F482041

General Info

Members Datasets Scaffolds Average Seq Length
816 329 736 109

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10001714|JGI24740J21852_100017144
Length 110
Sequence MSERLSVQVCYALANEQALVDVQLPAGATLAQAIEASGILQRFPQIDLXTQKXGVFGKLKPLDTVLADHDRVEIYRPLLVDPKVSRQRRVEKTRKAGSIEGRRWQNKDSR

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
16 2519103095 Burkholderia sp. KJ006 Isolate Nodule
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
19 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
20 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
21 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
22 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
23 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
24 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
25 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
26 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
27 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
28 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
29 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
30 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
31 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
32 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
33 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
34 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
35 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
36 2818991450 Burkholderia sp. 604 Isolate Unclassified
37 2818991452 Burkholderia cepacia 561 Isolate Unclassified
38 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
39 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
40 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
41 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
42 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
43 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
44 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
45 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
46 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
47 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
48 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
49 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
50 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
51 2904564687 Burkholderia sp. 571 Isolate Unclassified
52 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
53 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
54 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
55 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
56 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
57 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
58 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
59 2928163908 Burkholderia sp. 567 Isolate Unclassified
60 2928170801 Burkholderia sp. 572 Isolate Unclassified
61 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
62 2928536128 Burkholderia sola 565 Isolate Unclassified
63 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
64 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
65 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
66 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
67 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
68 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
69 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
70 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
71 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
72 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
73 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
74 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
75 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
76 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
77 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
83 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
119 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
182 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
195 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
208 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
225 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
255 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
259 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
278 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
279 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
306 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
307 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
308 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
311 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
312 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
313 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
314 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
315 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
316 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
317 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
318 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
319 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
320 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
321 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
322 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
323 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
324 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
325 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
326 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
327 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
328 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
329 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.58
Metatranscriptomes 0.61
Isolates 9.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.62
Nodule 2.33
Rhizoplane 6.86
Rhizosphere 71.69
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001714 3300001979 Bacteria 10072
2 JGI24739J22299_10072803 3300001989 Bacteria 1067
3 JGI24739J22299_10122563 3300001989 Bacteria 776
4 JGI24735J21928_10000382 3300002067 Bacteria 15479
5 JGI24735J21928_10000724 3300002067 Bacteria 11717
6 JGI24738J21930_10000432 3300002075 Bacteria 11832
7 JGI25156J39149_1002116 3300002705 Bacteria 7506
8 JGI25156J39149_1002258 3300002705 Bacteria 7087
9 JGI25156J39149_1003418 3300002705 Bacteria 5206
10 JGI25165J46597_1004165 3300003214 Bacteria 3206
11 rootH2_10065070 3300003320 Bacteria 3318
12 JGI25160J50197_1103624 3300003354 Bacteria 504
13 Ga0055533_1000085 3300003756 Bacteria 124875
14 Ga0055533_1002621 3300003756 Bacteria 3998
15 Ga0055532_1000001 3300003758 Bacteria 1119836
16 Ga0055532_1001321 3300003758 Bacteria 7174
17 Ga0055532_1001573 3300003758 Bacteria 6086
18 Ga0055532_1001598 3300003758 Bacteria 5997
19 Ga0055525_1004047 3300003759 Bacteria 1270
20 Ga0055527_1000002 3300003760 Bacteria 830488
21 Ga0055527_1000904 3300003760 Bacteria 7528
22 Ga0055527_1000911 3300003760 Bacteria 7446
23 Ga0055535_1000001 3300003761 Bacteria 1119836
24 Ga0055535_1002177 3300003761 Bacteria 7528
25 Ga0055535_1002192 3300003761 Bacteria 7446
26 Ga0055542_1000001 3300003762 Bacteria 1119836
27 Ga0055542_1001821 3300003762 Bacteria 8729
28 Ga0055542_1012905 3300003762 Bacteria 1426
29 Ga0055529_1000026 3300003763 Bacteria 293254
30 Ga0055529_1000485 3300003763 Bacteria 37024
31 Ga0055526_1022940 3300003771 Bacteria 2101
32 Ga0055528_1007373 3300003790 Bacteria 4869
33 Ga0058692_1004059 3300003856 Bacteria 4396
34 Ga0065165_1000789 3300005262 Bacteria 42391
35 Ga0070658_10006241 3300005327 Bacteria 9656
36 Ga0070660_100002350 3300005339 Bacteria 12991
37 Ga0070660_100005061 3300005339 Bacteria 9109
38 Ga0070660_100129562 3300005339 Bacteria 2018
39 Ga0070660_100760957 3300005339 Bacteria 814
40 Ga0070661_100138907 3300005344 Bacteria 1830
41 Ga0070661_100274517 3300005344 Bacteria 1306
42 Ga0070659_100000096 3300005366 Bacteria 66336
43 Ga0070659_100416172 3300005366 Bacteria 1136
44 Ga0070667_100250285 3300005367 Bacteria 1584
45 Ga0070663_100000940 3300005455 Bacteria 15818
46 Ga0070663_100101758 3300005455 Bacteria 2145
47 Ga0070663_100186724 3300005455 Bacteria 1611
48 Ga0070663_100523228 3300005455 Bacteria 988
49 Ga0070662_100276408 3300005457 Bacteria 1358
50 Ga0070684_100327326 3300005535 Bacteria 1408
51 Ga0070665_100480748 3300005548 Bacteria 1253
52 Ga0068855_100018889 3300005563 Bacteria 8286
53 Ga0068855_100036231 3300005563 Bacteria 5873
54 Ga0068855_100177297 3300005563 Bacteria 2411
55 Ga0068855_101199028 3300005563 Bacteria 789
56 Ga0070664_100053517 3300005564 Bacteria 3421
57 Ga0068854_100633852 3300005578 Bacteria 916
58 Ga0068854_102079275 3300005578 Bacteria 524
59 Ga0068856_100233179 3300005614 Bacteria 1856
60 Ga0068856_101052419 3300005614 Bacteria 832
61 Ga0068852_100017528 3300005616 Bacteria 5621
62 Ga0105251_10006858 3300009011 Bacteria 7164
63 Ga0105251_10008691 3300009011 Bacteria 6090
64 Ga0105244_10027065 3300009036 Bacteria 3096
65 Ga0105250_10079474 3300009092 Bacteria 1329
66 Ga0105250_10235407 3300009092 Bacteria 779
67 Ga0105250_10497058 3300009092 Bacteria 553
68 Ga0105240_10018071 3300009093 Bacteria 9481
69 Ga0105240_10044334 3300009093 Bacteria 5652
70 Ga0105240_10074656 3300009093 Bacteria 4184
71 Ga0105240_10517868 3300009093 Bacteria 1324
72 Ga0105240_12504487 3300009093 Bacteria 533
73 Ga0105242_11461942 3300009176 Bacteria 713
74 Ga0105248_10261261 3300009177 Bacteria 1949
75 Ga0105248_10385497 3300009177 Bacteria 1578
76 Ga0105237_10004060 3300009545 Bacteria 17081
77 Ga0105237_10038339 3300009545 Bacteria 4839
78 Ga0105237_10298644 3300009545 Bacteria 1613
79 Ga0105238_10072103 3300009551 Bacteria 3451
80 Ga0105238_10191107 3300009551 Bacteria 2023
81 Ga0105238_10450357 3300009551 Bacteria 1284
82 Ga0105238_10997211 3300009551 Bacteria 858
83 Ga0105239_10003611 3300010375 Bacteria 18905
84 Ga0105239_10863915 3300010375 Bacteria 1038
85 Ga0105246_10505833 3300011119 Bacteria 1027
86 Ga0157370_10002388 3300013104 Bacteria 22644
87 Ga0157370_10253218 3300013104 Bacteria 1628
88 Ga0157370_10374295 3300013104 Bacteria 1312
89 Ga0157370_10453892 3300013104 Bacteria 1178
90 Ga0157369_10000511 3300013105 Bacteria 51116
91 Ga0157369_10006322 3300013105 Bacteria 13749
92 Ga0157369_10041852 3300013105 Bacteria 4999
93 Ga0157369_10236239 3300013105 Bacteria 1910
94 Ga0157369_10405611 3300013105 Bacteria 1414
95 Ga0157369_10611065 3300013105 Bacteria 1125
96 Ga0157374_10299680 3300013296 Bacteria 1590
97 Ga0163162_10016411 3300013306 Bacteria 7236
98 Ga0157372_11315540 3300013307 Bacteria 834
99 Ga0157375_10041497 3300013308 Bacteria 4443
100 Ga0182008_10088323 3300014497 Bacteria 1527
101 Ga0182008_10467056 3300014497 Bacteria 689
102 Ga0182008_10916901 3300014497 Bacteria 517
103 Ga0182006_1067079 3300015261 Bacteria 1339
104 Ga0182006_1078009 3300015261 Bacteria 1214
105 Ga0182006_1094201 3300015261 Bacteria 1072
106 Ga0182007_10004893 3300015262 Bacteria 5984
107 Ga0182007_10005284 3300015262 Bacteria 5697
108 Ga0182007_10032191 3300015262 Bacteria 1782
109 Ga0182005_1031590 3300015265 Bacteria 1442
110 Ga0183361_10006 3300016635 Bacteria 368532
111 Ga0163161_11581889 3300017792 Bacteria 578
112 Ga0197907_10252183 3300020069 Bacteria 1190
113 Ga0206356_11352296 3300020070 Bacteria 814
114 Ga0206354_10463584 3300020081 Bacteria 1532
115 Ga0206353_10946608 3300020082 Bacteria 1800
116 Ga0213872_10349434 3300021361 Bacteria 607
117 Ga0224712_10004065 3300022467 Bacteria 3902
