F482103
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 817 | 270 | 817 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0012099|Ga0495580_0012099_3180_4313 |
| Length | 377 |
| Sequence | MKTGIIGLPQVGKTSLFRILTKAHLAPSRANPREAHVGVAKVPDDRLDRLAAMYSPKKLTHASVEYVDLGAIGQEALKESGYLGHLRQVDAVAHVVRAFEDDSIPHAGPIDPLRDIKNVEFDLMVSDLGQIEKRLERVXXXXKKMRSADLEKEFELLNRAKAHLETERPLRELEMTPEDKKRFRGFMFLSEKPILYVLNISESGELGKDLENAVAKYRLADLASGHAGTGDLARRAEQGSAVRTTGATAICGKVEAELAEMSDADAAEFLASYGLQESGLTRLIRTTYALLGLISFFTAGEDECRAWTIPVNTRAVQAAGAIHSDLEKHFIRAETIRWDQLLDAGSEANARAKGTLRLEGKDYIVQDGDVMHIRHSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 114 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 115 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 116 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 186 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 187 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 190 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 202 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 207 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 255 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 256 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 257 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.77 |
| Rhizosphere | 94.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.49 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000030 | 3300000546 | Bacteria | 18811 |
| 2 | Ga0058861_11655845 | 3300004800 | Bacteria | 1233 |
| 3 | Ga0065712_10082696 | 3300005290 | Bacteria | 2893 |
| 4 | Ga0065715_10005347 | 3300005293 | Bacteria | 6194 |
| 5 | Ga0070658_10008281 | 3300005327 | Bacteria | 8363 |
| 6 | Ga0070658_10246905 | 3300005327 | Bacteria | 1514 |
| 7 | Ga0070683_100019036 | 3300005329 | Bacteria | 6092 |
| 8 | Ga0070683_100023745 | 3300005329 | Bacteria | 5487 |
| 9 | Ga0070683_100073509 | 3300005329 | Bacteria | 3192 |
| 10 | Ga0070683_100079545 | 3300005329 | Unclassified | 3068 |
| 11 | Ga0070683_100124847 | 3300005329 | Unclassified | 2433 |
| 12 | Ga0070690_100019152 | 3300005330 | Bacteria | 4148 |
| 13 | Ga0070670_100010165 | 3300005331 | Bacteria | 8030 |
| 14 | Ga0068869_100006004 | 3300005334 | Bacteria | 7680 |
| 15 | Ga0068869_100011803 | 3300005334 | Bacteria | 5746 |
| 16 | Ga0070666_10017390 | 3300005335 | Bacteria | 4610 |
| 17 | Ga0070680_100025342 | 3300005336 | Bacteria | 4740 |
| 18 | Ga0070680_100053741 | 3300005336 | Bacteria | 3287 |
| 19 | Ga0070680_100113688 | 3300005336 | Bacteria | 2255 |
| 20 | Ga0070680_100212776 | 3300005336 | Bacteria | 1631 |
| 21 | Ga0070682_100025404 | 3300005337 | Bacteria | 3534 |
| 22 | Ga0070682_100062799 | 3300005337 | Bacteria | 2353 |
| 23 | Ga0070682_100072094 | 3300005337 | Unclassified | 2213 |
| 24 | Ga0068868_100003271 | 3300005338 | Bacteria | 11281 |
| 25 | Ga0068868_100008303 | 3300005338 | Bacteria | 7436 |
| 26 | Ga0068868_100015841 | 3300005338 | Bacteria | 5586 |
| 27 | Ga0068868_100054352 | 3300005338 | Unclassified | 3155 |
| 28 | Ga0068868_100144157 | 3300005338 | Bacteria | 1957 |
| 29 | Ga0070660_100017960 | 3300005339 | Bacteria | 5161 |
| 30 | Ga0070689_100095177 | 3300005340 | Bacteria | 2352 |
| 31 | Ga0070689_100104284 | 3300005340 | Bacteria | 2248 |
| 32 | Ga0070687_100060624 | 3300005343 | Bacteria | 1997 |
| 33 | Ga0070661_100013208 | 3300005344 | Bacteria | 5797 |
| 34 | Ga0070661_100022341 | 3300005344 | Bacteria | 4529 |
| 35 | Ga0070692_10063076 | 3300005345 | Bacteria | 1957 |
| 36 | Ga0070668_100002952 | 3300005347 | Bacteria | 12572 |
| 37 | Ga0070669_100003693 | 3300005353 | Bacteria | 11041 |
| 38 | Ga0070675_100008700 | 3300005354 | Bacteria | 7884 |
| 39 | Ga0070659_100001774 | 3300005366 | Bacteria | 15504 |
| 40 | Ga0070659_100047742 | 3300005366 | Bacteria | 3360 |
| 41 | Ga0070659_100141844 | 3300005366 | Bacteria | 1956 |
| 42 | Ga0070659_100180081 | 3300005366 | Unclassified | 1734 |
| 43 | Ga0070667_100016724 | 3300005367 | Bacteria | 6071 |
| 44 | Ga0070667_100102915 | 3300005367 | Bacteria | 2468 |
| 45 | Ga0070709_10005350 | 3300005434 | Bacteria | 6953 |
| 46 | Ga0070709_10007780 | 3300005434 | Bacteria | 5884 |
| 47 | Ga0070709_10010577 | 3300005434 | Bacteria | 5114 |
| 48 | Ga0070709_10014189 | 3300005434 | Bacteria | 4501 |
| 49 | Ga0070709_10060592 | 3300005434 | Bacteria | 2406 |
| 50 | Ga0070709_10099898 | 3300005434 | Unclassified | 1931 |
| 51 | Ga0070709_10159034 | 3300005434 | Unclassified | 1569 |
| 52 | Ga0070714_100000230 | 3300005435 | Bacteria | 44146 |
| 53 | Ga0070714_100015460 | 3300005435 | Bacteria | 6141 |
| 54 | Ga0070714_100064192 | 3300005435 | Unclassified | 3159 |
| 55 | Ga0070714_100344965 | 3300005435 | Bacteria | 1397 |
| 56 | Ga0070713_100001829 | 3300005436 | Bacteria | 13725 |
| 57 | Ga0070713_100002368 | 3300005436 | Bacteria | 12291 |
| 58 | Ga0070713_100004328 | 3300005436 | Bacteria | 9522 |
| 59 | Ga0070713_100014463 | 3300005436 | Bacteria | 5863 |
| 60 | Ga0070713_100021008 | 3300005436 | Bacteria | 5012 |
| 61 | Ga0070713_100035935 | 3300005436 | Unclassified | 3994 |
| 62 | Ga0070713_100072481 | 3300005436 | Bacteria | 2913 |
| 63 | Ga0070713_100099889 | 3300005436 | Bacteria | 2511 |
| 64 | Ga0070713_100114568 | 3300005436 | Bacteria | 2355 |
| 65 | Ga0070713_100278395 | 3300005436 | Unclassified | 1534 |
| 66 | Ga0070710_10011166 | 3300005437 | Bacteria | 4431 |
| 67 | Ga0070710_10023173 | 3300005437 | Bacteria | 3259 |
| 68 | Ga0070710_10041347 | 3300005437 | Bacteria | 2545 |
| 69 | Ga0070710_10067125 | 3300005437 | Bacteria | 2058 |
| 70 | Ga0070710_10069700 | 3300005437 | Bacteria | 2023 |
| 71 | Ga0070710_10089722 | 3300005437 | Bacteria | 1811 |
| 72 | Ga0070711_100000853 | 3300005439 | Bacteria | 16045 |
| 73 | Ga0070711_100003707 | 3300005439 | Bacteria | 8949 |
| 74 | Ga0070711_100006707 | 3300005439 | Bacteria | 6964 |
| 75 | Ga0070711_100028176 | 3300005439 | Bacteria | 3694 |
| 76 | Ga0070711_100052769 | 3300005439 | Bacteria | 2799 |
| 77 | Ga0070708_100001236 | 3300005445 | Bacteria | 19665 |
| 78 | Ga0070708_100001868 | 3300005445 | Bacteria | 16174 |
| 79 | Ga0070708_100003294 | 3300005445 | Bacteria | 12615 |
| 80 | Ga0070708_100006227 | 3300005445 | Bacteria | 9484 |
| 81 | Ga0070708_100007704 | 3300005445 | Bacteria | 8630 |
| 82 | Ga0070708_100009412 | 3300005445 | Bacteria | 7877 |
| 83 | Ga0070708_100020455 | 3300005445 | Bacteria | 5580 |
| 84 | Ga0070708_100026741 | 3300005445 | Bacteria | 4943 |
| 85 | Ga0070708_100056408 | 3300005445 | Unclassified | 3494 |
| 86 | Ga0070708_100089685 | 3300005445 | Bacteria | 2797 |
| 87 | Ga0070708_100109116 | 3300005445 | Unclassified | 2542 |
| 88 | Ga0070708_100133693 | 3300005445 | Bacteria | 2297 |
| 89 | Ga0070708_100249424 | 3300005445 | Bacteria | 1667 |
| 90 | Ga0070663_100029925 | 3300005455 | Bacteria | 3726 |
| 91 | Ga0070663_100285823 | 3300005455 | Bacteria | 1316 |
| 92 | Ga0070662_100003783 | 3300005457 | Bacteria | 9469 |
| 93 | Ga0070681_10001660 | 3300005458 | Bacteria | 19882 |
| 94 | Ga0070681_10004825 | 3300005458 | Bacteria | 12927 |
| 95 | Ga0070681_10015071 | 3300005458 | Bacteria | 7689 |
| 96 | Ga0070681_10025150 | 3300005458 | Bacteria | 5991 |
| 97 | Ga0070681_10029017 | 3300005458 | Bacteria | 5555 |
| 98 | Ga0070681_10037474 | 3300005458 | Bacteria | 4865 |
| 99 | Ga0070681_10043735 | 3300005458 | Bacteria | 4484 |
| 100 | Ga0070681_10065484 | 3300005458 | Bacteria | 3602 |
| 101 | Ga0070681_10080793 | 3300005458 | Bacteria | 3207 |
| 102 | Ga0070681_10183321 | 3300005458 | Bacteria | 2015 |
| 103 | Ga0070681_10279990 | 3300005458 | Bacteria | 1578 |
| 104 | Ga0068867_100013280 | 3300005459 | Bacteria | 5834 |
| 105 | Ga0068867_100072982 | 3300005459 | Unclassified | 2570 |
| 106 | Ga0070685_10015057 | 3300005466 | Bacteria | 4105 |
| 107 | Ga0070685_10039985 | 3300005466 | Unclassified | 2667 |
| 108 | Ga0070706_100001027 | 3300005467 | Bacteria | 30296 |
| 109 | Ga0070706_100028767 | 3300005467 | Bacteria | 5118 |
| 110 | Ga0070706_100037461 | 3300005467 | Bacteria | 4479 |
| 111 | Ga0070706_100089843 | 3300005467 | Bacteria | 2848 |
| 112 | Ga0070706_100121889 | 3300005467 | Unclassified | 2430 |
| 113 | Ga0070706_100299435 | 3300005467 | Bacteria | 1501 |
| 114 | Ga0070707_100001517 | 3300005468 | Bacteria | 22621 |
| 115 | Ga0070707_100004884 | 3300005468 | Bacteria | 12565 |
| 116 | Ga0070707_100039011 | 3300005468 | Bacteria | 4538 |
| 117 | Ga0070707_100068216 | 3300005468 | Unclassified | 3422 |
| 118 | Ga0070707_100165504 | 3300005468 | Unclassified | 2155 |
| 119 | Ga0070707_100192129 | 3300005468 | Bacteria | 1991 |
| 120 | Ga0070707_100291535 | 3300005468 | Bacteria | 1586 |
| 121 | Ga0070707_100401036 | 3300005468 | Bacteria | 1331 |
| 122 | Ga0070698_100000822 | 3300005471 | Bacteria | 33956 |
| 123 | Ga0070698_100071416 | 3300005471 | Unclassified | 3481 |
| 124 | Ga0070698_100071711 | 3300005471 | Bacteria | 3473 |
| 125 | Ga0070698_100108039 | 3300005471 | Bacteria | 2750 |
| 126 | Ga0070699_100000132 | 3300005518 | Bacteria | 69186 |
| 127 | Ga0070699_100005299 | 3300005518 | Bacteria | 11311 |
| 128 | Ga0070699_100053060 | 3300005518 | Bacteria | 3509 |
| 129 | Ga0070699_100307950 | 3300005518 | Unclassified | 1422 |
| 130 | Ga0070679_100015016 | 3300005530 | Bacteria | 7441 |
| 131 | Ga0070679_100015059 | 3300005530 | Bacteria | 7430 |
| 132 | Ga0070679_100026608 | 3300005530 | Bacteria | 5687 |
| 133 | Ga0070679_100063208 | 3300005530 | Bacteria | 3690 |
| 134 | Ga0070679_100099621 | 3300005530 | Bacteria | 2893 |
| 135 | Ga0070679_100214731 | 3300005530 | Bacteria | 1886 |
| 136 | Ga0070679_100226295 | 3300005530 | Unclassified | 1830 |
| 137 | Ga0070684_100001478 | 3300005535 | Bacteria | 16951 |
| 138 | Ga0070684_100019101 | 3300005535 | Bacteria | 5665 |
| 139 | Ga0070684_100022812 | 3300005535 | Bacteria | 5226 |
| 140 | Ga0070697_100000124 | 3300005536 | Bacteria | 61236 |
| 141 | Ga0070697_100001757 | 3300005536 | Bacteria | 16539 |
| 142 | Ga0070697_100002074 | 3300005536 | Bacteria | 15321 |
| 143 | Ga0070697_100009348 | 3300005536 | Bacteria | 7661 |
| 144 | Ga0070697_100047734 | 3300005536 | Unclassified | 3471 |
| 145 | Ga0070697_100085042 | 3300005536 | Bacteria | 2610 |
| 146 | Ga0070697_100100092 | 3300005536 | Bacteria | 2407 |
| 147 | Ga0070697_100104297 | 3300005536 | Unclassified | 2357 |
| 148 | Ga0068853_100000037 | 3300005539 | Bacteria | 108329 |
| 149 | Ga0068853_100056031 | 3300005539 | Bacteria | 3398 |
| 150 | Ga0068853_100239117 | 3300005539 | Bacteria | 1664 |
| 151 | Ga0068853_100368596 | 3300005539 | Bacteria | 1339 |
| 152 | Ga0070686_100036911 | 3300005544 | Bacteria | 3028 |
| 153 | Ga0070695_100072842 | 3300005545 | Unclassified | 2253 |
| 154 | Ga0070696_100016775 | 3300005546 | Bacteria | 4941 |
| 155 | Ga0070696_100077242 | 3300005546 | Bacteria | 2353 |
| 156 | Ga0070693_100196767 | 3300005547 | Bacteria | 1307 |
| 157 | Ga0070665_100018526 | 3300005548 | Bacteria | 6977 |
| 158 | Ga0070665_100278789 | 3300005548 | Bacteria | 1673 |
| 159 | Ga0070704_100023033 | 3300005549 | Bacteria | 4060 |
| 160 | Ga0068855_100001040 | 3300005563 | Bacteria | 34520 |
| 161 | Ga0068855_100008242 | 3300005563 | Bacteria | 12597 |
| 162 | Ga0068855_100021781 | 3300005563 | Bacteria | 7687 |
| 163 | Ga0068855_100048418 | 3300005563 | Bacteria | 5016 |
| 164 | Ga0068855_100052813 | 3300005563 | Bacteria | 4784 |
| 165 | Ga0068855_100171575 | 3300005563 | Unclassified | 2456 |
| 166 | Ga0068855_100185937 | 3300005563 | Bacteria | 2346 |
| 167 | Ga0070664_100002133 | 3300005564 | Bacteria | 15847 |
| 168 | Ga0070664_100047668 | 3300005564 | Bacteria | 3620 |
| 169 | Ga0068857_100008259 | 3300005577 | Bacteria | 8995 |
| 170 | Ga0068857_100010504 | 3300005577 | Bacteria | 8047 |
| 171 | Ga0068854_100000033 | 3300005578 | Bacteria | 105647 |
| 172 | Ga0068854_100008660 | 3300005578 | Bacteria | 6549 |
| 173 | Ga0068854_100009406 | 3300005578 | Bacteria | 6311 |
| 174 | Ga0068854_100013918 | 3300005578 | Bacteria | 5292 |
| 175 | Ga0068854_100022767 | 3300005578 | Bacteria | 4274 |
| 176 | Ga0068854_100188415 | 3300005578 | Unclassified | 1615 |
| 177 | Ga0068856_100002913 | 3300005614 | Bacteria | 17522 |
| 178 | Ga0068856_100003671 | 3300005614 | Bacteria | 15394 |
| 179 | Ga0068856_100004326 | 3300005614 | Bacteria | 14169 |
| 180 | Ga0068856_100017943 | 3300005614 | Bacteria | 6861 |
| 181 | Ga0068856_100081233 | 3300005614 | Bacteria | 3216 |
| 182 | Ga0068856_100338431 | 3300005614 | Bacteria | 1523 |
| 183 | Ga0068856_100402010 | 3300005614 | Bacteria | 1389 |
| 184 | Ga0070702_100058774 | 3300005615 | Bacteria | 2229 |
| 185 | Ga0070702_100059105 | 3300005615 | Bacteria | 2223 |
| 186 | Ga0068852_100027695 | 3300005616 | Bacteria | 4622 |
| 187 | Ga0068852_100064376 | 3300005616 | Bacteria | 3196 |
| 188 | Ga0068852_100078716 | 3300005616 | Bacteria | 2917 |
| 189 | Ga0068852_100145987 | 3300005616 | Bacteria | 2194 |
| 190 | Ga0068852_100207791 | 3300005616 | Bacteria | 1856 |
| 191 | Ga0068852_100306362 | 3300005616 | Unclassified | 1539 |
| 192 | Ga0068852_100362686 | 3300005616 | Bacteria | 1418 |
| 193 | Ga0068852_100489488 | 3300005616 | Bacteria | 1223 |
| 194 | Ga0068859_100000033 | 3300005617 | Bacteria | 172869 |
| 195 | Ga0068859_100002934 | 3300005617 | Bacteria | 17324 |
| 196 | Ga0068859_100003344 | 3300005617 | Bacteria | 16313 |
| 197 | Ga0068864_100005210 | 3300005618 | Bacteria | 10654 |
| 198 | Ga0068864_100007227 | 3300005618 | Bacteria | 9125 |
| 199 | Ga0068866_10001612 | 3300005718 | Bacteria | 9561 |
| 200 | Ga0068866_10057988 | 3300005718 | Bacteria | 1998 |
| 201 | Ga0068851_10015181 | 3300005834 | Bacteria | 3666 |
| 202 | Ga0068870_10040515 | 3300005840 | Bacteria | 2416 |
| 203 | Ga0068863_100057530 | 3300005841 | Unclassified | 3680 |
| 204 | Ga0068863_100133922 | 3300005841 | Bacteria | 2367 |
| 205 | Ga0068858_100000231 | 3300005842 | Bacteria | 60174 |
| 206 | Ga0068858_100030966 | 3300005842 | Bacteria | 4969 |
