_10308249 Ga0207667_103082491 318
729 3300025961 Ga0207712_10010691 Ga0207712_100106914 318
730 3300025972 Ga0207668_10017235 Ga0207668_100172352 318
731 3300025981 Ga0207640_10000001 Ga0207640_1000000111 318
732 3300025981 Ga0207640_10006049 Ga0207640_100060494 318
733 3300026023 Ga0207677_10143506 Ga0207677_101435062 318
734 3300026041 Ga0207639_10000060 Ga0207639_1000006097 318
735 3300026041 Ga0207639_10077233 Ga0207639_100772333 318
736 3300026067 Ga0207678_10002206 Ga0207678_100022064 318
737 3300026067 Ga0207678_10036947 Ga0207678_100369474 318
738 3300026067 Ga0207678_10087929 Ga0207678_100879293 318
739 3300026078 Ga0207702_10021839 Ga0207702_100218394 318
740 3300026078 Ga0207702_10044471 Ga0207702_100444713 318
741 3300026078 Ga0207702_10055944 Ga0207702_100559443 318
742 3300026089 Ga0207648_10009510 Ga0207648_100095105 318
743 3300026116 Ga0207674_10023971 Ga0207674_100239712 318
744 3300026116 Ga0207674_10043568 Ga0207674_100435682 318
745 3300026116 Ga0207674_10097741 Ga0207674_100977413 318
746 3300026116 Ga0207674_10137621 Ga0207674_101376212 318
747 3300026142 Ga0207698_10108539 Ga0207698_101085392 318
748 3300028017 Ga0265356_1000091 Ga0265356_10000917 318
749 3300028379 Ga0268266_10027246 Ga0268266_100272463 318
750 3300028380 Ga0268265_10003986 Ga0268265_100039864 318
751 3300031090 Ga0265760_10005583 Ga0265760_100055833 318
752 3300031247 Ga0265340_10062246 Ga0265340_100622461 318
753 3300031344 Ga0265316_10001343 Ga0265316_100013438 318
754 3300031548 Ga0307408_100233932 Ga0307408_1002339321 318
755 3300031711 Ga0265314_10004443 Ga0265314_1000444313 318
756 3300031731 Ga0307405_10060351 Ga0307405_100603511 318
757 3300031852 Ga0307410_10027211 Ga0307410_100272113 318
758 3300031901 Ga0307406_10010272 Ga0307406_100102722 318
759 3300031995 Ga0307409_100152228 Ga0307409_1001522281 318
760 3300032005 Ga0307411_10080737 Ga0307411_100807372 318
761 3300032126 Ga0307415_100012094 Ga0307415_1000120945 318
762 3300034957 Ga0373938_0014476 Ga0373938_0014476_32_1117 318
763 3300035083 Ga0373926_0000844 Ga0373926_0000844_5039_6124 318
764 3300035119 Ga0373956_0038528 Ga0373956_0038528_482_1567 318
765 3300035170 Ga0373943_0001473 Ga0373943_0001473_5610_6695 318
766 3300035171 Ga0373946_0025051 Ga0373946_0025051_89_1174 318
767 3300035242 Ga0373962_0049590 Ga0373962_0049590_106_1191 318
768 3300035410 Ga0373924_0000042 Ga0373924_0000042_22463_23548 318
769 3300035691 Ga0373931_0027649 Ga0373931_0027649_228_1313 318
770 3300035692 Ga0373935_0115779 Ga0373935_0115779_156_1241 318
771 3300035695 Ga0373927_0002504 Ga0373927_0002504_8753_9838 318
772 3300035725 Ga0373947_0010928 Ga0373947_0010928_629_1714 318
773 3300036401 Ga0373937_0000648 Ga0373937_0000648_7621_8706 318
774 3300037068 Ga0373925_0146327 Ga0373925_0146327_571_1656 318
775 3300037068 Ga0373925_0271834 Ga0373925_0271834_54_1139 318
776 3300039438 Ga0436360_0669763 Ga0436360_0669763_919_2004 318
777 3300044694 Ga0466963_0138548 Ga0466963_0138548_175_1260 318
778 3300044842 Ga0466957_0000292 Ga0466957_0000292_9254_10339 318
779 3300045976 Ga0466967_0022966 Ga0466967_0022966_180_1265 318
780 3300046462 Ga0495651_0211020 Ga0495651_0211020_235_1320 318
781 3300046472 Ga0495580_0000136 Ga0495580_0000136_14537_15622 318
782 3300046472 Ga0495580_0000228 Ga0495580_0000228_617_1702 318
783 3300046472 Ga0495580_0008064 Ga0495580_0008064_5583_6668 318
784 3300046472 Ga0495580_0013162 Ga0495580_0013162_419_1504 318
785 3300046472 Ga0495580_0063547 Ga0495580_0063547_494_1579 318
786 3300046559 Ga0495667_0091170 Ga0495667_0091170_844_1929 318
787 3300046663 Ga0495635_0030503 Ga0495635_0030503_1693_2778 318
788 3300046664 Ga0495659_0028465 Ga0495659_0028465_449_1534 318
789 3300046679 Ga0495623_0154345 Ga0495623_0154345_186_1271 318
790 3300046683 Ga0495658_0147555 Ga0495658_0147555_263_1348 318
791 3300046684 Ga0495669_0024760 Ga0495669_0024760_1336_2424 318
792 3300046684 Ga0495669_0098135 Ga0495669_0098135_77_1162 318
793 3300047315 Ga0495581_0035520 Ga0495581_0035520_1513_2598 318
794 3300047444 Ga0495675_0073077 Ga0495675_0073077_139_1224 318
795 3300048905 Ga0496102_0064028 Ga0496102_0064028_2249_3334 318
796 3300048906 Ga0496103_0015234 Ga0496103_0015234_1277_2362 318
797 3300048906 Ga0496103_0044890 Ga0496103_0044890_1277_2362 318
798 3300048906 Ga0496103_0075671 Ga0496103_0075671_548_1633 318
799 3300048907 Ga0496104_0061976 Ga0496104_0061976_262_1347 318
800 3300048907 Ga0496104_0098604 Ga0496104_0098604_360_1445 318
801 3300048907 Ga0496104_0145363 Ga0496104_0145363_93_1178 318
802 3300048908 Ga0496105_0003734 Ga0496105_0003734_4326_5411 318
803 3300048909 Ga0496106_0096381 Ga0496106_0096381_982_2067 318
804 3300048909 Ga0496106_0153272 Ga0496106_0153272_638_1723 318
805 3300048911 Ga0496108_0207131 Ga0496108_0207131_86_1171 318
806 3300048912 Ga0496109_0296985 Ga0496109_0296985_196_1281 318
807 3300048913 Ga0496110_0102424 Ga0496110_0102424_277_1362 318
808 3300048913 Ga0496110_0207667 Ga0496110_0207667_189_1274 318
809 3300048914 Ga0496111_0001607 Ga0496111_0001607_11731_12816 318
810 3300048915 Ga0496112_0002814 Ga0496112_0002814_8525_9610 318
811 3300048915 Ga0496112_0040910 Ga0496112_0040910_35_1120 318
812 3300048916 Ga0496113_0014564 Ga0496113_0014564_4217_5302 318
813 3300048916 Ga0496113_0050186 Ga0496113_0050186_31_1116 318
814 3300048918 Ga0496115_0083457 Ga0496115_0083457_1437_2522 318
815 3300048918 Ga0496115_0156511 Ga0496115_0156511_743_1828 318
816 3300048918 Ga0496115_0220761 Ga0496115_0220761_154_1239 318
817 3300050512 nmdc:mga0n895_93913_c1 nmdc:mga0n895_93913_c1_1228_2313 318