118 Ga0209566_100406 3300025225 Bacteria 34236
119 Ga0209566_117037 3300025225 Bacteria 626
120 Ga0209674_100005 3300025226 Bacteria 1708125
121 Ga0209674_100113 3300025226 Bacteria 139708
122 Ga0209672_100001 3300025228 Bacteria 2828210
123 Ga0209672_100014 3300025228 Bacteria 546252
124 Ga0209672_100023 3300025228 Bacteria 371758
125 Ga0209147_100001 3300025229 Bacteria 2384371
126 Ga0209147_100094 3300025229 Bacteria 167145
127 Ga0209147_100104 3300025229 Bacteria 158375
128 Ga0209147_100246 3300025229 Bacteria 52692
129 Ga0209563_100297 3300025230 Bacteria 20431
130 Ga0207427_101561 3300025231 Bacteria 7940
131 Ga0209258_100001 3300025242 Bacteria 2384269
132 Ga0209258_100040 3300025242 Bacteria 385401
133 Ga0209258_100142 3300025242 Bacteria 165865
134 Ga0209646_1023494 3300025246 Bacteria 874
135 Ga0209026_1001770 3300025250 Bacteria 8938
136 Ga0209148_1000003 3300025254 Bacteria 2384288
137 Ga0209148_1000035 3300025254 Bacteria 548413
138 Ga0209148_1001825 3300025254 Bacteria 8951
139 Ga0209759_1000029 3300025256 Bacteria 286968
140 Ga0209759_1000030 3300025256 Bacteria 285649
141 Ga0209759_1000113 3300025256 Bacteria 142453
142 Ga0209759_1001712 3300025256 Bacteria 11342
143 Ga0209759_1003039 3300025256 Bacteria 6917
144 Ga0209759_1048621 3300025256 Bacteria 670
145 Ga0209233_1000043 3300025261 Bacteria 509723
146 Ga0209565_1004135 3300025263 Bacteria 4511
147 Ga0209455_1000001 3300025272 Bacteria 2384278
148 Ga0209455_1000072 3300025272 Bacteria 293074
149 Ga0209455_1001335 3300025272 Bacteria 11388
150 Ga0209673_1000030 3300025273 Bacteria 351933
151 Ga0209130_1020828 3300025284 Bacteria 1492
152 Ga0209675_1016180 3300025291 Bacteria 2183
153 Ga0209564_1005170 3300025295 Bacteria 7572
154 Ga0207426_1000125 3300025302 Bacteria 217504
155 Ga0207426_1001819 3300025302 Bacteria 15806
156 Ga0207696_1047755 3300025711 Bacteria 1233
157 Ga0207713_1000252 3300025735 Bacteria 67447
158 Ga0207713_1032489 3300025735 Bacteria 2291
159 Ga0207680_10011961 3300025903 Bacteria 4406
160 Ga0207647_10000108 3300025904 Bacteria 63172
161 Ga0207647_10025478 3300025904 Bacteria 3885
162 Ga0207647_10032644 3300025904 Bacteria 3342
163 Ga0207647_10040451 3300025904 Bacteria 2936
164 Ga0207647_10060871 3300025904 Bacteria 2306
165 Ga0207705_10001472 3300025909 Bacteria 18763
166 Ga0207705_10087826 3300025909 Bacteria 2274
167 Ga0207695_10006143 3300025913 Bacteria 15659
168 Ga0207695_10013244 3300025913 Bacteria 9840
169 Ga0207695_10052435 3300025913 Bacteria 4274
170 Ga0207695_10233692 3300025913 Bacteria 1742
171 Ga0207695_11562266 3300025913 Bacteria 540
172 Ga0207671_10032853 3300025914 Bacteria 3862
173 Ga0207671_10071247 3300025914 Bacteria 2592
174 Ga0207657_10000004 3300025919 Bacteria 247179
175 Ga0207657_10004746 3300025919 Bacteria 14352
176 Ga0207657_10056578 3300025919 Bacteria 3383
177 Ga0207694_10028257 3300025924 Bacteria 4276
178 Ga0207694_10075245 3300025924 Bacteria 2643
179 Ga0207694_10143276 3300025924 Bacteria 1922
180 Ga0207690_10000015 3300025932 Bacteria 257457
181 Ga0207706_10240725 3300025933 Bacteria 1582
182 Ga0207706_10305748 3300025933 Bacteria 1385
183 Ga0207691_10594632 3300025940 Bacteria 937
184 Ga0207711_10431610 3300025941 Bacteria 1226
185 Ga0207711_10887008 3300025941 Bacteria 829
186 Ga0207679_10228149 3300025945 Bacteria 1570
187 Ga0207667_10003006 3300025949 Bacteria 20909
188 Ga0207667_10229729 3300025949 Bacteria 1900
189 Ga0207640_11470681 3300025981 Bacteria 612
190 Ga0207658_10228315 3300025986 Bacteria 1570
191 Ga0207639_11013111 3300026041 Bacteria 778
192 Ga0207678_10007019 3300026067 Bacteria 10000
193 Ga0207678_10086576 3300026067 Bacteria 2678
194 Ga0207678_10517797 3300026067 Bacteria 1041
195 Ga0207678_11513598 3300026067 Bacteria 592
196 Ga0207702_10677977 3300026078 Bacteria 1015
197 Ga0207683_10484424 3300026121 Bacteria 1142
198 Ga0207698_10022247 3300026142 Bacteria 4401
199 Ga0209371_1000079 3300027312 Bacteria 187621
200 Ga0209371_1007843 3300027312 Bacteria 3640
201 Ga0268266_10341953 3300028379 Bacteria 1405
202 Ga0265338_10000028 3300028800 Bacteria 279132
203 Ga0265338_10484560 3300028800 Bacteria 872
204 Ga0268256_1000090 3300030500 Bacteria 153976
205 Ga0268256_1008120 3300030500 Bacteria 3640
206 Ga0307408_100605097 3300031548 Bacteria 974
207 Ga0307405_10387210 3300031731 Bacteria 1090
208 Ga0307412_10000021 3300031911 Bacteria 250629
209 Ga0307412_10316819 3300031911 Bacteria 1239
210 Ga0395899_0000007 3300037312 Bacteria 629129
211 Ga0395899_0007335 3300037312 Bacteria 8530
212 Ga0395899_0092576 3300037312 Bacteria 2189
213 Ga0395900_0000026 3300037418 Bacteria 313470
214 Ga0395900_0006887 3300037418 Bacteria 11796
215 Ga0395900_0076376 3300037418 Bacteria 3443
216 Ga0395900_0100212 3300037418 Bacteria 2975
217 Ga0395900_0111842 3300037418 Bacteria 2805
218 Ga0395900_0327299 3300037418 Bacteria 1511
219 Ga0395900_1240385 3300037418 Bacteria 660
220 Ga0395898_0000497 3300037466 Bacteria 76853
221 Ga0395898_0001748 3300037466 Bacteria 28615
222 Ga0395898_0017158 3300037466 Bacteria 7395
223 Ga0395898_0124081 3300037466 Bacteria 2474
224 Ga0395898_0188055 3300037466 Bacteria 1973
225 Ga0395898_1460658 3300037466 Bacteria 610
226 Ga0395905_0003712 3300037471 Bacteria 16175
227 Ga0395905_1115101 3300037471 Bacteria 692
228 Ga0395901_0000061 3300038443 Bacteria 151609
229 Ga0395901_0000923 3300038443 Bacteria 31994
230 Ga0395901_0134278 3300038443 Bacteria 2600
231 Ga0395901_0228195 3300038443 Bacteria 1945
232 Ga0436365_1618225 3300039437 Bacteria 4194
233 Ga0436361_0070776 3300039447 Bacteria 572
234 Ga0436361_0709859 3300039447 Bacteria 693
235 Ga0439448_0000392 3300042005 Bacteria 9935
236 Ga0466969_0002567 3300044656 Bacteria 9708
237 Ga0466969_0018664 3300044656 Bacteria 3612
238 Ga0466969_0047131 3300044656 Bacteria 2134
239 Ga0466969_0528165 3300044656 Bacteria 539
240 Ga0466972_0068933 3300044658 Bacteria 1689
241 Ga0466972_0115825 3300044658 Bacteria 1265
242 Ga0466973_0200758 3300044659 Bacteria 1482
243 Ga0466965_0000890 3300044683 Bacteria 11416
244 Ga0466965_0019994 3300044683 Bacteria 3216
245 Ga0466965_0352455 3300044683 Bacteria 806
246 Ga0466966_0000084 3300044684 Bacteria 58535
247 Ga0466966_0041106 3300044684 Bacteria 2972
248 Ga0466966_0044894 3300044684 Bacteria 2827
249 Ga0466966_0072328 3300044684 Bacteria 2159
250 Ga0466966_0086304 3300044684 Bacteria 1951
251 Ga0466961_0000567 3300044693 Bacteria 23500
252 Ga0466961_0011071 3300044693 Bacteria 5765
253 Ga0466961_0017448 3300044693 Bacteria 4611
254 Ga0466961_0025437 3300044693 Bacteria 3806
255 Ga0466961_0039749 3300044693 Bacteria 3015
256 Ga0466961_0070039 3300044693 Bacteria 2226
257 Ga0466961_0657925 3300044693 Bacteria 628
258 Ga0466961_0690022 3300044693 Bacteria 612
259 Ga0466963_0011972 3300044694 Bacteria 5297
260 Ga0466963_0019197 3300044694 Bacteria 4284
261 Ga0466963_0032676 3300044694 Bacteria 3372
262 Ga0466964_0009458 3300044706 Bacteria 3671
263 Ga0466964_0758237 3300044706 Bacteria 545
264 Ga0466971_0002526 3300044719 Bacteria 7739
265 Ga0466971_0008086 3300044719 Bacteria 4587
266 Ga0466968_0051552 3300044735 Bacteria 1758
267 Ga0466970_0004794 3300044765 Bacteria 6678
268 Ga0466970_0023813 3300044765 Bacteria 3201
269 Ga0466970_0123741 3300044765 Bacteria 1417
270 Ga0466970_0292645 3300044765 Bacteria 917
271 Ga0466957_0006129 3300044842 Bacteria 6786
272 Ga0466957_0076329 3300044842 Bacteria 2080
273 Ga0466957_0103525 3300044842 Bacteria 1797
274 Ga0466957_0291974 3300044842 Bacteria 1094
275 Ga0466957_0556546 3300044842 Bacteria 800
276 Ga0466957_1190341 3300044842 Bacteria 551
277 Ga0466960_0259334 3300044901 Bacteria 968
278 Ga0466959_0027108 3300045049 Bacteria 4250
279 Ga0466959_0047524 3300045049 Bacteria 3156
280 Ga0466959_0122804 3300045049 Bacteria 1844
281 Ga0466959_0830691 3300045049 Bacteria 617
282 Ga0466959_1163208 3300045049 Bacteria 513
283 Ga0466958_0005168 3300045836 Bacteria 6983
284 Ga0466958_0009880 3300045836 Bacteria 5327
285 Ga0466958_0031642 3300045836 Bacteria 3145
286 Ga0466958_0081021 3300045836 Bacteria 1997
287 Ga0466958_0465398 3300045836 Bacteria 819
288 Ga0466967_0167771 3300045976 Bacteria 2064
289 Ga0466967_0332355 3300045976 Bacteria 1468
290 Ga0466967_0532749 3300045976 Bacteria 1155
291 Ga0466967_0605481 3300045976 Bacteria 1082
292 Ga0495592_0020789 3300046454 Bacteria 4993
293 Ga0495592_0102197 3300046454 Bacteria 2041
294 Ga0495592_0217564 3300046454 Bacteria 1279
295 Ga0495603_0017825 3300046455 Bacteria 4298
296 Ga0495590_0004304 3300046457 Bacteria 5752
297 Ga0495590_0005824 3300046457 Bacteria 4843
298 Ga0495590_0011532 3300046457 Bacteria 3302
299 Ga0495590_0130583 3300046457 Bacteria 903
300 Ga0495591_002749 3300046458 Bacteria 9504
301 Ga0495591_146923 3300046458 Bacteria 567
302 Ga0495629_0000281 3300046459 Bacteria 44035
303 Ga0495629_0001027 3300046459 Bacteria 22377
304 Ga0495629_0002911 3300046459 Bacteria 13056
305 Ga0495629_0056812 3300046459 Bacteria 2736
306 Ga0495629_0067652 3300046459 Bacteria 2493
307 Ga0495629_0077034 3300046459 Bacteria 2328
308 Ga0495629_0081683 3300046459 Bacteria 2256
309 Ga0495638_0005631 3300046460 Bacteria 9232
310 Ga0495638_0012474 3300046460 Bacteria 5822
311 Ga0495641_0017661 3300046461 Bacteria 3708
312 Ga0495651_0014367 3300046462 Bacteria 6121
313 Ga0495651_0119048 3300046462 Bacteria 1942
314 Ga0495651_0124963 3300046462 Bacteria 1885
315 Ga0495651_0184066 3300046462 Bacteria 1476
316 Ga0495651_0337700 3300046462 Bacteria 999
317 Ga0495653_0012862 3300046463 Bacteria 6832
318 Ga0495653_0039682 3300046463 Bacteria 3686
319 Ga0495653_0077177 3300046463 Bacteria 2474
320 Ga0495653_0095972 3300046463 Bacteria 2156
321 Ga0495653_0108173 3300046463 Bacteria 2002
322 Ga0495653_0203973 3300046463 Bacteria 1340
323 Ga0495653_0325226 3300046463 Bacteria 995
324 Ga0495653_0593748 3300046463 Bacteria 681
325 Ga0495653_0801863 3300046463 Bacteria 566
326 Ga0495650_0008939 3300046471 Bacteria 5768
327 Ga0495650_0011742 3300046471 Bacteria 4765
328 Ga0495650_0048080 3300046471 Bacteria 1780
329 Ga0495650_0062850 3300046471 Bacteria 1482
330 Ga0495650_0111320 3300046471 Bacteria 1016
331 Ga0495580_0000154 3300046472 Bacteria 50111
332 Ga0495580_0030093 3300046472 Bacteria 3934
333 Ga0495580_0035096 3300046472 Bacteria 3606
334 Ga0495580_0044745 3300046472 Bacteria 3147
335 Ga0495580_0070966 3300046472 Bacteria 2433
336 Ga0495580_0075674 3300046472 Bacteria 2348
337 Ga0495580_0508562 3300046472 Bacteria 803
338 Ga0495582_0045895 3300046473 Bacteria 2407
339 Ga0495582_0053737 3300046473 Bacteria 2221
340 Ga0495582_0071608 3300046473 Bacteria 1918
341 Ga0495582_0167707 3300046473 Bacteria 1249
342 Ga0495605_0014238 3300046474 Bacteria 4361
343 Ga0495605_0016251 3300046474 Bacteria 4031
344 Ga0495605_0031602 3300046474 Bacteria 2703
345 Ga0495605_0294788 3300046474 Bacteria 687
346 Ga0495639_0159817 3300046475 Bacteria 1090
347 Ga0495662_0041710 3300046476 Bacteria 2216
348 Ga0495662_0054588 3300046476 Bacteria 1930
349 Ga0495662_0126374 3300046476 Bacteria 1256
350 Ga0495662_0166867 3300046476 Bacteria 1085
351 Ga0495664_0005063 3300046477 Bacteria 7223
352 Ga0495664_0030156 3300046477 Bacteria 3176
353 Ga0495664_0110091 3300046477 Bacteria 1662
354 Ga0495664_0170043 3300046477 Bacteria 1322
355 Ga0495664_0287449 3300046477 Bacteria 993
356 Ga0495664_0548962 3300046477 Bacteria 688
357 Ga0495584_0080785 3300046491 Bacteria 1636
358 Ga0495584_0237109 3300046491 Bacteria 927
359 Ga0495585_0036219 3300046492 Bacteria 2785