| 207 | Ga0068858_100046492 | 3300005842 | Bacteria | 4023 |
| 208 | Ga0068858_100145915 | 3300005842 | Bacteria | 2222 |
| 209 | Ga0068860_100032528 | 3300005843 | Bacteria | 5010 |
| 210 | Ga0068860_100084794 | 3300005843 | Bacteria | 3013 |
| 211 | Ga0068860_100133300 | 3300005843 | Bacteria | 2385 |
| 212 | Ga0068862_100006541 | 3300005844 | Bacteria | 9672 |
| 213 | Ga0068862_100120387 | 3300005844 | Bacteria | 2313 |
| 214 | Ga0081538_10011454 | 3300005981 | Bacteria | 7182 |
| 215 | Ga0081538_10014162 | 3300005981 | Bacteria | 6265 |
| 216 | Ga0081538_10053514 | 3300005981 | Bacteria | 2399 |
| 217 | Ga0081540_1011204 | 3300005983 | Bacteria | 6012 |
| 218 | Ga0070717_10005131 | 3300006028 | Bacteria | 9551 |
| 219 | Ga0070717_10006272 | 3300006028 | Bacteria | 8733 |
| 220 | Ga0070717_10017409 | 3300006028 | Bacteria | 5592 |
| 221 | Ga0070717_10025624 | 3300006028 | Bacteria | 4693 |
| 222 | Ga0070717_10055041 | 3300006028 | Bacteria | 3282 |
| 223 | Ga0070717_10092640 | 3300006028 | Unclassified | 2553 |
| 224 | Ga0070717_10110458 | 3300006028 | Bacteria | 2345 |
| 225 | Ga0070717_10205012 | 3300006028 | Bacteria | 1729 |
| 226 | Ga0070717_10214419 | 3300006028 | Bacteria | 1690 |
| 227 | Ga0070717_10299424 | 3300006028 | Bacteria | 1430 |
| 228 | Ga0070715_10001303 | 3300006163 | Bacteria | 7171 |
| 229 | Ga0070715_10001715 | 3300006163 | Bacteria | 6515 |
| 230 | Ga0070715_10011808 | 3300006163 | Bacteria | 3156 |
| 231 | Ga0070716_100000452 | 3300006173 | Bacteria | 16970 |
| 232 | Ga0070716_100009209 | 3300006173 | Bacteria | 4918 |
| 233 | Ga0070716_100131101 | 3300006173 | Bacteria | 1585 |
| 234 | Ga0070712_100001256 | 3300006175 | Bacteria | 15333 |
| 235 | Ga0070712_100001507 | 3300006175 | Bacteria | 14198 |
| 236 | Ga0070712_100001608 | 3300006175 | Bacteria | 13807 |
| 237 | Ga0070712_100005436 | 3300006175 | Bacteria | 7888 |
| 238 | Ga0070712_100006793 | 3300006175 | Bacteria | 7120 |
| 239 | Ga0070712_100008495 | 3300006175 | Bacteria | 6458 |
| 240 | Ga0070712_100024297 | 3300006175 | Bacteria | 4014 |
| 241 | Ga0097621_100001938 | 3300006237 | Bacteria | 14120 |
| 242 | Ga0097621_100002920 | 3300006237 | Bacteria | 11745 |
| 243 | Ga0097621_100002940 | 3300006237 | Bacteria | 11708 |
| 244 | Ga0097621_100018133 | 3300006237 | Bacteria | 5368 |
| 245 | Ga0068871_100000486 | 3300006358 | Bacteria | 27151 |
| 246 | Ga0068871_100004726 | 3300006358 | Bacteria | 9529 |
| 247 | Ga0068871_100007176 | 3300006358 | Bacteria | 7948 |
| 248 | Ga0068871_100035453 | 3300006358 | Bacteria | 3965 |
| 249 | Ga0068871_100037824 | 3300006358 | Bacteria | 3851 |
| 250 | Ga0068871_100090482 | 3300006358 | Bacteria | 2549 |
| 251 | Ga0068871_100183082 | 3300006358 | Bacteria | 1801 |
| 252 | Ga0068871_100393766 | 3300006358 | Unclassified | 1233 |
| 253 | Ga0075431_100365843 | 3300006847 | Bacteria | 1448 |
| 254 | Ga0075434_100020485 | 3300006871 | Bacteria | 6416 |
| 255 | Ga0075434_100094472 | 3300006871 | Bacteria | 2995 |
| 256 | Ga0068865_100015548 | 3300006881 | Bacteria | 4854 |
| 257 | Ga0068865_100062392 | 3300006881 | Bacteria | 2616 |
| 258 | Ga0068865_100098197 | 3300006881 | Bacteria | 2139 |
| 259 | Ga0068865_100107932 | 3300006881 | Bacteria | 2048 |
| 260 | Ga0068865_100139110 | 3300006881 | Bacteria | 1829 |
| 261 | Ga0075436_100002558 | 3300006914 | Bacteria | 12524 |
| 262 | Ga0075436_100010271 | 3300006914 | Bacteria | 6410 |
| 263 | Ga0075436_100025900 | 3300006914 | Bacteria | 4037 |
| 264 | Ga0075436_100053075 | 3300006914 | Bacteria | 2798 |
| 265 | Ga0075436_100150972 | 3300006914 | Bacteria | 1635 |
| 266 | Ga0097620_100000033 | 3300006931 | Bacteria | 172869 |
| 267 | Ga0097620_100002934 | 3300006931 | Bacteria | 17324 |
| 268 | Ga0097620_100003344 | 3300006931 | Bacteria | 16313 |
| 269 | Ga0075435_100006189 | 3300007076 | Bacteria | 8442 |
| 270 | Ga0099795_10003515 | 3300007788 | Bacteria | 3891 |
| 271 | Ga0105240_10002547 | 3300009093 | Bacteria | 29224 |
| 272 | Ga0105240_10011585 | 3300009093 | Bacteria | 12270 |
| 273 | Ga0105240_10025905 | 3300009093 | Bacteria | 7701 |
| 274 | Ga0105240_10029156 | 3300009093 | Bacteria | 7196 |
| 275 | Ga0105240_10042044 | 3300009093 | Bacteria | 5827 |
| 276 | Ga0105240_10061795 | 3300009093 | Bacteria | 4667 |
| 277 | Ga0105240_10062461 | 3300009093 | Unclassified | 4637 |
| 278 | Ga0111539_10159041 | 3300009094 | Bacteria | 2643 |
| 279 | Ga0105245_10004753 | 3300009098 | Bacteria | 11990 |
| 280 | Ga0105245_10005718 | 3300009098 | Bacteria | 10920 |
| 281 | Ga0105245_10013541 | 3300009098 | Bacteria | 7103 |
| 282 | Ga0105245_10095823 | 3300009098 | Bacteria | 2738 |
| 283 | Ga0105247_10002535 | 3300009101 | Bacteria | 12400 |
| 284 | Ga0105247_10073600 | 3300009101 | Bacteria | 2141 |
| 285 | Ga0114129_10166826 | 3300009147 | Unclassified | 3004 |
| 286 | Ga0105243_10124235 | 3300009148 | Bacteria | 2180 |
| 287 | Ga0105241_10010670 | 3300009174 | Bacteria | 6739 |
| 288 | Ga0105241_10015408 | 3300009174 | Bacteria | 5598 |
| 289 | Ga0105241_10016057 | 3300009174 | Bacteria | 5489 |
| 290 | Ga0105241_10021542 | 3300009174 | Bacteria | 4766 |
| 291 | Ga0105241_10025045 | 3300009174 | Bacteria | 4434 |
| 292 | Ga0105241_10067128 | 3300009174 | Bacteria | 2776 |
| 293 | Ga0105241_10271480 | 3300009174 | Unclassified | 1445 |
| 294 | Ga0105242_10016491 | 3300009176 | Bacteria | 5744 |
| 295 | Ga0105242_10269628 | 3300009176 | Bacteria | 1541 |
| 296 | Ga0105248_10006181 | 3300009177 | Bacteria | 13124 |
| 297 | Ga0105248_10014835 | 3300009177 | Bacteria | 8582 |
| 298 | Ga0105248_10035273 | 3300009177 | Bacteria | 5595 |
| 299 | Ga0105248_10206362 | 3300009177 | Bacteria | 2214 |
| 300 | Ga0105248_10224396 | 3300009177 | Unclassified | 2115 |
| 301 | Ga0105237_10006540 | 3300009545 | Bacteria | 12890 |
| 302 | Ga0105237_10010441 | 3300009545 | Bacteria | 9876 |
| 303 | Ga0105237_10016823 | 3300009545 | Bacteria | 7591 |
| 304 | Ga0105237_10111196 | 3300009545 | Unclassified | 2731 |
| 305 | Ga0105237_10123375 | 3300009545 | Bacteria | 2585 |
| 306 | Ga0105237_10241614 | 3300009545 | Bacteria | 1807 |
| 307 | Ga0105237_10368531 | 3300009545 | Bacteria | 1441 |
| 308 | Ga0105238_10001815 | 3300009551 | Bacteria | 21408 |
| 309 | Ga0105238_10016889 | 3300009551 | Bacteria | 7405 |
| 310 | Ga0105238_10042543 | 3300009551 | Unclassified | 4599 |
| 311 | Ga0105238_10054425 | 3300009551 | Bacteria | 4018 |
| 312 | Ga0105238_10079079 | 3300009551 | Bacteria | 3278 |
| 313 | Ga0105238_10319411 | 3300009551 | Bacteria | 1538 |
| 314 | Ga0105249_10004362 | 3300009553 | Bacteria | 12232 |
| 315 | Ga0105249_10052427 | 3300009553 | Bacteria | 3725 |
| 316 | Ga0099796_10009816 | 3300010159 | Bacteria | 2606 |
| 317 | Ga0105239_10012680 | 3300010375 | Bacteria | 9377 |
| 318 | Ga0105239_10219030 | 3300010375 | Bacteria | 2134 |
| 319 | Ga0105239_10424000 | 3300010375 | Bacteria | 1507 |
| 320 | Ga0105246_10032222 | 3300011119 | Bacteria | 3475 |
| 321 | Ga0105246_10051038 | 3300011119 | Bacteria | 2839 |
| 322 | Ga0157373_10004970 | 3300013100 | Bacteria | 9992 |
| 323 | Ga0157373_10025405 | 3300013100 | Bacteria | 4285 |
| 324 | Ga0157373_10028127 | 3300013100 | Bacteria | 4056 |
| 325 | Ga0157373_10059034 | 3300013100 | Bacteria | 2718 |
| 326 | Ga0157373_10238716 | 3300013100 | Bacteria | 1285 |
| 327 | Ga0157371_10008726 | 3300013102 | Bacteria | 8045 |
| 328 | Ga0157371_10010962 | 3300013102 | Bacteria | 7026 |
| 329 | Ga0157371_10105234 | 3300013102 | Bacteria | 2002 |
| 330 | Ga0157370_10010916 | 3300013104 | Bacteria | 9538 |
| 331 | Ga0157370_10091105 | 3300013104 | Bacteria | 2863 |
| 332 | Ga0157370_10174924 | 3300013104 | Bacteria | 1995 |
| 333 | Ga0157369_10000300 | 3300013105 | Bacteria | 66166 |
| 334 | Ga0157369_10002843 | 3300013105 | Bacteria | 20667 |
| 335 | Ga0157369_10029189 | 3300013105 | Bacteria | 6098 |
| 336 | Ga0157369_10031833 | 3300013105 | Bacteria | 5804 |
| 337 | Ga0157369_10072894 | 3300013105 | Bacteria | 3685 |
| 338 | Ga0157369_10081084 | 3300013105 | Bacteria | 3473 |
| 339 | Ga0157369_10172108 | 3300013105 | Bacteria | 2281 |
| 340 | Ga0157369_10189975 | 3300013105 | Unclassified | 2158 |
| 341 | Ga0157369_10301322 | 3300013105 | Bacteria | 1667 |
| 342 | Ga0157374_10002248 | 3300013296 | Bacteria | 16256 |
| 343 | Ga0157374_10002617 | 3300013296 | Bacteria | 15184 |
| 344 | Ga0157374_10015624 | 3300013296 | Bacteria | 6664 |
| 345 | Ga0157374_10019485 | 3300013296 | Bacteria | 6004 |
| 346 | Ga0157374_10023556 | 3300013296 | Bacteria | 5509 |
| 347 | Ga0157374_10050863 | 3300013296 | Bacteria | 3853 |
| 348 | Ga0157374_10058827 | 3300013296 | Bacteria | 3592 |
| 349 | Ga0157374_10230224 | 3300013296 | Bacteria | 1820 |
| 350 | Ga0157374_10272348 | 3300013296 | Bacteria | 1670 |
| 351 | Ga0157378_10000532 | 3300013297 | Bacteria | 36169 |
| 352 | Ga0157378_10001506 | 3300013297 | Bacteria | 21092 |
| 353 | Ga0157378_10006631 | 3300013297 | Bacteria | 10119 |
| 354 | Ga0157378_10052854 | 3300013297 | Bacteria | 3615 |
| 355 | Ga0157378_10065433 | 3300013297 | Bacteria | 3254 |
| 356 | Ga0157378_10095798 | 3300013297 | Bacteria | 2704 |
| 357 | Ga0157378_10110162 | 3300013297 | Bacteria | 2523 |
| 358 | Ga0163162_10000661 | 3300013306 | Bacteria | 31916 |
| 359 | Ga0163162_10003102 | 3300013306 | Bacteria | 15861 |
| 360 | Ga0163162_10004705 | 3300013306 | Bacteria | 13161 |
| 361 | Ga0163162_10189242 | 3300013306 | Bacteria | 2185 |
| 362 | Ga0163162_10256934 | 3300013306 | Bacteria | 1879 |
| 363 | Ga0157372_10000282 | 3300013307 | Bacteria | 56474 |
| 364 | Ga0157372_10002600 | 3300013307 | Bacteria | 19545 |
| 365 | Ga0157372_10002936 | 3300013307 | Bacteria | 18395 |
| 366 | Ga0157372_10004156 | 3300013307 | Bacteria | 15491 |
| 367 | Ga0157372_10012590 | 3300013307 | Bacteria | 9008 |
| 368 | Ga0157372_10013627 | 3300013307 | Bacteria | 8688 |
| 369 | Ga0157372_10019219 | 3300013307 | Bacteria | 7357 |
| 370 | Ga0157372_10022103 | 3300013307 | Bacteria | 6880 |
| 371 | Ga0157372_10049067 | 3300013307 | Bacteria | 4693 |
| 372 | Ga0157372_10243736 | 3300013307 | Unclassified | 2086 |
| 373 | Ga0157375_10013927 | 3300013308 | Bacteria | 7170 |
| 374 | Ga0163163_10002219 | 3300014325 | Bacteria | 16344 |
| 375 | Ga0163163_10018353 | 3300014325 | Bacteria | 6546 |
| 376 | Ga0157380_10061173 | 3300014326 | Bacteria | 3012 |
| 377 | Ga0182008_10010743 | 3300014497 | Unclassified | 4892 |
| 378 | Ga0157379_10006386 | 3300014968 | Bacteria | 10154 |
| 379 | Ga0157379_10108889 | 3300014968 | Bacteria | 2488 |
| 380 | Ga0157376_10024100 | 3300014969 | Unclassified | 4773 |
| 381 | Ga0157376_10308334 | 3300014969 | Bacteria | 1501 |
| 382 | Ga0182006_1021302 | 3300015261 | Unclassified | 2704 |
| 383 | Ga0182007_10004386 | 3300015262 | Bacteria | 6405 |
| 384 | Ga0163161_10000643 | 3300017792 | Bacteria | 27887 |
| 385 | Ga0213874_10002144 | 3300021377 | Bacteria | 4189 |
| 386 | Ga0224570_100894 | 3300022730 | Bacteria | 2368 |
| 387 | Ga0224569_100300 | 3300022732 | Bacteria | 4139 |
| 388 | Ga0224572_1008666 | 3300024225 | Bacteria | 1884 |
| 389 | Ga0228598_1001285 | 3300024227 | Bacteria | 5520 |
| 390 | Ga0207656_10016535 | 3300025321 | Bacteria | 2873 |
| 391 | Ga0207692_10009693 | 3300025898 | Bacteria | 4032 |
| 392 | Ga0207692_10018779 | 3300025898 | Bacteria | 3111 |
| 393 | Ga0207692_10176548 | 3300025898 | Bacteria | 1242 |
| 394 | Ga0207642_10009662 | 3300025899 | Bacteria | 3366 |
| 395 | Ga0207642_10016834 | 3300025899 | Unclassified | 2765 |
| 396 | Ga0207642_10018490 | 3300025899 | Bacteria | 2676 |
| 397 | Ga0207642_10047143 | 3300025899 | Unclassified | 1925 |
| 398 | Ga0207688_10189705 | 3300025901 | Bacteria | 1229 |
| 399 | Ga0207680_10016488 | 3300025903 | Bacteria | 3879 |
| 400 | Ga0207647_10002745 | 3300025904 | Bacteria | 13286 |
| 401 | Ga0207647_10003491 | 3300025904 | Bacteria | 11788 |
| 402 | Ga0207685_10002829 | 3300025905 | Bacteria | 4075 |
| 403 | Ga0207699_10003324 | 3300025906 | Bacteria | 7667 |
| 404 | Ga0207699_10011770 | 3300025906 | Bacteria | 4431 |
| 405 | Ga0207699_10028174 | 3300025906 | Bacteria | 3119 |
| 406 | Ga0207699_10137136 | 3300025906 | Unclassified | 1604 |
| 407 | Ga0207699_10153623 | 3300025906 | Bacteria | 1525 |
| 408 | Ga0207699_10160927 | 3300025906 | Bacteria | 1494 |
| 409 | Ga0207645_10067112 | 3300025907 | Bacteria | 2293 |
| 410 | Ga0207645_10153156 | 3300025907 | Unclassified | 1506 |
| 411 | Ga0207643_10022301 | 3300025908 | Bacteria | 3485 |
| 412 | Ga0207705_10192255 | 3300025909 | Bacteria | 1544 |
| 413 | Ga0207684_10004409 | 3300025910 | Bacteria | 13259 |
| 414 | Ga0207684_10019417 | 3300025910 | Bacteria | 5817 |
| 415 | Ga0207684_10024082 | 3300025910 | Bacteria | 5194 |
| 416 | Ga0207684_10031935 | 3300025910 | Bacteria | 4480 |
| 417 | Ga0207684_10056542 | 3300025910 | Unclassified | 3328 |
| 418 | Ga0207684_10260967 | 3300025910 | Bacteria | 1495 |
| 419 | Ga0207684_10299446 | 3300025910 | Bacteria | 1386 |
| 420 | Ga0207654_10004737 | 3300025911 | Bacteria | 6886 |
| 421 | Ga0207654_10015966 | 3300025911 | Bacteria | 3905 |
| 422 | Ga0207654_10020770 | 3300025911 | Bacteria | 3487 |
| 423 | Ga0207654_10057178 | 3300025911 | Bacteria | 2266 |
| 424 | Ga0207707_10014891 | 3300025912 | Bacteria | 6773 |
| 425 | Ga0207707_10026426 | 3300025912 | Bacteria | 5074 |
| 426 | Ga0207707_10027675 | 3300025912 | Bacteria | 4957 |
| 427 | Ga0207707_10085534 | 3300025912 | Bacteria | 2755 |
| 428 | Ga0207707_10087837 | 3300025912 | Bacteria | 2716 |
| 429 | Ga0207707_10102596 | 3300025912 | Bacteria | 2500 |
| 430 | Ga0207707_10126789 | 3300025912 | Bacteria | 2232 |
| 431 | Ga0207707_10135761 | 3300025912 | Bacteria | 2151 |
| 432 | Ga0207695_10006448 | 3300025913 | Bacteria | 15237 |
| 433 | Ga0207695_10010387 | 3300025913 | Bacteria | 11391 |
| 434 | Ga0207695_10012954 | 3300025913 | Bacteria | 9969 |
| 435 | Ga0207695_10029044 | 3300025913 | Bacteria | 6119 |