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06071

YchF-GTPase_C

Protein of unknown function (DUF933)

293

376

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hvz-assembly3.cif.gz_E crystal structure of the tgs domain of the clolep_03100 protein from clostridium leptum, northeast structural genomics consortium target qlr13a 0.8802 235 317
3hvz-assembly3.cif.gz_E crystal structure of the tgs domain of the clolep_03100 protein from clostridium leptum, northeast structural genomics consortium target qlr13a 0.8545 235 317
1ni3-assembly1.cif.gz_A structure of the schizosaccharomyces pombe ychf gtpase 0.8301 1 315
5ee0-assembly1.cif.gz_A crystal structure of osychf1 at ph 6.5 0.8217 1 317
1ni3-assembly1.cif.gz_A structure of the schizosaccharomyces pombe ychf gtpase 0.8203 1 315
ID Description Score Start End Superfamily
af_K7L8F3_337_419_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9951 236 317 3.10.20.30
af_Q7ZU42_294_388_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9895 224 317 3.10.20.30
2dbyA02 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9894 235 315 3.10.20.30
af_Q6Z1J6_301_384_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9841 233 313 3.10.20.30
af_K7L8F3_337_419_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9715 236 317 3.10.20.30
ID Description Score Start End GO Terms
AF-W1VBG4-F1-model_v4 GTP-binding protein 0.9963 246 317 GO:0005737
GO:0016887
AF-A0A095YEM4-F1-model_v4 GTP-binding protein 0.9937 220 318 GO:0005737
GO:0016887
AF-K1T835-F1-model_v4 Protein containing DUF933 0.9912 237 318 GO:0005737
GO:0016887
AF-A0A2H0YA64-F1-model_v4 Redox-regulated ATPase YchF 0.9907 248 318 GO:0005737
GO:0016887
AF-A0A2V9U246-F1-model_v4 Redox-regulated ATPase YchF 0.99 191 318 GO:0005737
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.64 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map