360 Ga0495594_0111194 3300046499 Bacteria 1545
361 Ga0495594_0287385 3300046499 Bacteria 937
362 Ga0495596_0013287 3300046500 Bacteria 3497
363 Ga0495596_0032825 3300046500 Bacteria 2068
364 Ga0495596_0034526 3300046500 Bacteria 2008
365 Ga0495596_0042355 3300046500 Bacteria 1794
366 Ga0495596_0060930 3300046500 Bacteria 1470
367 Ga0495596_0097282 3300046500 Bacteria 1143
368 Ga0495607_0032487 3300046501 Bacteria 3185
369 Ga0495583_0010852 3300046506 Bacteria 5272
370 Ga0495583_0149025 3300046506 Bacteria 971
371 Ga0495583_0200388 3300046506 Bacteria 811
372 Ga0495606_0015296 3300046507 Bacteria 5920
373 Ga0495606_0015308 3300046507 Bacteria 5917
374 Ga0495606_0020876 3300046507 Bacteria 4812
375 Ga0495606_0048336 3300046507 Bacteria 2799
376 Ga0495606_0073082 3300046507 Bacteria 2153
377 Ga0495606_0141960 3300046507 Bacteria 1417
378 Ga0495606_0145817 3300046507 Bacteria 1394
379 Ga0495606_0151546 3300046507 Bacteria 1360
380 Ga0495606_0448213 3300046507 Bacteria 662
381 Ga0495608_0016903 3300046511 Bacteria 5049
382 Ga0495608_0068634 3300046511 Bacteria 2318
383 Ga0495608_0286367 3300046511 Bacteria 1022
384 Ga0495610_0000369 3300046512 Bacteria 46808
385 Ga0495610_0329945 3300046512 Bacteria 580
386 Ga0495618_0019627 3300046514 Bacteria 4160
387 Ga0495618_0028556 3300046514 Bacteria 3477
388 Ga0495618_0106825 3300046514 Bacteria 1792
389 Ga0495620_0011282 3300046515 Bacteria 4665
390 Ga0495620_0067287 3300046515 Bacteria 1474
391 Ga0495620_0192615 3300046515 Bacteria 786
392 Ga0495628_0000957 3300046516 Bacteria 26501
393 Ga0495628_0043400 3300046516 Bacteria 3582
394 Ga0495628_0068546 3300046516 Bacteria 2767
395 Ga0495628_0095319 3300046516 Bacteria 2299
396 Ga0495628_0120160 3300046516 Bacteria 2016
397 Ga0495628_0228471 3300046516 Bacteria 1395
398 Ga0495628_0518422 3300046516 Bacteria 859
399 Ga0495628_0627676 3300046516 Bacteria 765
400 Ga0495628_0774260 3300046516 Bacteria 673
401 Ga0495630_0011675 3300046517 Bacteria 6365
402 Ga0495630_0036267 3300046517 Bacteria 3686
403 Ga0495630_0038400 3300046517 Bacteria 3581
404 Ga0495630_0117251 3300046517 Bacteria 2018
405 Ga0495630_0202201 3300046517 Bacteria 1516
406 Ga0495630_0214938 3300046517 Bacteria 1467
407 Ga0495630_0693122 3300046517 Bacteria 779
408 Ga0495631_0091851 3300046518 Bacteria 1307
409 Ga0495631_0121655 3300046518 Bacteria 1122
410 Ga0495643_0074058 3300046522 Bacteria 1784
411 Ga0495644_0049550 3300046523 Bacteria 1576
412 Ga0495648_0020030 3300046524 Bacteria 4679
413 Ga0495648_0051857 3300046524 Bacteria 2496
414 Ga0495648_0073333 3300046524 Bacteria 1976
415 Ga0495648_0099764 3300046524 Bacteria 1605
416 Ga0495648_0377971 3300046524 Bacteria 639
417 Ga0495666_0005671 3300046526 Bacteria 6289
418 Ga0495666_0140827 3300046526 Bacteria 1124
419 Ga0495666_0146375 3300046526 Bacteria 1099
420 Ga0495666_0179048 3300046526 Bacteria 979
421 Ga0495642_0061830 3300046528 Bacteria 1554
422 Ga0495642_0064424 3300046528 Bacteria 1525
423 Ga0495652_0007894 3300046529 Bacteria 9771
424 Ga0495652_0010346 3300046529 Bacteria 8453
425 Ga0495652_0078034 3300046529 Bacteria 2743
426 Ga0495652_0079661 3300046529 Bacteria 2707
427 Ga0495652_0298167 3300046529 Bacteria 1173
428 Ga0495652_0401680 3300046529 Bacteria 970
429 Ga0495652_0779659 3300046529 Bacteria 638
430 Ga0495654_0111041 3300046530 Bacteria 1251
431 Ga0495654_0228217 3300046530 Bacteria 784
432 Ga0495665_0001638 3300046531 Bacteria 11983
433 Ga0495665_0002860 3300046531 Bacteria 9329
434 Ga0495665_0012429 3300046531 Bacteria 4607
435 Ga0495665_0027317 3300046531 Bacteria 3063
436 Ga0495665_0109187 3300046531 Bacteria 1451
437 Ga0495665_0188415 3300046531 Bacteria 1071
438 Ga0495640_0016370 3300046533 Bacteria 5547
439 Ga0495640_0027384 3300046533 Bacteria 4111
440 Ga0495640_0036762 3300046533 Bacteria 3457
441 Ga0495586_0005670 3300046535 Bacteria 6677
442 Ga0495586_0035251 3300046535 Bacteria 2688
443 Ga0495586_0114362 3300046535 Bacteria 1504
444 Ga0495586_0131039 3300046535 Bacteria 1404
445 Ga0495586_0303355 3300046535 Bacteria 915
446 Ga0495587_0006577 3300046536 Bacteria 7568
447 Ga0495587_0046722 3300046536 Bacteria 2568
448 Ga0495597_0030419 3300046542 Bacteria 2461
449 Ga0495597_0032107 3300046542 Bacteria 2385
450 Ga0495597_0152699 3300046542 Bacteria 946
451 Ga0495645_0016002 3300046543 Bacteria 5346
452 Ga0495645_0016682 3300046543 Bacteria 5251
453 Ga0495645_0117998 3300046543 Bacteria 1871
454 Ga0495645_0235019 3300046543 Bacteria 1226
455 Ga0495645_0254608 3300046543 Bacteria 1165
456 Ga0495645_0432748 3300046543 Bacteria 833
457 Ga0495622_0000383 3300046557 Bacteria 30408
458 Ga0495667_0074733 3300046559 Bacteria 2206
459 Ga0495667_0176613 3300046559 Bacteria 1371
460 Ga0495656_0163640 3300046615 Bacteria 1083
461 Ga0495668_0063937 3300046616 Bacteria 2026
462 Ga0495668_0477169 3300046616 Bacteria 687
463 Ga0495668_0541579 3300046616 Bacteria 642
464 Ga0495634_0015597 3300046642 Bacteria 5453
465 Ga0495634_0058755 3300046642 Bacteria 2562
466 Ga0495634_0156104 3300046642 Bacteria 1440
467 Ga0495634_0607287 3300046642 Bacteria 634
468 Ga0495611_0026723 3300046648 Bacteria 2519
469 Ga0495611_0033563 3300046648 Bacteria 2265
470 Ga0495625_0018707 3300046660 Bacteria 5397
471 Ga0495625_0122746 3300046660 Bacteria 1766
472 Ga0495635_0000831 3300046663 Bacteria 20224
473 Ga0495635_0028072 3300046663 Bacteria 3912
474 Ga0495635_0041991 3300046663 Bacteria 3160
475 Ga0495635_1087258 3300046663 Bacteria 506
476 Ga0495661_0020936 3300046665 Bacteria 4265
477 Ga0495661_0041205 3300046665 Bacteria 2858
478 Ga0495661_0392898 3300046665 Bacteria 676
479 Ga0495588_0140899 3300046674 Bacteria 1274
480 Ga0495588_0208107 3300046674 Bacteria 1033
481 Ga0495657_0040697 3300046675 Bacteria 3185
482 Ga0495599_0029991 3300046678 Bacteria 3411
483 Ga0495599_0083470 3300046678 Bacteria 1995
484 Ga0495599_0089203 3300046678 Bacteria 1924
485 Ga0495599_0295677 3300046678 Bacteria 978
486 Ga0495599_0561183 3300046678 Bacteria 668
487 Ga0495623_0010427 3300046679 Bacteria 6015
488 Ga0495623_0013066 3300046679 Bacteria 5380
489 Ga0495623_0016627 3300046679 Bacteria 4750
490 Ga0495623_0081951 3300046679 Bacteria 1994
491 Ga0495623_0331754 3300046679 Bacteria 833
492 Ga0495646_0015341 3300046680 Bacteria 4862
493 Ga0495646_0021769 3300046680 Bacteria 4049
494 Ga0495646_0058315 3300046680 Bacteria 2308
495 Ga0495646_0116522 3300046680 Bacteria 1515
496 Ga0495646_0119703 3300046680 Bacteria 1491
497 Ga0495646_0146869 3300046680 Bacteria 1314
498 Ga0495646_0273187 3300046680 Bacteria 900
499 Ga0495646_0273757 3300046680 Bacteria 899
500 Ga0495669_0049782 3300046684 Bacteria 1877
501 Ga0495669_0192233 3300046684 Bacteria 974
502 Ga0495669_0268143 3300046684 Bacteria 821
503 Ga0495669_0517374 3300046684 Bacteria 580
504 Ga0495613_0010942 3300046689 Bacteria 6735
505 Ga0495613_0074631 3300046689 Bacteria 2470
506 Ga0495613_0161198 3300046689 Bacteria 1595
507 Ga0495613_0321149 3300046689 Bacteria 1069
508 Ga0495624_0006505 3300046690 Bacteria 8283
509 Ga0495624_0015934 3300046690 Bacteria 5061
510 Ga0495624_0063854 3300046690 Bacteria 2301
511 Ga0495624_0181423 3300046690 Bacteria 1282
512 Ga0495624_0231369 3300046690 Bacteria 1119
513 Ga0495624_0297395 3300046690 Bacteria 973
514 Ga0495670_0052688 3300046691 Bacteria 2038
515 Ga0495670_0827494 3300046691 Bacteria 505
516 Ga0495671_0022152 3300046692 Bacteria 3331
517 Ga0495671_0240739 3300046692 Bacteria 874
518 Ga0495671_0611975 3300046692 Bacteria 518
519 Ga0495649_0006437 3300046694 Bacteria 7309
520 Ga0495649_0101337 3300046694 Bacteria 1530
521 Ga0495649_0127197 3300046694 Bacteria 1345
522 Ga0495649_0377497 3300046694 Bacteria 714
523 Ga0495589_0011585 3300046794 Bacteria 4578
524 Ga0495589_0016427 3300046794 Bacteria 3805
525 Ga0495589_0032655 3300046794 Bacteria 2617
526 Ga0495589_0082034 3300046794 Bacteria 1568
527 Ga0495589_0167757 3300046794 Bacteria 1044
528 Ga0495589_0179260 3300046794 Bacteria 1005
529 Ga0495589_0426722 3300046794 Bacteria 607
530 Ga0495600_0000230 3300046809 Bacteria 30997
531 Ga0495600_0020259 3300046809 Bacteria 4254
532 Ga0495600_0075679 3300046809 Bacteria 2198
533 Ga0495600_0097938 3300046809 Bacteria 1912
534 Ga0495600_0190647 3300046809 Bacteria 1318
535 Ga0495660_0200227 3300046810 Bacteria 954
536 Ga0495660_0242351 3300046810 Bacteria 840
537 Ga0495660_0473142 3300046810 Bacteria 539
538 Ga0495581_0000175 3300047315 Bacteria 29134
539 Ga0495581_0010181 3300047315 Bacteria 5439
540 Ga0495581_0060985 3300047315 Bacteria 2180
541 Ga0495581_0069960 3300047315 Bacteria 2029
542 Ga0495604_0014571 3300047317 Bacteria 6267
543 Ga0495604_0024517 3300047317 Bacteria 4812
544 Ga0495604_0077021 3300047317 Bacteria 2507
545 Ga0495604_0092162 3300047317 Bacteria 2245
546 Ga0495604_0102689 3300047317 Bacteria 2098
547 Ga0495604_0200269 3300047317 Bacteria 1386
548 Ga0495604_0716911 3300047317 Bacteria 634
549 Ga0495636_0102512 3300047318 Bacteria 1253
550 Ga0495674_0003433 3300047319 Bacteria 15394
551 Ga0495674_0029930 3300047319 Bacteria 4953
552 Ga0495674_0031504 3300047319 Bacteria 4817
553 Ga0495674_0093833 3300047319 Bacteria 2560
554 Ga0495674_0146077 3300047319 Bacteria 1985
555 Ga0495674_0175434 3300047319 Bacteria 1786
556 Ga0495674_0195922 3300047319 Bacteria 1678
557 Ga0495674_0278452 3300047319 Bacteria 1371
558 Ga0495674_0338705 3300047319 Bacteria 1222
559 Ga0495674_0383689 3300047319 Bacteria 1136
560 Ga0495672_0054162 3300047320 Bacteria 2346
561 Ga0495672_0450309 3300047320 Bacteria 580
562 Ga0495672_0463098 3300047320 Bacteria 569
563 Ga0495676_0004878 3300047321 Bacteria 12307
564 Ga0495676_0043309 3300047321 Bacteria 3686
565 Ga0495676_0175632 3300047321 Bacteria 1504
566 Ga0495676_0252601 3300047321 Bacteria 1202
567 Ga0495676_0373666 3300047321 Bacteria 949
568 Ga0495680_0027903 3300047322 Bacteria 4632
569 Ga0495680_0072210 3300047322 Bacteria 2625
570 Ga0495680_0148243 3300047322 Bacteria 1712
571 Ga0495680_0158524 3300047322 Bacteria 1645
572 Ga0495680_0262328 3300047322 Bacteria 1221
573 Ga0495683_0013650 3300047323 Bacteria 4244
574 Ga0495683_0030504 3300047323 Bacteria 2750
575 Ga0495683_0031526 3300047323 Bacteria 2701
576 Ga0495683_0041277 3300047323 Bacteria 2328
577 Ga0495683_0065680 3300047323 Bacteria 1789
578 Ga0495683_0066082 3300047323 Bacteria 1782
579 Ga0495683_0109784 3300047323 Bacteria 1318
580 Ga0495683_0114280 3300047323 Bacteria 1286
581 Ga0495683_0192496 3300047323 Bacteria 924
582 Ga0495687_034863 3300047443 Bacteria 2268
583 Ga0495687_050153 3300047443 Bacteria 1780
584 Ga0495687_056502 3300047443 Bacteria 1637
585 Ga0495687_059590 3300047443 Bacteria 1578
586 Ga0495687_062729 3300047443 Bacteria 1524
587 Ga0495687_125370 3300047443 Bacteria 919
588 Ga0495687_223592 3300047443 Bacteria 580
589 Ga0495675_0016864 3300047444 Bacteria 4620
590 Ga0495675_0028740 3300047444 Bacteria 3543
591 Ga0495675_0031902 3300047444 Bacteria 3364
592 Ga0495675_0108687 3300047444 Bacteria 1732
593 Ga0495675_0263683 3300047444 Bacteria 1031
594 Ga0495675_0278670 3300047444 Bacteria 997
595 Ga0495675_0415759 3300047444 Bacteria 782
596 Ga0495679_000102 3300047446 Bacteria 76337
597 Ga0495679_001030 3300047446 Bacteria 17116
598 Ga0495679_069252 3300047446 Bacteria 1019
599 Ga0495673_0024042 3300047469 Bacteria 2952
600 Ga0495673_0044512 3300047469 Bacteria 1979
601 Ga0495681_0072339 3300047470 Bacteria 1559
602 Ga0495681_0134022 3300047470 Bacteria 1052
603 Ga0495684_0052678 3300047471 Bacteria 3105
604 Ga0495686_0105920 3300047472 Bacteria 1691