| 436 | Ga0207695_10036849 | 3300025913 | Bacteria | 5282 |
| 437 | Ga0207695_10038078 | 3300025913 | Bacteria | 5183 |
| 438 | Ga0207695_10111607 | 3300025913 | Bacteria | 2713 |
| 439 | Ga0207695_10162095 | 3300025913 | Bacteria | 2167 |
| 440 | Ga0207695_10386953 | 3300025913 | Bacteria | 1284 |
| 441 | Ga0207671_10011449 | 3300025914 | Bacteria | 7221 |
| 442 | Ga0207671_10145609 | 3300025914 | Bacteria | 1827 |
| 443 | Ga0207671_10245044 | 3300025914 | Bacteria | 1408 |
| 444 | Ga0207693_10000013 | 3300025915 | Bacteria | 154365 |
| 445 | Ga0207693_10000304 | 3300025915 | Bacteria | 45833 |
| 446 | Ga0207693_10003018 | 3300025915 | Bacteria | 14556 |
| 447 | Ga0207693_10005944 | 3300025915 | Bacteria | 10128 |
| 448 | Ga0207693_10053324 | 3300025915 | Bacteria | 3173 |
| 449 | Ga0207693_10123031 | 3300025915 | Unclassified | 2038 |
| 450 | Ga0207693_10177635 | 3300025915 | Bacteria | 1675 |
| 451 | Ga0207663_10012437 | 3300025916 | Unclassified | 4602 |
| 452 | Ga0207663_10015375 | 3300025916 | Bacteria | 4221 |
| 453 | Ga0207663_10024839 | 3300025916 | Bacteria | 3456 |
| 454 | Ga0207663_10060712 | 3300025916 | Bacteria | 2397 |
| 455 | Ga0207663_10081116 | 3300025916 | Bacteria | 2123 |
| 456 | Ga0207660_10000297 | 3300025917 | Bacteria | 32914 |
| 457 | Ga0207660_10026730 | 3300025917 | Bacteria | 3932 |
| 458 | Ga0207660_10042428 | 3300025917 | Bacteria | 3193 |
| 459 | Ga0207660_10154570 | 3300025917 | Bacteria | 1765 |
| 460 | Ga0207660_10283891 | 3300025917 | Bacteria | 1314 |
| 461 | Ga0207662_10007835 | 3300025918 | Bacteria | 5820 |
| 462 | Ga0207657_10001110 | 3300025919 | Bacteria | 28585 |
| 463 | Ga0207657_10002518 | 3300025919 | Bacteria | 19813 |
| 464 | Ga0207657_10006370 | 3300025919 | Bacteria | 12259 |
| 465 | Ga0207657_10044099 | 3300025919 | Bacteria | 3923 |
| 466 | Ga0207657_10094271 | 3300025919 | Bacteria | 2493 |
| 467 | Ga0207649_10008330 | 3300025920 | Bacteria | 5650 |
| 468 | Ga0207649_10038935 | 3300025920 | Bacteria | 2881 |
| 469 | Ga0207652_10011210 | 3300025921 | Bacteria | 7221 |
| 470 | Ga0207652_10020366 | 3300025921 | Bacteria | 5461 |
| 471 | Ga0207652_10027282 | 3300025921 | Bacteria | 4757 |
| 472 | Ga0207652_10052367 | 3300025921 | Bacteria | 3503 |
| 473 | Ga0207646_10000194 | 3300025922 | Bacteria | 82991 |
| 474 | Ga0207646_10000438 | 3300025922 | Bacteria | 55782 |
| 475 | Ga0207646_10002543 | 3300025922 | Bacteria | 21532 |
| 476 | Ga0207646_10044144 | 3300025922 | Bacteria | 4001 |
| 477 | Ga0207646_10161287 | 3300025922 | Bacteria | 2023 |
| 478 | Ga0207646_10274326 | 3300025922 | Bacteria | 1524 |
| 479 | Ga0207681_10061641 | 3300025923 | Bacteria | 2579 |
| 480 | Ga0207694_10002726 | 3300025924 | Bacteria | 14284 |
| 481 | Ga0207694_10063235 | 3300025924 | Bacteria | 2883 |
| 482 | Ga0207694_10236048 | 3300025924 | Bacteria | 1494 |
| 483 | Ga0207650_10000155 | 3300025925 | Bacteria | 82859 |
| 484 | Ga0207650_10058532 | 3300025925 | Bacteria | 2869 |
| 485 | Ga0207650_10146490 | 3300025925 | Bacteria | 1860 |
| 486 | Ga0207659_10035794 | 3300025926 | Bacteria | 3434 |
| 487 | Ga0207659_10167216 | 3300025926 | Bacteria | 1732 |
| 488 | Ga0207687_10006362 | 3300025927 | Bacteria | 7804 |
| 489 | Ga0207687_10009622 | 3300025927 | Bacteria | 6318 |
| 490 | Ga0207687_10074646 | 3300025927 | Bacteria | 2431 |
| 491 | Ga0207687_10187666 | 3300025927 | Bacteria | 1606 |
| 492 | Ga0207700_10001442 | 3300025928 | Bacteria | 13496 |
| 493 | Ga0207700_10002926 | 3300025928 | Bacteria | 9850 |
| 494 | Ga0207700_10003515 | 3300025928 | Bacteria | 9128 |
| 495 | Ga0207700_10004676 | 3300025928 | Bacteria | 8108 |
| 496 | Ga0207700_10041156 | 3300025928 | Bacteria | 3379 |
| 497 | Ga0207700_10055668 | 3300025928 | Bacteria | 2974 |
| 498 | Ga0207700_10084381 | 3300025928 | Unclassified | 2490 |
| 499 | Ga0207700_10131786 | 3300025928 | Bacteria | 2042 |
| 500 | Ga0207700_10309336 | 3300025928 | Bacteria | 1366 |
| 501 | Ga0207700_10321106 | 3300025928 | Unclassified | 1342 |
| 502 | Ga0207664_10000236 | 3300025929 | Bacteria | 41929 |
| 503 | Ga0207664_10020593 | 3300025929 | Bacteria | 4892 |
| 504 | Ga0207664_10039149 | 3300025929 | Unclassified | 3680 |
| 505 | Ga0207664_10062377 | 3300025929 | Bacteria | 2977 |
| 506 | Ga0207664_10074102 | 3300025929 | Bacteria | 2749 |
| 507 | Ga0207664_10100369 | 3300025929 | Bacteria | 2390 |
| 508 | Ga0207664_10180529 | 3300025929 | Unclassified | 1812 |
| 509 | Ga0207664_10267852 | 3300025929 | Bacteria | 1496 |
| 510 | Ga0207664_10383132 | 3300025929 | Bacteria | 1249 |
| 511 | Ga0207644_10144761 | 3300025931 | Bacteria | 1834 |
| 512 | Ga0207690_10011394 | 3300025932 | Bacteria | 5318 |
| 513 | Ga0207690_10011497 | 3300025932 | Bacteria | 5291 |
| 514 | Ga0207706_10002659 | 3300025933 | Bacteria | 17394 |
| 515 | Ga0207706_10117637 | 3300025933 | Bacteria | 2337 |
| 516 | Ga0207706_10154715 | 3300025933 | Bacteria | 2017 |
| 517 | Ga0207706_10224380 | 3300025933 | Bacteria | 1645 |
| 518 | Ga0207709_10146862 | 3300025935 | Bacteria | 1628 |
| 519 | Ga0207704_10008613 | 3300025938 | Bacteria | 4886 |
| 520 | Ga0207704_10031737 | 3300025938 | Bacteria | 2980 |
| 521 | Ga0207704_10053412 | 3300025938 | Bacteria | 2456 |
| 522 | Ga0207665_10000300 | 3300025939 | Bacteria | 34180 |
| 523 | Ga0207665_10000962 | 3300025939 | Bacteria | 19516 |
| 524 | Ga0207665_10019196 | 3300025939 | Bacteria | 4492 |
| 525 | Ga0207665_10021434 | 3300025939 | Bacteria | 4249 |
| 526 | Ga0207665_10061163 | 3300025939 | Bacteria | 2552 |
| 527 | Ga0207665_10128839 | 3300025939 | Bacteria | 1794 |
| 528 | Ga0207665_10220885 | 3300025939 | Unclassified | 1388 |
| 529 | Ga0207665_10259687 | 3300025939 | Bacteria | 1286 |
| 530 | Ga0207711_10000892 | 3300025941 | Bacteria | 28721 |
| 531 | Ga0207711_10154254 | 3300025941 | Unclassified | 2074 |
| 532 | Ga0207711_10385628 | 3300025941 | Unclassified | 1301 |
| 533 | Ga0207689_10010511 | 3300025942 | Bacteria | 7970 |
| 534 | Ga0207689_10011197 | 3300025942 | Bacteria | 7696 |
| 535 | Ga0207661_10002010 | 3300025944 | Bacteria | 14012 |
| 536 | Ga0207661_10008828 | 3300025944 | Bacteria | 7213 |
| 537 | Ga0207661_10019265 | 3300025944 | Bacteria | 5084 |
| 538 | Ga0207661_10036433 | 3300025944 | Bacteria | 3840 |
| 539 | Ga0207661_10150762 | 3300025944 | Bacteria | 2009 |
| 540 | Ga0207679_10000106 | 3300025945 | Bacteria | 68506 |
| 541 | Ga0207679_10006373 | 3300025945 | Bacteria | 7456 |
| 542 | Ga0207679_10126932 | 3300025945 | Bacteria | 2040 |
| 543 | Ga0207667_10004320 | 3300025949 | Bacteria | 17402 |
| 544 | Ga0207667_10004960 | 3300025949 | Bacteria | 16259 |
| 545 | Ga0207667_10005735 | 3300025949 | Bacteria | 15149 |
| 546 | Ga0207667_10022702 | 3300025949 | Bacteria | 6922 |
| 547 | Ga0207667_10032158 | 3300025949 | Bacteria | 5656 |
| 548 | Ga0207667_10172219 | 3300025949 | Bacteria | 2225 |
| 549 | Ga0207667_10209862 | 3300025949 | Bacteria | 1996 |
| 550 | Ga0207667_10308249 | 3300025949 | Unclassified | 1617 |
| 551 | Ga0207651_10001643 | 3300025960 | Bacteria | 10271 |
| 552 | Ga0207651_10012487 | 3300025960 | Bacteria | 4811 |
| 553 | Ga0207712_10010691 | 3300025961 | Bacteria | 5829 |
| 554 | Ga0207668_10017235 | 3300025972 | Bacteria | 4521 |
| 555 | Ga0207640_10000001 | 3300025981 | Bacteria | 628778 |
| 556 | Ga0207640_10006049 | 3300025981 | Bacteria | 6615 |
| 557 | Ga0207640_10031466 | 3300025981 | Bacteria | 3279 |
| 558 | Ga0207640_10227764 | 3300025981 | Unclassified | 1432 |
| 559 | Ga0207658_10002109 | 3300025986 | Bacteria | 14801 |
| 560 | Ga0207658_10055739 | 3300025986 | Bacteria | 2931 |
| 561 | Ga0207677_10003082 | 3300026023 | Bacteria | 8798 |
| 562 | Ga0207677_10005897 | 3300026023 | Bacteria | 6666 |
| 563 | Ga0207677_10019289 | 3300026023 | Unclassified | 4116 |
| 564 | Ga0207677_10041494 | 3300026023 | Unclassified | 3043 |
| 565 | Ga0207677_10143506 | 3300026023 | Bacteria | 1832 |
| 566 | Ga0207703_10001136 | 3300026035 | Bacteria | 25138 |
| 567 | Ga0207703_10007386 | 3300026035 | Bacteria | 8731 |
| 568 | Ga0207703_10064115 | 3300026035 | Bacteria | 3015 |
| 569 | Ga0207639_10000060 | 3300026041 | Bacteria | 108336 |
| 570 | Ga0207639_10077233 | 3300026041 | Bacteria | 2624 |
| 571 | Ga0207639_10208694 | 3300026041 | Bacteria | 1680 |
| 572 | Ga0207678_10002206 | 3300026067 | Bacteria | 17584 |
| 573 | Ga0207678_10036947 | 3300026067 | Unclassified | 4252 |
| 574 | Ga0207678_10087929 | 3300026067 | Unclassified | 2656 |
| 575 | Ga0207702_10004124 | 3300026078 | Bacteria | 13029 |
| 576 | Ga0207702_10004714 | 3300026078 | Bacteria | 12048 |
| 577 | Ga0207702_10016530 | 3300026078 | Bacteria | 6107 |
| 578 | Ga0207702_10021839 | 3300026078 | Bacteria | 5300 |
| 579 | Ga0207702_10034765 | 3300026078 | Bacteria | 4215 |
| 580 | Ga0207702_10044471 | 3300026078 | Bacteria | 3732 |
| 581 | Ga0207702_10055944 | 3300026078 | Bacteria | 3348 |
| 582 | Ga0207641_10000298 | 3300026088 | Bacteria | 62177 |
| 583 | Ga0207641_10030130 | 3300026088 | Bacteria | 4493 |
| 584 | Ga0207641_10037728 | 3300026088 | Bacteria | 4037 |
| 585 | Ga0207648_10000385 | 3300026089 | Bacteria | 48932 |
| 586 | Ga0207648_10009510 | 3300026089 | Bacteria | 9300 |
| 587 | Ga0207648_10026797 | 3300026089 | Bacteria | 5119 |
| 588 | Ga0207676_10000118 | 3300026095 | Bacteria | 69518 |
| 589 | Ga0207676_10003201 | 3300026095 | Bacteria | 11658 |
| 590 | Ga0207676_10215489 | 3300026095 | Bacteria | 1706 |
| 591 | Ga0207674_10000048 | 3300026116 | Bacteria | 119394 |
| 592 | Ga0207674_10013329 | 3300026116 | Bacteria | 9131 |
| 593 | Ga0207674_10013634 | 3300026116 | Bacteria | 9002 |
| 594 | Ga0207674_10023971 | 3300026116 | Bacteria | 6526 |
| 595 | Ga0207674_10043568 | 3300026116 | Bacteria | 4627 |
| 596 | Ga0207674_10097741 | 3300026116 | Unclassified | 2920 |
| 597 | Ga0207674_10137621 | 3300026116 | Bacteria | 2403 |
| 598 | Ga0207674_10200335 | 3300026116 | Bacteria | 1946 |
| 599 | Ga0207683_10000718 | 3300026121 | Bacteria | 30120 |
| 600 | Ga0207698_10062432 | 3300026142 | Bacteria | 2909 |
| 601 | Ga0207698_10108539 | 3300026142 | Bacteria | 2320 |
| 602 | Ga0265356_1000091 | 3300028017 | Bacteria | 15112 |
| 603 | Ga0265356_1000870 | 3300028017 | Bacteria | 4956 |
| 604 | Ga0265356_1002586 | 3300028017 | Bacteria | 2384 |
| 605 | Ga0268266_10027246 | 3300028379 | Bacteria | 4861 |
| 606 | Ga0268266_10170895 | 3300028379 | Bacteria | 1973 |
| 607 | Ga0268265_10003986 | 3300028380 | Bacteria | 10398 |
| 608 | Ga0268265_10015614 | 3300028380 | Bacteria | 5199 |
| 609 | Ga0268265_10124270 | 3300028380 | Bacteria | 2132 |
| 610 | Ga0268264_10031036 | 3300028381 | Bacteria | 4382 |
| 611 | Ga0268264_10254732 | 3300028381 | Bacteria | 1632 |
| 612 | Ga0265336_10005167 | 3300028666 | Bacteria | 4850 |
| 613 | Ga0265336_10030293 | 3300028666 | Bacteria | 1686 |
| 614 | Ga0265338_10002458 | 3300028800 | Bacteria | 27697 |
| 615 | Ga0265338_10042423 | 3300028800 | Bacteria | 4236 |
| 616 | Ga0265762_1000682 | 3300030760 | Bacteria | 5976 |
| 617 | Ga0265760_10005583 | 3300031090 | Bacteria | 3600 |
| 618 | Ga0265760_10008276 | 3300031090 | Bacteria | 2973 |
| 619 | Ga0265330_10000232 | 3300031235 | Bacteria | 42060 |
| 620 | Ga0265330_10008199 | 3300031235 | Bacteria | 5040 |
| 621 | Ga0265330_10080489 | 3300031235 | Bacteria | 1403 |
| 622 | Ga0265328_10018624 | 3300031239 | Bacteria | 2674 |
| 623 | Ga0265325_10001176 | 3300031241 | Bacteria | 18668 |
| 624 | Ga0265325_10005592 | 3300031241 | Bacteria | 7746 |
| 625 | Ga0265325_10008190 | 3300031241 | Bacteria | 6191 |
| 626 | Ga0265325_10012231 | 3300031241 | Bacteria | 4911 |
| 627 | Ga0265325_10060656 | 3300031241 | Bacteria | 1921 |
| 628 | Ga0265340_10004857 | 3300031247 | Bacteria | 7475 |
| 629 | Ga0265340_10030192 | 3300031247 | Bacteria | 2718 |
| 630 | Ga0265340_10062246 | 3300031247 | Bacteria | 1783 |
| 631 | Ga0265340_10097635 | 3300031247 | Bacteria | 1368 |
| 632 | Ga0265340_10098620 | 3300031247 | Bacteria | 1360 |
| 633 | Ga0265339_10002498 | 3300031249 | Bacteria | 13139 |
| 634 | Ga0265339_10003585 | 3300031249 | Bacteria | 10841 |
| 635 | Ga0265339_10021166 | 3300031249 | Bacteria | 3789 |
| 636 | Ga0265316_10001343 | 3300031344 | Bacteria | 26473 |
| 637 | Ga0265316_10004348 | 3300031344 | Bacteria | 14121 |
| 638 | Ga0265316_10009254 | 3300031344 | Bacteria | 9070 |
| 639 | Ga0265316_10026349 | 3300031344 | Bacteria | 4837 |
| 640 | Ga0265316_10185213 | 3300031344 | Bacteria | 1549 |
| 641 | Ga0307408_100233932 | 3300031548 | Bacteria | 1506 |
| 642 | Ga0265313_10007208 | 3300031595 | Bacteria | 7653 |
| 643 | Ga0265314_10004443 | 3300031711 | Bacteria | 13019 |
| 644 | Ga0265314_10130161 | 3300031711 | Bacteria | 1571 |
| 645 | Ga0265342_10002002 | 3300031712 | Bacteria | 18146 |
| 646 | Ga0265342_10002216 | 3300031712 | Bacteria | 17065 |
| 647 | Ga0265342_10011488 | 3300031712 | Bacteria | 6059 |
| 648 | Ga0307405_10060351 | 3300031731 | Bacteria | 2393 |
| 649 | Ga0307410_10027211 | 3300031852 | Bacteria | 3612 |
| 650 | Ga0307406_10010272 | 3300031901 | Bacteria | 5276 |
| 651 | Ga0307409_100152228 | 3300031995 | Bacteria | 2010 |
| 652 | Ga0307411_10080737 | 3300032005 | Bacteria | 2237 |
| 653 | Ga0307415_100012094 | 3300032126 | Bacteria | 4976 |
| 654 | Ga0373938_0014476 | 3300034957 | Bacteria | 1515 |
| 655 | Ga0373926_0000844 | 3300035083 | Bacteria | 8716 |
| 656 | Ga0373926_0013203 | 3300035083 | Bacteria | 2799 |
| 657 | Ga0373936_0000415 | 3300035113 | Bacteria | 14386 |
| 658 | Ga0373936_0028326 | 3300035113 | Bacteria | 2202 |
| 659 | Ga0373936_0046086 | 3300035113 | Bacteria | 1757 |
| 660 | Ga0373936_0100436 | 3300035113 | Bacteria | 1220 |
| 661 | Ga0373945_0004899 | 3300035116 | Bacteria | 4264 |
| 662 | Ga0373956_0030158 | 3300035119 | Bacteria | 2369 |
| 663 | Ga0373956_0038528 | 3300035119 | Unclassified | 2115 |
| 664 | Ga0373956_0096162 | 3300035119 | Unclassified | 1370 |
| 665 | Ga0373943_0000008 | 3300035170 | Bacteria | 69214 |
| 666 | Ga0373943_0001473 | 3300035170 | Bacteria | 10661 |
| 667 | Ga0373943_0019598 | 3300035170 | Unclassified | 3111 |
| 668 | Ga0373943_0101616 | 3300035170 | Unclassified | 1505 |
| 669 | Ga0373946_0025051 | 3300035171 | Bacteria | 2344 |
| 670 | Ga0373946_0071447 | 3300035171 | Bacteria | 1500 |
| 671 | Ga0373962_0049590 | 3300035242 | Bacteria | 1207 |
| 672 | Ga0373924_0000042 | 3300035410 | Bacteria | 32998 |
| 673 | Ga0373931_0021534 | 3300035691 | Bacteria | 3236 |
| 674 | Ga0373931_0027649 | 3300035691 | Bacteria | 2897 |
| 675 | Ga0373935_0009541 | 3300035692 | Bacteria | 5808 |
| 676 | Ga0373935_0049826 | 3300035692 | Bacteria | 2656 |
| 677 | Ga0373935_0115779 | 3300035692 | Bacteria | 1785 |
| 678 | Ga0373927_0002504 | 3300035695 | Bacteria | 13411 |
| 679 | Ga0373927_0007025 | 3300035695 | Bacteria | 7642 |
| 680 | Ga0373933_0021455 | 3300035724 | Bacteria | 3669 |
| 681 | Ga0373947_0000210 | 3300035725 | Bacteria | 32754 |
| 682 | Ga0373947_0003427 | 3300035725 | Bacteria | 9386 |
| 683 | Ga0373947_0003826 | 3300035725 | Bacteria | 8865 |
| 684 | Ga0373947_0010928 | 3300035725 | Bacteria | 5212 |
| 685 | Ga0373947_0058231 | 3300035725 | Bacteria | 2341 |
| 686 | Ga0373947_0144803 | 3300035725 | Bacteria | 1527 |
| 687 | Ga0373947_0190382 | 3300035725 | Bacteria | 1338 |
| 688 | Ga0373937_0000648 | 3300036401 | Bacteria | 30543 |
| 689 | Ga0373937_0036379 | 3300036401 | Bacteria | 4486 |
| 690 | Ga0373937_0107164 | 3300036401 | Unclassified | 2598 |
| 691 | Ga0373937_0177730 | 3300036401 | Bacteria | 1998 |
| 692 | Ga0373925_0001100 | 3300037068 | Bacteria | 24202 |
| 693 | Ga0373925_0019849 | 3300037068 | Bacteria | 4889 |
| 694 | Ga0373925_0069116 | 3300037068 | Bacteria | 2667 |
| 695 | Ga0373925_0109594 | 3300037068 | Bacteria | 2131 |
| 696 | Ga0373925_0146327 | 3300037068 | Unclassified | 1852 |
| 697 | Ga0373925_0271834 | 3300037068 | Bacteria | 1363 |
| 698 | Ga0395898_0019750 | 3300037466 | Bacteria | 6852 |
| 699 | Ga0395905_0005868 | 3300037471 | Bacteria | 12470 |
| 700 | Ga0395905_0153843 | 3300037471 | Bacteria | 2163 |
| 701 | Ga0436360_0213845 | 3300039438 | Bacteria | 5479 |
| 702 | Ga0436360_0324039 | 3300039438 | Bacteria | 2259 |
| 703 | Ga0436360_0669763 | 3300039438 | Bacteria | 2246 |
| 704 | Ga0436361_0251067 | 3300039447 | Archaea | 5683 |
| 705 | Ga0436363_0241926 | 3300039450 | Bacteria | 9886 |
| 706 | Ga0436363_0281651 | 3300039450 | Bacteria | 2588 |
| 707 | Ga0436363_0630469 | 3300039450 | Bacteria | 3569 |
| 708 | Ga0451577_0000290 | 3300042876 | Bacteria | 97706 |
| 709 | Ga0453683_0041843 | 3300044673 | Bacteria | 2877 |
| 710 | Ga0466963_0011405 | 3300044694 | Bacteria | 5412 |
| 711 | Ga0466963_0138548 | 3300044694 | Bacteria | 1685 |
| 712 | Ga0466957_0000292 | 3300044842 | Bacteria | 24570 |
| 713 | Ga0466959_0003455 | 3300045049 | Bacteria | 10340 |
| 714 | Ga0451576_0182885 | 3300045051 | Bacteria | 2188 |
| 715 | Ga0466967_0012591 | 3300045976 | Bacteria | 6481 |
| 716 | Ga0466967_0014317 | 3300045976 | Bacteria | 6173 |
| 717 | Ga0466967_0022966 | 3300045976 | Bacteria | 5103 |
| 718 | Ga0466967_0178766 | 3300045976 | Bacteria | 2000 |
| 719 | Ga0495629_0004259 | 3300046459 | Bacteria | 10727 |
| 720 | Ga0495651_0172481 | 3300046462 | Bacteria | 1539 |
| 721 | Ga0495651_0211020 | 3300046462 | Unclassified | 1351 |
| 722 | Ga0495653_0170997 | 3300046463 | Bacteria | 1500 |
| 723 | Ga0495580_0000030 | 3300046472 | Bacteria | 78710 |
| 724 | Ga0495580_0000136 | 3300046472 | Bacteria | 51924 |
| 725 | Ga0495580_0000176 | 3300046472 | Bacteria | 47717 |
| 726 | Ga0495580_0000228 | 3300046472 | Bacteria | 43816 |
| 727 | Ga0495580_0008064 | 3300046472 | Bacteria | 8404 |
| 728 | Ga0495580_0008352 | 3300046472 | Bacteria | 8236 |
| 729 | Ga0495580_0012099 | 3300046472 | Bacteria | 6641 |
| 730 | Ga0495580_0013162 | 3300046472 | Bacteria | 6333 |
| 731 | Ga0495580_0014601 | 3300046472 | Bacteria | 5953 |
| 732 | Ga0495580_0017538 | 3300046472 | Bacteria | 5352 |
| 733 | Ga0495580_0018388 | 3300046472 | Bacteria | 5204 |
| 734 | Ga0495580_0063547 | 3300046472 | Bacteria | 2589 |
| 735 | Ga0495580_0097030 | 3300046472 | Bacteria | 2050 |
| 736 | Ga0495580_0163177 | 3300046472 | Bacteria | 1542 |
| 737 | Ga0495580_0360780 | 3300046472 | Bacteria | 983 |
| 738 | Ga0495582_0030688 | 3300046473 | Bacteria | 2952 |
| 739 | Ga0495582_0235973 | 3300046473 | Bacteria | 1047 |
| 740 | Ga0495662_0061711 | 3300046476 | Bacteria | 1811 |
| 741 | Ga0495630_0126265 | 3300046517 | Bacteria | 1941 |
| 742 | Ga0495652_0235316 | 3300046529 | Bacteria | 1367 |
| 743 | Ga0495665_0005649 | 3300046531 | Bacteria | 6747 |
| 744 | Ga0495665_0058776 | 3300046531 | Bacteria | 2030 |
| 745 | Ga0495586_0102828 | 3300046535 | Bacteria | 1586 |
| 746 | Ga0495587_0074666 | 3300046536 | Unclassified | 1969 |
| 747 | Ga0495645_0116461 | 3300046543 | Bacteria | 1886 |
| 748 | Ga0495667_0091170 | 3300046559 | Bacteria | 1974 |
| 749 | Ga0495635_0030503 | 3300046663 | Bacteria | 3747 |
| 750 | Ga0495659_0028465 | 3300046664 | Bacteria | 1934 |
| 751 | Ga0495599_0093240 | 3300046678 | Bacteria | 1879 |
| 752 | Ga0495623_0154345 | 3300046679 | Bacteria | 1354 |
| 753 | Ga0495647_0001185 | 3300046681 | Bacteria | 8020 |
| 754 | Ga0495647_0022524 | 3300046681 | Bacteria | 2276 |
| 755 | Ga0495658_0007219 | 3300046683 | Bacteria | 5490 |
| 756 | Ga0495658_0147555 | 3300046683 | Bacteria | 1443 |
| 757 | Ga0495669_0024760 | 3300046684 | Bacteria | 2614 |
| 758 | Ga0495669_0098135 | 3300046684 | Bacteria | 1359 |
| 759 | Ga0495624_0053189 | 3300046690 | Bacteria | 2557 |
| 760 | Ga0495624_0097789 | 3300046690 | Bacteria | 1808 |
| 761 | Ga0495581_0033780 | 3300047315 | Bacteria | 2961 |
| 762 | Ga0495581_0035520 | 3300047315 | Bacteria | 2884 |
| 763 | Ga0495674_0010257 | 3300047319 | Bacteria | 8873 |
| 764 | Ga0495674_0012423 | 3300047319 | Bacteria | 8025 |
| 765 | Ga0495674_0238612 | 3300047319 | Bacteria | 1499 |
| 766 | Ga0495675_0073077 | 3300047444 | Bacteria | 2163 |
| 767 | Ga0495684_0125650 | 3300047471 | Bacteria | 1930 |
| 768 | Ga0495602_0012288 | 3300048088 | Bacteria | 8812 |
| 769 | Ga0495602_0103407 | 3300048088 | Bacteria | 2332 |
| 770 | Ga0495602_0164402 | 3300048088 | Bacteria | 1729 |
| 771 | Ga0496102_0064028 | 3300048905 | Bacteria | 3367 |
| 772 | Ga0496102_0203500 | 3300048905 | Bacteria | 1866 |
| 773 | Ga0496103_0015234 | 3300048906 | Bacteria | 4572 |
| 774 | Ga0496103_0044890 | 3300048906 | Unclassified | 2725 |
| 775 | Ga0496103_0075671 | 3300048906 | Bacteria | 2112 |
| 776 | Ga0496104_0061976 | 3300048907 | Unclassified | 3546 |
| 777 | Ga0496104_0088178 | 3300048907 | Bacteria | 2964 |
| 778 | Ga0496104_0098604 | 3300048907 | Bacteria | 2797 |
| 779 | Ga0496104_0145363 | 3300048907 | Unclassified | 2277 |
| 780 | Ga0496105_0003734 | 3300048908 | Bacteria | 11340 |
| 781 | Ga0496106_0096381 | 3300048909 | Bacteria | 2289 |
| 782 | Ga0496106_0153272 | 3300048909 | Bacteria | 1819 |
| 783 | Ga0496106_0516952 | 3300048909 | Bacteria | 959 |
| 784 | Ga0496108_0000116 | 3300048911 | Bacteria | 79135 |
| 785 | Ga0496108_0207131 | 3300048911 | Bacteria | 1702 |
| 786 | Ga0496109_0000265 | 3300048912 | Bacteria | 50463 |
| 787 | Ga0496109_0296985 | 3300048912 | Bacteria | 1523 |
| 788 | Ga0496110_0000239 | 3300048913 | Bacteria | 35620 |
| 789 | Ga0496110_0102424 | 3300048913 | Unclassified | 2568 |
| 790 | Ga0496110_0207667 | 3300048913 | Unclassified | 1780 |
| 791 | Ga0496111_0001607 | 3300048914 | Bacteria | 13076 |
| 792 | Ga0496111_0066135 | 3300048914 | Bacteria | 2624 |
| 793 | Ga0496112_0001222 | 3300048915 | Bacteria | 19333 |
| 794 | Ga0496112_0002498 | 3300048915 | Bacteria | 14837 |
| 795 | Ga0496112_0002814 | 3300048915 | Bacteria | 14127 |
| 796 | Ga0496112_0016160 | 3300048915 | Bacteria | 6982 |
| 797 | Ga0496112_0027607 | 3300048915 | Bacteria | 5474 |
| 798 | Ga0496112_0040910 | 3300048915 | Bacteria | 4533 |
| 799 | Ga0496112_0094621 | 3300048915 | Bacteria | 2958 |
| 800 | Ga0496113_0000435 | 3300048916 | Bacteria | 20283 |
| 801 | Ga0496113_0014564 | 3300048916 | Bacteria | 5370 |
| 802 | Ga0496113_0050186 | 3300048916 | Bacteria | 3110 |
| 803 | Ga0496113_0205920 | 3300048916 | Bacteria | 1565 |
| 804 | Ga0496114_0237597 | 3300048917 | Bacteria | 1602 |
| 805 | Ga0496115_0083457 | 3300048918 | Bacteria | 2604 |
| 806 | Ga0496115_0103391 | 3300048918 | Bacteria | 2337 |
| 807 | Ga0496115_0124740 | 3300048918 | Bacteria | 2121 |
| 808 | Ga0496115_0156511 | 3300048918 | Bacteria | 1883 |
| 809 | Ga0496115_0220761 | 3300048918 | Bacteria | 1564 |
| 810 | nmdc:mga05p37_305361_c1 | 3300050507 | Unclassified | 1888 |
| 811 | nmdc:mga0n895_46507_c1 | 3300050512 | Bacteria | 4240 |
| 812 | nmdc:mga0n895_93913_c1 | 3300050512 | Bacteria | 3003 |
| 813 | nmdc:mga0rr50_374258_c1 | 3300050513 | Unclassified | 1200 |
| 814 | nmdc:mga08x19_1929_c1 | 3300050514 | Bacteria | 12682 |
| 815 | nmdc:mga08x19_4136_c1 | 3300050514 | Bacteria | 8606 |
| 816 | nmdc:mga08x19_57764_c1 | 3300050514 | Bacteria | 2509 |
| 817 | Ga0495601_0014941 | 3300053077 | Bacteria | 4687 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0360780 | Ga0495580_0360780_11_895 | 251 |
| 2 | 3300047471 | Ga0495684_0125650 | Ga0495684_0125650_1004_1888 | 251 |
| 3 | 3300048909 | Ga0496106_0516952 | Ga0496106_0516952_23_907 | 251 |
| 4 | 3300013105 | Ga0157369_10172108 | Ga0157369_101721081 | 278 |
| 5 | 3300025913 | Ga0207695_10111607 | Ga0207695_101116072 | 281 |
| 6 | 3300050512 | nmdc:mga0n895_46507_c1 | nmdc:mga0n895_46507_c1_484_1533 | 287 |
| 7 | 3300025939 | Ga0207665_10128839 | Ga0207665_101288392 | 288 |
| 8 | 3300005434 | Ga0070709_10005350 | Ga0070709_100053503 | 289 |
| 9 | 3300005434 | Ga0070709_10014189 | Ga0070709_100141895 | 289 |
| 10 | 3300005436 | Ga0070713_100014463 | Ga0070713_1000144632 | 289 |
| 11 | 3300005436 | Ga0070713_100099889 | Ga0070713_1000998891 | 289 |
| 12 | 3300005437 | Ga0070710_10041347 | Ga0070710_100413472 | 289 |
| 13 | 3300005437 | Ga0070710_10089722 | Ga0070710_100897222 | 289 |
| 14 | 3300005439 | Ga0070711_100052769 | Ga0070711_1000527692 | 289 |
| 15 | 3300006173 | Ga0070716_100009209 | Ga0070716_1000092093 | 289 |
| 16 | 3300006175 | Ga0070712_100001256 | Ga0070712_1000012567 | 289 |
| 17 | 3300006175 | Ga0070712_100006793 | Ga0070712_1000067934 | 289 |
| 18 | 3300025898 | Ga0207692_10009693 | Ga0207692_100096932 | 289 |
| 19 | 3300025906 | Ga0207699_10003324 | Ga0207699_100033244 | 289 |
| 20 | 3300025906 | Ga0207699_10011770 | Ga0207699_100117702 | 289 |
| 21 | 3300025915 | Ga0207693_10003018 | Ga0207693_100030187 | 289 |
| 22 | 3300025915 | Ga0207693_10177635 | Ga0207693_101776352 | 289 |
| 23 | 3300025916 | Ga0207663_10081116 | Ga0207663_100811162 | 289 |
| 24 | 3300025928 | Ga0207700_10003515 | Ga0207700_100035155 | 289 |
| 25 | 3300046472 | Ga0495580_0017538 | Ga0495580_0017538_156_1241 | 289 |
| 26 | 3300046517 | Ga0495630_0126265 | Ga0495630_0126265_359_1438 | 289 |
| 27 | 3300013105 | Ga0157369_10000300 | Ga0157369_1000030023 | 297 |
| 28 | 3300045051 | Ga0451576_0182885 | Ga0451576_0182885_920_1969 | 297 |
| 29 | 3300046473 | Ga0495582_0235973 | Ga0495582_0235973_11_1033 | 297 |
| 30 | 3300025927 | Ga0207687_10074646 | Ga0207687_100746462 | 298 |
| 31 | 3300025926 | Ga0207659_10167216 | Ga0207659_101672162 | 299 |
| 32 | 3300046472 | Ga0495580_0163177 | Ga0495580_0163177_482_1513 | 300 |
| 33 | 3300046472 | Ga0495580_0097030 | Ga0495580_0097030_620_1702 | 304 |
| 34 | 3300045976 | Ga0466967_0178766 | Ga0466967_0178766_640_1725 | 305 |
| 35 | 3300013296 | Ga0157374_10272348 | Ga0157374_102723482 | 307 |
| 36 | 3300035725 | Ga0373947_0058231 | Ga0373947_0058231_134_1186 | 307 |
| 37 | 3300031235 | Ga0265330_10000232 | Ga0265330_1000023216 | 309 |
| 38 | 3300031241 | Ga0265325_10001176 | Ga0265325_100011766 | 309 |
| 39 | 3300031249 | Ga0265339_10002498 | Ga0265339_1000249810 | 309 |
| 40 | 3300031344 | Ga0265316_10004348 | Ga0265316_100043483 | 309 |
| 41 | 3300031595 | Ga0265313_10007208 | Ga0265313_100072082 | 309 |
| 42 | 3300031712 | Ga0265342_10002002 | Ga0265342_100020029 | 309 |
| 43 | 3300005336 | Ga0070680_100212776 | Ga0070680_1002127762 | 310 |
| 44 | 3300005445 | Ga0070708_100109116 | Ga0070708_1001091163 | 310 |
| 45 | 3300005458 | Ga0070681_10037474 | Ga0070681_100374742 | 310 |
| 46 | 3300005530 | Ga0070679_100099621 | Ga0070679_1000996213 | 310 |
| 47 | 3300025917 | Ga0207660_10026730 | Ga0207660_100267302 | 310 |
| 48 | 3300026116 | Ga0207674_10200335 | Ga0207674_102003352 | 310 |
| 49 | 3300030760 | Ga0265762_1000682 | Ga0265762_10006824 | 310 |
| 50 | 3300031241 | Ga0265325_10005592 | Ga0265325_100055927 | 310 |
| 51 | 3300005468 | Ga0070707_100004884 | Ga0070707_1000048845 | 311 |
| 52 | 3300005468 | Ga0070707_100192129 | Ga0070707_1001921292 | 311 |
| 53 | 3300007788 | Ga0099795_10003515 | Ga0099795_100035151 | 311 |
| 54 | 3300009147 | Ga0114129_10166826 | Ga0114129_101668262 | 311 |
| 55 | 3300010159 | Ga0099796_10009816 | Ga0099796_100098163 | 311 |
| 56 | 3300025922 | Ga0207646_10002543 | Ga0207646_1000254321 | 311 |
| 57 | 3300031247 | Ga0265340_10004857 | Ga0265340_100048576 | 311 |
| 58 | 3300035083 | Ga0373926_0013203 | Ga0373926_0013203_766_1866 | 311 |
| 59 | 3300035725 | Ga0373947_0144803 | Ga0373947_0144803_306_1406 | 311 |
| 60 | 3300039438 | Ga0436360_0324039 | Ga0436360_0324039_949_2049 | 311 |
| 61 | 3300050507 | nmdc:mga05p37_305361_c1 | nmdc:mga05p37_305361_c1_437_1522 | 311 |
| 62 | 3300006028 | Ga0070717_10092640 | Ga0070717_100926403 | 312 |
| 63 | 3300025915 | Ga0207693_10123031 | Ga0207693_101230311 | 312 |
| 64 | 3300025939 | Ga0207665_10019196 | Ga0207665_100191961 | 312 |
| 65 | 3300005437 | Ga0070710_10069700 | Ga0070710_100697002 | 313 |
| 66 | 3300005445 | Ga0070708_100020455 | Ga0070708_1000204556 | 313 |
| 67 | 3300005536 | Ga0070697_100000124 | Ga0070697_10000012453 | 313 |
| 68 | 3300006028 | Ga0070717_10205012 | Ga0070717_102050122 | 313 |