605 Ga0495593_0002180 3300047673 Bacteria 11721
606 Ga0495593_0008077 3300047673 Bacteria 6121
607 Ga0495593_0013609 3300047673 Bacteria 4638
608 Ga0495593_0042272 3300047673 Bacteria 2446
609 Ga0495593_0300363 3300047673 Bacteria 802
610 Ga0495593_0588569 3300047673 Bacteria 558
611 Ga0495602_0006744 3300048088 Bacteria 12051
612 Ga0495602_0057716 3300048088 Bacteria 3403
613 Ga0495602_0067223 3300048088 Bacteria 3084
614 Ga0495602_0084115 3300048088 Bacteria 2662
615 Ga0495602_0089210 3300048088 Bacteria 2564
616 Ga0495602_0117094 3300048088 Bacteria 2151
617 Ga0495602_0250971 3300048088 Bacteria 1318
618 Ga0495602_0485111 3300048088 Bacteria 866
619 Ga0495602_0692107 3300048088 Bacteria 692
620 Ga0495614_0000336 3300048089 Bacteria 18584
621 Ga0495614_0001827 3300048089 Bacteria 9324
622 Ga0495614_0173009 3300048089 Bacteria 969
623 Ga0495614_0245751 3300048089 Bacteria 817
624 Ga0495626_0019875 3300048091 Bacteria 3352
625 Ga0495626_0070582 3300048091 Bacteria 1571
626 Ga0496100_0000354 3300048903 Bacteria 22328
627 Ga0496100_0013574 3300048903 Bacteria 4703
628 Ga0496100_0065110 3300048903 Bacteria 2414
629 Ga0496100_0176191 3300048903 Bacteria 1544
630 Ga0496100_0252150 3300048903 Bacteria 1306
631 Ga0496101_0000527 3300048904 Bacteria 23690
632 Ga0496101_0041749 3300048904 Bacteria 3272
633 Ga0496101_0054830 3300048904 Bacteria 2877
634 Ga0496102_0002557 3300048905 Bacteria 15519
635 Ga0496102_0006275 3300048905 Bacteria 10133
636 Ga0496102_0060309 3300048905 Bacteria 3470
637 Ga0496102_0170307 3300048905 Bacteria 2050
638 Ga0496102_0244462 3300048905 Bacteria 1692
639 Ga0496102_0373030 3300048905 Bacteria 1343
640 Ga0496102_0441143 3300048905 Bacteria 1222
641 Ga0496102_0467636 3300048905 Bacteria 1182
642 Ga0496103_0000752 3300048906 Bacteria 23872
643 Ga0496103_0001958 3300048906 Bacteria 13318
644 Ga0496103_0039972 3300048906 Bacteria 2883
645 Ga0496103_0316919 3300048906 Bacteria 1003
646 Ga0496103_0526227 3300048906 Bacteria 756
647 Ga0496103_0547157 3300048906 Bacteria 739
648 Ga0496104_0168632 3300048907 Bacteria 2099
649 Ga0496104_0259682 3300048907 Bacteria 1650
650 Ga0496104_0435893 3300048907 Bacteria 1222
651 Ga0496105_0067989 3300048908 Bacteria 2942
652 Ga0496105_0122978 3300048908 Bacteria 2139
653 Ga0496105_0164990 3300048908 Bacteria 1817
654 Ga0496106_0000089 3300048909 Bacteria 72356
655 Ga0496106_0053740 3300048909 Bacteria 3043
656 Ga0496106_0067555 3300048909 Bacteria 2725
657 Ga0496107_0010716 3300048910 Bacteria 6375
658 Ga0496107_0014841 3300048910 Bacteria 5454
659 Ga0496107_0941101 3300048910 Bacteria 629
660 Ga0496108_0237244 3300048911 Bacteria 1586
661 Ga0496109_0031696 3300048912 Bacteria 4747
662 Ga0496110_0000457 3300048913 Bacteria 27743
663 Ga0496110_0868371 3300048913 Bacteria 808
664 Ga0496110_0932571 3300048913 Bacteria 775
665 Ga0496111_0014839 3300048914 Bacteria 5332
666 Ga0496111_0927413 3300048914 Bacteria 626
667 Ga0496112_0040308 3300048915 Bacteria 4566
668 Ga0496112_0073198 3300048915 Bacteria 3387
669 Ga0496113_0004377 3300048916 Bacteria 8662
670 Ga0496113_0044079 3300048916 Bacteria 3303
671 Ga0496113_1303564 3300048916 Bacteria 565
672 Ga0496114_0041637 3300048917 Bacteria 3807
673 Ga0496114_0193544 3300048917 Bacteria 1780
674 Ga0496114_0574584 3300048917 Bacteria 995
675 Ga0496115_0029692 3300048918 Bacteria 4296
676 Ga0496115_0272241 3300048918 Bacteria 1391
677 Ga0496116_0005969 3300048919 Bacteria 11171
678 Ga0496116_0027332 3300048919 Bacteria 4156
679 Ga0496116_0032041 3300048919 Bacteria 3753
680 Ga0496116_0094580 3300048919 Bacteria 1806
681 Ga0496117_0000266 3300048920 Bacteria 98856
682 Ga0496117_0000852 3300048920 Bacteria 47272
683 Ga0496117_0008100 3300048920 Bacteria 10059
684 Ga0496117_0020029 3300048920 Bacteria 5472
685 Ga0496117_0033871 3300048920 Bacteria 3857
686 Ga0496117_0070246 3300048920 Bacteria 2353
687 Ga0496117_0093273 3300048920 Bacteria 1931
688 Ga0496117_0178338 3300048920 Bacteria 1224
689 Ga0496117_0497303 3300048920 Bacteria 592
690 Ga0496118_0003538 3300048921 Bacteria 19542
691 Ga0496118_0006374 3300048921 Bacteria 12999
692 Ga0496118_0019825 3300048921 Bacteria 5996
693 Ga0496118_0023214 3300048921 Bacteria 5394
694 Ga0496118_0033086 3300048921 Bacteria 4249
695 Ga0496118_0034192 3300048921 Bacteria 4153
696 Ga0496118_0082420 3300048921 Bacteria 2254
697 Ga0496118_0184975 3300048921 Bacteria 1253
698 Ga0496118_0249491 3300048921 Bacteria 1009
699 Ga0496119_0137744 3300048922 Bacteria 1322
700 Ga0496119_0143683 3300048922 Bacteria 1286
701 Ga0496119_0362327 3300048922 Bacteria 699
702 Ga0496119_0481819 3300048922 Bacteria 580
703 Ga0496121_0003101 3300048924 Bacteria 24033
704 Ga0496121_0004927 3300048924 Bacteria 17519
705 Ga0496121_0005745 3300048924 Bacteria 15753
706 Ga0496121_0010104 3300048924 Bacteria 10703
707 Ga0496121_0029385 3300048924 Bacteria 5083
708 Ga0496121_0093316 3300048924 Bacteria 2344
709 Ga0496121_0359243 3300048924 Bacteria 967
710 Ga0496121_0551732 3300048924 Bacteria 721
711 Ga0496122_0004444 3300048925 Bacteria 17402
712 Ga0496122_0319406 3300048925 Bacteria 827
713 Ga0496123_0058701 3300048926 Bacteria 2493
714 Ga0496123_0102511 3300048926 Bacteria 1660
715 Ga0496123_0238197 3300048926 Bacteria 905
716 Ga0496124_0001916 3300048927 Bacteria 28536
717 Ga0496124_0551248 3300048927 Bacteria 761
718 Ga0496125_0035561 3300048928 Bacteria 4365
719 Ga0496125_0270213 3300048928 Bacteria 1060
720 Ga0496125_0274957 3300048928 Bacteria 1047
721 Ga0496125_0287274 3300048928 Bacteria 1015
722 Ga0496126_0000550 3300048929 Bacteria 72171
723 Ga0496126_0001193 3300048929 Bacteria 42367
724 Ga0496126_0011060 3300048929 Bacteria 9379
725 Ga0496126_0055766 3300048929 Bacteria 3573
726 Ga0496126_0215031 3300048929 Bacteria 1617
727 Ga0496126_0406364 3300048929 Bacteria 1103
728 Ga0496126_0637993 3300048929 Bacteria 835
729 Ga0466983_0663009 3300048986 Bacteria 669
730 Ga0495678_003802 3300049459 Bacteria 9105
731 Ga0495678_044164 3300049459 Bacteria 1765
732 Ga0495682_0176796 3300049460 Bacteria 759
733 Ga0500618_002723 3300053125 Bacteria 6446
734 Ga0466962_0006130 3300061719 Bacteria 5780
735 Ga0466962_0012513 3300061719 Bacteria 4079
736 Ga0466962_0013995 3300061719 Bacteria 3864

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025250 Ga0209026_1001770 Ga0209026_10017704 97
2 3300048091 Ga0495626_0070582 Ga0495626_0070582_20_319 98
3 iso_pu_bacteria 2891633521 2891637411 100
4 iso_pu_bacteria 2519103095 2519459040 103
5 iso_pu_bacteria 2582581311 2585291441 103
6 iso_pu_bacteria 2599185239 2599736645 103
7 iso_pu_bacteria 2599185240 2599744699 103
8 iso_pu_bacteria 2599185355 2600205940 103
9 iso_pu_bacteria 2675903129 2676742826 103
10 iso_pu_bacteria 2816332253 2817261331 103
11 iso_pu_bacteria 2816332256 2817279008 103
12 iso_pu_bacteria 2816332286 2817451268 103
13 iso_pu_bacteria 2818991452 2819631129 103
14 iso_pu_bacteria 2863421361 2863424769 103
15 iso_pu_bacteria 2870068957 2870071006 103
16 iso_pu_bacteria 2904564687 2904570998 103
17 iso_pu_bacteria 2904571731 2904575952 103
18 iso_pu_bacteria 2928157003 2928160070 103
19 iso_pu_bacteria 2928163908 2928168509 103
20 iso_pu_bacteria 2928170801 2928171753 103
21 iso_pu_bacteria 2928536128 2928539909 103
22 iso_pu_bacteria 2981990288 2981994776 103
23 iso_pu_bacteria 641736154 642416890 103
24 iso_pu_bacteria 8018845410 8018851393 103
25 iso_pu_bacteria 8020807995 8020810175 103
26 iso_pu_bacteria 8020938398 8020945047 103
27 iso_pu_bacteria 8020945358 8020951695 103
28 iso_pu_bacteria 8020953355 8020956916 103
29 iso_pu_bacteria 8021120328 8021122230 103
30 iso_pu_bacteria 8039098773 8039102525 103
31 iso_pu_bacteria 8040173305 8040174746 103
32 3300009011 Ga0105251_10006858 Ga0105251_100068586 105
33 3300009092 Ga0105250_10497058 Ga0105250_104970581 105
34 3300009093 Ga0105240_10517868 Ga0105240_105178682 105
35 3300046463 Ga0495653_0593748 Ga0495653_0593748_239_559 105
36 3300046516 Ga0495628_0627676 Ga0495628_0627676_323_643 105
37 3300046517 Ga0495630_0693122 Ga0495630_0693122_278_598 105
38 3300047319 Ga0495674_0195922 Ga0495674_0195922_1225_1545 105
39 3300047322 Ga0495680_0148243 Ga0495680_0148243_793_1113 105
40 3300047444 Ga0495675_0108687 Ga0495675_0108687_941_1261 105
41 3300047673 Ga0495593_0013609 Ga0495593_0013609_3107_3427 105
42 3300048088 Ga0495602_0117094 Ga0495602_0117094_656_976 105
43 3300048908 Ga0496105_0122978 Ga0496105_0122978_705_1025 105
44 3300002067 JGI24735J21928_10000382 JGI24735J21928_100003826 106
45 3300003354 JGI25160J50197_1103624 JGI25160J50197_11036241 106
46 3300005455 Ga0070663_100523228 Ga0070663_1005232282 106
47 3300009036 Ga0105244_10027065 Ga0105244_100270652 106
48 3300009551 Ga0105238_10072103 Ga0105238_100721036 106
49 3300011119 Ga0105246_10505833 Ga0105246_105058332 106
50 3300013105 Ga0157369_10236239 Ga0157369_102362392 106
51 3300013105 Ga0157369_10611065 Ga0157369_106110652 106
52 3300013296 Ga0157374_10299680 Ga0157374_102996802 106
53 3300014497 Ga0182008_10916901 Ga0182008_109169012 106
54 3300025302 Ga0207426_1001819 Ga0207426_10018196 106
55 3300025735 Ga0207713_1032489 Ga0207713_10324894 106
56 3300025904 Ga0207647_10025478 Ga0207647_100254782 106
57 3300025913 Ga0207695_10233692 Ga0207695_102336924 106
58 3300025924 Ga0207694_10075245 Ga0207694_100752454 106
59 3300026067 Ga0207678_10517797 Ga0207678_105177972 106
60 3300037471 Ga0395905_0003712 Ga0395905_0003712_5875_6198 106
61 3300045976 Ga0466967_0605481 Ga0466967_0605481_376_699 106
62 3300046457 Ga0495590_0004304 Ga0495590_0004304_768_1091 106
63 3300046457 Ga0495590_0130583 Ga0495590_0130583_453_776 106
64 3300046459 Ga0495629_0077034 Ga0495629_0077034_1281_1604 106
65 3300046463 Ga0495653_0077177 Ga0495653_0077177_1101_1424 106
66 3300046474 Ga0495605_0294788 Ga0495605_0294788_169_492 106
67 3300046476 Ga0495662_0041710 Ga0495662_0041710_1489_1812 106
68 3300046477 Ga0495664_0548962 Ga0495664_0548962_105_428 106
69 3300046491 Ga0495584_0237109 Ga0495584_0237109_418_741 106
70 3300046500 Ga0495596_0097282 Ga0495596_0097282_239_562 106
71 3300046507 Ga0495606_0020876 Ga0495606_0020876_3071_3394 106
72 3300046507 Ga0495606_0141960 Ga0495606_0141960_637_960 106
73 3300046507 Ga0495606_0151546 Ga0495606_0151546_197_520 106
74 3300046507 Ga0495606_0448213 Ga0495606_0448213_22_345 106
75 3300046515 Ga0495620_0067287 Ga0495620_0067287_476_799 106
76 3300046516 Ga0495628_0120160 Ga0495628_0120160_1489_1812 106
77 3300046517 Ga0495630_0202201 Ga0495630_0202201_790_1113 106
78 3300046529 Ga0495652_0079661 Ga0495652_0079661_64_387 106
79 3300046531 Ga0495665_0012429 Ga0495665_0012429_3776_4099 106
80 3300046535 Ga0495586_0131039 Ga0495586_0131039_595_918 106
81 3300046542 Ga0495597_0030419 Ga0495597_0030419_1555_1878 106
82 3300046543 Ga0495645_0254608 Ga0495645_0254608_49_372 106
83 3300046616 Ga0495668_0477169 Ga0495668_0477169_327_650 106
84 3300046663 Ga0495635_1087258 Ga0495635_1087258_120_443 106
85 3300046678 Ga0495599_0561183 Ga0495599_0561183_278_601 106
86 3300046680 Ga0495646_0116522 Ga0495646_0116522_338_661 106
87 3300046684 Ga0495669_0268143 Ga0495669_0268143_364_687 106
88 3300046692 Ga0495671_0611975 Ga0495671_0611975_115_438 106
89 3300046694 Ga0495649_0101337 Ga0495649_0101337_269_592 106
90 3300046694 Ga0495649_0377497 Ga0495649_0377497_95_418 106
91 3300046794 Ga0495589_0167757 Ga0495589_0167757_683_1006 106
92 3300046809 Ga0495600_0190647 Ga0495600_0190647_209_532 106
93 3300046810 Ga0495660_0242351 Ga0495660_0242351_226_549 106