| 69 | 3300028017 | Ga0265356_1002586 | Ga0265356_10025862 | 313 |
| 70 | 3300035170 | Ga0373943_0101616 | Ga0373943_0101616_237_1322 | 313 |
| 71 | 3300046472 | Ga0495580_0000176 | Ga0495580_0000176_32207_33289 | 313 |
| 72 | 3300046473 | Ga0495582_0030688 | Ga0495582_0030688_1087_2169 | 313 |
| 73 | 3300046531 | Ga0495665_0058776 | Ga0495665_0058776_574_1656 | 313 |
| 74 | 3300005435 | Ga0070714_100064192 | Ga0070714_1000641922 | 314 |
| 75 | 3300005436 | Ga0070713_100004328 | Ga0070713_1000043288 | 314 |
| 76 | 3300005436 | Ga0070713_100021008 | Ga0070713_1000210085 | 314 |
| 77 | 3300005536 | Ga0070697_100104297 | Ga0070697_1001042973 | 314 |
| 78 | 3300005546 | Ga0070696_100077242 | Ga0070696_1000772422 | 314 |
| 79 | 3300006914 | Ga0075436_100002558 | Ga0075436_1000025586 | 314 |
| 80 | 3300013104 | Ga0157370_10091105 | Ga0157370_100911052 | 314 |
| 81 | 3300013105 | Ga0157369_10189975 | Ga0157369_101899751 | 314 |
| 82 | 3300025913 | Ga0207695_10036849 | Ga0207695_100368494 | 314 |
| 83 | 3300025913 | Ga0207695_10162095 | Ga0207695_101620952 | 314 |
| 84 | 3300025928 | Ga0207700_10041156 | Ga0207700_100411562 | 314 |
| 85 | 3300025929 | Ga0207664_10100369 | Ga0207664_101003692 | 314 |
| 86 | 3300025929 | Ga0207664_10267852 | Ga0207664_102678521 | 314 |
| 87 | 3300031090 | Ga0265760_10008276 | Ga0265760_100082762 | 314 |
| 88 | 3300039450 | Ga0436363_0630469 | Ga0436363_0630469_241_1320 | 314 |
| 89 | 3300044673 | Ga0453683_0041843 | Ga0453683_0041843_768_1841 | 314 |
| 90 | 3300046472 | Ga0495580_0008352 | Ga0495580_0008352_172_1254 | 314 |
| 91 | 3300050513 | nmdc:mga0rr50_374258_c1 | nmdc:mga0rr50_374258_c1_28_1137 | 314 |
| 92 | 3300050514 | nmdc:mga08x19_4136_c1 | nmdc:mga08x19_4136_c1_3410_4519 | 314 |
| 93 | 3300005331 | Ga0070670_100010165 | Ga0070670_1000101659 | 315 |
| 94 | 3300005334 | Ga0068869_100006004 | Ga0068869_1000060041 | 315 |
| 95 | 3300005334 | Ga0068869_100011803 | Ga0068869_1000118033 | 315 |
| 96 | 3300005338 | Ga0068868_100054352 | Ga0068868_1000543523 | 315 |
| 97 | 3300005340 | Ga0070689_100095177 | Ga0070689_1000951772 | 315 |
| 98 | 3300005344 | Ga0070661_100022341 | Ga0070661_1000223412 | 315 |
| 99 | 3300005366 | Ga0070659_100141844 | Ga0070659_1001418441 | 315 |
| 100 | 3300005367 | Ga0070667_100102915 | Ga0070667_1001029152 | 315 |
| 101 | 3300005435 | Ga0070714_100015460 | Ga0070714_1000154604 | 315 |
| 102 | 3300005436 | Ga0070713_100002368 | Ga0070713_1000023689 | 315 |
| 103 | 3300005445 | Ga0070708_100001868 | Ga0070708_1000018683 | 315 |
| 104 | 3300005445 | Ga0070708_100026741 | Ga0070708_1000267414 | 315 |
| 105 | 3300005458 | Ga0070681_10015071 | Ga0070681_100150715 | 315 |
| 106 | 3300005459 | Ga0068867_100072982 | Ga0068867_1000729823 | 315 |
| 107 | 3300005466 | Ga0070685_10039985 | Ga0070685_100399852 | 315 |
| 108 | 3300005467 | Ga0070706_100001027 | Ga0070706_10000102712 | 315 |
| 109 | 3300005468 | Ga0070707_100001517 | Ga0070707_1000015177 | 315 |
| 110 | 3300005471 | Ga0070698_100000822 | Ga0070698_10000082215 | 315 |
| 111 | 3300005518 | Ga0070699_100053060 | Ga0070699_1000530603 | 315 |
| 112 | 3300005518 | Ga0070699_100307950 | Ga0070699_1003079501 | 315 |
| 113 | 3300005530 | Ga0070679_100063208 | Ga0070679_1000632083 | 315 |
| 114 | 3300005535 | Ga0070684_100022812 | Ga0070684_1000228125 | 315 |
| 115 | 3300005536 | Ga0070697_100001757 | Ga0070697_10000175714 | 315 |
| 116 | 3300005539 | Ga0068853_100239117 | Ga0068853_1002391172 | 315 |
| 117 | 3300005548 | Ga0070665_100278789 | Ga0070665_1002787892 | 315 |
| 118 | 3300005563 | Ga0068855_100008242 | Ga0068855_1000082428 | 315 |
| 119 | 3300005563 | Ga0068855_100185937 | Ga0068855_1001859371 | 315 |
| 120 | 3300005564 | Ga0070664_100002133 | Ga0070664_1000021333 | 315 |
| 121 | 3300005577 | Ga0068857_100010504 | Ga0068857_1000105042 | 315 |
| 122 | 3300005578 | Ga0068854_100008660 | Ga0068854_1000086602 | 315 |
| 123 | 3300005578 | Ga0068854_100188415 | Ga0068854_1001884151 | 315 |
| 124 | 3300005614 | Ga0068856_100004326 | Ga0068856_1000043268 | 315 |
| 125 | 3300005616 | Ga0068852_100207791 | Ga0068852_1002077912 | 315 |
| 126 | 3300005616 | Ga0068852_100306362 | Ga0068852_1003063622 | 315 |
| 127 | 3300005617 | Ga0068859_100000033 | Ga0068859_10000003397 | 315 |
| 128 | 3300005617 | Ga0068859_100002934 | Ga0068859_1000029344 | 315 |
| 129 | 3300005617 | Ga0068859_100003344 | Ga0068859_10000334411 | 315 |
| 130 | 3300005618 | Ga0068864_100007227 | Ga0068864_1000072276 | 315 |
| 131 | 3300005718 | Ga0068866_10057988 | Ga0068866_100579882 | 315 |
| 132 | 3300005841 | Ga0068863_100057530 | Ga0068863_1000575302 | 315 |
| 133 | 3300005842 | Ga0068858_100000231 | Ga0068858_10000023140 | 315 |
| 134 | 3300005842 | Ga0068858_100030966 | Ga0068858_1000309663 | 315 |
| 135 | 3300005843 | Ga0068860_100032528 | Ga0068860_1000325287 | 315 |
| 136 | 3300005843 | Ga0068860_100133300 | Ga0068860_1001333003 | 315 |
| 137 | 3300005844 | Ga0068862_100120387 | Ga0068862_1001203872 | 315 |
| 138 | 3300006028 | Ga0070717_10017409 | Ga0070717_100174094 | 315 |
| 139 | 3300006028 | Ga0070717_10055041 | Ga0070717_100550413 | 315 |
| 140 | 3300006237 | Ga0097621_100002920 | Ga0097621_10000292010 | 315 |
| 141 | 3300006358 | Ga0068871_100007176 | Ga0068871_1000071764 | 315 |
| 142 | 3300006358 | Ga0068871_100183082 | Ga0068871_1001830822 | 315 |
| 143 | 3300006881 | Ga0068865_100062392 | Ga0068865_1000623922 | 315 |
| 144 | 3300006881 | Ga0068865_100107932 | Ga0068865_1001079322 | 315 |
| 145 | 3300006931 | Ga0097620_100000033 | Ga0097620_10000003397 | 315 |
| 146 | 3300006931 | Ga0097620_100002934 | Ga0097620_10000293413 | 315 |
| 147 | 3300006931 | Ga0097620_100003344 | Ga0097620_10000334411 | 315 |
| 148 | 3300009098 | Ga0105245_10095823 | Ga0105245_100958233 | 315 |
| 149 | 3300009174 | Ga0105241_10067128 | Ga0105241_100671282 | 315 |
| 150 | 3300009177 | Ga0105248_10206362 | Ga0105248_102063621 | 315 |
| 151 | 3300009545 | Ga0105237_10006540 | Ga0105237_1000654011 | 315 |
| 152 | 3300009545 | Ga0105237_10010441 | Ga0105237_100104418 | 315 |
| 153 | 3300009551 | Ga0105238_10016889 | Ga0105238_100168891 | 315 |
| 154 | 3300011119 | Ga0105246_10032222 | Ga0105246_100322222 | 315 |
| 155 | 3300013102 | Ga0157371_10008726 | Ga0157371_100087262 | 315 |
| 156 | 3300013296 | Ga0157374_10002617 | Ga0157374_100026178 | 315 |
| 157 | 3300013296 | Ga0157374_10023556 | Ga0157374_100235563 | 315 |
| 158 | 3300013297 | Ga0157378_10001506 | Ga0157378_1000150614 | 315 |
| 159 | 3300013306 | Ga0163162_10003102 | Ga0163162_100031024 | 315 |
| 160 | 3300013307 | Ga0157372_10002600 | Ga0157372_100026008 | 315 |
| 161 | 3300025899 | Ga0207642_10047143 | Ga0207642_100471432 | 315 |
| 162 | 3300025904 | Ga0207647_10002745 | Ga0207647_100027455 | 315 |
| 163 | 3300025907 | Ga0207645_10153156 | Ga0207645_101531561 | 315 |
| 164 | 3300025910 | Ga0207684_10019417 | Ga0207684_100194172 | 315 |
| 165 | 3300025912 | Ga0207707_10126789 | Ga0207707_101267892 | 315 |
| 166 | 3300025914 | Ga0207671_10145609 | Ga0207671_101456092 | 315 |
| 167 | 3300025920 | Ga0207649_10038935 | Ga0207649_100389352 | 315 |
| 168 | 3300025921 | Ga0207652_10052367 | Ga0207652_100523672 | 315 |
| 169 | 3300025922 | Ga0207646_10000438 | Ga0207646_1000043818 | 315 |
| 170 | 3300025924 | Ga0207694_10236048 | Ga0207694_102360481 | 315 |
| 171 | 3300025925 | Ga0207650_10058532 | Ga0207650_100585323 | 315 |
| 172 | 3300025927 | Ga0207687_10187666 | Ga0207687_101876662 | 315 |
| 173 | 3300025928 | Ga0207700_10004676 | Ga0207700_100046765 | 315 |
| 174 | 3300025928 | Ga0207700_10321106 | Ga0207700_103211061 | 315 |
| 175 | 3300025929 | Ga0207664_10020593 | Ga0207664_100205935 | 315 |
| 176 | 3300025933 | Ga0207706_10224380 | Ga0207706_102243802 | 315 |
| 177 | 3300025935 | Ga0207709_10146862 | Ga0207709_101468622 | 315 |
| 178 | 3300025938 | Ga0207704_10031737 | Ga0207704_100317372 | 315 |
| 179 | 3300025941 | Ga0207711_10385628 | Ga0207711_103856281 | 315 |
| 180 | 3300025942 | Ga0207689_10010511 | Ga0207689_100105115 | 315 |
| 181 | 3300025942 | Ga0207689_10011197 | Ga0207689_100111979 | 315 |
| 182 | 3300025944 | Ga0207661_10019265 | Ga0207661_100192651 | 315 |
| 183 | 3300025945 | Ga0207679_10006373 | Ga0207679_100063736 | 315 |
| 184 | 3300025949 | Ga0207667_10022702 | Ga0207667_100227025 | 315 |
| 185 | 3300025949 | Ga0207667_10172219 | Ga0207667_101722192 | 315 |
| 186 | 3300025960 | Ga0207651_10012487 | Ga0207651_100124872 | 315 |
| 187 | 3300025981 | Ga0207640_10227764 | Ga0207640_102277641 | 315 |
| 188 | 3300025986 | Ga0207658_10055739 | Ga0207658_100557392 | 315 |
| 189 | 3300026023 | Ga0207677_10003082 | Ga0207677_100030822 | 315 |
| 190 | 3300026023 | Ga0207677_10041494 | Ga0207677_100414944 | 315 |
| 191 | 3300026035 | Ga0207703_10001136 | Ga0207703_1000113610 | 315 |
| 192 | 3300026035 | Ga0207703_10064115 | Ga0207703_100641153 | 315 |
| 193 | 3300026041 | Ga0207639_10208694 | Ga0207639_102086941 | 315 |
| 194 | 3300026078 | Ga0207702_10016530 | Ga0207702_100165305 | 315 |
| 195 | 3300026088 | Ga0207641_10037728 | Ga0207641_100377284 | 315 |
| 196 | 3300026089 | Ga0207648_10026797 | Ga0207648_100267976 | 315 |
| 197 | 3300026095 | Ga0207676_10003201 | Ga0207676_100032016 | 315 |
| 198 | 3300026116 | Ga0207674_10013329 | Ga0207674_100133293 | 315 |
| 199 | 3300028017 | Ga0265356_1000870 | Ga0265356_10008703 | 315 |
| 200 | 3300028379 | Ga0268266_10170895 | Ga0268266_101708953 | 315 |
| 201 | 3300028380 | Ga0268265_10124270 | Ga0268265_101242702 | 315 |
| 202 | 3300028381 | Ga0268264_10031036 | Ga0268264_100310361 | 315 |
| 203 | 3300028666 | Ga0265336_10030293 | Ga0265336_100302932 | 315 |
| 204 | 3300031344 | Ga0265316_10026349 | Ga0265316_100263492 | 315 |
| 205 | 3300036401 | Ga0373937_0107164 | Ga0373937_0107164_225_1301 | 315 |
| 206 | 3300036401 | Ga0373937_0177730 | Ga0373937_0177730_226_1302 | 315 |
| 207 | 3300045976 | Ga0466967_0014317 | Ga0466967_0014317_516_1595 | 315 |
| 208 | 3300046536 | Ga0495587_0074666 | Ga0495587_0074666_95_1171 | 315 |
| 209 | 3300047319 | Ga0495674_0238612 | Ga0495674_0238612_48_1124 | 315 |
| 210 | 3300048915 | Ga0496112_0002498 | Ga0496112_0002498_9136_10221 | 315 |
| 211 | 3300048915 | Ga0496112_0094621 | Ga0496112_0094621_1050_2183 | 315 |
| 212 | 3300004800 | Ga0058861_11655845 | Ga0058861_116558451 | 316 |
| 213 | 3300005327 | Ga0070658_10246905 | Ga0070658_102469052 | 316 |
| 214 | 3300005329 | Ga0070683_100079545 | Ga0070683_1000795453 | 316 |
| 215 | 3300005335 | Ga0070666_10017390 | Ga0070666_100173903 | 316 |
| 216 | 3300005336 | Ga0070680_100053741 | Ga0070680_1000537413 | 316 |
| 217 | 3300005337 | Ga0070682_100062799 | Ga0070682_1000627991 | 316 |
| 218 | 3300005338 | Ga0068868_100008303 | Ga0068868_1000083035 | 316 |
| 219 | 3300005343 | Ga0070687_100060624 | Ga0070687_1000606241 | 316 |
| 220 | 3300005347 | Ga0070668_100002952 | Ga0070668_1000029526 | 316 |
| 221 | 3300005353 | Ga0070669_100003693 | Ga0070669_1000036936 | 316 |
| 222 | 3300005354 | Ga0070675_100008700 | Ga0070675_1000087007 | 316 |
| 223 | 3300005434 | Ga0070709_10060592 | Ga0070709_100605923 | 316 |
| 224 | 3300005436 | Ga0070713_100114568 | Ga0070713_1001145682 | 316 |
| 225 | 3300005437 | Ga0070710_10067125 | Ga0070710_100671252 | 316 |
| 226 | 3300005445 | Ga0070708_100006227 | Ga0070708_1000062274 | 316 |
| 227 | 3300005458 | Ga0070681_10004825 | Ga0070681_1000482511 | 316 |
| 228 | 3300005459 | Ga0068867_100013280 | Ga0068867_1000132804 | 316 |
| 229 | 3300005466 | Ga0070685_10015057 | Ga0070685_100150571 | 316 |
| 230 | 3300005467 | Ga0070706_100028767 | Ga0070706_1000287674 | 316 |
| 231 | 3300005467 | Ga0070706_100299435 | Ga0070706_1002994352 | 316 |
| 232 | 3300005530 | Ga0070679_100015016 | Ga0070679_1000150162 | 316 |
| 233 | 3300005530 | Ga0070679_100214731 | Ga0070679_1002147312 | 316 |
| 234 | 3300005535 | Ga0070684_100001478 | Ga0070684_1000014789 | 316 |
| 235 | 3300005536 | Ga0070697_100085042 | Ga0070697_1000850422 | 316 |
| 236 | 3300005544 | Ga0070686_100036911 | Ga0070686_1000369113 | 316 |
| 237 | 3300005563 | Ga0068855_100052813 | Ga0068855_1000528135 | 316 |
| 238 | 3300005578 | Ga0068854_100009406 | Ga0068854_1000094063 | 316 |
| 239 | 3300005614 | Ga0068856_100402010 | Ga0068856_1004020101 | 316 |
| 240 | 3300005615 | Ga0070702_100059105 | Ga0070702_1000591051 | 316 |
| 241 | 3300005616 | Ga0068852_100145987 | Ga0068852_1001459873 | 316 |
| 242 | 3300005618 | Ga0068864_100005210 | Ga0068864_1000052107 | 316 |
| 243 | 3300005718 | Ga0068866_10001612 | Ga0068866_100016127 | 316 |
| 244 | 3300005840 | Ga0068870_10040515 | Ga0068870_100405152 | 316 |
| 245 | 3300005844 | Ga0068862_100006541 | Ga0068862_1000065413 | 316 |
| 246 | 3300005983 | Ga0081540_1011204 | Ga0081540_10112045 | 316 |
| 247 | 3300006028 | Ga0070717_10110458 | Ga0070717_101104582 | 316 |
| 248 | 3300006028 | Ga0070717_10299424 | Ga0070717_102994242 | 316 |
| 249 | 3300006173 | Ga0070716_100131101 | Ga0070716_1001311012 | 316 |
| 250 | 3300006237 | Ga0097621_100001938 | Ga0097621_1000019386 | 316 |
| 251 | 3300006358 | Ga0068871_100000486 | Ga0068871_10000048612 | 316 |
| 252 | 3300006358 | Ga0068871_100037824 | Ga0068871_1000378244 | 316 |
| 253 | 3300006871 | Ga0075434_100020485 | Ga0075434_1000204852 | 316 |
| 254 | 3300006881 | Ga0068865_100098197 | Ga0068865_1000981972 | 316 |
| 255 | 3300006914 | Ga0075436_100010271 | Ga0075436_1000102716 | 316 |
| 256 | 3300006914 | Ga0075436_100150972 | Ga0075436_1001509722 | 316 |
| 257 | 3300007076 | Ga0075435_100006189 | Ga0075435_1000061894 | 316 |
| 258 | 3300009093 | Ga0105240_10042044 | Ga0105240_100420441 | 316 |
| 259 | 3300009094 | Ga0111539_10159041 | Ga0111539_101590412 | 316 |
| 260 | 3300009098 | Ga0105245_10013541 | Ga0105245_100135414 | 316 |
| 261 | 3300009101 | Ga0105247_10002535 | Ga0105247_100025352 | 316 |
| 262 | 3300009174 | Ga0105241_10010670 | Ga0105241_100106703 | 316 |
| 263 | 3300009174 | Ga0105241_10271480 | Ga0105241_102714801 | 316 |
| 264 | 3300009176 | Ga0105242_10016491 | Ga0105242_100164912 | 316 |
| 265 | 3300009176 | Ga0105242_10269628 | Ga0105242_102696282 | 316 |
| 266 | 3300009177 | Ga0105248_10035273 | Ga0105248_100352736 | 316 |
| 267 | 3300009545 | Ga0105237_10016823 | Ga0105237_100168234 | 316 |
| 268 | 3300009545 | Ga0105237_10368531 | Ga0105237_103685312 | 316 |
| 269 | 3300009553 | Ga0105249_10052427 | Ga0105249_100524274 | 316 |
| 270 | 3300010375 | Ga0105239_10424000 | Ga0105239_104240002 | 316 |
| 271 | 3300013100 | Ga0157373_10004970 | Ga0157373_100049706 | 316 |
| 272 | 3300013100 | Ga0157373_10059034 | Ga0157373_100590341 | 316 |
| 273 | 3300013104 | Ga0157370_10174924 | Ga0157370_101749242 | 316 |
| 274 | 3300013105 | Ga0157369_10072894 | Ga0157369_100728943 | 316 |
| 275 | 3300013105 | Ga0157369_10081084 | Ga0157369_100810842 | 316 |
| 276 | 3300013296 | Ga0157374_10050863 | Ga0157374_100508632 | 316 |
| 277 | 3300013297 | Ga0157378_10000532 | Ga0157378_1000053220 | 316 |
| 278 | 3300013306 | Ga0163162_10189242 | Ga0163162_101892423 | 316 |
| 279 | 3300013307 | Ga0157372_10004156 | Ga0157372_1000415614 | 316 |
| 280 | 3300013307 | Ga0157372_10013627 | Ga0157372_100136274 | 316 |
| 281 | 3300013307 | Ga0157372_10022103 | Ga0157372_100221033 | 316 |
| 282 | 3300013307 | Ga0157372_10243736 | Ga0157372_102437363 | 316 |
| 283 | 3300014326 | Ga0157380_10061173 | Ga0157380_100611732 | 316 |
| 284 | 3300015262 | Ga0182007_10004386 | Ga0182007_100043861 | 316 |
| 285 | 3300017792 | Ga0163161_10000643 | Ga0163161_1000064315 | 316 |
| 286 | 3300021377 | Ga0213874_10002144 | Ga0213874_100021444 | 316 |
| 287 | 3300022732 | Ga0224569_100300 | Ga0224569_1003003 | 316 |
| 288 | 3300025899 | Ga0207642_10016834 | Ga0207642_100168342 | 316 |
| 289 | 3300025899 | Ga0207642_10018490 | Ga0207642_100184902 | 316 |
| 290 | 3300025901 | Ga0207688_10189705 | Ga0207688_101897051 | 316 |
| 291 | 3300025904 | Ga0207647_10003491 | Ga0207647_100034918 | 316 |
| 292 | 3300025908 | Ga0207643_10022301 | Ga0207643_100223013 | 316 |
| 293 | 3300025909 | Ga0207705_10192255 | Ga0207705_101922551 | 316 |
| 294 | 3300025910 | Ga0207684_10024082 | Ga0207684_100240823 | 316 |
| 295 | 3300025910 | Ga0207684_10299446 | Ga0207684_102994461 | 316 |
| 296 | 3300025912 | Ga0207707_10085534 | Ga0207707_100855341 | 316 |
| 297 | 3300025914 | Ga0207671_10245044 | Ga0207671_102450441 | 316 |
| 298 | 3300025915 | Ga0207693_10053324 | Ga0207693_100533242 | 316 |
| 299 | 3300025916 | Ga0207663_10060712 | Ga0207663_100607121 | 316 |
| 300 | 3300025917 | Ga0207660_10000297 | Ga0207660_100002972 | 316 |
| 301 | 3300025917 | Ga0207660_10154570 | Ga0207660_101545702 | 316 |
| 302 | 3300025918 | Ga0207662_10007835 | Ga0207662_100078352 | 316 |
| 303 | 3300025919 | Ga0207657_10044099 | Ga0207657_100440992 | 316 |
| 304 | 3300025921 | Ga0207652_10011210 | Ga0207652_100112105 | 316 |
| 305 | 3300025923 | Ga0207681_10061641 | Ga0207681_100616412 | 316 |
| 306 | 3300025925 | Ga0207650_10000155 | Ga0207650_1000015519 | 316 |
| 307 | 3300025926 | Ga0207659_10035794 | Ga0207659_100357943 | 316 |
| 308 | 3300025927 | Ga0207687_10009622 | Ga0207687_100096224 | 316 |
| 309 | 3300025928 | Ga0207700_10055668 | Ga0207700_100556682 | 316 |
| 310 | 3300025929 | Ga0207664_10074102 | Ga0207664_100741023 | 316 |
| 311 | 3300025932 | Ga0207690_10011394 | Ga0207690_100113945 | 316 |
| 312 | 3300025933 | Ga0207706_10154715 | Ga0207706_101547152 | 316 |
| 313 | 3300025938 | Ga0207704_10053412 | Ga0207704_100534122 | 316 |
| 314 | 3300025939 | Ga0207665_10000962 | Ga0207665_1000096213 | 316 |
| 315 | 3300025944 | Ga0207661_10002010 | Ga0207661_100020104 | 316 |
| 316 | 3300025945 | Ga0207679_10000106 | Ga0207679_1000010656 | 316 |
| 317 | 3300025949 | Ga0207667_10209862 | Ga0207667_102098622 | 316 |
| 318 | 3300025960 | Ga0207651_10001643 | Ga0207651_100016435 | 316 |
| 319 | 3300025986 | Ga0207658_10002109 | Ga0207658_100021092 | 316 |
| 320 | 3300026023 | Ga0207677_10019289 | Ga0207677_100192892 | 316 |
| 321 | 3300026078 | Ga0207702_10034765 | Ga0207702_100347652 | 316 |
| 322 | 3300026088 | Ga0207641_10000298 | Ga0207641_1000029828 | 316 |
| 323 | 3300026089 | Ga0207648_10000385 | Ga0207648_1000038514 | 316 |
| 324 | 3300026095 | Ga0207676_10000118 | Ga0207676_1000011823 | 316 |
| 325 | 3300026116 | Ga0207674_10000048 | Ga0207674_1000004849 | 316 |
| 326 | 3300026121 | Ga0207683_10000718 | Ga0207683_1000071810 | 316 |
| 327 | 3300028380 | Ga0268265_10015614 | Ga0268265_100156143 | 316 |
| 328 | 3300028381 | Ga0268264_10254732 | Ga0268264_102547321 | 316 |
| 329 | 3300028666 | Ga0265336_10005167 | Ga0265336_100051673 | 316 |
| 330 | 3300028800 | Ga0265338_10042423 | Ga0265338_100424232 | 316 |
| 331 | 3300031235 | Ga0265330_10008199 | Ga0265330_100081992 | 316 |
| 332 | 3300031235 | Ga0265330_10080489 | Ga0265330_100804892 | 316 |
| 333 | 3300031241 | Ga0265325_10008190 | Ga0265325_100081904 | 316 |
| 334 | 3300031241 | Ga0265325_10012231 | Ga0265325_100122313 | 316 |
| 335 | 3300031247 | Ga0265340_10030192 | Ga0265340_100301922 | 316 |
| 336 | 3300031247 | Ga0265340_10097635 | Ga0265340_100976352 | 316 |
| 337 | 3300031247 | Ga0265340_10098620 | Ga0265340_100986201 | 316 |
| 338 | 3300031249 | Ga0265339_10021166 | Ga0265339_100211662 | 316 |
| 339 | 3300031344 | Ga0265316_10009254 | Ga0265316_100092547 | 316 |
| 340 | 3300031711 | Ga0265314_10130161 | Ga0265314_101301611 | 316 |
| 341 | 3300031712 | Ga0265342_10002216 | Ga0265342_100022165 | 316 |
| 342 | 3300031712 | Ga0265342_10011488 | Ga0265342_100114883 | 316 |
| 343 | 3300035113 | Ga0373936_0046086 | Ga0373936_0046086_273_1352 | 316 |
| 344 | 3300035119 | Ga0373956_0096162 | Ga0373956_0096162_120_1202 | 316 |
| 345 | 3300035695 | Ga0373927_0007025 | Ga0373927_0007025_3951_5030 | 316 |
| 346 | 3300035724 | Ga0373933_0021455 | Ga0373933_0021455_455_1537 | 316 |
| 347 | 3300035725 | Ga0373947_0003826 | Ga0373947_0003826_1223_2302 | 316 |
| 348 | 3300036401 | Ga0373937_0036379 | Ga0373937_0036379_835_1917 | 316 |
| 349 | 3300037068 | Ga0373925_0019849 | Ga0373925_0019849_3700_4779 | 316 |
| 350 | 3300037466 | Ga0395898_0019750 | Ga0395898_0019750_32_1111 | 316 |
| 351 | 3300039450 | Ga0436363_0241926 | Ga0436363_0241926_4566_5645 | 316 |
| 352 | 3300042876 | Ga0451577_0000290 | Ga0451577_0000290_36118_37197 | 316 |
| 353 | 3300044694 | Ga0466963_0011405 | Ga0466963_0011405_394_1473 | 316 |
| 354 | 3300045976 | Ga0466967_0012591 | Ga0466967_0012591_422_1501 | 316 |
| 355 | 3300046462 | Ga0495651_0172481 | Ga0495651_0172481_380_1462 | 316 |
| 356 | 3300046472 | Ga0495580_0018388 | Ga0495580_0018388_445_1524 | 316 |
| 357 | 3300046531 | Ga0495665_0005649 | Ga0495665_0005649_1397_2476 | 316 |
| 358 | 3300048907 | Ga0496104_0088178 | Ga0496104_0088178_34_1113 | 316 |
| 359 | 3300048911 | Ga0496108_0000116 | Ga0496108_0000116_43170_44249 | 316 |
| 360 | 3300048912 | Ga0496109_0000265 | Ga0496109_0000265_8642_9721 | 316 |
| 361 | 3300048913 | Ga0496110_0000239 | Ga0496110_0000239_15110_16189 | 316 |
| 362 | 3300048914 | Ga0496111_0066135 | Ga0496111_0066135_330_1409 | 316 |
| 363 | 3300048915 | Ga0496112_0001222 | Ga0496112_0001222_14503_15582 | 316 |
| 364 | 3300048915 | Ga0496112_0016160 | Ga0496112_0016160_2745_3824 | 316 |
| 365 | 3300048916 | Ga0496113_0000435 | Ga0496113_0000435_6731_7810 | 316 |
| 366 | 3300048917 | Ga0496114_0237597 | Ga0496114_0237597_88_1167 | 316 |
| 367 | 3300050514 | nmdc:mga08x19_57764_c1 | nmdc:mga08x19_57764_c1_34_1113 | 316 |
| 368 | 3300005329 | Ga0070683_100019036 | Ga0070683_1000190364 | 317 |
| 369 | 3300005336 | Ga0070680_100025342 | Ga0070680_1000253422 | 317 |
| 370 | 3300005336 | Ga0070680_100113688 | Ga0070680_1001136882 | 317 |
| 371 | 3300005338 | Ga0068868_100015841 | Ga0068868_1000158414 | 317 |
| 372 | 3300005434 | Ga0070709_10007780 | Ga0070709_100077801 | 317 |
| 373 | 3300005435 | Ga0070714_100000230 | Ga0070714_1000002306 | 317 |
| 374 | 3300005435 | Ga0070714_100344965 | Ga0070714_1003449652 | 317 |
| 375 | 3300005445 | Ga0070708_100007704 | Ga0070708_1000077045 | 317 |
| 376 | 3300005445 | Ga0070708_100089685 | Ga0070708_1000896853 | 317 |
| 377 | 3300005458 | Ga0070681_10001660 | Ga0070681_100016608 | 317 |
| 378 | 3300005458 | Ga0070681_10025150 | Ga0070681_100251503 | 317 |
| 379 | 3300005467 | Ga0070706_100037461 | Ga0070706_1000374613 | 317 |
| 380 | 3300005471 | Ga0070698_100071711 | Ga0070698_1000717112 | 317 |
| 381 | 3300005530 | Ga0070679_100015059 | Ga0070679_1000150591 | 317 |
| 382 | 3300005545 | Ga0070695_100072842 | Ga0070695_1000728421 | 317 |
| 383 | 3300005546 | Ga0070696_100016775 | Ga0070696_1000167751 | 317 |
| 384 | 3300005563 | Ga0068855_100001040 | Ga0068855_10000104029 | 317 |
| 385 | 3300005577 | Ga0068857_100008259 | Ga0068857_1000082596 | 317 |
| 386 | 3300005578 | Ga0068854_100022767 | Ga0068854_1000227674 | 317 |
| 387 | 3300005614 | Ga0068856_100002913 | Ga0068856_1000029133 | 317 |
| 388 | 3300005616 | Ga0068852_100064376 | Ga0068852_1000643762 | 317 |
| 389 | 3300005842 | Ga0068858_100046492 | Ga0068858_1000464923 | 317 |
| 390 | 3300006028 | Ga0070717_10006272 | Ga0070717_100062725 | 317 |
| 391 | 3300006237 | Ga0097621_100002940 | Ga0097621_10000294010 | 317 |
| 392 | 3300006358 | Ga0068871_100004726 | Ga0068871_1000047263 | 317 |
| 393 | 3300006914 | Ga0075436_100025900 | Ga0075436_1000259005 | 317 |
| 394 | 3300006914 | Ga0075436_100053075 | Ga0075436_1000530752 | 317 |
| 395 | 3300009093 | Ga0105240_10002547 | Ga0105240_100025473 | 317 |
| 396 | 3300009093 | Ga0105240_10011585 | Ga0105240_100115858 | 317 |
| 397 | 3300009093 | Ga0105240_10061795 | Ga0105240_100617953 | 317 |
| 398 | 3300009174 | Ga0105241_10016057 | Ga0105241_100160573 | 317 |
| 399 | 3300009177 | Ga0105248_10014835 | Ga0105248_100148355 | 317 |
| 400 | 3300009545 | Ga0105237_10241614 | Ga0105237_102416141 | 317 |
| 401 | 3300009551 | Ga0105238_10001815 | Ga0105238_1000181513 | 317 |
| 402 | 3300010375 | Ga0105239_10012680 | Ga0105239_100126807 | 317 |
| 403 | 3300013102 | Ga0157371_10105234 | Ga0157371_101052342 | 317 |
| 404 | 3300013105 | Ga0157369_10002843 | Ga0157369_1000284313 | 317 |
| 405 | 3300013296 | Ga0157374_10002248 | Ga0157374_100022482 | 317 |
| 406 | 3300013296 | Ga0157374_10019485 | Ga0157374_100194852 | 317 |
| 407 | 3300013297 | Ga0157378_10006631 | Ga0157378_100066315 | 317 |
| 408 | 3300013297 | Ga0157378_10065433 | Ga0157378_100654333 | 317 |
| 409 | 3300013307 | Ga0157372_10000282 | Ga0157372_1000028214 | 317 |
| 410 | 3300013307 | Ga0157372_10002936 | Ga0157372_1000293611 | 317 |
| 411 | 3300013307 | Ga0157372_10049067 | Ga0157372_100490674 | 317 |
| 412 | 3300014969 | Ga0157376_10308334 | Ga0157376_103083342 | 317 |
| 413 | 3300025898 | Ga0207692_10176548 | Ga0207692_101765481 | 317 |
| 414 | 3300025906 | Ga0207699_10160927 | Ga0207699_101609271 | 317 |
| 415 | 3300025910 | Ga0207684_10031935 | Ga0207684_100319352 | 317 |
| 416 | 3300025911 | Ga0207654_10020770 | Ga0207654_100207703 | 317 |
| 417 | 3300025912 | Ga0207707_10014891 | Ga0207707_100148914 | 317 |
| 418 | 3300025912 | Ga0207707_10087837 | Ga0207707_100878373 | 317 |
| 419 | 3300025912 | Ga0207707_10102596 | Ga0207707_101025962 | 317 |
| 420 | 3300025913 | Ga0207695_10010387 | Ga0207695_100103879 | 317 |
| 421 | 3300025913 | Ga0207695_10012954 | Ga0207695_100129544 | 317 |
| 422 | 3300025921 | Ga0207652_10020366 | Ga0207652_100203664 | 317 |
| 423 | 3300025924 | Ga0207694_10002726 | Ga0207694_1000272610 | 317 |
| 424 | 3300025928 | Ga0207700_10131786 | Ga0207700_101317861 | 317 |
| 425 | 3300025929 | Ga0207664_10000236 | Ga0207664_100002366 | 317 |
| 426 | 3300025929 | Ga0207664_10383132 | Ga0207664_103831322 | 317 |
| 427 | 3300025933 | Ga0207706_10117637 | Ga0207706_101176371 | 317 |
| 428 | 3300025944 | Ga0207661_10008828 | Ga0207661_100088285 | 317 |
| 429 | 3300025944 | Ga0207661_10036433 | Ga0207661_100364333 | 317 |
| 430 | 3300025945 | Ga0207679_10126932 | Ga0207679_101269322 | 317 |
| 431 | 3300025949 | Ga0207667_10004960 | Ga0207667_1000496014 | 317 |
| 432 | 3300025949 | Ga0207667_10005735 | Ga0207667_1000573510 | 317 |
| 433 | 3300025981 | Ga0207640_10031466 | Ga0207640_100314662 | 317 |
| 434 | 3300026023 | Ga0207677_10005897 | Ga0207677_100058975 | 317 |
| 435 | 3300026035 | Ga0207703_10007386 | Ga0207703_100073867 | 317 |
| 436 | 3300026078 | Ga0207702_10004124 | Ga0207702_100041249 | 317 |
| 437 | 3300026078 | Ga0207702_10004714 | Ga0207702_100047142 | 317 |
| 438 | 3300026088 | Ga0207641_10030130 | Ga0207641_100301302 | 317 |
| 439 | 3300026095 | Ga0207676_10215489 | Ga0207676_102154891 | 317 |
| 440 | 3300026116 | Ga0207674_10013634 | Ga0207674_100136344 | 317 |
| 441 | 3300026142 | Ga0207698_10062432 | Ga0207698_100624322 | 317 |
| 442 | 3300028800 | Ga0265338_10002458 | Ga0265338_1000245813 | 317 |
| 443 | 3300031239 | Ga0265328_10018624 | Ga0265328_100186241 | 317 |
| 444 | 3300031241 | Ga0265325_10060656 | Ga0265325_100606561 | 317 |
| 445 | 3300031249 | Ga0265339_10003585 | Ga0265339_100035855 | 317 |
| 446 | 3300031344 | Ga0265316_10185213 | Ga0265316_101852132 | 317 |
| 447 | 3300035113 | Ga0373936_0000415 | Ga0373936_0000415_8279_9361 | 317 |
| 448 | 3300035113 | Ga0373936_0028326 | Ga0373936_0028326_760_1845 | 317 |
| 449 | 3300035113 | Ga0373936_0100436 | Ga0373936_0100436_88_1170 | 317 |
| 450 | 3300035116 | Ga0373945_0004899 | Ga0373945_0004899_2732_3814 | 317 |
| 451 | 3300035119 | Ga0373956_0030158 | Ga0373956_0030158_1191_2273 | 317 |
| 452 | 3300035170 | Ga0373943_0000008 | Ga0373943_0000008_16348_17430 | 317 |
| 453 | 3300035170 | Ga0373943_0019598 | Ga0373943_0019598_1002_2084 | 317 |
| 454 | 3300035171 | Ga0373946_0071447 | Ga0373946_0071447_290_1372 | 317 |
| 455 | 3300035691 | Ga0373931_0021534 | Ga0373931_0021534_183_1265 | 317 |
| 456 | 3300035692 | Ga0373935_0009541 | Ga0373935_0009541_263_1348 | 317 |
| 457 | 3300035692 | Ga0373935_0049826 | Ga0373935_0049826_253_1335 | 317 |