94 3300047317 Ga0495604_0092162 Ga0495604_0092162_952_1275 106
95 3300047319 Ga0495674_0383689 Ga0495674_0383689_356_679 106
96 3300047322 Ga0495680_0158524 Ga0495680_0158524_279_602 106
97 3300047323 Ga0495683_0013650 Ga0495683_0013650_466_789 106
98 3300047323 Ga0495683_0114280 Ga0495683_0114280_375_698 106
99 3300047443 Ga0495687_056502 Ga0495687_056502_738_1061 106
100 3300047443 Ga0495687_223592 Ga0495687_223592_124_447 106
101 3300047673 Ga0495593_0300363 Ga0495593_0300363_148_471 106
102 3300047673 Ga0495593_0588569 Ga0495593_0588569_22_345 106
103 3300048088 Ga0495602_0057716 Ga0495602_0057716_229_552 106
104 3300048903 Ga0496100_0013574 Ga0496100_0013574_3128_3451 106
105 3300048904 Ga0496101_0041749 Ga0496101_0041749_2741_3064 106
106 3300048904 Ga0496101_0054830 Ga0496101_0054830_603_926 106
107 3300048905 Ga0496102_0006275 Ga0496102_0006275_4128_4451 106
108 3300048905 Ga0496102_0441143 Ga0496102_0441143_184_507 106
109 3300048906 Ga0496103_0001958 Ga0496103_0001958_11932_12255 106
110 3300048906 Ga0496103_0316919 Ga0496103_0316919_248_571 106
111 3300048907 Ga0496104_0168632 Ga0496104_0168632_806_1129 106
112 3300048908 Ga0496105_0067989 Ga0496105_0067989_2012_2335 106
113 3300048909 Ga0496106_0067555 Ga0496106_0067555_916_1239 106
114 3300048910 Ga0496107_0010716 Ga0496107_0010716_413_736 106
115 3300048910 Ga0496107_0941101 Ga0496107_0941101_134_457 106
116 3300048911 Ga0496108_0237244 Ga0496108_0237244_971_1294 106
117 3300048912 Ga0496109_0031696 Ga0496109_0031696_1015_1338 106
118 3300048913 Ga0496110_0000457 Ga0496110_0000457_20682_21005 106
119 3300048913 Ga0496110_0868371 Ga0496110_0868371_363_686 106
120 3300048913 Ga0496110_0932571 Ga0496110_0932571_194_517 106
121 3300048914 Ga0496111_0014839 Ga0496111_0014839_4324_4647 106
122 3300048915 Ga0496112_0040308 Ga0496112_0040308_1829_2152 106
123 3300048916 Ga0496113_0004377 Ga0496113_0004377_5085_5408 106
124 3300048917 Ga0496114_0193544 Ga0496114_0193544_64_387 106
125 3300048919 Ga0496116_0005969 Ga0496116_0005969_7721_8044 106
126 3300048920 Ga0496117_0020029 Ga0496117_0020029_3527_3850 106
127 3300048920 Ga0496117_0497303 Ga0496117_0497303_226_549 106
128 3300048921 Ga0496118_0033086 Ga0496118_0033086_1686_2009 106
129 3300048922 Ga0496119_0143683 Ga0496119_0143683_296_619 106
130 3300048922 Ga0496119_0362327 Ga0496119_0362327_118_441 106
131 3300048924 Ga0496121_0005745 Ga0496121_0005745_14332_14655 106
132 3300048924 Ga0496121_0551732 Ga0496121_0551732_145_468 106
133 3300048925 Ga0496122_0004444 Ga0496122_0004444_5009_5332 106
134 3300048926 Ga0496123_0058701 Ga0496123_0058701_302_625 106
135 3300048927 Ga0496124_0001916 Ga0496124_0001916_25202_25525 106
136 3300048928 Ga0496125_0035561 Ga0496125_0035561_1798_2121 106
137 3300048928 Ga0496125_0270213 Ga0496125_0270213_43_366 106
138 3300048928 Ga0496125_0287274 Ga0496125_0287274_497_820 106
139 3300048929 Ga0496126_0215031 Ga0496126_0215031_838_1161 106
140 3300049459 Ga0495678_044164 Ga0495678_044164_1272_1595 106
141 iso_pu_bacteria 2501025501 2501070232 106
142 iso_pu_bacteria 2501025502 2501080668 106
143 iso_pu_bacteria 2501025504 2501410690 106
144 iso_pu_bacteria 2508501125 2509132027 106
145 iso_pu_bacteria 2510065045 2510251362 106
146 iso_pu_bacteria 2510917013 2511086880 106
147 iso_pu_bacteria 2510917014 2511096849 106
148 iso_pu_bacteria 2510917015 2511103658 106
149 iso_pu_bacteria 2512047030 2512345700 106
150 iso_pu_bacteria 2513237082 2513553880 106
151 iso_pu_bacteria 2513237083 2513564757 106
152 iso_pu_bacteria 2513237151 2513961983 106
153 iso_pu_bacteria 2513237166 2514054166 106
154 iso_pu_bacteria 2515154122 2515680968 106
155 iso_pu_bacteria 2515154189 2516019326 106
156 iso_pu_bacteria 2526164713 2527075326 106
157 iso_pu_bacteria 2718217991 2719640478 106
158 iso_pu_bacteria 2738541296 2738818390 106
159 iso_pu_bacteria 2738541298 2738831453 106
160 iso_pu_bacteria 2738541306 2738872981 106
161 iso_pu_bacteria 2738543002 2739184611 106
162 iso_pu_bacteria 2738543008 2739219580 106
163 iso_pu_bacteria 2744054900 2746085752 106
164 iso_pu_bacteria 2744054901 2746097472 106
165 iso_pu_bacteria 2751185846 2753566529 106
166 iso_pu_bacteria 2791355137 2792835930 106
167 iso_pu_bacteria 2818991450 2819622828 106
168 iso_pu_bacteria 2842324504 2842327963 106
169 iso_pu_bacteria 2842348783 2842352280 106
170 iso_pu_bacteria 2842454564 2842458565 106
171 iso_pu_bacteria 2856287931 2856290467 106
172 iso_pu_bacteria 2857357740 2857363314 106
173 iso_pu_bacteria 2883087390 2883092920 106
174 iso_pu_bacteria 2885270888 2885275485 106
175 iso_pu_bacteria 2900634093 2900634405 106
176 iso_pu_bacteria 2902682994 2902683575 106
177 iso_pu_bacteria 2904483920 2904484715 106
178 iso_pu_bacteria 2904615490 2904624062 106
179 iso_pu_bacteria 2919527303 2919531324 106
180 iso_pu_bacteria 2921643360 2921655864 106
181 iso_pu_bacteria 2928108538 2928113354 106
182 iso_pu_bacteria 2928135762 2928140513 106
183 iso_pu_bacteria 2928503688 2928507403 106
184 iso_pu_bacteria 2945934425 2945937101 106
185 iso_pu_bacteria 2990703756 2990706164 106
186 iso_pu_bacteria 641736151 642422995 106
187 iso_pu_bacteria 642555112 642593093 106
188 iso_pu_bacteria 642555113 642621987 106
189 iso_pu_bacteria 8003955200 8003961163 106
190 iso_pu_bacteria 8055266321 8055267605 106
191 iso_pu_bacteria 8055301274 8055302238 106
192 3300001989 JGI24739J22299_10122563 JGI24739J22299_101225632 107
193 3300003758 Ga0055532_1001321 Ga0055532_10013212 107
194 3300003758 Ga0055532_1001573 Ga0055532_10015732 107
195 3300003758 Ga0055532_1001598 Ga0055532_10015982 107
196 3300003760 Ga0055527_1000904 Ga0055527_10009042 107
197 3300003760 Ga0055527_1000911 Ga0055527_10009112 107
198 3300003761 Ga0055535_1002177 Ga0055535_10021772 107
199 3300003761 Ga0055535_1002192 Ga0055535_10021922 107
200 3300003762 Ga0055542_1001821 Ga0055542_100182110 107
201 3300003762 Ga0055542_1012905 Ga0055542_10129052 107
202 3300003763 Ga0055529_1000485 Ga0055529_100048542 107
203 3300003771 Ga0055526_1022940 Ga0055526_10229402 107
204 3300003790 Ga0055528_1007373 Ga0055528_10073735 107
205 3300003856 Ga0058692_1004059 Ga0058692_10040592 107
206 3300005339 Ga0070660_100002350 Ga0070660_1000023504 107
207 3300005366 Ga0070659_100000096 Ga0070659_10000009641 107
208 3300005455 Ga0070663_100000940 Ga0070663_1000009409 107
209 3300005535 Ga0070684_100327326 Ga0070684_1003273262 107
210 3300005563 Ga0068855_101199028 Ga0068855_1011990282 107
211 3300005564 Ga0070664_100053517 Ga0070664_1000535173 107
212 3300005578 Ga0068854_102079275 Ga0068854_1020792751 107
213 3300005614 Ga0068856_101052419 Ga0068856_1010524192 107
214 3300005616 Ga0068852_100017528 Ga0068852_1000175283 107
215 3300009092 Ga0105250_10079474 Ga0105250_100794741 107
216 3300009093 Ga0105240_10018071 Ga0105240_100180718 107
217 3300009093 Ga0105240_10074656 Ga0105240_100746562 107
218 3300009545 Ga0105237_10004060 Ga0105237_1000406014 107
219 3300009551 Ga0105238_10191107 Ga0105238_101911074 107
220 3300010375 Ga0105239_10003611 Ga0105239_1000361112 107
221 3300013104 Ga0157370_10374295 Ga0157370_103742952 107
222 3300015261 Ga0182006_1067079 Ga0182006_10670791 107
223 3300015261 Ga0182006_1094201 Ga0182006_10942011 107
224 3300015262 Ga0182007_10004893 Ga0182007_100048938 107
225 3300015265 Ga0182005_1031590 Ga0182005_10315901 107
226 3300025225 Ga0209566_100406 Ga0209566_10040632 107
227 3300025228 Ga0209672_100014 Ga0209672_100014201 107
228 3300025228 Ga0209672_100023 Ga0209672_100023236 107
229 3300025229 Ga0209147_100094 Ga0209147_100094106 107
230 3300025229 Ga0209147_100104 Ga0209147_10010480 107
231 3300025229 Ga0209147_100246 Ga0209147_10024653 107
232 3300025242 Ga0209258_100040 Ga0209258_100040304 107
233 3300025242 Ga0209258_100142 Ga0209258_10014295 107
234 3300025254 Ga0209148_1000035 Ga0209148_1000035304 107
235 3300025254 Ga0209148_1001825 Ga0209148_10018254 107
236 3300025256 Ga0209759_1001712 Ga0209759_10017128 107
237 3300025263 Ga0209565_1004135 Ga0209565_10041356 107
238 3300025272 Ga0209455_1000072 Ga0209455_1000072148 107
239 3300025272 Ga0209455_1001335 Ga0209455_10013356 107
240 3300025273 Ga0209673_1000030 Ga0209673_1000030105 107
241 3300025291 Ga0209675_1016180 Ga0209675_10161802 107
242 3300025295 Ga0209564_1005170 Ga0209564_10051704 107
243 3300025904 Ga0207647_10032644 Ga0207647_100326443 107
244 3300025913 Ga0207695_10013244 Ga0207695_100132446 107
245 3300025913 Ga0207695_10052435 Ga0207695_100524354 107
246 3300025914 Ga0207671_10032853 Ga0207671_100328532 107
247 3300025919 Ga0207657_10000004 Ga0207657_1000000487 107
248 3300025924 Ga0207694_10028257 Ga0207694_100282575 107
249 3300025932 Ga0207690_10000015 Ga0207690_10000015206 107
250 3300025933 Ga0207706_10240725 Ga0207706_102407252 107
251 3300025945 Ga0207679_10228149 Ga0207679_102281492 107
252 3300025949 Ga0207667_10229729 Ga0207667_102297292 107
253 3300025981 Ga0207640_11470681 Ga0207640_114706811 107
254 3300026067 Ga0207678_10007019 Ga0207678_100070198 107
255 3300026078 Ga0207702_10677977 Ga0207702_106779772 107
256 3300026142 Ga0207698_10022247 Ga0207698_100222473 107
257 3300027312 Ga0209371_1000079 Ga0209371_100007953 107
258 3300030500 Ga0268256_1000090 Ga0268256_100009056 107
259 3300039437 Ga0436365_1618225 Ga0436365_1618225_1865_2188 107
260 3300039447 Ga0436361_0709859 Ga0436361_0709859_293_616 107
261 3300044656 Ga0466969_0018664 Ga0466969_0018664_2768_3091 107
262 3300044684 Ga0466966_0000084 Ga0466966_0000084_52269_52592 107
263 3300044693 Ga0466961_0011071 Ga0466961_0011071_985_1308 107
264 3300044693 Ga0466961_0039749 Ga0466961_0039749_1358_1681 107
265 3300044693 Ga0466961_0657925 Ga0466961_0657925_274_597 107
266 3300044694 Ga0466963_0032676 Ga0466963_0032676_1676_1999 107
267 3300044765 Ga0466970_0292645 Ga0466970_0292645_561_884 107
268 3300045049 Ga0466959_0047524 Ga0466959_0047524_1072_1395 107
269 3300045049 Ga0466959_1163208 Ga0466959_1163208_151_474 107
270 3300045836 Ga0466958_0005168 Ga0466958_0005168_3819_4142 107
271 3300048905 Ga0496102_0467636 Ga0496102_0467636_738_1064 107
272 3300048920 Ga0496117_0000852 Ga0496117_0000852_43126_43452 107
273 3300048920 Ga0496117_0033871 Ga0496117_0033871_69_392 107
274 3300048921 Ga0496118_0019825 Ga0496118_0019825_3493_3819 107
275 3300048921 Ga0496118_0184975 Ga0496118_0184975_887_1210 107
276 3300048922 Ga0496119_0481819 Ga0496119_0481819_206_529 107
277 3300048924 Ga0496121_0359243 Ga0496121_0359243_55_378 107
278 3300048926 Ga0496123_0238197 Ga0496123_0238197_63_386 107
279 3300048929 Ga0496126_0000550 Ga0496126_0000550_4038_4364 107
280 3300048986 Ga0466983_0663009 Ga0466983_0663009_53_376 107
281 3300053125 Ga0500618_002723 Ga0500618_002723_1562_1885 107
282 3300061719 Ga0466962_0012513 Ga0466962_0012513_534_857 107
283 3300005455 Ga0070663_100101758 Ga0070663_1001017582 108
284 3300005457 Ga0070662_100276408 Ga0070662_1002764082 108
285 3300005548 Ga0070665_100480748 Ga0070665_1004807482 108
286 3300009092 Ga0105250_10235407 Ga0105250_102354072 108
287 3300009177 Ga0105248_10385497 Ga0105248_103854972 108
288 3300013306 Ga0163162_10016411 Ga0163162_100164117 108
289 3300013308 Ga0157375_10041497 Ga0157375_100414973 108
290 3300017792 Ga0163161_11581889 Ga0163161_115818891 108
291 3300025711 Ga0207696_1047755 Ga0207696_10477552 108
292 3300025903 Ga0207680_10011961 Ga0207680_100119614 108
293 3300025933 Ga0207706_10305748 Ga0207706_103057482 108
294 3300025940 Ga0207691_10594632 Ga0207691_105946322 108