| 458 | 3300035725 | Ga0373947_0000210 | Ga0373947_0000210_14262_15344 | 317 |
| 459 | 3300035725 | Ga0373947_0003427 | Ga0373947_0003427_5857_6939 | 317 |
| 460 | 3300035725 | Ga0373947_0190382 | Ga0373947_0190382_122_1204 | 317 |
| 461 | 3300037068 | Ga0373925_0001100 | Ga0373925_0001100_5060_6142 | 317 |
| 462 | 3300037068 | Ga0373925_0069116 | Ga0373925_0069116_210_1292 | 317 |
| 463 | 3300037068 | Ga0373925_0109594 | Ga0373925_0109594_57_1142 | 317 |
| 464 | 3300037471 | Ga0395905_0005868 | Ga0395905_0005868_10202_11284 | 317 |
| 465 | 3300037471 | Ga0395905_0153843 | Ga0395905_0153843_1050_2132 | 317 |
| 466 | 3300039438 | Ga0436360_0213845 | Ga0436360_0213845_3126_4211 | 317 |
| 467 | 3300039447 | Ga0436361_0251067 | Ga0436361_0251067_2161_3246 | 317 |
| 468 | 3300039450 | Ga0436363_0281651 | Ga0436363_0281651_898_1980 | 317 |
| 469 | 3300045049 | Ga0466959_0003455 | Ga0466959_0003455_828_1910 | 317 |
| 470 | 3300046459 | Ga0495629_0004259 | Ga0495629_0004259_927_2012 | 317 |
| 471 | 3300046463 | Ga0495653_0170997 | Ga0495653_0170997_267_1349 | 317 |
| 472 | 3300046472 | Ga0495580_0000030 | Ga0495580_0000030_18296_19381 | 317 |
| 473 | 3300046472 | Ga0495580_0012099 | Ga0495580_0012099_3180_4313 | 317 |
| 474 | 3300046472 | Ga0495580_0014601 | Ga0495580_0014601_4129_5211 | 317 |
| 475 | 3300046476 | Ga0495662_0061711 | Ga0495662_0061711_550_1632 | 317 |
| 476 | 3300046529 | Ga0495652_0235316 | Ga0495652_0235316_79_1164 | 317 |
| 477 | 3300046535 | Ga0495586_0102828 | Ga0495586_0102828_250_1332 | 317 |
| 478 | 3300046543 | Ga0495645_0116461 | Ga0495645_0116461_372_1454 | 317 |
| 479 | 3300046678 | Ga0495599_0093240 | Ga0495599_0093240_404_1489 | 317 |
| 480 | 3300046681 | Ga0495647_0001185 | Ga0495647_0001185_5614_6696 | 317 |
| 481 | 3300046681 | Ga0495647_0022524 | Ga0495647_0022524_86_1168 | 317 |
| 482 | 3300046683 | Ga0495658_0007219 | Ga0495658_0007219_1785_2870 | 317 |
| 483 | 3300046690 | Ga0495624_0053189 | Ga0495624_0053189_604_1686 | 317 |
| 484 | 3300046690 | Ga0495624_0097789 | Ga0495624_0097789_24_1106 | 317 |
| 485 | 3300047315 | Ga0495581_0033780 | Ga0495581_0033780_1572_2657 | 317 |
| 486 | 3300047319 | Ga0495674_0010257 | Ga0495674_0010257_7751_8833 | 317 |
| 487 | 3300047319 | Ga0495674_0012423 | Ga0495674_0012423_4068_5153 | 317 |
| 488 | 3300048088 | Ga0495602_0012288 | Ga0495602_0012288_6032_7114 | 317 |
| 489 | 3300048088 | Ga0495602_0103407 | Ga0495602_0103407_549_1682 | 317 |
| 490 | 3300048088 | Ga0495602_0164402 | Ga0495602_0164402_143_1225 | 317 |
| 491 | 3300048905 | Ga0496102_0203500 | Ga0496102_0203500_213_1295 | 317 |
| 492 | 3300048915 | Ga0496112_0027607 | Ga0496112_0027607_3093_4175 | 317 |
| 493 | 3300048916 | Ga0496113_0205920 | Ga0496113_0205920_327_1412 | 317 |
| 494 | 3300048918 | Ga0496115_0103391 | Ga0496115_0103391_220_1302 | 317 |
| 495 | 3300048918 | Ga0496115_0124740 | Ga0496115_0124740_119_1201 | 317 |
| 496 | 3300050514 | nmdc:mga08x19_1929_c1 | nmdc:mga08x19_1929_c1_2888_3970 | 317 |
| 497 | 3300053077 | Ga0495601_0014941 | Ga0495601_0014941_1083_2168 | 317 |
| 498 | 3300000546 | LJNas_1000030 | LJNas_100003011 | 318 |
| 499 | 3300005290 | Ga0065712_10082696 | Ga0065712_100826963 | 318 |
| 500 | 3300005293 | Ga0065715_10005347 | Ga0065715_100053475 | 318 |
| 501 | 3300005327 | Ga0070658_10008281 | Ga0070658_100082812 | 318 |
| 502 | 3300005329 | Ga0070683_100023745 | Ga0070683_1000237453 | 318 |
| 503 | 3300005329 | Ga0070683_100073509 | Ga0070683_1000735092 | 318 |
| 504 | 3300005329 | Ga0070683_100124847 | Ga0070683_1001248471 | 318 |
| 505 | 3300005330 | Ga0070690_100019152 | Ga0070690_1000191525 | 318 |
| 506 | 3300005337 | Ga0070682_100025404 | Ga0070682_1000254043 | 318 |
| 507 | 3300005337 | Ga0070682_100072094 | Ga0070682_1000720941 | 318 |
| 508 | 3300005338 | Ga0068868_100003271 | Ga0068868_1000032716 | 318 |
| 509 | 3300005338 | Ga0068868_100144157 | Ga0068868_1001441572 | 318 |
| 510 | 3300005339 | Ga0070660_100017960 | Ga0070660_1000179603 | 318 |
| 511 | 3300005340 | Ga0070689_100104284 | Ga0070689_1001042842 | 318 |
| 512 | 3300005344 | Ga0070661_100013208 | Ga0070661_1000132086 | 318 |
| 513 | 3300005345 | Ga0070692_10063076 | Ga0070692_100630763 | 318 |
| 514 | 3300005366 | Ga0070659_100001774 | Ga0070659_1000017747 | 318 |
| 515 | 3300005366 | Ga0070659_100047742 | Ga0070659_1000477423 | 318 |
| 516 | 3300005366 | Ga0070659_100180081 | Ga0070659_1001800812 | 318 |
| 517 | 3300005367 | Ga0070667_100016724 | Ga0070667_1000167243 | 318 |
| 518 | 3300005434 | Ga0070709_10010577 | Ga0070709_100105775 | 318 |
| 519 | 3300005434 | Ga0070709_10099898 | Ga0070709_100998983 | 318 |
| 520 | 3300005434 | Ga0070709_10159034 | Ga0070709_101590342 | 318 |
| 521 | 3300005436 | Ga0070713_100001829 | Ga0070713_1000018296 | 318 |
| 522 | 3300005436 | Ga0070713_100035935 | Ga0070713_1000359353 | 318 |
| 523 | 3300005436 | Ga0070713_100072481 | Ga0070713_1000724812 | 318 |
| 524 | 3300005436 | Ga0070713_100278395 | Ga0070713_1002783951 | 318 |
| 525 | 3300005437 | Ga0070710_10011166 | Ga0070710_100111663 | 318 |
| 526 | 3300005437 | Ga0070710_10023173 | Ga0070710_100231733 | 318 |
| 527 | 3300005439 | Ga0070711_100000853 | Ga0070711_10000085310 | 318 |
| 528 | 3300005439 | Ga0070711_100003707 | Ga0070711_1000037079 | 318 |
| 529 | 3300005439 | Ga0070711_100006707 | Ga0070711_1000067076 | 318 |
| 530 | 3300005439 | Ga0070711_100028176 | Ga0070711_1000281761 | 318 |
| 531 | 3300005445 | Ga0070708_100001236 | Ga0070708_10000123620 | 318 |
| 532 | 3300005445 | Ga0070708_100003294 | Ga0070708_10000329412 | 318 |
| 533 | 3300005445 | Ga0070708_100009412 | Ga0070708_1000094126 | 318 |
| 534 | 3300005445 | Ga0070708_100056408 | Ga0070708_1000564083 | 318 |
| 535 | 3300005445 | Ga0070708_100133693 | Ga0070708_1001336931 | 318 |
| 536 | 3300005445 | Ga0070708_100249424 | Ga0070708_1002494242 | 318 |
| 537 | 3300005455 | Ga0070663_100029925 | Ga0070663_1000299254 | 318 |
| 538 | 3300005455 | Ga0070663_100285823 | Ga0070663_1002858231 | 318 |
| 539 | 3300005457 | Ga0070662_100003783 | Ga0070662_1000037835 | 318 |
| 540 | 3300005458 | Ga0070681_10029017 | Ga0070681_100290173 | 318 |
| 541 | 3300005458 | Ga0070681_10043735 | Ga0070681_100437351 | 318 |
| 542 | 3300005458 | Ga0070681_10065484 | Ga0070681_100654843 | 318 |
| 543 | 3300005458 | Ga0070681_10080793 | Ga0070681_100807932 | 318 |
| 544 | 3300005458 | Ga0070681_10183321 | Ga0070681_101833212 | 318 |
| 545 | 3300005458 | Ga0070681_10279990 | Ga0070681_102799902 | 318 |
| 546 | 3300005467 | Ga0070706_100089843 | Ga0070706_1000898432 | 318 |
| 547 | 3300005467 | Ga0070706_100121889 | Ga0070706_1001218892 | 318 |
| 548 | 3300005468 | Ga0070707_100039011 | Ga0070707_1000390114 | 318 |
| 549 | 3300005468 | Ga0070707_100068216 | Ga0070707_1000682161 | 318 |
| 550 | 3300005468 | Ga0070707_100165504 | Ga0070707_1001655042 | 318 |
| 551 | 3300005468 | Ga0070707_100291535 | Ga0070707_1002915352 | 318 |
| 552 | 3300005468 | Ga0070707_100401036 | Ga0070707_1004010361 | 318 |
| 553 | 3300005471 | Ga0070698_100071416 | Ga0070698_1000714163 | 318 |
| 554 | 3300005471 | Ga0070698_100108039 | Ga0070698_1001080392 | 318 |
| 555 | 3300005518 | Ga0070699_100000132 | Ga0070699_10000013261 | 318 |
| 556 | 3300005518 | Ga0070699_100005299 | Ga0070699_1000052998 | 318 |
| 557 | 3300005530 | Ga0070679_100026608 | Ga0070679_1000266084 | 318 |
| 558 | 3300005530 | Ga0070679_100226295 | Ga0070679_1002262952 | 318 |
| 559 | 3300005535 | Ga0070684_100019101 | Ga0070684_1000191014 | 318 |
| 560 | 3300005536 | Ga0070697_100002074 | Ga0070697_1000020747 | 318 |
| 561 | 3300005536 | Ga0070697_100009348 | Ga0070697_1000093481 | 318 |
| 562 | 3300005536 | Ga0070697_100047734 | Ga0070697_1000477343 | 318 |
| 563 | 3300005536 | Ga0070697_100100092 | Ga0070697_1001000922 | 318 |
| 564 | 3300005539 | Ga0068853_100000037 | Ga0068853_10000003797 | 318 |
| 565 | 3300005539 | Ga0068853_100056031 | Ga0068853_1000560313 | 318 |
| 566 | 3300005539 | Ga0068853_100368596 | Ga0068853_1003685961 | 318 |
| 567 | 3300005547 | Ga0070693_100196767 | Ga0070693_1001967671 | 318 |
| 568 | 3300005548 | Ga0070665_100018526 | Ga0070665_1000185262 | 318 |
| 569 | 3300005549 | Ga0070704_100023033 | Ga0070704_1000230333 | 318 |
| 570 | 3300005563 | Ga0068855_100021781 | Ga0068855_1000217812 | 318 |
| 571 | 3300005563 | Ga0068855_100048418 | Ga0068855_1000484181 | 318 |
| 572 | 3300005563 | Ga0068855_100171575 | Ga0068855_1001715753 | 318 |
| 573 | 3300005564 | Ga0070664_100047668 | Ga0070664_1000476684 | 318 |
| 574 | 3300005578 | Ga0068854_100000033 | Ga0068854_10000003311 | 318 |
| 575 | 3300005578 | Ga0068854_100013918 | Ga0068854_1000139184 | 318 |
| 576 | 3300005614 | Ga0068856_100003671 | Ga0068856_1000036714 | 318 |
| 577 | 3300005614 | Ga0068856_100017943 | Ga0068856_1000179435 | 318 |
| 578 | 3300005614 | Ga0068856_100081233 | Ga0068856_1000812333 | 318 |
| 579 | 3300005614 | Ga0068856_100338431 | Ga0068856_1003384312 | 318 |
| 580 | 3300005615 | Ga0070702_100058774 | Ga0070702_1000587742 | 318 |
| 581 | 3300005616 | Ga0068852_100027695 | Ga0068852_1000276951 | 318 |
| 582 | 3300005616 | Ga0068852_100078716 | Ga0068852_1000787163 | 318 |
| 583 | 3300005616 | Ga0068852_100362686 | Ga0068852_1003626861 | 318 |
| 584 | 3300005616 | Ga0068852_100489488 | Ga0068852_1004894881 | 318 |
| 585 | 3300005834 | Ga0068851_10015181 | Ga0068851_100151814 | 318 |
| 586 | 3300005841 | Ga0068863_100133922 | Ga0068863_1001339222 | 318 |
| 587 | 3300005842 | Ga0068858_100145915 | Ga0068858_1001459153 | 318 |
| 588 | 3300005843 | Ga0068860_100084794 | Ga0068860_1000847943 | 318 |
| 589 | 3300005981 | Ga0081538_10011454 | Ga0081538_100114545 | 318 |
| 590 | 3300005981 | Ga0081538_10014162 | Ga0081538_100141623 | 318 |
| 591 | 3300005981 | Ga0081538_10053514 | Ga0081538_100535142 | 318 |
| 592 | 3300006028 | Ga0070717_10005131 | Ga0070717_100051314 | 318 |
| 593 | 3300006028 | Ga0070717_10025624 | Ga0070717_100256243 | 318 |
| 594 | 3300006028 | Ga0070717_10214419 | Ga0070717_102144192 | 318 |
| 595 | 3300006163 | Ga0070715_10001303 | Ga0070715_100013036 | 318 |
| 596 | 3300006163 | Ga0070715_10001715 | Ga0070715_100017153 | 318 |
| 597 | 3300006163 | Ga0070715_10011808 | Ga0070715_100118082 | 318 |
| 598 | 3300006173 | Ga0070716_100000452 | Ga0070716_1000004523 | 318 |
| 599 | 3300006175 | Ga0070712_100001507 | Ga0070712_1000015072 | 318 |
| 600 | 3300006175 | Ga0070712_100001608 | Ga0070712_1000016087 | 318 |
| 601 | 3300006175 | Ga0070712_100005436 | Ga0070712_1000054365 | 318 |
| 602 | 3300006175 | Ga0070712_100008495 | Ga0070712_1000084954 | 318 |
| 603 | 3300006175 | Ga0070712_100024297 | Ga0070712_1000242973 | 318 |
| 604 | 3300006237 | Ga0097621_100018133 | Ga0097621_1000181335 | 318 |
| 605 | 3300006358 | Ga0068871_100035453 | Ga0068871_1000354533 | 318 |
| 606 | 3300006358 | Ga0068871_100090482 | Ga0068871_1000904822 | 318 |
| 607 | 3300006358 | Ga0068871_100393766 | Ga0068871_1003937661 | 318 |
| 608 | 3300006847 | Ga0075431_100365843 | Ga0075431_1003658432 | 318 |
| 609 | 3300006871 | Ga0075434_100094472 | Ga0075434_1000944723 | 318 |
| 610 | 3300006881 | Ga0068865_100015548 | Ga0068865_1000155483 | 318 |
| 611 | 3300006881 | Ga0068865_100139110 | Ga0068865_1001391102 | 318 |
| 612 | 3300009093 | Ga0105240_10025905 | Ga0105240_100259052 | 318 |
| 613 | 3300009093 | Ga0105240_10029156 | Ga0105240_100291567 | 318 |
| 614 | 3300009093 | Ga0105240_10062461 | Ga0105240_100624614 | 318 |
| 615 | 3300009098 | Ga0105245_10004753 | Ga0105245_100047534 | 318 |
| 616 | 3300009098 | Ga0105245_10005718 | Ga0105245_100057184 | 318 |
| 617 | 3300009101 | Ga0105247_10073600 | Ga0105247_100736002 | 318 |
| 618 | 3300009148 | Ga0105243_10124235 | Ga0105243_101242353 | 318 |
| 619 | 3300009174 | Ga0105241_10015408 | Ga0105241_100154086 | 318 |
| 620 | 3300009174 | Ga0105241_10021542 | Ga0105241_100215421 | 318 |
| 621 | 3300009174 | Ga0105241_10025045 | Ga0105241_100250454 | 318 |
| 622 | 3300009177 | Ga0105248_10006181 | Ga0105248_1000618114 | 318 |
| 623 | 3300009177 | Ga0105248_10224396 | Ga0105248_102243962 | 318 |
| 624 | 3300009545 | Ga0105237_10111196 | Ga0105237_101111961 | 318 |
| 625 | 3300009545 | Ga0105237_10123375 | Ga0105237_101233753 | 318 |
| 626 | 3300009551 | Ga0105238_10042543 | Ga0105238_100425432 | 318 |
| 627 | 3300009551 | Ga0105238_10054425 | Ga0105238_100544253 | 318 |
| 628 | 3300009551 | Ga0105238_10079079 | Ga0105238_100790792 | 318 |
| 629 | 3300009551 | Ga0105238_10319411 | Ga0105238_103194112 | 318 |
| 630 | 3300009553 | Ga0105249_10004362 | Ga0105249_100043628 | 318 |
| 631 | 3300010375 | Ga0105239_10219030 | Ga0105239_102190303 | 318 |
| 632 | 3300011119 | Ga0105246_10051038 | Ga0105246_100510381 | 318 |
| 633 | 3300013100 | Ga0157373_10025405 | Ga0157373_100254054 | 318 |
| 634 | 3300013100 | Ga0157373_10028127 | Ga0157373_100281273 | 318 |
| 635 | 3300013100 | Ga0157373_10238716 | Ga0157373_102387161 | 318 |
| 636 | 3300013102 | Ga0157371_10010962 | Ga0157371_100109626 | 318 |
| 637 | 3300013104 | Ga0157370_10010916 | Ga0157370_100109167 | 318 |
| 638 | 3300013105 | Ga0157369_10029189 | Ga0157369_100291894 | 318 |
| 639 | 3300013105 | Ga0157369_10031833 | Ga0157369_100318333 | 318 |
| 640 | 3300013105 | Ga0157369_10301322 | Ga0157369_103013221 | 318 |
| 641 | 3300013296 | Ga0157374_10015624 | Ga0157374_100156245 | 318 |
| 642 | 3300013296 | Ga0157374_10058827 | Ga0157374_100588273 | 318 |
| 643 | 3300013296 | Ga0157374_10230224 | Ga0157374_102302242 | 318 |
| 644 | 3300013297 | Ga0157378_10052854 | Ga0157378_100528542 | 318 |
| 645 | 3300013297 | Ga0157378_10095798 | Ga0157378_100957981 | 318 |
| 646 | 3300013297 | Ga0157378_10110162 | Ga0157378_101101623 | 318 |
| 647 | 3300013306 | Ga0163162_10000661 | Ga0163162_1000066123 | 318 |
| 648 | 3300013306 | Ga0163162_10004705 | Ga0163162_100047059 | 318 |
| 649 | 3300013306 | Ga0163162_10256934 | Ga0163162_102569342 | 318 |
| 650 | 3300013307 | Ga0157372_10012590 | Ga0157372_100125904 | 318 |