295 3300025941 Ga0207711_10431610 Ga0207711_104316102 108
296 3300026121 Ga0207683_10484424 Ga0207683_104844241 108
297 3300028379 Ga0268266_10341953 Ga0268266_103419533 108
298 3300044656 Ga0466969_0528165 Ga0466969_0528165_160_489 108
299 3300044683 Ga0466965_0352455 Ga0466965_0352455_323_652 108
300 3300044684 Ga0466966_0086304 Ga0466966_0086304_1378_1707 108
301 3300044693 Ga0466961_0025437 Ga0466961_0025437_1508_1837 108
302 3300044765 Ga0466970_0023813 Ga0466970_0023813_1648_1977 108
303 3300045049 Ga0466959_0830691 Ga0466959_0830691_226_555 108
304 3300045976 Ga0466967_0167771 Ga0466967_0167771_583_912 108
305 3300046459 Ga0495629_0001027 Ga0495629_0001027_6250_6579 108
306 3300046460 Ga0495638_0005631 Ga0495638_0005631_7766_8095 108
307 3300046463 Ga0495653_0203973 Ga0495653_0203973_608_937 108
308 3300046471 Ga0495650_0008939 Ga0495650_0008939_3590_3919 108
309 3300046471 Ga0495650_0048080 Ga0495650_0048080_1073_1402 108
310 3300046472 Ga0495580_0070966 Ga0495580_0070966_773_1102 108
311 3300046474 Ga0495605_0031602 Ga0495605_0031602_821_1150 108
312 3300046475 Ga0495639_0159817 Ga0495639_0159817_743_1072 108
313 3300046476 Ga0495662_0166867 Ga0495662_0166867_593_922 108
314 3300046477 Ga0495664_0287449 Ga0495664_0287449_52_381 108
315 3300046491 Ga0495584_0080785 Ga0495584_0080785_1283_1612 108
316 3300046492 Ga0495585_0036219 Ga0495585_0036219_1768_2097 108
317 3300046500 Ga0495596_0042355 Ga0495596_0042355_777_1106 108
318 3300046501 Ga0495607_0032487 Ga0495607_0032487_1172_1501 108
319 3300046506 Ga0495583_0149025 Ga0495583_0149025_358_687 108
320 3300046506 Ga0495583_0200388 Ga0495583_0200388_179_508 108
321 3300046507 Ga0495606_0048336 Ga0495606_0048336_1894_2223 108
322 3300046512 Ga0495610_0329945 Ga0495610_0329945_46_375 108
323 3300046516 Ga0495628_0774260 Ga0495628_0774260_48_377 108
324 3300046518 Ga0495631_0121655 Ga0495631_0121655_235_564 108
325 3300046523 Ga0495644_0049550 Ga0495644_0049550_853_1182 108
326 3300046528 Ga0495642_0061830 Ga0495642_0061830_153_482 108
327 3300046529 Ga0495652_0779659 Ga0495652_0779659_211_540 108
328 3300046530 Ga0495654_0111041 Ga0495654_0111041_217_546 108
329 3300046530 Ga0495654_0228217 Ga0495654_0228217_144_473 108
330 3300046531 Ga0495665_0188415 Ga0495665_0188415_587_916 108
331 3300046543 Ga0495645_0016002 Ga0495645_0016002_3191_3520 108
332 3300046543 Ga0495645_0117998 Ga0495645_0117998_871_1200 108
333 3300046615 Ga0495656_0163640 Ga0495656_0163640_442_771 108
334 3300046616 Ga0495668_0063937 Ga0495668_0063937_854_1183 108
335 3300046642 Ga0495634_0607287 Ga0495634_0607287_250_579 108
336 3300046660 Ga0495625_0122746 Ga0495625_0122746_434_763 108
337 3300046674 Ga0495588_0140899 Ga0495588_0140899_281_610 108
338 3300046680 Ga0495646_0119703 Ga0495646_0119703_1054_1383 108
339 3300046684 Ga0495669_0049782 Ga0495669_0049782_1105_1434 108
340 3300046689 Ga0495613_0074631 Ga0495613_0074631_1966_2295 108
341 3300046691 Ga0495670_0052688 Ga0495670_0052688_1271_1600 108
342 3300046794 Ga0495589_0016427 Ga0495589_0016427_1107_1436 108
343 3300046794 Ga0495589_0082034 Ga0495589_0082034_797_1126 108
344 3300046809 Ga0495600_0097938 Ga0495600_0097938_355_684 108
345 3300046810 Ga0495660_0473142 Ga0495660_0473142_161_490 108
346 3300047315 Ga0495581_0010181 Ga0495581_0010181_264_593 108
347 3300047318 Ga0495636_0102512 Ga0495636_0102512_242_571 108
348 3300047323 Ga0495683_0065680 Ga0495683_0065680_434_763 108
349 3300047323 Ga0495683_0109784 Ga0495683_0109784_749_1078 108
350 3300047443 Ga0495687_062729 Ga0495687_062729_327_656 108
351 3300047444 Ga0495675_0415759 Ga0495675_0415759_151_480 108
352 3300047446 Ga0495679_069252 Ga0495679_069252_655_984 108
353 3300047470 Ga0495681_0072339 Ga0495681_0072339_683_1012 108
354 3300048089 Ga0495614_0173009 Ga0495614_0173009_593_922 108
355 3300048903 Ga0496100_0065110 Ga0496100_0065110_26_355 108
356 3300048903 Ga0496100_0176191 Ga0496100_0176191_779_1108 108
357 3300048905 Ga0496102_0170307 Ga0496102_0170307_542_871 108
358 3300048907 Ga0496104_0259682 Ga0496104_0259682_638_967 108
359 3300048909 Ga0496106_0053740 Ga0496106_0053740_1638_1967 108
360 3300048910 Ga0496107_0014841 Ga0496107_0014841_4129_4458 108
361 3300048914 Ga0496111_0927413 Ga0496111_0927413_257_586 108
362 3300048917 Ga0496114_0041637 Ga0496114_0041637_1184_1513 108
363 3300048917 Ga0496114_0574584 Ga0496114_0574584_51_380 108
364 3300048918 Ga0496115_0272241 Ga0496115_0272241_616_945 108
365 3300048929 Ga0496126_0637993 Ga0496126_0637993_345_674 108
366 3300046471 Ga0495650_0011742 Ga0495650_0011742_659_988 109
367 3300001979 JGI24740J21852_10001714 JGI24740J21852_100017144 110
368 3300001989 JGI24739J22299_10072803 JGI24739J22299_100728032 110
369 3300002067 JGI24735J21928_10000724 JGI24735J21928_1000072412 110
370 3300002075 JGI24738J21930_10000432 JGI24738J21930_100004329 110
371 3300002705 JGI25156J39149_1002116 JGI25156J39149_10021162 110
372 3300002705 JGI25156J39149_1002258 JGI25156J39149_10022582 110
373 3300002705 JGI25156J39149_1003418 JGI25156J39149_10034187 110
374 3300003214 JGI25165J46597_1004165 JGI25165J46597_10041652 110
375 3300003320 rootH2_10065070 rootH2_100650703 110
376 3300003756 Ga0055533_1000085 Ga0055533_1000085109 110
377 3300003756 Ga0055533_1002621 Ga0055533_10026214 110
378 3300003758 Ga0055532_1000001 Ga0055532_1000001199 110
379 3300003759 Ga0055525_1004047 Ga0055525_10040473 110
380 3300003760 Ga0055527_1000002 Ga0055527_1000002560 110
381 3300003761 Ga0055535_1000001 Ga0055535_1000001805 110
382 3300003762 Ga0055542_1000001 Ga0055542_1000001199 110
383 3300003763 Ga0055529_1000026 Ga0055529_100002685 110
384 3300005262 Ga0065165_1000789 Ga0065165_10007894 110
385 3300005327 Ga0070658_10006241 Ga0070658_100062417 110
386 3300005339 Ga0070660_100005061 Ga0070660_10000506110 110
387 3300005339 Ga0070660_100129562 Ga0070660_1001295621 110
388 3300005339 Ga0070660_100760957 Ga0070660_1007609572 110
389 3300005344 Ga0070661_100138907 Ga0070661_1001389071 110
390 3300005344 Ga0070661_100274517 Ga0070661_1002745173 110
391 3300005366 Ga0070659_100416172 Ga0070659_1004161722 110
392 3300005367 Ga0070667_100250285 Ga0070667_1002502853 110
393 3300005455 Ga0070663_100186724 Ga0070663_1001867241 110
394 3300005563 Ga0068855_100018889 Ga0068855_1000188893 110
395 3300005563 Ga0068855_100036231 Ga0068855_1000362312 110
396 3300005563 Ga0068855_100177297 Ga0068855_1001772972 110
397 3300005578 Ga0068854_100633852 Ga0068854_1006338522 110
398 3300005614 Ga0068856_100233179 Ga0068856_1002331791 110
399 3300009011 Ga0105251_10008691 Ga0105251_100086912 110
400 3300009093 Ga0105240_10044334 Ga0105240_100443343 110
401 3300009093 Ga0105240_12504487 Ga0105240_125044871 110
402 3300009176 Ga0105242_11461942 Ga0105242_114619422 110
403 3300009177 Ga0105248_10261261 Ga0105248_102612612 110
404 3300009545 Ga0105237_10038339 Ga0105237_100383391 110
405 3300009545 Ga0105237_10298644 Ga0105237_102986442 110
406 3300009551 Ga0105238_10450357 Ga0105238_104503572 110
407 3300009551 Ga0105238_10997211 Ga0105238_109972112 110
408 3300010375 Ga0105239_10863915 Ga0105239_108639153 110
409 3300013104 Ga0157370_10002388 Ga0157370_100023886 110
410 3300013104 Ga0157370_10253218 Ga0157370_102532183 110
411 3300013104 Ga0157370_10453892 Ga0157370_104538921 110
412 3300013105 Ga0157369_10000511 Ga0157369_100005112 110
413 3300013105 Ga0157369_10006322 Ga0157369_1000632214 110
414 3300013105 Ga0157369_10041852 Ga0157369_100418522 110
415 3300013105 Ga0157369_10405611 Ga0157369_104056112 110
416 3300013307 Ga0157372_11315540 Ga0157372_113155402 110
417 3300014497 Ga0182008_10088323 Ga0182008_100883232 110
418 3300014497 Ga0182008_10467056 Ga0182008_104670562 110
419 3300015261 Ga0182006_1078009 Ga0182006_10780092 110
420 3300015262 Ga0182007_10005284 Ga0182007_100052842 110
421 3300015262 Ga0182007_10032191 Ga0182007_100321913 110
422 3300016635 Ga0183361_10006 Ga0183361_10006143 110
423 3300020069 Ga0197907_10252183 Ga0197907_102521832 110
424 3300020070 Ga0206356_11352296 Ga0206356_113522962 110
425 3300020081 Ga0206354_10463584 Ga0206354_104635842 110
426 3300020082 Ga0206353_10946608 Ga0206353_109466082 110
427 3300021361 Ga0213872_10349434 Ga0213872_103494342 110
428 3300022467 Ga0224712_10004065 Ga0224712_100040655 110
429 3300025225 Ga0209566_117037 Ga0209566_1170372 110
430 3300025226 Ga0209674_100005 Ga0209674_100005569 110
431 3300025226 Ga0209674_100113 Ga0209674_10011323 110
432 3300025228 Ga0209672_100001 Ga0209672_1000011030 110
433 3300025229 Ga0209147_100001 Ga0209147_1000011030 110
434 3300025230 Ga0209563_100297 Ga0209563_1002979 110
435 3300025231 Ga0207427_101561 Ga0207427_1015614 110
436 3300025242 Ga0209258_100001 Ga0209258_1000011030 110
437 3300025246 Ga0209646_1023494 Ga0209646_10234942 110
438 3300025254 Ga0209148_1000003 Ga0209148_10000031030 110
439 3300025256 Ga0209759_1000029 Ga0209759_1000029188 110
440 3300025256 Ga0209759_1000030 Ga0209759_1000030141 110
441 3300025256 Ga0209759_1000113 Ga0209759_100011315 110
442 3300025256 Ga0209759_1003039 Ga0209759_10030394 110
443 3300025256 Ga0209759_1048621 Ga0209759_10486212 110
444 3300025261 Ga0209233_1000043 Ga0209233_1000043456 110
445 3300025272 Ga0209455_1000001 Ga0209455_10000011030 110
446 3300025284 Ga0209130_1020828 Ga0209130_10208282 110
447 3300025302 Ga0207426_1000125 Ga0207426_1000125100 110
448 3300025735 Ga0207713_1000252 Ga0207713_100025238 110
449 3300025904 Ga0207647_10000108 Ga0207647_1000010826 110
450 3300025904 Ga0207647_10040451 Ga0207647_100404514 110
451 3300025904 Ga0207647_10060871 Ga0207647_100608712 110
452 3300025909 Ga0207705_10001472 Ga0207705_100014723 110
453 3300025909 Ga0207705_10087826 Ga0207705_100878262 110
454 3300025913 Ga0207695_10006143 Ga0207695_1000614316 110
455 3300025913 Ga0207695_11562266 Ga0207695_115622661 110
456 3300025914 Ga0207671_10071247 Ga0207671_100712475 110
457 3300025919 Ga0207657_10004746 Ga0207657_100047464 110
458 3300025919 Ga0207657_10056578 Ga0207657_100565784 110
459 3300025924 Ga0207694_10143276 Ga0207694_101432764 110
460 3300025941 Ga0207711_10887008 Ga0207711_108870082 110
461 3300025949 Ga0207667_10003006 Ga0207667_100030064 110
462 3300025986 Ga0207658_10228315 Ga0207658_102283153 110
463 3300026041 Ga0207639_11013111 Ga0207639_110131111 110
464 3300026067 Ga0207678_10086576 Ga0207678_100865762 110
465 3300026067 Ga0207678_11513598 Ga0207678_115135982 110
466 3300027312 Ga0209371_1007843 Ga0209371_10078432 110
467 3300028800 Ga0265338_10000028 Ga0265338_1000002895 110
468 3300028800 Ga0265338_10484560 Ga0265338_104845601 110
469 3300030500 Ga0268256_1008120 Ga0268256_10081205 110
470 3300031548 Ga0307408_100605097 Ga0307408_1006050972 110
471 3300031731 Ga0307405_10387210 Ga0307405_103872102 110
472 3300031911 Ga0307412_10000021 Ga0307412_10000021208 110
473 3300031911 Ga0307412_10316819 Ga0307412_103168192 110
474 3300037312 Ga0395899_0000007 Ga0395899_0000007_373592_373924 110
475 3300037312 Ga0395899_0007335 Ga0395899_0007335_2906_3238 110
476 3300037312 Ga0395899_0092576 Ga0395899_0092576_1419_1751 110
477 3300037418 Ga0395900_0000026 Ga0395900_0000026_57933_58265 110
478 3300037418 Ga0395900_0006887 Ga0395900_0006887_5017_5349 110
479 3300037418 Ga0395900_0076376 Ga0395900_0076376_1406_1738 110
480 3300037418 Ga0395900_0100212 Ga0395900_0100212_1954_2286 110
481 3300037418 Ga0395900_0111842 Ga0395900_0111842_1134_1466 110
482 3300037418 Ga0395900_0327299 Ga0395900_0327299_586_918 110
483 3300037418 Ga0395900_1240385 Ga0395900_1240385_213_545 110
484 3300037466 Ga0395898_0000497 Ga0395898_0000497_63400_63732 110
485 3300037466 Ga0395898_0001748 Ga0395898_0001748_2379_2711 110
486 3300037466 Ga0395898_0017158 Ga0395898_0017158_5208_5540 110
487 3300037466 Ga0395898_0124081 Ga0395898_0124081_1976_2308 110
488 3300037466 Ga0395898_0188055 Ga0395898_0188055_216_548 110
489 3300037466 Ga0395898_1460658 Ga0395898_1460658_44_376 110
490 3300037471 Ga0395905_1115101 Ga0395905_1115101_100_432 110
491 3300038443 Ga0395901_0000061 Ga0395901_0000061_141339_141671 110
492 3300038443 Ga0395901_0000923 Ga0395901_0000923_5244_5576 110
493 3300038443 Ga0395901_0134278 Ga0395901_0134278_639_971 110
494 3300038443 Ga0395901_0228195 Ga0395901_0228195_564_896 110
495 3300039447 Ga0436361_0070776 Ga0436361_0070776_168_500 110
496 3300042005 Ga0439448_0000392 Ga0439448_0000392_5305_5637 110
497 3300044656 Ga0466969_0002567 Ga0466969_0002567_4069_4401 110
498 3300044656 Ga0466969_0047131 Ga0466969_0047131_29_361 110
499 3300044658 Ga0466972_0068933 Ga0466972_0068933_1018_1350 110
500 3300044658 Ga0466972_0115825 Ga0466972_0115825_818_1150 110
501 3300044659 Ga0466973_0200758 Ga0466973_0200758_397_729 110
502 3300044683 Ga0466965_0000890 Ga0466965_0000890_1482_1814 110
503 3300044683 Ga0466965_0019994 Ga0466965_0019994_1987_2319 110
504 3300044684 Ga0466966_0041106 Ga0466966_0041106_511_843 110
505 3300044684 Ga0466966_0044894 Ga0466966_0044894_1458_1790 110
506 3300044684 Ga0466966_0072328 Ga0466966_0072328_1047_1379 110
507 3300044693 Ga0466961_0000567 Ga0466961_0000567_5638_5970 110
508 3300044693 Ga0466961_0017448 Ga0466961_0017448_823_1155 110
509 3300044693 Ga0466961_0070039 Ga0466961_0070039_1116_1448 110
510 3300044693 Ga0466961_0690022 Ga0466961_0690022_240_572 110
511 3300044694 Ga0466963_0011972 Ga0466963_0011972_3506_3838 110
512 3300044694 Ga0466963_0019197 Ga0466963_0019197_2849_3181 110
513 3300044706 Ga0466964_0009458 Ga0466964_0009458_3216_3548 110
514 3300044706 Ga0466964_0758237 Ga0466964_0758237_104_436 110
515 3300044719 Ga0466971_0002526 Ga0466971_0002526_1118_1450 110
516 3300044719 Ga0466971_0008086 Ga0466971_0008086_784_1116 110
517 3300044735 Ga0466968_0051552 Ga0466968_0051552_1391_1723 110
518 3300044765 Ga0466970_0004794 Ga0466970_0004794_1180_1512 110
519 3300044765 Ga0466970_0123741 Ga0466970_0123741_671_1003 110
520 3300044842 Ga0466957_0006129 Ga0466957_0006129_3357_3689 110
521 3300044842 Ga0466957_0076329 Ga0466957_0076329_918_1250 110
522 3300044842 Ga0466957_0103525 Ga0466957_0103525_132_464 110
523 3300044842 Ga0466957_0291974 Ga0466957_0291974_471_803 110
524 3300044842 Ga0466957_0556546 Ga0466957_0556546_360_692 110
525 3300044842 Ga0466957_1190341 Ga0466957_1190341_137_469 110
526 3300044901 Ga0466960_0259334 Ga0466960_0259334_231_563 110
527 3300045049 Ga0466959_0027108 Ga0466959_0027108_2621_2953 110
528 3300045049 Ga0466959_0122804 Ga0466959_0122804_1310_1642 110
529 3300045836 Ga0466958_0009880 Ga0466958_0009880_3686_4018 110
530 3300045836 Ga0466958_0031642 Ga0466958_0031642_1264_1596 110
531 3300045836 Ga0466958_0081021 Ga0466958_0081021_1564_1896 110
532 3300045836 Ga0466958_0465398 Ga0466958_0465398_222_554 110
533 3300045976 Ga0466967_0332355 Ga0466967_0332355_214_546 110
534 3300045976 Ga0466967_0532749 Ga0466967_0532749_247_579 110
535 3300046454 Ga0495592_0020789 Ga0495592_0020789_3998_4330 110
536 3300046454 Ga0495592_0102197 Ga0495592_0102197_1641_1973 110
537 3300046454 Ga0495592_0217564 Ga0495592_0217564_457_789 110
538 3300046455 Ga0495603_0017825 Ga0495603_0017825_504_836 110
539 3300046457 Ga0495590_0005824 Ga0495590_0005824_3430_3762 110
540 3300046457 Ga0495590_0011532 Ga0495590_0011532_1372_1704 110
541 3300046458 Ga0495591_002749 Ga0495591_002749_5908_6240 110
542 3300046458 Ga0495591_146923 Ga0495591_146923_195_527 110
543 3300046459 Ga0495629_0000281 Ga0495629_0000281_39915_40247 110
544 3300046459 Ga0495629_0002911 Ga0495629_0002911_8832_9164 110
545 3300046459 Ga0495629_0056812 Ga0495629_0056812_1108_1440 110
546 3300046459 Ga0495629_0067652 Ga0495629_0067652_703_1035 110
547 3300046459 Ga0495629_0081683 Ga0495629_0081683_1657_1989 110
548 3300046460 Ga0495638_0012474 Ga0495638_0012474_5426_5758 110
549 3300046461 Ga0495641_0017661 Ga0495641_0017661_3291_3623 110
550 3300046462 Ga0495651_0014367 Ga0495651_0014367_5723_6055 110
551 3300046462 Ga0495651_0119048 Ga0495651_0119048_1471_1803 110
552 3300046462 Ga0495651_0124963 Ga0495651_0124963_1499_1831 110
553 3300046462 Ga0495651_0184066 Ga0495651_0184066_774_1106 110
554 3300046462 Ga0495651_0337700 Ga0495651_0337700_584_916 110
555 3300046463 Ga0495653_0012862 Ga0495653_0012862_2859_3191 110
556 3300046463 Ga0495653_0039682 Ga0495653_0039682_174_506 110
557 3300046463 Ga0495653_0095972 Ga0495653_0095972_413_745 110
558 3300046463 Ga0495653_0108173 Ga0495653_0108173_1230_1562 110
559 3300046463 Ga0495653_0325226 Ga0495653_0325226_65_397 110
560 3300046463 Ga0495653_0801863 Ga0495653_0801863_75_407 110
561 3300046471 Ga0495650_0062850 Ga0495650_0062850_447_779 110
562 3300046471 Ga0495650_0111320 Ga0495650_0111320_463_795 110
563 3300046472 Ga0495580_0000154 Ga0495580_0000154_39708_40040 110
564 3300046472 Ga0495580_0030093 Ga0495580_0030093_3191_3523 110
565 3300046472 Ga0495580_0035096 Ga0495580_0035096_603_935 110
566 3300046472 Ga0495580_0044745 Ga0495580_0044745_2581_2913 110
567 3300046472 Ga0495580_0075674 Ga0495580_0075674_1592_1924 110
568 3300046472 Ga0495580_0508562 Ga0495580_0508562_60_392 110
569 3300046473 Ga0495582_0045895 Ga0495582_0045895_1605_1937 110
570 3300046473 Ga0495582_0053737 Ga0495582_0053737_1672_2004 110
571 3300046473 Ga0495582_0071608 Ga0495582_0071608_440_772 110
572 3300046473 Ga0495582_0167707 Ga0495582_0167707_226_558 110
573 3300046474 Ga0495605_0014238 Ga0495605_0014238_3955_4287 110
574 3300046474 Ga0495605_0016251 Ga0495605_0016251_570_902 110
575 3300046476 Ga0495662_0054588 Ga0495662_0054588_1359_1691 110
576 3300046476 Ga0495662_0126374 Ga0495662_0126374_85_417 110
577 3300046477 Ga0495664_0005063 Ga0495664_0005063_3260_3592 110
578 3300046477 Ga0495664_0030156 Ga0495664_0030156_2158_2490 110
579 3300046477 Ga0495664_0110091 Ga0495664_0110091_1088_1420 110
580 3300046477 Ga0495664_0170043 Ga0495664_0170043_445_777 110
581 3300046499 Ga0495594_0111194 Ga0495594_0111194_91_423 110
582 3300046499 Ga0495594_0287385 Ga0495594_0287385_412_744 110
583 3300046500 Ga0495596_0013287 Ga0495596_0013287_568_900 110
584 3300046500 Ga0495596_0032825 Ga0495596_0032825_562_894 110
585 3300046500 Ga0495596_0034526 Ga0495596_0034526_1517_1849 110
586 3300046500 Ga0495596_0060930 Ga0495596_0060930_651_983 110
587 3300046506 Ga0495583_0010852 Ga0495583_0010852_1337_1669 110
588 3300046507 Ga0495606_0015296 Ga0495606_0015296_1574_1906 110
589 3300046507 Ga0495606_0015308 Ga0495606_0015308_3067_3399 110
590 3300046507 Ga0495606_0073082 Ga0495606_0073082_308_640 110
591 3300046507 Ga0495606_0145817 Ga0495606_0145817_33_365 110
592 3300046511 Ga0495608_0016903 Ga0495608_0016903_1237_1569 110
593 3300046511 Ga0495608_0068634 Ga0495608_0068634_1816_2148 110
594 3300046511 Ga0495608_0286367 Ga0495608_0286367_502_834 110
595 3300046512 Ga0495610_0000369 Ga0495610_0000369_44958_45290 110
596 3300046514 Ga0495618_0019627 Ga0495618_0019627_3449_3781 110
597 3300046514 Ga0495618_0028556 Ga0495618_0028556_2486_2818 110
598 3300046514 Ga0495618_0106825 Ga0495618_0106825_37_369 110
599 3300046515 Ga0495620_0011282 Ga0495620_0011282_2747_3079 110
600 3300046515 Ga0495620_0192615 Ga0495620_0192615_414_746 110
601 3300046516 Ga0495628_0000957 Ga0495628_0000957_20775_21107 110
602 3300046516 Ga0495628_0043400 Ga0495628_0043400_1949_2281 110
603 3300046516 Ga0495628_0068546 Ga0495628_0068546_474_806 110
604 3300046516 Ga0495628_0095319 Ga0495628_0095319_1525_1857 110
605 3300046516 Ga0495628_0228471 Ga0495628_0228471_443_775 110
606 3300046516 Ga0495628_0518422 Ga0495628_0518422_43_375 110
607 3300046517 Ga0495630_0011675 Ga0495630_0011675_4703_5035 110
608 3300046517 Ga0495630_0036267 Ga0495630_0036267_1619_1951 110
609 3300046517 Ga0495630_0038400 Ga0495630_0038400_1607_1939 110
610 3300046517 Ga0495630_0117251 Ga0495630_0117251_886_1218 110
611 3300046517 Ga0495630_0214938 Ga0495630_0214938_467_799 110
612 3300046518 Ga0495631_0091851 Ga0495631_0091851_29_361 110
613 3300046522 Ga0495643_0074058 Ga0495643_0074058_1191_1523 110
614 3300046524 Ga0495648_0020030 Ga0495648_0020030_1792_2124 110
615 3300046524 Ga0495648_0051857 Ga0495648_0051857_1229_1561 110
616 3300046524 Ga0495648_0073333 Ga0495648_0073333_761_1093 110
617 3300046524 Ga0495648_0099764 Ga0495648_0099764_506_838 110
618 3300046524 Ga0495648_0377971 Ga0495648_0377971_194_526 110
619 3300046526 Ga0495666_0005671 Ga0495666_0005671_3436_3768 110
620 3300046526 Ga0495666_0140827 Ga0495666_0140827_218_550 110
621 3300046526 Ga0495666_0146375 Ga0495666_0146375_405_737 110
622 3300046526 Ga0495666_0179048 Ga0495666_0179048_465_797 110
623 3300046528 Ga0495642_0064424 Ga0495642_0064424_457_789 110
624 3300046529 Ga0495652_0007894 Ga0495652_0007894_504_836 110
625 3300046529 Ga0495652_0010346 Ga0495652_0010346_7616_7948 110
626 3300046529 Ga0495652_0078034 Ga0495652_0078034_2007_2339 110
627 3300046529 Ga0495652_0298167 Ga0495652_0298167_429_761 110
628 3300046529 Ga0495652_0401680 Ga0495652_0401680_211_543 110
629 3300046531 Ga0495665_0001638 Ga0495665_0001638_632_964 110
630 3300046531 Ga0495665_0002860 Ga0495665_0002860_3749_4081 110
631 3300046531 Ga0495665_0027317 Ga0495665_0027317_1572_1904 110
632 3300046531 Ga0495665_0109187 Ga0495665_0109187_1043_1375 110
633 3300046533 Ga0495640_0016370 Ga0495640_0016370_3180_3512 110
634 3300046533 Ga0495640_0027384 Ga0495640_0027384_3599_3931 110
635 3300046533 Ga0495640_0036762 Ga0495640_0036762_897_1229 110
636 3300046535 Ga0495586_0005670 Ga0495586_0005670_3557_3889 110
637 3300046535 Ga0495586_0035251 Ga0495586_0035251_212_544 110
638 3300046535 Ga0495586_0114362 Ga0495586_0114362_310_642 110
639 3300046535 Ga0495586_0303355 Ga0495586_0303355_59_391 110
640 3300046536 Ga0495587_0006577 Ga0495587_0006577_3936_4268 110
641 3300046536 Ga0495587_0046722 Ga0495587_0046722_563_895 110
642 3300046542 Ga0495597_0032107 Ga0495597_0032107_1986_2318 110
643 3300046542 Ga0495597_0152699 Ga0495597_0152699_446_778 110
644 3300046543 Ga0495645_0016682 Ga0495645_0016682_489_821 110
645 3300046543 Ga0495645_0235019 Ga0495645_0235019_383_715 110
646 3300046543 Ga0495645_0432748 Ga0495645_0432748_51_383 110
647 3300046557 Ga0495622_0000383 Ga0495622_0000383_3539_3871 110
648 3300046559 Ga0495667_0074733 Ga0495667_0074733_571_903 110
649 3300046559 Ga0495667_0176613 Ga0495667_0176613_450_782 110
650 3300046616 Ga0495668_0541579 Ga0495668_0541579_141_473 110
651 3300046642 Ga0495634_0015597 Ga0495634_0015597_2155_2487 110
652 3300046642 Ga0495634_0058755 Ga0495634_0058755_591_923 110
653 3300046642 Ga0495634_0156104 Ga0495634_0156104_603_935 110
654 3300046648 Ga0495611_0026723 Ga0495611_0026723_600_932 110
655 3300046648 Ga0495611_0033563 Ga0495611_0033563_1852_2184 110
656 3300046660 Ga0495625_0018707 Ga0495625_0018707_1042_1374 110
657 3300046663 Ga0495635_0000831 Ga0495635_0000831_196_528 110
658 3300046663 Ga0495635_0028072 Ga0495635_0028072_1203_1535 110
659 3300046663 Ga0495635_0041991 Ga0495635_0041991_830_1162 110
660 3300046665 Ga0495661_0020936 Ga0495661_0020936_2347_2679 110
661 3300046665 Ga0495661_0041205 Ga0495661_0041205_2441_2773 110
662 3300046665 Ga0495661_0392898 Ga0495661_0392898_131_463 110
663 3300046674 Ga0495588_0208107 Ga0495588_0208107_493_825 110
664 3300046675 Ga0495657_0040697 Ga0495657_0040697_448_780 110
665 3300046678 Ga0495599_0029991 Ga0495599_0029991_1465_1797 110
666 3300046678 Ga0495599_0083470 Ga0495599_0083470_1453_1785 110
667 3300046678 Ga0495599_0089203 Ga0495599_0089203_1262_1594 110
668 3300046678 Ga0495599_0295677 Ga0495599_0295677_543_875 110
669 3300046679 Ga0495623_0010427 Ga0495623_0010427_1739_2071 110
670 3300046679 Ga0495623_0013066 Ga0495623_0013066_3594_3926 110
671 3300046679 Ga0495623_0016627 Ga0495623_0016627_3994_4326 110
672 3300046679 Ga0495623_0081951 Ga0495623_0081951_562_894 110
673 3300046679 Ga0495623_0331754 Ga0495623_0331754_267_599 110
674 3300046680 Ga0495646_0015341 Ga0495646_0015341_3470_3802 110
675 3300046680 Ga0495646_0021769 Ga0495646_0021769_3358_3690 110
676 3300046680 Ga0495646_0058315 Ga0495646_0058315_473_805 110
677 3300046680 Ga0495646_0146869 Ga0495646_0146869_448_780 110
678 3300046680 Ga0495646_0273187 Ga0495646_0273187_352_684 110
679 3300046680 Ga0495646_0273757 Ga0495646_0273757_349_681 110
680 3300046684 Ga0495669_0192233 Ga0495669_0192233_163_495 110
681 3300046684 Ga0495669_0517374 Ga0495669_0517374_110_442 110
682 3300046689 Ga0495613_0010942 Ga0495613_0010942_3471_3803 110
683 3300046689 Ga0495613_0161198 Ga0495613_0161198_664_996 110
684 3300046689 Ga0495613_0321149 Ga0495613_0321149_18_350 110
685 3300046690 Ga0495624_0006505 Ga0495624_0006505_4577_4909 110
686 3300046690 Ga0495624_0015934 Ga0495624_0015934_722_1054 110
687 3300046690 Ga0495624_0063854 Ga0495624_0063854_409_741 110
688 3300046690 Ga0495624_0181423 Ga0495624_0181423_447_779 110
689 3300046690 Ga0495624_0231369 Ga0495624_0231369_567_899 110
690 3300046690 Ga0495624_0297395 Ga0495624_0297395_313_645 110
691 3300046691 Ga0495670_0827494 Ga0495670_0827494_111_443 110
692 3300046692 Ga0495671_0022152 Ga0495671_0022152_2098_2430 110
693 3300046692 Ga0495671_0240739 Ga0495671_0240739_477_809 110
694 3300046694 Ga0495649_0006437 Ga0495649_0006437_3805_4137 110
695 3300046694 Ga0495649_0127197 Ga0495649_0127197_222_554 110
696 3300046794 Ga0495589_0011585 Ga0495589_0011585_532_864 110
697 3300046794 Ga0495589_0032655 Ga0495589_0032655_1539_1871 110
698 3300046794 Ga0495589_0179260 Ga0495589_0179260_418_750 110
699 3300046794 Ga0495589_0426722 Ga0495589_0426722_94_426 110
700 3300046809 Ga0495600_0000230 Ga0495600_0000230_30235_30567 110
701 3300046809 Ga0495600_0020259 Ga0495600_0020259_2332_2664 110
702 3300046809 Ga0495600_0075679 Ga0495600_0075679_1184_1516 110
703 3300046810 Ga0495660_0200227 Ga0495660_0200227_379_711 110
704 3300047315 Ga0495581_0000175 Ga0495581_0000175_3428_3760 110
705 3300047315 Ga0495581_0060985 Ga0495581_0060985_552_884 110
706 3300047315 Ga0495581_0069960 Ga0495581_0069960_452_784 110
707 3300047317 Ga0495604_0014571 Ga0495604_0014571_2969_3301 110
708 3300047317 Ga0495604_0024517 Ga0495604_0024517_542_874 110
709 3300047317 Ga0495604_0077021 Ga0495604_0077021_591_923 110
710 3300047317 Ga0495604_0102689 Ga0495604_0102689_218_550 110
711 3300047317 Ga0495604_0200269 Ga0495604_0200269_861_1193 110
712 3300047317 Ga0495604_0716911 Ga0495604_0716911_166_498 110
713 3300047319 Ga0495674_0003433 Ga0495674_0003433_8936_9268 110
714 3300047319 Ga0495674_0029930 Ga0495674_0029930_1425_1757 110
715 3300047319 Ga0495674_0031504 Ga0495674_0031504_3062_3394 110
716 3300047319 Ga0495674_0093833 Ga0495674_0093833_360_692 110
717 3300047319 Ga0495674_0146077 Ga0495674_0146077_138_470 110
718 3300047319 Ga0495674_0175434 Ga0495674_0175434_467_799 110
719 3300047319 Ga0495674_0278452 Ga0495674_0278452_990_1322 110
720 3300047319 Ga0495674_0338705 Ga0495674_0338705_690_1022 110
721 3300047320 Ga0495672_0054162 Ga0495672_0054162_949_1281 110
722 3300047320 Ga0495672_0450309 Ga0495672_0450309_165_497 110
723 3300047320 Ga0495672_0463098 Ga0495672_0463098_190_522 110
724 3300047321 Ga0495676_0004878 Ga0495676_0004878_6758_7090 110
725 3300047321 Ga0495676_0043309 Ga0495676_0043309_3181_3513 110
726 3300047321 Ga0495676_0175632 Ga0495676_0175632_1077_1409 110
727 3300047321 Ga0495676_0252601 Ga0495676_0252601_750_1082 110
728 3300047321 Ga0495676_0373666 Ga0495676_0373666_556_888 110
729 3300047322 Ga0495680_0027903 Ga0495680_0027903_1332_1664 110
730 3300047322 Ga0495680_0072210 Ga0495680_0072210_1709_2041 110
731 3300047322 Ga0495680_0262328 Ga0495680_0262328_754_1086 110
732 3300047323 Ga0495683_0030504 Ga0495683_0030504_1120_1452 110
733 3300047323 Ga0495683_0031526 Ga0495683_0031526_1787_2119 110
734 3300047323 Ga0495683_0041277 Ga0495683_0041277_1229_1561 110
735 3300047323 Ga0495683_0066082 Ga0495683_0066082_50_382 110
736 3300047323 Ga0495683_0192496 Ga0495683_0192496_197_529 110
737 3300047443 Ga0495687_034863 Ga0495687_034863_896_1228 110
738 3300047443 Ga0495687_050153 Ga0495687_050153_1229_1561 110
739 3300047443 Ga0495687_059590 Ga0495687_059590_621_953 110
740 3300047443 Ga0495687_125370 Ga0495687_125370_335_667 110
741 3300047444 Ga0495675_0016864 Ga0495675_0016864_3069_3401 110
742 3300047444 Ga0495675_0028740 Ga0495675_0028740_2284_2616 110
743 3300047444 Ga0495675_0031902 Ga0495675_0031902_1715_2047 110
744 3300047444 Ga0495675_0263683 Ga0495675_0263683_436_768 110
745 3300047444 Ga0495675_0278670 Ga0495675_0278670_268_600 110
746 3300047446 Ga0495679_000102 Ga0495679_000102_22801_23133 110
747 3300047446 Ga0495679_001030 Ga0495679_001030_14467_14799 110
748 3300047469 Ga0495673_0024042 Ga0495673_0024042_775_1107 110
749 3300047469 Ga0495673_0044512 Ga0495673_0044512_595_927 110
750 3300047470 Ga0495681_0134022 Ga0495681_0134022_493_825 110
751 3300047471 Ga0495684_0052678 Ga0495684_0052678_2021_2353 110
752 3300047472 Ga0495686_0105920 Ga0495686_0105920_484_816 110
753 3300047673 Ga0495593_0002180 Ga0495593_0002180_2603_2935 110
754 3300047673 Ga0495593_0008077 Ga0495593_0008077_2494_2826 110
755 3300047673 Ga0495593_0042272 Ga0495593_0042272_1718_2050 110
756 3300048088 Ga0495602_0006744 Ga0495602_0006744_3357_3689 110
757 3300048088 Ga0495602_0067223 Ga0495602_0067223_435_767 110
758 3300048088 Ga0495602_0084115 Ga0495602_0084115_1903_2235 110
759 3300048088 Ga0495602_0089210 Ga0495602_0089210_1550_1882 110
760 3300048088 Ga0495602_0250971 Ga0495602_0250971_389_721 110
761 3300048088 Ga0495602_0485111 Ga0495602_0485111_186_518 110
762 3300048088 Ga0495602_0692107 Ga0495602_0692107_324_656 110
763 3300048089 Ga0495614_0000336 Ga0495614_0000336_3916_4248 110
764 3300048089 Ga0495614_0001827 Ga0495614_0001827_2026_2358 110
765 3300048089 Ga0495614_0245751 Ga0495614_0245751_191_523 110
766 3300048091 Ga0495626_0019875 Ga0495626_0019875_3008_3340 110
767 3300048903 Ga0496100_0000354 Ga0496100_0000354_20079_20411 110
768 3300048903 Ga0496100_0252150 Ga0496100_0252150_241_573 110
769 3300048904 Ga0496101_0000527 Ga0496101_0000527_3288_3620 110
770 3300048905 Ga0496102_0002557 Ga0496102_0002557_11900_12232 110
771 3300048905 Ga0496102_0060309 Ga0496102_0060309_2796_3128 110
772 3300048905 Ga0496102_0244462 Ga0496102_0244462_895_1227 110
773 3300048905 Ga0496102_0373030 Ga0496102_0373030_929_1261 110
774 3300048906 Ga0496103_0000752 Ga0496103_0000752_1336_1668 110
775 3300048906 Ga0496103_0039972 Ga0496103_0039972_1614_1946 110
776 3300048906 Ga0496103_0526227 Ga0496103_0526227_203_535 110
777 3300048906 Ga0496103_0547157 Ga0496103_0547157_29_361 110
778 3300048907 Ga0496104_0435893 Ga0496104_0435893_708_1040 110
779 3300048908 Ga0496105_0164990 Ga0496105_0164990_1260_1592 110
780 3300048909 Ga0496106_0000089 Ga0496106_0000089_16675_17007 110
781 3300048915 Ga0496112_0073198 Ga0496112_0073198_132_464 110
782 3300048916 Ga0496113_0044079 Ga0496113_0044079_2511_2843 110
783 3300048916 Ga0496113_1303564 Ga0496113_1303564_141_473 110
784 3300048918 Ga0496115_0029692 Ga0496115_0029692_2582_2914 110
785 3300048919 Ga0496116_0027332 Ga0496116_0027332_205_537 110
786 3300048919 Ga0496116_0032041 Ga0496116_0032041_500_832 110
787 3300048919 Ga0496116_0094580 Ga0496116_0094580_1098_1430 110
788 3300048920 Ga0496117_0000266 Ga0496117_0000266_3922_4254 110
789 3300048920 Ga0496117_0008100 Ga0496117_0008100_3394_3726 110
790 3300048920 Ga0496117_0070246 Ga0496117_0070246_569_901 110
791 3300048920 Ga0496117_0093273 Ga0496117_0093273_334_666 110
792 3300048920 Ga0496117_0178338 Ga0496117_0178338_591_923 110
793 3300048921 Ga0496118_0003538 Ga0496118_0003538_10983_11315 110
794 3300048921 Ga0496118_0006374 Ga0496118_0006374_3380_3712 110
795 3300048921 Ga0496118_0023214 Ga0496118_0023214_3510_3842 110
796 3300048921 Ga0496118_0034192 Ga0496118_0034192_2465_2797 110
797 3300048921 Ga0496118_0082420 Ga0496118_0082420_417_749 110
798 3300048921 Ga0496118_0249491 Ga0496118_0249491_155_487 110
799 3300048922 Ga0496119_0137744 Ga0496119_0137744_379_711 110
800 3300048924 Ga0496121_0003101 Ga0496121_0003101_20251_20583 110
801 3300048924 Ga0496121_0004927 Ga0496121_0004927_15763_16095 110
802 3300048924 Ga0496121_0010104 Ga0496121_0010104_1093_1425 110
803 3300048924 Ga0496121_0029385 Ga0496121_0029385_1647_1979 110
804 3300048924 Ga0496121_0093316 Ga0496121_0093316_1589_1921 110
805 3300048925 Ga0496122_0319406 Ga0496122_0319406_223_555 110
806 3300048926 Ga0496123_0102511 Ga0496123_0102511_613_945 110
807 3300048927 Ga0496124_0551248 Ga0496124_0551248_31_363 110
808 3300048928 Ga0496125_0274957 Ga0496125_0274957_324_656 110
809 3300048929 Ga0496126_0001193 Ga0496126_0001193_28617_28949 110
810 3300048929 Ga0496126_0011060 Ga0496126_0011060_7232_7564 110
811 3300048929 Ga0496126_0055766 Ga0496126_0055766_1661_1993 110
812 3300048929 Ga0496126_0406364 Ga0496126_0406364_393_725 110
813 3300049459 Ga0495678_003802 Ga0495678_003802_7426_7758 110
814 3300049460 Ga0495682_0176796 Ga0495682_0176796_326_658 110
815 3300061719 Ga0466962_0006130 Ga0466962_0006130_3597_3929 110
816 3300061719 Ga0466962_0013995 Ga0466962_0013995_801_1133 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03658

Ub-RnfH

RnfH family Ubiquitin

5

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ahx-assembly1.cif.gz_H cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.9653 7 74
8ahx-assembly1.cif.gz_H cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.9132 7 74
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.7815 5 76
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.7631 6 79
7qbe-assembly2.cif.gz_C tc:cd320 in complex with nanobody tc-nb11 0.7543 1 72
ID Description Score Start End Superfamily
af_P52119_2_89_3.10.20.280 Alpha Beta;Roll;Ubiquitin-like (UB roll);RnfH-like 0.8876 4 86 3.10.20.280
af_P52119_2_89_3.10.20.280 Alpha Beta;Roll;Ubiquitin-like (UB roll);RnfH-like 0.8289 4 86 3.10.20.280
af_A0A0B4J391_26_106_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7949 6 79 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.7818 5 76 3.10.20.30
af_A0A0G2KNZ3_53_150_3.30.110.20 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Alba-like domain 0.7721 3 25 3.30.110.20
ID Description Score Start End GO Terms
AF-A0A379W5V7-F1-model_v4 UPF0125 protein NCTC8258_01725 0.9842 4 91
AF-A0A0F9R153-F1-model_v4 RnfH family protein 0.9839 2 73
AF-A0A6P1LQ33-F1-model_v4 UPF0125 protein EGQ50_02005 0.9767 5 79
AF-A0A272ER02-F1-model_v4 UPF0125 protein CGU29_11225 0.9737 5 79
AF-A0A7C1D148-F1-model_v4 UPF0125 protein ENN42_10500 0.9704 2 77

Feature Viewer

pLDDT pTM Quality
83.9 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map