| 651 | 3300013307 | Ga0157372_10019219 | Ga0157372_100192195 | 318 |
| 652 | 3300013308 | Ga0157375_10013927 | Ga0157375_100139274 | 318 |
| 653 | 3300014325 | Ga0163163_10002219 | Ga0163163_100022199 | 318 |
| 654 | 3300014325 | Ga0163163_10018353 | Ga0163163_100183531 | 318 |
| 655 | 3300014497 | Ga0182008_10010743 | Ga0182008_100107432 | 318 |
| 656 | 3300014968 | Ga0157379_10006386 | Ga0157379_100063865 | 318 |
| 657 | 3300014968 | Ga0157379_10108889 | Ga0157379_101088893 | 318 |
| 658 | 3300014969 | Ga0157376_10024100 | Ga0157376_100241006 | 318 |
| 659 | 3300015261 | Ga0182006_1021302 | Ga0182006_10213022 | 318 |
| 660 | 3300022730 | Ga0224570_100894 | Ga0224570_1008941 | 318 |
| 661 | 3300024225 | Ga0224572_1008666 | Ga0224572_10086662 | 318 |
| 662 | 3300024227 | Ga0228598_1001285 | Ga0228598_10012853 | 318 |
| 663 | 3300025321 | Ga0207656_10016535 | Ga0207656_100165353 | 318 |
| 664 | 3300025898 | Ga0207692_10018779 | Ga0207692_100187791 | 318 |
| 665 | 3300025899 | Ga0207642_10009662 | Ga0207642_100096624 | 318 |
| 666 | 3300025903 | Ga0207680_10016488 | Ga0207680_100164883 | 318 |
| 667 | 3300025905 | Ga0207685_10002829 | Ga0207685_100028294 | 318 |
| 668 | 3300025906 | Ga0207699_10028174 | Ga0207699_100281742 | 318 |
| 669 | 3300025906 | Ga0207699_10137136 | Ga0207699_101371362 | 318 |
| 670 | 3300025906 | Ga0207699_10153623 | Ga0207699_101536232 | 318 |
| 671 | 3300025907 | Ga0207645_10067112 | Ga0207645_100671123 | 318 |
| 672 | 3300025910 | Ga0207684_10004409 | Ga0207684_1000440911 | 318 |
| 673 | 3300025910 | Ga0207684_10056542 | Ga0207684_100565421 | 318 |
| 674 | 3300025910 | Ga0207684_10260967 | Ga0207684_102609671 | 318 |
| 675 | 3300025911 | Ga0207654_10004737 | Ga0207654_100047376 | 318 |
| 676 | 3300025911 | Ga0207654_10015966 | Ga0207654_100159663 | 318 |
| 677 | 3300025911 | Ga0207654_10057178 | Ga0207654_100571782 | 318 |
| 678 | 3300025912 | Ga0207707_10026426 | Ga0207707_100264265 | 318 |
| 679 | 3300025912 | Ga0207707_10027675 | Ga0207707_100276753 | 318 |
| 680 | 3300025912 | Ga0207707_10135761 | Ga0207707_101357612 | 318 |
| 681 | 3300025913 | Ga0207695_10006448 | Ga0207695_100064487 | 318 |
| 682 | 3300025913 | Ga0207695_10029044 | Ga0207695_100290444 | 318 |
| 683 | 3300025913 | Ga0207695_10038078 | Ga0207695_100380784 | 318 |
| 684 | 3300025913 | Ga0207695_10386953 | Ga0207695_103869531 | 318 |
| 685 | 3300025914 | Ga0207671_10011449 | Ga0207671_100114493 | 318 |
| 686 | 3300025915 | Ga0207693_10000013 | Ga0207693_1000001310 | 318 |
| 687 | 3300025915 | Ga0207693_10000304 | Ga0207693_1000030432 | 318 |
| 688 | 3300025915 | Ga0207693_10005944 | Ga0207693_100059445 | 318 |
| 689 | 3300025916 | Ga0207663_10012437 | Ga0207663_100124372 | 318 |
| 690 | 3300025916 | Ga0207663_10015375 | Ga0207663_100153754 | 318 |
| 691 | 3300025916 | Ga0207663_10024839 | Ga0207663_100248394 | 318 |
| 692 | 3300025917 | Ga0207660_10042428 | Ga0207660_100424284 | 318 |
| 693 | 3300025917 | Ga0207660_10283891 | Ga0207660_102838912 | 318 |
| 694 | 3300025919 | Ga0207657_10001110 | Ga0207657_1000111012 | 318 |
| 695 | 3300025919 | Ga0207657_10002518 | Ga0207657_100025186 | 318 |
| 696 | 3300025919 | Ga0207657_10006370 | Ga0207657_100063703 | 318 |
| 697 | 3300025919 | Ga0207657_10094271 | Ga0207657_100942712 | 318 |
| 698 | 3300025920 | Ga0207649_10008330 | Ga0207649_100083306 | 318 |
| 699 | 3300025921 | Ga0207652_10027282 | Ga0207652_100272823 | 318 |
| 700 | 3300025922 | Ga0207646_10000194 | Ga0207646_1000019487 | 318 |
| 701 | 3300025922 | Ga0207646_10044144 | Ga0207646_100441443 | 318 |
| 702 | 3300025922 | Ga0207646_10161287 | Ga0207646_101612871 | 318 |
| 703 | 3300025922 | Ga0207646_10274326 | Ga0207646_102743262 | 318 |
| 704 | 3300025924 | Ga0207694_10063235 | Ga0207694_100632353 | 318 |
| 705 | 3300025925 | Ga0207650_10146490 | Ga0207650_101464902 | 318 |
| 706 | 3300025927 | Ga0207687_10006362 | Ga0207687_100063623 | 318 |
| 707 | 3300025928 | Ga0207700_10001442 | Ga0207700_100014428 | 318 |
| 708 | 3300025928 | Ga0207700_10002926 | Ga0207700_100029268 | 318 |
| 709 | 3300025928 | Ga0207700_10084381 | Ga0207700_100843812 | 318 |
| 710 | 3300025928 | Ga0207700_10309336 | Ga0207700_103093361 | 318 |
| 711 | 3300025929 | Ga0207664_10039149 | Ga0207664_100391492 | 318 |
| 712 | 3300025929 | Ga0207664_10062377 | Ga0207664_100623771 | 318 |
| 713 | 3300025929 | Ga0207664_10180529 | Ga0207664_101805292 | 318 |
| 714 | 3300025931 | Ga0207644_10144761 | Ga0207644_101447612 | 318 |
| 715 | 3300025932 | Ga0207690_10011497 | Ga0207690_100114974 | 318 |
| 716 | 3300025933 | Ga0207706_10002659 | Ga0207706_100026593 | 318 |
| 717 | 3300025938 | Ga0207704_10008613 | Ga0207704_100086135 | 318 |
| 718 | 3300025939 | Ga0207665_10000300 | Ga0207665_100003005 | 318 |
| 719 | 3300025939 | Ga0207665_10021434 | Ga0207665_100214342 | 318 |
| 720 | 3300025939 | Ga0207665_10061163 | Ga0207665_100611633 | 318 |
| 721 | 3300025939 | Ga0207665_10220885 | Ga0207665_102208851 | 318 |
| 722 | 3300025939 | Ga0207665_10259687 | Ga0207665_102596871 | 318 |
| 723 | 3300025941 | Ga0207711_10000892 | Ga0207711_100008923 | 318 |
| 724 | 3300025941 | Ga0207711_10154254 | Ga0207711_101542542 | 318 |
| 725 | 3300025944 | Ga0207661_10150762 | Ga0207661_101507622 | 318 |
| 726 | 3300025949 | Ga0207667_10004320 | Ga0207667_100043206 | 318 |
| 727 | 3300025949 | Ga0207667_10032158 | Ga0207667_100321583 | 318 |
| 728 | 3300025949 | Ga0207667_10308249 | Ga0207667_103082491 | 318 |
| 729 | 3300025961 | Ga0207712_10010691 | Ga0207712_100106914 | 318 |
| 730 | 3300025972 | Ga0207668_10017235 | Ga0207668_100172352 | 318 |
| 731 | 3300025981 | Ga0207640_10000001 | Ga0207640_1000000111 | 318 |
| 732 | 3300025981 | Ga0207640_10006049 | Ga0207640_100060494 | 318 |
| 733 | 3300026023 | Ga0207677_10143506 | Ga0207677_101435062 | 318 |
| 734 | 3300026041 | Ga0207639_10000060 | Ga0207639_1000006097 | 318 |
| 735 | 3300026041 | Ga0207639_10077233 | Ga0207639_100772333 | 318 |
| 736 | 3300026067 | Ga0207678_10002206 | Ga0207678_100022064 | 318 |
| 737 | 3300026067 | Ga0207678_10036947 | Ga0207678_100369474 | 318 |
| 738 | 3300026067 | Ga0207678_10087929 | Ga0207678_100879293 | 318 |
| 739 | 3300026078 | Ga0207702_10021839 | Ga0207702_100218394 | 318 |
| 740 | 3300026078 | Ga0207702_10044471 | Ga0207702_100444713 | 318 |
| 741 | 3300026078 | Ga0207702_10055944 | Ga0207702_100559443 | 318 |
| 742 | 3300026089 | Ga0207648_10009510 | Ga0207648_100095105 | 318 |
| 743 | 3300026116 | Ga0207674_10023971 | Ga0207674_100239712 | 318 |
| 744 | 3300026116 | Ga0207674_10043568 | Ga0207674_100435682 | 318 |
| 745 | 3300026116 | Ga0207674_10097741 | Ga0207674_100977413 | 318 |
| 746 | 3300026116 | Ga0207674_10137621 | Ga0207674_101376212 | 318 |
| 747 | 3300026142 | Ga0207698_10108539 | Ga0207698_101085392 | 318 |
| 748 | 3300028017 | Ga0265356_1000091 | Ga0265356_10000917 | 318 |
| 749 | 3300028379 | Ga0268266_10027246 | Ga0268266_100272463 | 318 |
| 750 | 3300028380 | Ga0268265_10003986 | Ga0268265_100039864 | 318 |
| 751 | 3300031090 | Ga0265760_10005583 | Ga0265760_100055833 | 318 |
| 752 | 3300031247 | Ga0265340_10062246 | Ga0265340_100622461 | 318 |
| 753 | 3300031344 | Ga0265316_10001343 | Ga0265316_100013438 | 318 |
| 754 | 3300031548 | Ga0307408_100233932 | Ga0307408_1002339321 | 318 |
| 755 | 3300031711 | Ga0265314_10004443 | Ga0265314_1000444313 | 318 |
| 756 | 3300031731 | Ga0307405_10060351 | Ga0307405_100603511 | 318 |
| 757 | 3300031852 | Ga0307410_10027211 | Ga0307410_100272113 | 318 |
| 758 | 3300031901 | Ga0307406_10010272 | Ga0307406_100102722 | 318 |
| 759 | 3300031995 | Ga0307409_100152228 | Ga0307409_1001522281 | 318 |
| 760 | 3300032005 | Ga0307411_10080737 | Ga0307411_100807372 | 318 |
| 761 | 3300032126 | Ga0307415_100012094 | Ga0307415_1000120945 | 318 |
| 762 | 3300034957 | Ga0373938_0014476 | Ga0373938_0014476_32_1117 | 318 |
| 763 | 3300035083 | Ga0373926_0000844 | Ga0373926_0000844_5039_6124 | 318 |
| 764 | 3300035119 | Ga0373956_0038528 | Ga0373956_0038528_482_1567 | 318 |
| 765 | 3300035170 | Ga0373943_0001473 | Ga0373943_0001473_5610_6695 | 318 |
| 766 | 3300035171 | Ga0373946_0025051 | Ga0373946_0025051_89_1174 | 318 |
| 767 | 3300035242 | Ga0373962_0049590 | Ga0373962_0049590_106_1191 | 318 |
| 768 | 3300035410 | Ga0373924_0000042 | Ga0373924_0000042_22463_23548 | 318 |
| 769 | 3300035691 | Ga0373931_0027649 | Ga0373931_0027649_228_1313 | 318 |
| 770 | 3300035692 | Ga0373935_0115779 | Ga0373935_0115779_156_1241 | 318 |
| 771 | 3300035695 | Ga0373927_0002504 | Ga0373927_0002504_8753_9838 | 318 |
| 772 | 3300035725 | Ga0373947_0010928 | Ga0373947_0010928_629_1714 | 318 |
| 773 | 3300036401 | Ga0373937_0000648 | Ga0373937_0000648_7621_8706 | 318 |
| 774 | 3300037068 | Ga0373925_0146327 | Ga0373925_0146327_571_1656 | 318 |
| 775 | 3300037068 | Ga0373925_0271834 | Ga0373925_0271834_54_1139 | 318 |
| 776 | 3300039438 | Ga0436360_0669763 | Ga0436360_0669763_919_2004 | 318 |
| 777 | 3300044694 | Ga0466963_0138548 | Ga0466963_0138548_175_1260 | 318 |
| 778 | 3300044842 | Ga0466957_0000292 | Ga0466957_0000292_9254_10339 | 318 |
| 779 | 3300045976 | Ga0466967_0022966 | Ga0466967_0022966_180_1265 | 318 |
| 780 | 3300046462 | Ga0495651_0211020 | Ga0495651_0211020_235_1320 | 318 |
| 781 | 3300046472 | Ga0495580_0000136 | Ga0495580_0000136_14537_15622 | 318 |
| 782 | 3300046472 | Ga0495580_0000228 | Ga0495580_0000228_617_1702 | 318 |
| 783 | 3300046472 | Ga0495580_0008064 | Ga0495580_0008064_5583_6668 | 318 |
| 784 | 3300046472 | Ga0495580_0013162 | Ga0495580_0013162_419_1504 | 318 |
| 785 | 3300046472 | Ga0495580_0063547 | Ga0495580_0063547_494_1579 | 318 |
| 786 | 3300046559 | Ga0495667_0091170 | Ga0495667_0091170_844_1929 | 318 |
| 787 | 3300046663 | Ga0495635_0030503 | Ga0495635_0030503_1693_2778 | 318 |
| 788 | 3300046664 | Ga0495659_0028465 | Ga0495659_0028465_449_1534 | 318 |
| 789 | 3300046679 | Ga0495623_0154345 | Ga0495623_0154345_186_1271 | 318 |
| 790 | 3300046683 | Ga0495658_0147555 | Ga0495658_0147555_263_1348 | 318 |
| 791 | 3300046684 | Ga0495669_0024760 | Ga0495669_0024760_1336_2424 | 318 |
| 792 | 3300046684 | Ga0495669_0098135 | Ga0495669_0098135_77_1162 | 318 |
| 793 | 3300047315 | Ga0495581_0035520 | Ga0495581_0035520_1513_2598 | 318 |
| 794 | 3300047444 | Ga0495675_0073077 | Ga0495675_0073077_139_1224 | 318 |
| 795 | 3300048905 | Ga0496102_0064028 | Ga0496102_0064028_2249_3334 | 318 |
| 796 | 3300048906 | Ga0496103_0015234 | Ga0496103_0015234_1277_2362 | 318 |
| 797 | 3300048906 | Ga0496103_0044890 | Ga0496103_0044890_1277_2362 | 318 |
| 798 | 3300048906 | Ga0496103_0075671 | Ga0496103_0075671_548_1633 | 318 |
| 799 | 3300048907 | Ga0496104_0061976 | Ga0496104_0061976_262_1347 | 318 |
| 800 | 3300048907 | Ga0496104_0098604 | Ga0496104_0098604_360_1445 | 318 |
| 801 | 3300048907 | Ga0496104_0145363 | Ga0496104_0145363_93_1178 | 318 |
| 802 | 3300048908 | Ga0496105_0003734 | Ga0496105_0003734_4326_5411 | 318 |
| 803 | 3300048909 | Ga0496106_0096381 | Ga0496106_0096381_982_2067 | 318 |
| 804 | 3300048909 | Ga0496106_0153272 | Ga0496106_0153272_638_1723 | 318 |
| 805 | 3300048911 | Ga0496108_0207131 | Ga0496108_0207131_86_1171 | 318 |
| 806 | 3300048912 | Ga0496109_0296985 | Ga0496109_0296985_196_1281 | 318 |
| 807 | 3300048913 | Ga0496110_0102424 | Ga0496110_0102424_277_1362 | 318 |
| 808 | 3300048913 | Ga0496110_0207667 | Ga0496110_0207667_189_1274 | 318 |
| 809 | 3300048914 | Ga0496111_0001607 | Ga0496111_0001607_11731_12816 | 318 |
| 810 | 3300048915 | Ga0496112_0002814 | Ga0496112_0002814_8525_9610 | 318 |
| 811 | 3300048915 | Ga0496112_0040910 | Ga0496112_0040910_35_1120 | 318 |
| 812 | 3300048916 | Ga0496113_0014564 | Ga0496113_0014564_4217_5302 | 318 |
| 813 | 3300048916 | Ga0496113_0050186 | Ga0496113_0050186_31_1116 | 318 |
| 814 | 3300048918 | Ga0496115_0083457 | Ga0496115_0083457_1437_2522 | 318 |
| 815 | 3300048918 | Ga0496115_0156511 | Ga0496115_0156511_743_1828 | 318 |
| 816 | 3300048918 | Ga0496115_0220761 | Ga0496115_0220761_154_1239 | 318 |
| 817 | 3300050512 | nmdc:mga0n895_93913_c1 | nmdc:mga0n895_93913_c1_1228_2313 | 318 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hvz-assembly3.cif.gz_E | crystal structure of the tgs domain of the clolep_03100 protein from clostridium leptum, northeast structural genomics consortium target qlr13a | 0.8802 | 235 | 317 |
| 3hvz-assembly3.cif.gz_E | crystal structure of the tgs domain of the clolep_03100 protein from clostridium leptum, northeast structural genomics consortium target qlr13a | 0.8545 | 235 | 317 |
| 1ni3-assembly1.cif.gz_A | structure of the schizosaccharomyces pombe ychf gtpase | 0.8301 | 1 | 315 |
| 5ee0-assembly1.cif.gz_A | crystal structure of osychf1 at ph 6.5 | 0.8217 | 1 | 317 |
| 1ni3-assembly1.cif.gz_A | structure of the schizosaccharomyces pombe ychf gtpase | 0.8203 | 1 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L8F3_337_419_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9951 | 236 | 317 | 3.10.20.30 |
| af_Q7ZU42_294_388_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9895 | 224 | 317 | 3.10.20.30 |
| 2dbyA02 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9894 | 235 | 315 | 3.10.20.30 |
| af_Q6Z1J6_301_384_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9841 | 233 | 313 | 3.10.20.30 |
| af_K7L8F3_337_419_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9715 | 236 | 317 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W1VBG4-F1-model_v4 | GTP-binding protein | 0.9963 | 246 | 317 |
GO:0005737
GO:0016887 |
| AF-A0A095YEM4-F1-model_v4 | GTP-binding protein | 0.9937 | 220 | 318 |
GO:0005737
GO:0016887 |
| AF-K1T835-F1-model_v4 | Protein containing DUF933 | 0.9912 | 237 | 318 |
GO:0005737
GO:0016887 |
| AF-A0A2H0YA64-F1-model_v4 | Redox-regulated ATPase YchF | 0.9907 | 248 | 318 |
GO:0005737
GO:0016887 |
| AF-A0A2V9U246-F1-model_v4 | Redox-regulated ATPase YchF | 0.99 | 191 | 318 |
GO:0005737
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar