F482002
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 814 | 452 | 696 | 281 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2946041624|2946043353 |
| Length | 324 |
| Sequence | SESEPTSTQETSVSSRRSASRSTTGTEEIHGSLSETKRREPMAPAQVGVLGGGRMGAGIAHAFLLAGSRVSVVERDDESAAAAAHRVGDSIRRSVERDGGLDETEIRSRLDTGTDATAFGECDLVIEAVPEERTLKETALSRAEAAMPAYAILASNTSSISIDDLASRRLRPERFLGLHFFNPVPASALVEVVQGSATSPDVIDSARVWVSALGKTPIVVRDSPGFASSRLGVMLGLEAIRMLEDGVASAADIDAAMTLGYRHPTGPLRTTDIVGLDVRLGIAEELERAFGERFAPPELLRRMVAEGKLGRKSGQGFYEWNEER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 2 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 10 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 11 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 12 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 13 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 14 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 15 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 16 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 17 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 18 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 19 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 20 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 21 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 22 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 23 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 24 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 25 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 26 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 27 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 28 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 29 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 30 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 31 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 32 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 33 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 34 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 35 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 36 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 37 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 38 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 39 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 40 | 2751185788 | Curtobacterium pusillum AA3 | Isolate | Unclassified |
| 41 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 42 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 43 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 44 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 45 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 46 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 47 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 48 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 49 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 50 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 51 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 52 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 53 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 54 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 55 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 56 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 57 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 58 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 59 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 60 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 61 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 62 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 63 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 64 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 65 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 66 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 67 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 68 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 69 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 70 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 71 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 72 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 73 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 74 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 75 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 76 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 77 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 78 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 79 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 80 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 81 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 82 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 83 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 84 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 85 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 86 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 87 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 88 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 89 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 90 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 91 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 92 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 93 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 94 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 95 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 96 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 97 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 98 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 99 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 100 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 101 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 102 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 103 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 104 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 105 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 106 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 107 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 108 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 109 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 110 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 111 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 112 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 113 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 114 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 115 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 116 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 117 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 118 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 120 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 121 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 123 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 125 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 130 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 131 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 132 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 135 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 136 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 139 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 140 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 141 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 142 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 143 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 144 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 145 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 146 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 147 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 148 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 149 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 150 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 151 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 152 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 167 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 178 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 185 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 230 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 231 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 232 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 233 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 237 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 249 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 250 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 251 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 252 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 263 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 264 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 265 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 266 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 269 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 272 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 273 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 274 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 275 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 276 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 277 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 278 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 368 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 404 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 408 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 411 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 412 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 413 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 415 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 421 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 422 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 423 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 424 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 425 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 445 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 446 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 447 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 448 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 449 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 450 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 451 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 452 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.31 |
| Metatranscriptomes | 3.19 |
| Isolates | 14.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.37 |
| Bulb | 0 |
| Endosphere | 8.85 |
| Nodule | 0 |
| Rhizoplane | 3.32 |
| Rhizosphere | 69.04 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 18.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25164J39214_1000649 | 3300002772 | Bacteria | 14285 |
| 2 | JGI25165J46597_1000174 | 3300003214 | Bacteria | 100372 |
| 3 | rootL2_10035491 | 3300003322 | Bacteria | 16840 |
| 4 | rootH1_10055294 | 3300003323 | Bacteria | 1447 |
| 5 | Ga0006562J51391_1111915 | 3300003578 | Bacteria | 26433 |
| 6 | Ga0006562J51391_1111917 | 3300003578 | Bacteria | 16790 |
| 7 | Ga0006562J51391_1209490 | 3300003578 | Bacteria | 7710 |
| 8 | Ga0006562J51391_1209491 | 3300003578 | Bacteria | 7690 |
| 9 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 10 | Ga0055525_1000330 | 3300003759 | Bacteria | 36101 |
| 11 | Ga0055542_1000427 | 3300003762 | Bacteria | 40635 |
| 12 | Ga0055529_1000571 | 3300003763 | Bacteria | 30068 |
| 13 | Ga0055540_1011213 | 3300003792 | Bacteria | 2911 |
| 14 | Ga0070658_10009760 | 3300005327 | Bacteria | 7709 |
| 15 | Ga0070658_10105547 | 3300005327 | Bacteria | 2330 |
| 16 | Ga0070683_100147207 | 3300005329 | Bacteria | 2232 |
| 17 | Ga0070683_100274017 | 3300005329 | Bacteria | 1605 |
| 18 | Ga0070683_100331821 | 3300005329 | Bacteria | 1448 |
| 19 | Ga0070670_100287151 | 3300005331 | Bacteria | 1437 |
| 20 | Ga0070670_100293247 | 3300005331 | Bacteria | 1422 |
| 21 | Ga0068868_100096268 | 3300005338 | Bacteria | 2391 |
| 22 | Ga0068868_100268046 | 3300005338 | Bacteria | 1442 |
| 23 | Ga0070660_100054836 | 3300005339 | Bacteria | 3079 |
| 24 | Ga0070660_100267364 | 3300005339 | Bacteria | 1397 |
| 25 | Ga0070668_100000560 | 3300005347 | Bacteria | 24850 |
| 26 | Ga0070668_100044032 | 3300005347 | Bacteria | 3423 |
| 27 | Ga0070659_100000749 | 3300005366 | Bacteria | 23637 |
| 28 | Ga0070667_100049296 | 3300005367 | Bacteria | 3546 |
| 29 | Ga0070685_10033968 | 3300005466 | Bacteria | 2870 |
| 30 | Ga0070679_100158901 | 3300005530 | Bacteria | 2235 |
| 31 | Ga0068853_100001645 | 3300005539 | Bacteria | 16333 |
| 32 | Ga0068853_100199644 | 3300005539 | Bacteria | 1820 |
| 33 | Ga0070672_100202532 | 3300005543 | Bacteria | 1660 |
| 34 | Ga0070665_100076240 | 3300005548 | Bacteria | 3360 |
| 35 | Ga0070665_100115555 | 3300005548 | Bacteria | 2686 |
| 36 | Ga0068855_100005522 | 3300005563 | Bacteria | 15431 |
| 37 | Ga0068855_100167483 | 3300005563 | Bacteria | 2490 |
| 38 | Ga0068855_100318733 | 3300005563 | Bacteria | 1719 |
| 39 | Ga0068857_100001028 | 3300005577 | Bacteria | 21558 |
| 40 | Ga0068857_100049400 | 3300005577 | Bacteria | 3732 |
| 41 | Ga0068854_100001906 | 3300005578 | Bacteria | 12696 |
| 42 | Ga0068856_100193332 | 3300005614 | Bacteria | 2048 |
| 43 | Ga0068852_100003952 | 3300005616 | Bacteria | 10419 |
| 44 | Ga0068852_100012604 | 3300005616 | Bacteria | 6426 |
| 45 | Ga0068852_100035556 | 3300005616 | Bacteria | 4157 |
| 46 | Ga0068852_100151450 | 3300005616 | Bacteria | 2157 |
| 47 | Ga0068864_100042847 | 3300005618 | Bacteria | 3874 |
| 48 | Ga0068864_100210238 | 3300005618 | Bacteria | 1791 |
| 49 | Ga0068851_10000008 | 3300005834 | Bacteria | 231006 |
| 50 | Ga0068863_100057676 | 3300005841 | Bacteria | 3675 |
| 51 | Ga0068858_100000096 | 3300005842 | Bacteria | 91762 |
| 52 | Ga0068858_100011201 | 3300005842 | Bacteria | 8475 |
| 53 | Ga0068860_100168878 | 3300005843 | Bacteria | 2112 |
| 54 | Ga0081455_10008614 | 3300005937 | Bacteria | 10581 |
| 55 | Ga0081540_1010901 | 3300005983 | Bacteria | 6104 |
| 56 | Ga0081539_10006285 | 3300005985 | Bacteria | 11482 |
| 57 | Ga0075365_10000074 | 3300006038 | Bacteria | 29323 |
| 58 | Ga0075365_10001691 | 3300006038 | Bacteria | 10208 |
| 59 | Ga0075365_10095488 | 3300006038 | Bacteria | 2030 |
| 60 | Ga0075365_10346357 | 3300006038 | Bacteria | 1047 |
| 61 | Ga0075363_100062469 | 3300006048 | Bacteria | 2008 |
| 62 | Ga0075364_10009137 | 3300006051 | Bacteria | 5937 |
| 63 | Ga0075364_10053696 | 3300006051 | Bacteria | 2634 |
| 64 | Ga0075364_10110763 | 3300006051 | Bacteria | 1832 |
| 65 | Ga0075364_10120647 | 3300006051 | Bacteria | 1755 |
| 66 | Ga0075364_10182612 | 3300006051 | Bacteria | 1420 |
| 67 | Ga0075364_10235609 | 3300006051 | Bacteria | 1243 |
| 68 | Ga0075432_10008430 | 3300006058 | Bacteria | 3517 |
| 69 | Ga0075367_10014844 | 3300006178 | Bacteria | 4220 |
| 70 | Ga0075370_10074719 | 3300006353 | Bacteria | 1942 |
| 71 | Ga0075370_10097603 | 3300006353 | Bacteria | 1699 |
| 72 | Ga0105240_10099808 | 3300009093 | Bacteria | 3533 |
| 73 | Ga0105240_10424377 | 3300009093 | Bacteria | 1493 |
| 74 | Ga0111539_10258735 | 3300009094 | Bacteria | 2026 |
| 75 | Ga0105245_10071744 | 3300009098 | Bacteria | 3145 |
| 76 | Ga0105245_10117434 | 3300009098 | Bacteria | 2481 |
| 77 | Ga0105245_10502714 | 3300009098 | Bacteria | 1228 |
| 78 | Ga0105243_10060287 | 3300009148 | Bacteria | 3031 |
| 79 | Ga0105243_10442023 | 3300009148 | Bacteria | 1218 |
| 80 | Ga0105241_10006075 | 3300009174 | Bacteria | 8905 |
| 81 | Ga0105241_10020164 | 3300009174 | Bacteria | 4925 |
| 82 | Ga0105248_10000713 | 3300009177 | Bacteria | 37644 |
| 83 | Ga0105248_10036889 | 3300009177 | Bacteria | 5467 |
| 84 | Ga0105237_10000688 | 3300009545 | Bacteria | 46838 |
| 85 | Ga0105237_10147307 | 3300009545 | Bacteria | 2349 |
| 86 | Ga0105237_10153998 | 3300009545 | Bacteria | 2295 |
| 87 | Ga0105238_10006959 | 3300009551 | Bacteria | 11300 |
| 88 | Ga0105238_10017275 | 3300009551 | Bacteria | 7329 |
| 89 | Ga0105238_10055894 | 3300009551 | Bacteria | 3960 |
| 90 | Ga0105238_10067508 | 3300009551 | Bacteria | 3577 |
| 91 | Ga0105249_10155161 | 3300009553 | Bacteria | 2207 |
| 92 | Ga0105239_10113586 | 3300010375 | Bacteria | 3003 |
| 93 | Ga0105239_10190119 | 3300010375 | Bacteria | 2298 |
| 94 | Ga0105239_10735083 | 3300010375 | Bacteria | 1129 |
| 95 | Ga0105246_10113931 | 3300011119 | Bacteria | 1991 |
| 96 | Ga0157370_10006011 | 3300013104 | Bacteria | 13505 |
| 97 | Ga0157369_10110300 | 3300013105 | Bacteria | 2925 |
| 98 | Ga0157369_10143141 | 3300013105 | Bacteria | 2529 |
| 99 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 100 | Ga0163162_10099567 | 3300013306 | Bacteria | 2998 |
| 101 | Ga0157375_10282440 | 3300013308 | Bacteria | 1823 |
| 102 | Ga0157375_10324619 | 3300013308 | Bacteria | 1704 |
| 103 | Ga0163163_10149343 | 3300014325 | Bacteria | 2381 |
| 104 | Ga0163163_10592093 | 3300014325 | Bacteria | 1172 |
| 105 | Ga0157380_10006897 | 3300014326 | Bacteria | 8033 |
| 106 | Ga0157380_10467656 | 3300014326 | Bacteria | 1216 |
| 107 | Ga0157380_10809113 | 3300014326 | Bacteria | 955 |
| 108 | Ga0157379_10042903 | 3300014968 | Bacteria | 4039 |
| 109 | Ga0157379_10597026 | 3300014968 | Bacteria | 1030 |
| 110 | Ga0157376_10656637 | 3300014969 | Bacteria | 1050 |
| 111 | Ga0163161_10319712 | 3300017792 | Bacteria | 1227 |
| 112 | Ga0206356_10506699 | 3300020070 | Bacteria | 2239 |
| 113 | Ga0206354_10181118 | 3300020081 | Bacteria | 2976 |
| 114 | Ga0206353_10162159 | 3300020082 | Bacteria | 6239 |
| 115 | Ga0206353_11489331 | 3300020082 | Bacteria | 2714 |
| 116 | Ga0213875_10005353 | 3300021388 | Bacteria | 6900 |
| 117 | Ga0209566_100053 | 3300025225 | Bacteria | 224436 |
| 118 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 119 | Ga0209672_100039 | 3300025228 | Bacteria | 283064 |
| 120 | Ga0209147_102885 | 3300025229 | Bacteria | 3782 |
| 121 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 122 | Ga0207427_100010 | 3300025231 | Bacteria | 648610 |
| 123 | Ga0209646_1000192 | 3300025246 | Bacteria | 75005 |
| 124 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 125 | Ga0209677_100378 | 3300025253 | Bacteria | 27274 |
| 126 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 127 | Ga0209148_1002409 | 3300025254 | Bacteria | 6501 |
| 128 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 129 | Ga0209455_1000377 | 3300025272 | Bacteria | 40663 |
| 130 | Ga0209051_1020243 | 3300025303 | Bacteria | 2872 |
| 131 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 132 | Ga0207688_10012150 | 3300025901 | Bacteria | 4685 |
| 133 | Ga0207647_10001411 | 3300025904 | Bacteria | 18447 |
| 134 | Ga0207643_10053036 | 3300025908 | Bacteria | 2304 |
| 135 | Ga0207705_10076475 | 3300025909 | Bacteria | 2434 |
| 136 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 137 | Ga0207654_10029988 | 3300025911 | Bacteria | 2982 |
| 138 | Ga0207695_10009355 | 3300025913 | Bacteria | 12117 |
| 139 | Ga0207695_10019929 | 3300025913 | Bacteria | 7703 |
| 140 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 141 | Ga0207671_10001866 | 3300025914 | Bacteria | 23478 |
| 142 | Ga0207671_10114909 | 3300025914 | Bacteria | 2052 |
| 143 | Ga0207657_10023164 | 3300025919 | Bacteria | 5788 |
| 144 | Ga0207657_10227729 | 3300025919 | Bacteria | 1491 |
| 145 | Ga0207652_10136467 | 3300025921 | Bacteria | 2191 |
| 146 | Ga0207652_10342280 | 3300025921 | Bacteria | 1350 |
| 147 | Ga0207681_10103573 | 3300025923 | Bacteria | 2057 |
| 148 | Ga0207694_10000196 | 3300025924 | Bacteria | 60714 |
| 149 | Ga0207694_10285495 | 3300025924 | Bacteria | 1356 |
| 150 | Ga0207650_10299270 | 3300025925 | Bacteria | 1313 |
| 151 | Ga0207687_10042745 | 3300025927 | Bacteria | 3120 |
| 152 | Ga0207690_10002298 | 3300025932 | Bacteria | 11651 |
| 153 | Ga0207709_10022715 | 3300025935 | Bacteria | 3561 |
| 154 | Ga0207691_10268967 | 3300025940 | Bacteria | 1468 |
| 155 | Ga0207711_10135194 | 3300025941 | Bacteria | 2214 |
| 156 | Ga0207661_10017840 | 3300025944 | Bacteria | 5261 |
| 157 | Ga0207661_10140936 | 3300025944 | Bacteria | 2075 |
| 158 | Ga0207661_10194858 | 3300025944 | Bacteria | 1778 |
| 159 | Ga0207667_10001482 | 3300025949 | Bacteria | 29458 |
| 160 | Ga0207667_10397099 | 3300025949 | Bacteria | 1404 |
| 161 | Ga0207712_10239305 | 3300025961 | Bacteria | 1461 |
| 162 | Ga0207668_10000481 | 3300025972 | Bacteria | 24975 |
| 163 | Ga0207668_10208879 | 3300025972 | Bacteria | 1560 |
| 164 | Ga0207640_10233276 | 3300025981 | Bacteria | 1417 |
| 165 | Ga0207677_10029357 | 3300026023 | Bacteria | 3494 |
| 166 | Ga0207677_10245924 | 3300026023 | Bacteria | 1450 |
| 167 | Ga0207703_10001625 | 3300026035 | Bacteria | 20245 |
| 168 | Ga0207639_10040609 | 3300026041 | Bacteria | 3474 |
| 169 | Ga0207639_10103246 | 3300026041 | Bacteria | 2309 |
| 170 | Ga0207678_10628044 | 3300026067 | Bacteria | 943 |
| 171 | Ga0207702_10054536 | 3300026078 | Bacteria | 3388 |
| 172 | Ga0207702_10182105 | 3300026078 | Bacteria | 1935 |
| 173 | Ga0207641_10010811 | 3300026088 | Bacteria | 7482 |
| 174 | Ga0207676_10118215 | 3300026095 | Bacteria | 2231 |
| 175 | Ga0207676_10174425 | 3300026095 | Bacteria | 1876 |
| 176 | Ga0207674_10000405 | 3300026116 | Bacteria | 55884 |
| 177 | Ga0207674_10221300 | 3300026116 | Bacteria | 1841 |
| 178 | Ga0207675_100095849 | 3300026118 | Bacteria | 2793 |
| 179 | Ga0207683_10114464 | 3300026121 | Bacteria | 2417 |
| 180 | Ga0207698_10000078 | 3300026142 | Bacteria | 65050 |
| 181 | Ga0207698_10002196 | 3300026142 | Bacteria | 11542 |
| 182 | Ga0207698_10021148 | 3300026142 | Bacteria | 4494 |
| 183 | Ga0207428_10053527 | 3300027907 | Bacteria | 3218 |
| 184 | Ga0268266_10070008 | 3300028379 | Bacteria | 3041 |
| 185 | Ga0268266_10161904 | 3300028379 | Bacteria | 2025 |
| 186 | Ga0268266_10363727 | 3300028379 | Bacteria | 1362 |
| 187 | Ga0268265_10036705 | 3300028380 | Bacteria | 3591 |
| 188 | Ga0268265_10161472 | 3300028380 | Bacteria | 1904 |
| 189 | Ga0307517_10005202 | 3300028786 | Bacteria | 19711 |
| 190 | Ga0307517_10050934 | 3300028786 | Bacteria | 4193 |
| 191 | Ga0307515_10000189 | 3300028794 | Bacteria | 150703 |
| 192 | Ga0307515_10000436 | 3300028794 | Bacteria | 100131 |
| 193 | Ga0307515_10026558 | 3300028794 | Bacteria | 9958 |
| 194 | Ga0307515_10041387 | 3300028794 | Bacteria | 7246 |
| 195 | Ga0307515_10100480 | 3300028794 | Bacteria | 3501 |
| 196 | Ga0307515_10149291 | 3300028794 | Bacteria | 2454 |
| 197 | Ga0307515_10214310 | 3300028794 | Bacteria | 1761 |
| 198 | Ga0307511_10000194 | 3300030521 | Bacteria | 60345 |
| 199 | Ga0307511_10000824 | 3300030521 | Bacteria | 33088 |
| 200 | Ga0307511_10075469 | 3300030521 | Bacteria | 2419 |
| 201 | Ga0307512_10007529 | 3300030522 | Bacteria | 10772 |
| 202 | Ga0307512_10011457 | 3300030522 | Bacteria | 8402 |
| 203 | Ga0307512_10151248 | 3300030522 | Bacteria | 1388 |
| 204 | Ga0307513_10001658 | 3300031456 | Bacteria | 31815 |
| 205 | Ga0307513_10003959 | 3300031456 | Bacteria | 19895 |
| 206 | Ga0307513_10040155 | 3300031456 | Bacteria | 5176 |
| 207 | Ga0307509_10013932 | 3300031507 | Bacteria | 9484 |
| 208 | Ga0307509_10022228 | 3300031507 | Bacteria | 7156 |
| 209 | Ga0307509_10025555 | 3300031507 | Bacteria | 6592 |
| 210 | Ga0307509_10061064 | 3300031507 | Bacteria | 3981 |
| 211 | Ga0307509_10080593 | 3300031507 | Bacteria | 3366 |
| 212 | Ga0307509_10103294 | 3300031507 | Bacteria | 2878 |
| 213 | Ga0307408_100034128 | 3300031548 | Bacteria | 3561 |
| 214 | Ga0307408_100139192 | 3300031548 | Bacteria | 1903 |
| 215 | Ga0307408_100157919 | 3300031548 | Bacteria | 1798 |
| 216 | Ga0307508_10003658 | 3300031616 | Bacteria | 15415 |
| 217 | Ga0307508_10061681 | 3300031616 | Bacteria | 3312 |
| 218 | Ga0307508_10078310 | 3300031616 | Bacteria | 2886 |
| 219 | Ga0307508_10100940 | 3300031616 | Bacteria | 2481 |
| 220 | Ga0307508_10148644 | 3300031616 | Bacteria | 1947 |
| 221 | Ga0307514_10063841 | 3300031649 | Bacteria | 2795 |
| 222 | Ga0307516_10005460 | 3300031730 | Bacteria | 15196 |
| 223 | Ga0307516_10045235 | 3300031730 | Bacteria | 4349 |
| 224 | Ga0307516_10064212 | 3300031730 | Bacteria | 3552 |
| 225 | Ga0307516_10106039 | 3300031730 | Bacteria | 2621 |
| 226 | Ga0307405_10185122 | 3300031731 | Bacteria | 1499 |
| 227 | Ga0307413_10039100 | 3300031824 | Bacteria | 2756 |
| 228 | Ga0307413_10115553 | 3300031824 | Bacteria | 1806 |
| 229 | Ga0307413_10286025 | 3300031824 | Bacteria | 1243 |
| 230 | Ga0307413_10625090 | 3300031824 | Bacteria | 885 |
| 231 | Ga0307518_10000412 | 3300031838 | Bacteria | 32912 |
| 232 | Ga0307518_10175499 | 3300031838 | Bacteria | 1455 |
| 233 | Ga0307410_10018744 | 3300031852 | Bacteria | 4190 |
| 234 | Ga0307410_10021437 | 3300031852 | Bacteria | 3974 |
| 235 | Ga0307410_10138062 | 3300031852 | Bacteria | 1800 |
| 236 | Ga0307410_10138325 | 3300031852 | Bacteria | 1798 |
| 237 | Ga0307410_10369755 | 3300031852 | Bacteria | 1151 |
| 238 | Ga0307406_10001204 | 3300031901 | Bacteria | 14485 |
| 239 | Ga0307406_10052440 | 3300031901 | Bacteria | 2594 |
| 240 | Ga0307406_10072553 | 3300031901 | Bacteria | 2260 |
| 241 | Ga0307406_10137549 | 3300031901 | Bacteria | 1724 |
| 242 | Ga0307406_10427058 | 3300031901 | Bacteria | 1057 |
| 243 | Ga0307407_10199789 | 3300031903 | Bacteria | 1339 |
| 244 | Ga0307407_10267718 | 3300031903 | Bacteria | 1178 |
| 245 | Ga0307412_10024159 | 3300031911 | Bacteria | 3749 |
| 246 | Ga0307412_10057256 | 3300031911 | Bacteria | 2601 |
| 247 | Ga0307412_10392120 | 3300031911 | Bacteria | 1128 |
| 248 | Ga0307409_100006047 | 3300031995 | Bacteria | 7064 |
| 249 | Ga0307409_100288224 | 3300031995 | Bacteria | 1521 |
| 250 | Ga0307409_100327823 | 3300031995 | Bacteria | 1435 |
| 251 | Ga0307416_100002272 | 3300032002 | Bacteria | 10949 |
| 252 | Ga0307416_100225247 | 3300032002 | Bacteria | 1802 |
| 253 | Ga0307416_100317519 | 3300032002 | Bacteria | 1558 |
| 254 | Ga0307416_100456828 | 3300032002 | Bacteria | 1331 |
| 255 | Ga0307414_10066312 | 3300032004 | Bacteria | 2580 |
| 256 | Ga0307414_10117497 | 3300032004 | Bacteria | 2038 |
| 257 | Ga0307414_10219748 | 3300032004 | Bacteria | 1559 |
| 258 | Ga0307414_10392665 | 3300032004 | Bacteria | 1203 |
| 259 | Ga0307411_10083770 | 3300032005 | Bacteria | 2204 |
| 260 | Ga0307411_10310014 | 3300032005 | Bacteria | 1270 |
| 261 | Ga0307415_100369478 | 3300032126 | Bacteria | 1214 |
| 262 | Ga0307507_10009303 | 3300033179 | Bacteria | 13156 |
| 263 | Ga0307507_10023801 | 3300033179 | Bacteria | 6701 |
| 264 | Ga0307507_10057799 | 3300033179 | Bacteria | 3649 |
| 265 | Ga0307507_10082816 | 3300033179 | Bacteria | 2810 |
| 266 | Ga0307507_10165311 | 3300033179 | Bacteria | 1623 |
| 267 | Ga0307507_10188201 | 3300033179 | Bacteria | 1457 |
| 268 | Ga0307510_10033562 | 3300033180 | Bacteria | 5761 |
| 269 | Ga0307510_10103362 | 3300033180 | Bacteria | 2626 |
| 270 | Ga0307510_10206826 | 3300033180 | Bacteria | 1490 |
| 271 | Ga0316214_1002008 | 3300033545 | Bacteria | 2467 |
| 272 | Ga0373938_0011954 | 3300034957 | Bacteria | 1623 |
| 273 | Ga0373940_0001334 | 3300035088 | Bacteria | 4403 |
| 274 | Ga0373942_0001388 | 3300035207 | Bacteria | 6263 |
| 275 | Ga0373962_0000420 | 3300035242 | Bacteria | 9243 |
| 276 | Ga0395899_0011272 | 3300037312 | Bacteria | 6848 |
| 277 | Ga0395899_0020111 | 3300037312 | Bacteria | 5065 |
| 278 | Ga0395899_0046544 | 3300037312 | Bacteria | 3231 |
| 279 | Ga0395899_0050283 | 3300037312 | Bacteria | 3095 |
| 280 | Ga0395900_0054877 | 3300037418 | Bacteria | 4102 |
| 281 | Ga0395900_0088650 | 3300037418 | Bacteria | 3181 |
| 282 | Ga0395900_0116325 | 3300037418 | Bacteria | 2744 |
| 283 | Ga0395900_0269495 | 3300037418 | Bacteria | 1698 |
| 284 | Ga0395898_0000256 | 3300037466 | Bacteria | 130878 |
| 285 | Ga0395898_0003736 | 3300037466 | Bacteria | 16878 |
| 286 | Ga0395898_0006023 | 3300037466 | Bacteria | 13025 |
| 287 | Ga0395898_0009444 | 3300037466 | Bacteria | 10246 |
| 288 | Ga0395898_0038380 | 3300037466 | Bacteria | 4747 |
| 289 | Ga0395898_0076921 | 3300037466 | Bacteria | 3222 |
| 290 | Ga0395898_0232569 | 3300037466 | Bacteria | 1758 |
| 291 | Ga0395905_0034166 | 3300037471 | Bacteria | 4774 |
| 292 | Ga0395905_0445427 | 3300037471 | Bacteria | 1193 |
| 293 | Ga0436364_0891096 | 3300037853 | Bacteria | 17632 |
| 294 | Ga0395901_0001692 | 3300038443 | Bacteria | 22752 |
| 295 | Ga0395901_0005007 | 3300038443 | Bacteria | 13377 |
| 296 | Ga0395901_0023278 | 3300038443 | Bacteria | 6350 |
| 297 | Ga0395901_0095473 | 3300038443 | Bacteria | 3116 |
| 298 | Ga0395901_0098948 | 3300038443 | Bacteria | 3058 |
| 299 | Ga0395901_0144104 | 3300038443 | Bacteria | 2504 |
| 300 | Ga0395901_0288080 | 3300038443 | Bacteria | 1705 |
| 301 | Ga0395901_0382965 | 3300038443 | Bacteria | 1447 |
| 302 | Ga0395901_0412286 | 3300038443 | Bacteria | 1387 |
| 303 | Ga0439436_0020261 | 3300041404 | Bacteria | 1981 |
| 304 | Ga0451837_0641337 | 3300041494 | Bacteria | 1190 |
| 305 | Ga0439433_0007739 | 3300041999 | Bacteria | 2323 |
| 306 | Ga0439449_0035166 | 3300042007 | Bacteria | 1865 |
| 307 | Ga0439449_0038334 | 3300042007 | Bacteria | 1782 |
| 308 | Ga0439457_002025 | 3300042014 | Bacteria | 5949 |
| 309 | Ga0439458_0051848 | 3300042157 | Bacteria | 1014 |
| 310 | Ga0466969_0009413 | 3300044656 | Bacteria | 5178 |
| 311 | Ga0466969_0044415 | 3300044656 | Bacteria | 2210 |
| 312 | Ga0466969_0152838 | 3300044656 | Bacteria | 1063 |
| 313 | Ga0466972_0023059 | 3300044658 | Bacteria | 3098 |
| 314 | Ga0466972_0057218 | 3300044658 | Bacteria | 1873 |
| 315 | Ga0466965_0004730 | 3300044683 | Bacteria | 6068 |
| 316 | Ga0466965_0024111 | 3300044683 | Bacteria | 2942 |
| 317 | Ga0466965_0105219 | 3300044683 | Bacteria | 1446 |
| 318 | Ga0466966_0017223 | 3300044684 | Bacteria | 4777 |
| 319 | Ga0466966_0060069 | 3300044684 | Bacteria | 2400 |
| 320 | Ga0466966_0103107 | 3300044684 | Bacteria | 1763 |
| 321 | Ga0466961_0018907 | 3300044693 | Bacteria | 4432 |
| 322 | Ga0466961_0105952 | 3300044693 | Bacteria | 1770 |
| 323 | Ga0466963_0050792 | 3300044694 | Bacteria | 2745 |
| 324 | Ga0466968_0001871 | 3300044735 | Bacteria | 7614 |
| 325 | Ga0466968_0005778 | 3300044735 | Bacteria | 4641 |
| 326 | Ga0466970_0036417 | 3300044765 | Bacteria | 2606 |
| 327 | Ga0466970_0044839 | 3300044765 | Bacteria | 2354 |
| 328 | Ga0466970_0062493 | 3300044765 | Bacteria | 1996 |
| 329 | Ga0466970_0236514 | 3300044765 | Bacteria | 1021 |
| 330 | Ga0466957_0020653 | 3300044842 | Bacteria | 3876 |
| 331 | Ga0466960_0023405 | 3300044901 | Bacteria | 2774 |
| 332 | Ga0466960_0024039 | 3300044901 | Bacteria | 2744 |
| 333 | Ga0466960_0031329 | 3300044901 | Bacteria | 2453 |
| 334 | Ga0466960_0044342 | 3300044901 | Bacteria | 2120 |
| 335 | Ga0466960_0173329 | 3300044901 | Bacteria | 1165 |
| 336 | Ga0466959_0005086 | 3300045049 | Bacteria | 8941 |
| 337 | Ga0466959_0019351 | 3300045049 | Bacteria | 5006 |
| 338 | Ga0466959_0274148 | 3300045049 | Bacteria | 1159 |
| 339 | Ga0466958_0052816 | 3300045836 | Bacteria | 2464 |
| 340 | Ga0466958_0069880 | 3300045836 | Bacteria | 2148 |
| 341 | Ga0466958_0170159 | 3300045836 | Bacteria | 1379 |
| 342 | Ga0466967_0000584 | 3300045976 | Bacteria | 18008 |
| 343 | Ga0466967_0014483 | 3300045976 | Bacteria | 6145 |
| 344 | Ga0466967_0081394 | 3300045976 | Bacteria | 2925 |
| 345 | Ga0466967_0289063 | 3300045976 | Bacteria | 1574 |
| 346 | Ga0466967_0372360 | 3300045976 | Bacteria | 1385 |
| 347 | Ga0466967_0603939 | 3300045976 | Bacteria | 1083 |
| 348 | Ga0495627_000352 | 3300046453 | Bacteria | 43219 |
| 349 | Ga0495627_010387 | 3300046453 | Bacteria | 3387 |
| 350 | Ga0495592_0042075 | 3300046454 | Bacteria | 3422 |
| 351 | Ga0495603_0116803 | 3300046455 | Bacteria | 1555 |
| 352 | Ga0495590_0000075 | 3300046457 | Bacteria | 68919 |
| 353 | Ga0495629_0003756 | 3300046459 | Bacteria | 11441 |
| 354 | Ga0495629_0006664 | 3300046459 | Bacteria | 8547 |
| 355 | Ga0495629_0014354 | 3300046459 | Bacteria | 5698 |
| 356 | Ga0495638_0145539 | 3300046460 | Bacteria | 1379 |
| 357 | Ga0495651_0033791 | 3300046462 | Bacteria | 3988 |
| 358 | Ga0495651_0278319 | 3300046462 | Bacteria | 1131 |
| 359 | Ga0495650_0000558 | 3300046471 | Bacteria | 52874 |
| 360 | Ga0495580_0030566 | 3300046472 | Bacteria | 3899 |
| 361 | Ga0495580_0114658 | 3300046472 | Bacteria | 1872 |
| 362 | Ga0495582_0013541 | 3300046473 | Bacteria | 4491 |
| 363 | Ga0495582_0103776 | 3300046473 | Bacteria | 1593 |
| 364 | Ga0495662_0002738 | 3300046476 | Bacteria | 8908 |
| 365 | Ga0495662_0010284 | 3300046476 | Bacteria | 4586 |
| 366 | Ga0495662_0226138 | 3300046476 | Bacteria | 922 |
| 367 | Ga0495664_0003195 | 3300046477 | Bacteria | 8897 |
| 368 | Ga0495585_0103279 | 3300046492 | Bacteria | 1522 |
| 369 | Ga0495594_0031966 | 3300046499 | Bacteria | 2855 |
| 370 | Ga0495594_0136107 | 3300046499 | Bacteria | 1392 |
| 371 | Ga0495594_0138606 | 3300046499 | Bacteria | 1379 |
| 372 | Ga0495607_0069964 | 3300046501 | Bacteria | 1962 |
| 373 | Ga0495583_0022213 | 3300046506 | Bacteria | 3243 |
| 374 | Ga0495583_0074848 | 3300046506 | Bacteria | 1481 |
| 375 | Ga0495606_0004805 | 3300046507 | Bacteria | 13280 |
| 376 | Ga0495608_0004783 | 3300046511 | Bacteria | 9684 |
| 377 | Ga0495610_0063392 | 3300046512 | Bacteria | 1750 |
| 378 | Ga0495616_0013185 | 3300046513 | Bacteria | 4670 |
| 379 | Ga0495618_0118948 | 3300046514 | Bacteria | 1692 |
| 380 | Ga0495620_0001179 | 3300046515 | Bacteria | 16001 |
| 381 | Ga0495620_0004461 | 3300046515 | Bacteria | 7885 |
| 382 | Ga0495620_0018122 | 3300046515 | Bacteria | 3492 |
| 383 | Ga0495628_0044346 | 3300046516 | Bacteria | 3539 |
| 384 | Ga0495628_0091481 | 3300046516 | Bacteria | 2354 |
| 385 | Ga0495630_0111222 | 3300046517 | Bacteria | 2075 |
| 386 | Ga0495631_0032324 | 3300046518 | Bacteria | 2360 |
| 387 | Ga0495632_0074653 | 3300046519 | Bacteria | 1624 |
| 388 | Ga0495666_0036041 | 3300046526 | Bacteria | 2409 |
| 389 | Ga0495652_0030604 | 3300046529 | Bacteria | 4719 |
| 390 | Ga0495652_0066264 | 3300046529 | Bacteria | 3031 |
| 391 | Ga0495652_0268641 | 3300046529 | Bacteria | 1255 |
| 392 | Ga0495654_0128870 | 3300046530 | Bacteria | 1138 |
| 393 | Ga0495665_0012080 | 3300046531 | Bacteria | 4675 |
| 394 | Ga0495665_0037615 | 3300046531 | Bacteria | 2582 |
| 395 | Ga0495640_0024818 | 3300046533 | Bacteria | 4355 |
| 396 | Ga0495640_0045740 | 3300046533 | Bacteria | 3037 |
| 397 | Ga0495640_0260234 | 3300046533 | Bacteria | 1084 |
| 398 | Ga0495586_0038016 | 3300046535 | Bacteria | 2584 |
| 399 | Ga0495587_0003896 | 3300046536 | Bacteria | 9901 |
| 400 | Ga0495587_0009303 | 3300046536 | Bacteria | 6303 |
| 401 | Ga0495598_0015743 | 3300046537 | Bacteria | 1916 |
| 402 | Ga0495621_0030879 | 3300046539 | Bacteria | 1834 |
| 403 | Ga0495597_0023607 | 3300046542 | Bacteria | 2844 |
| 404 | Ga0495645_0028098 | 3300046543 | Bacteria | 4086 |
| 405 | Ga0495645_0032423 | 3300046543 | Bacteria | 3811 |
| 406 | Ga0495645_0169134 | 3300046543 | Bacteria | 1505 |
| 407 | Ga0495622_0007858 | 3300046557 | Bacteria | 4949 |
| 408 | Ga0495667_0000402 | 3300046559 | Bacteria | 27723 |
| 409 | Ga0495667_0029993 | 3300046559 | Bacteria | 3657 |
| 410 | Ga0495667_0200542 | 3300046559 | Bacteria | 1277 |
| 411 | Ga0495656_0020545 | 3300046615 | Bacteria | 2563 |
| 412 | Ga0495656_0069864 | 3300046615 | Bacteria | 1557 |
| 413 | Ga0495656_0125319 | 3300046615 | Bacteria | 1217 |
| 414 | Ga0495656_0152308 | 3300046615 | Bacteria | 1118 |
| 415 | Ga0495668_0000360 | 3300046616 | Bacteria | 60235 |
| 416 | Ga0495668_0014227 | 3300046616 | Bacteria | 4671 |
| 417 | Ga0495668_0229307 | 3300046616 | Bacteria | 1017 |
| 418 | Ga0495634_0009470 | 3300046642 | Bacteria | 7183 |
| 419 | Ga0495634_0151866 | 3300046642 | Bacteria | 1464 |
| 420 | Ga0495611_0095848 | 3300046648 | Bacteria | 1373 |
| 421 | Ga0495625_0022500 | 3300046660 | Bacteria | 4832 |
| 422 | Ga0495625_0025631 | 3300046660 | Bacteria | 4469 |
| 423 | Ga0495625_0254465 | 3300046660 | Bacteria | 1139 |
| 424 | Ga0495635_0070706 | 3300046663 | Bacteria | 2392 |
| 425 | Ga0495635_0180113 | 3300046663 | Bacteria | 1436 |
| 426 | Ga0495635_0219770 | 3300046663 | Bacteria | 1285 |
| 427 | Ga0495635_0242347 | 3300046663 | Bacteria | 1216 |
| 428 | Ga0495588_0021027 | 3300046674 | Bacteria | 3212 |
| 429 | Ga0495657_0000206 | 3300046675 | Bacteria | 52948 |
| 430 | Ga0495657_0041189 | 3300046675 | Bacteria | 3163 |
| 431 | Ga0495657_0141715 | 3300046675 | Bacteria | 1498 |
| 432 | Ga0495646_0007542 | 3300046680 | Bacteria | 6913 |
| 433 | Ga0495646_0057100 | 3300046680 | Bacteria | 2338 |
| 434 | Ga0495613_0000367 | 3300046689 | Bacteria | 39278 |
| 435 | Ga0495613_0001326 | 3300046689 | Bacteria | 18918 |
| 436 | Ga0495624_0071602 | 3300046690 | Bacteria | 2157 |
| 437 | Ga0495624_0261162 | 3300046690 | Bacteria | 1046 |
| 438 | Ga0495670_0189227 | 3300046691 | Bacteria | 1088 |
| 439 | Ga0495671_0016857 | 3300046692 | Bacteria | 3894 |
| 440 | Ga0495589_0027582 | 3300046794 | Bacteria | 2871 |
| 441 | Ga0495600_0014480 | 3300046809 | Bacteria | 4969 |
| 442 | Ga0495600_0045170 | 3300046809 | Bacteria | 2874 |
| 443 | Ga0495600_0071668 | 3300046809 | Bacteria | 2263 |
| 444 | Ga0495660_0081780 | 3300046810 | Bacteria | 1692 |
| 445 | Ga0495581_0004793 | 3300047315 | Bacteria | 7819 |
| 446 | Ga0495581_0011256 | 3300047315 | Bacteria | 5173 |
| 447 | Ga0495581_0016467 | 3300047315 | Bacteria | 4297 |
| 448 | Ga0495581_0022959 | 3300047315 | Bacteria | 3613 |
| 449 | Ga0495581_0072907 | 3300047315 | Bacteria | 1987 |
| 450 | Ga0495581_0103739 | 3300047315 | Bacteria | 1652 |
| 451 | Ga0495581_0113894 | 3300047315 | Bacteria | 1573 |
| 452 | Ga0495581_0285079 | 3300047315 | Bacteria | 965 |
| 453 | Ga0495604_0002982 | 3300047317 | Bacteria | 13553 |
| 454 | Ga0495604_0029703 | 3300047317 | Bacteria | 4348 |
| 455 | Ga0495674_0022245 | 3300047319 | Bacteria | 5846 |
| 456 | Ga0495676_0003572 | 3300047321 | Bacteria | 14105 |
| 457 | Ga0495676_0036943 | 3300047321 | Bacteria | 4072 |
| 458 | Ga0495676_0039869 | 3300047321 | Bacteria | 3884 |
| 459 | Ga0495676_0051383 | 3300047321 | Bacteria | 3298 |
| 460 | Ga0495680_0090308 | 3300047322 | Bacteria | 2298 |
| 461 | Ga0495683_0032612 | 3300047323 | Bacteria | 2652 |
| 462 | Ga0495683_0057043 | 3300047323 | Bacteria | 1941 |
| 463 | Ga0495687_005511 | 3300047443 | Bacteria | 8035 |
| 464 | Ga0495687_012184 | 3300047443 | Bacteria | 4562 |
| 465 | Ga0495687_044913 | 3300047443 | Bacteria | 1917 |
| 466 | Ga0495687_080310 | 3300047443 | Bacteria | 1279 |
| 467 | Ga0495675_0045533 | 3300047444 | Bacteria | 2793 |
| 468 | Ga0495685_057869 | 3300047447 | Bacteria | 1309 |
| 469 | Ga0495673_0092469 | 3300047469 | Bacteria | 1234 |
| 470 | Ga0495681_0000253 | 3300047470 | Bacteria | 43616 |
| 471 | Ga0495684_0301623 | 3300047471 | Bacteria | 1150 |
| 472 | Ga0495686_0092048 | 3300047472 | Bacteria | 1840 |
| 473 | Ga0495686_0282525 | 3300047472 | Bacteria | 922 |
| 474 | Ga0495593_0020878 | 3300047673 | Bacteria | 3662 |
| 475 | Ga0495593_0025064 | 3300047673 | Bacteria | 3300 |
| 476 | Ga0495593_0049420 | 3300047673 | Bacteria | 2231 |
| 477 | Ga0495614_0004541 | 3300048089 | Bacteria | 6256 |
| 478 | Ga0495614_0023141 | 3300048089 | Bacteria | 2679 |
| 479 | Ga0495626_0008479 | 3300048091 | Bacteria | 5631 |
| 480 | Ga0496102_0040056 | 3300048905 | Bacteria | 4237 |
| 481 | Ga0496102_0162700 | 3300048905 | Bacteria | 2099 |
| 482 | Ga0496102_0237422 | 3300048905 | Bacteria | 1719 |
| 483 | Ga0496103_0031930 | 3300048906 | Bacteria | 3212 |
| 484 | Ga0496103_0180870 | 3300048906 | Bacteria | 1355 |
| 485 | Ga0496103_0206905 | 3300048906 | Bacteria | 1262 |
| 486 | Ga0496103_0250639 | 3300048906 | Bacteria | 1139 |
| 487 | Ga0496104_0003058 | 3300048907 | Bacteria | 14421 |
| 488 | Ga0496104_0104230 | 3300048907 | Bacteria | 2717 |
| 489 | Ga0496105_0046766 | 3300048908 | Bacteria | 3571 |
| 490 | Ga0496105_0054451 | 3300048908 | Bacteria | 3303 |
| 491 | Ga0496105_0144649 | 3300048908 | Bacteria | 1955 |
| 492 | Ga0496106_0465515 | 3300048909 | Bacteria | 1015 |
| 493 | Ga0496107_0033172 | 3300048910 | Bacteria | 3694 |
| 494 | Ga0496107_0103815 | 3300048910 | Bacteria | 2086 |
| 495 | Ga0496108_0000100 | 3300048911 | Bacteria | 89095 |
| 496 | Ga0496108_0211814 | 3300048911 | Bacteria | 1682 |
| 497 | Ga0496110_0042786 | 3300048913 | Bacteria | 3954 |
| 498 | Ga0496112_0135018 | 3300048915 | Bacteria | 2438 |
| 499 | Ga0496113_0144758 | 3300048916 | Bacteria | 1871 |
| 500 | Ga0496113_0255062 | 3300048916 | Bacteria | 1401 |
| 501 | Ga0496113_0495337 | 3300048916 | Bacteria | 981 |
| 502 | Ga0496114_0045297 | 3300048917 | Bacteria | 3653 |
| 503 | Ga0496114_0048331 | 3300048917 | Bacteria | 3539 |
| 504 | Ga0496114_0155028 | 3300048917 | Bacteria | 1988 |
| 505 | Ga0496115_0354322 | 3300048918 | Bacteria | 1196 |
| 506 | Ga0496115_0412722 | 3300048918 | Bacteria | 1094 |
| 507 | Ga0496116_0109688 | 3300048919 | Bacteria | 1626 |
| 508 | Ga0496117_0000394 | 3300048920 | Bacteria | 74632 |
| 509 | Ga0496117_0008044 | 3300048920 | Bacteria | 10109 |
| 510 | Ga0496117_0070251 | 3300048920 | Bacteria | 2353 |
| 511 | Ga0496117_0184411 | 3300048920 | Bacteria | 1196 |
| 512 | Ga0496118_0037908 | 3300048921 | Bacteria | 3871 |
| 513 | Ga0496118_0084493 | 3300048921 | Bacteria | 2214 |
| 514 | Ga0496119_0000605 | 3300048922 | Bacteria | 48474 |
| 515 | Ga0496120_0002952 | 3300048923 | Bacteria | 16205 |
| 516 | Ga0496120_0047737 | 3300048923 | Bacteria | 2467 |
| 517 | Ga0496122_0011187 | 3300048925 | Bacteria | 9131 |
| 518 | Ga0496122_0029005 | 3300048925 | Bacteria | 4679 |
| 519 | Ga0496122_0033605 | 3300048925 | Bacteria | 4215 |
| 520 | Ga0496122_0072498 | 3300048925 | Bacteria | 2448 |
| 521 | Ga0496122_0091889 | 3300048925 | Bacteria | 2065 |
| 522 | Ga0496123_0005519 | 3300048926 | Bacteria | 12698 |
| 523 | Ga0496124_0104903 | 3300048927 | Bacteria | 2285 |
| 524 | Ga0496125_0012426 | 3300048928 | Bacteria | 8453 |
| 525 | Ga0496125_0027233 | 3300048928 | Bacteria | 5185 |
| 526 | Ga0496125_0092225 | 3300048928 | Bacteria | 2265 |
| 527 | Ga0496125_0130172 | 3300048928 | Bacteria | 1773 |
| 528 | Ga0496126_0016360 | 3300048929 | Bacteria | 7420 |
| 529 | Ga0496126_0042168 | 3300048929 | Bacteria | 4216 |
| 530 | Ga0496126_0150392 | 3300048929 | Bacteria | 1996 |
| 531 | Ga0496126_0175586 | 3300048929 | Bacteria | 1822 |
| 532 | Ga0501031_0043036 | 3300049568 | Bacteria | 2948 |
| 533 | Ga0501032_0021647 | 3300049569 | Bacteria | 4468 |
| 534 | Ga0501032_0047557 | 3300049569 | Bacteria | 2896 |
| 535 | Ga0501032_0110366 | 3300049569 | Bacteria | 1820 |
| 536 | Ga0501033_0000203 | 3300049570 | Bacteria | 56963 |
| 537 | Ga0501033_0000422 | 3300049570 | Bacteria | 40484 |
| 538 | Ga0501033_0004260 | 3300049570 | Bacteria | 11503 |
| 539 | Ga0501033_0019120 | 3300049570 | Bacteria | 5179 |
| 540 | Ga0501033_0118334 | 3300049570 | Bacteria | 1924 |
| 541 | Ga0501033_0266013 | 3300049570 | Bacteria | 1213 |
| 542 | Ga0501034_0000042 | 3300049571 | Bacteria | 229124 |
| 543 | Ga0501034_0001033 | 3300049571 | Bacteria | 39834 |
| 544 | Ga0501034_0010152 | 3300049571 | Bacteria | 9825 |
| 545 | Ga0501034_0012846 | 3300049571 | Bacteria | 8637 |
| 546 | Ga0501034_0023839 | 3300049571 | Bacteria | 6231 |
| 547 | Ga0501034_0036310 | 3300049571 | Bacteria | 4992 |
| 548 | Ga0501034_0077122 | 3300049571 | Bacteria | 3338 |
| 549 | Ga0501034_0132802 | 3300049571 | Bacteria | 2472 |
| 550 | Ga0501034_0139401 | 3300049571 | Bacteria | 2405 |
| 551 | Ga0501034_0346388 | 3300049571 | Bacteria | 1415 |
| 552 | Ga0501036_0007959 | 3300049572 | Bacteria | 8675 |
| 553 | Ga0501036_0014204 | 3300049572 | Bacteria | 6625 |
| 554 | Ga0501036_0055755 | 3300049572 | Bacteria | 3348 |
| 555 | Ga0501036_0071418 | 3300049572 | Bacteria | 2935 |
| 556 | Ga0501036_0119416 | 3300049572 | Bacteria | 2226 |
| 557 | Ga0501037_0000225 | 3300049573 | Bacteria | 49210 |
| 558 | Ga0501037_0011416 | 3300049573 | Bacteria | 6535 |
| 559 | Ga0501037_0012159 | 3300049573 | Bacteria | 6335 |
| 560 | Ga0501037_0021352 | 3300049573 | Bacteria | 4783 |
| 561 | Ga0501037_0023217 | 3300049573 | Bacteria | 4587 |
| 562 | Ga0501037_0112354 | 3300049573 | Bacteria | 1962 |
| 563 | Ga0501037_0153546 | 3300049573 | Bacteria | 1644 |
| 564 | Ga0501038_0001877 | 3300049574 | Bacteria | 19413 |
| 565 | Ga0501038_0008985 | 3300049574 | Bacteria | 9168 |
| 566 | Ga0501038_0317029 | 3300049574 | Bacteria | 1220 |
| 567 | Ga0501038_0430979 | 3300049574 | Bacteria | 1016 |
| 568 | Ga0501038_0493368 | 3300049574 | Bacteria | 937 |
| 569 | Ga0501038_0575449 | 3300049574 | Bacteria | 854 |
| 570 | Ga0501039_0015717 | 3300049575 | Bacteria | 5791 |
| 571 | Ga0501039_0016214 | 3300049575 | Bacteria | 5709 |
| 572 | Ga0501039_0422712 | 3300049575 | Bacteria | 1047 |
| 573 | Ga0501042_0026205 | 3300049578 | Bacteria | 4097 |
| 574 | Ga0501042_0144767 | 3300049578 | Bacteria | 1713 |
| 575 | Ga0501043_0004371 | 3300049579 | Bacteria | 11505 |
| 576 | Ga0501043_0005999 | 3300049579 | Bacteria | 9765 |
| 577 | Ga0501043_0022390 | 3300049579 | Bacteria | 4956 |
| 578 | Ga0501043_0042724 | 3300049579 | Bacteria | 3562 |
| 579 | Ga0501043_0045475 | 3300049579 | Bacteria | 3453 |
| 580 | Ga0501043_0099302 | 3300049579 | Bacteria | 2288 |
| 581 | Ga0501043_0147350 | 3300049579 | Bacteria | 1843 |
| 582 | Ga0501043_0527595 | 3300049579 | Bacteria | 879 |
| 583 | Ga0501046_0000071 | 3300049580 | Bacteria | 107260 |
| 584 | Ga0501046_0002191 | 3300049580 | Bacteria | 18452 |
| 585 | Ga0501046_0002217 | 3300049580 | Bacteria | 18328 |
| 586 | Ga0501046_0008066 | 3300049580 | Bacteria | 9201 |
| 587 | Ga0501046_0018748 | 3300049580 | Bacteria | 5751 |
| 588 | Ga0501046_0093917 | 3300049580 | Bacteria | 2305 |
| 589 | Ga0501046_0157522 | 3300049580 | Bacteria | 1710 |
| 590 | Ga0501047_0036556 | 3300049581 | Bacteria | 4747 |
| 591 | Ga0501047_0044973 | 3300049581 | Bacteria | 4267 |
| 592 | Ga0501047_0045354 | 3300049581 | Bacteria | 4251 |
| 593 | Ga0501047_0049528 | 3300049581 | Bacteria | 4056 |
| 594 | Ga0501047_0055264 | 3300049581 | Bacteria | 3839 |
| 595 | Ga0501047_0139676 | 3300049581 | Bacteria | 2301 |
| 596 | Ga0501048_0000826 | 3300049582 | Bacteria | 22836 |
| 597 | Ga0501048_0009404 | 3300049582 | Bacteria | 7338 |
| 598 | Ga0501067_0085744 | 3300049583 | Bacteria | 1748 |
| 599 | Ga0501067_0133645 | 3300049583 | Bacteria | 1381 |
| 600 | Ga0501067_0300153 | 3300049583 | Bacteria | 894 |
| 601 | Ga0501070_0000524 | 3300049586 | Bacteria | 35215 |
| 602 | Ga0501070_0000569 | 3300049586 | Bacteria | 33672 |
| 603 | Ga0501070_0001028 | 3300049586 | Bacteria | 25074 |
| 604 | Ga0501070_0003400 | 3300049586 | Bacteria | 13815 |
| 605 | Ga0501070_0048064 | 3300049586 | Bacteria | 3545 |
| 606 | Ga0501070_0141255 | 3300049586 | Bacteria | 1988 |
| 607 | Ga0501070_0192141 | 3300049586 | Bacteria | 1678 |
| 608 | Ga0501070_0230528 | 3300049586 | Bacteria | 1517 |
| 609 | Ga0501070_0298765 | 3300049586 | Bacteria | 1312 |
| 610 | Ga0501071_0008372 | 3300049587 | Bacteria | 6834 |
| 611 | Ga0501072_0031955 | 3300049588 | Bacteria | 4121 |
| 612 | Ga0501072_0273447 | 3300049588 | Bacteria | 1344 |
| 613 | Ga0501073_0020944 | 3300049589 | Bacteria | 4716 |
| 614 | Ga0501073_0035250 | 3300049589 | Bacteria | 3558 |
| 615 | Ga0501073_0172242 | 3300049589 | Bacteria | 1498 |
| 616 | Ga0501074_0016706 | 3300049590 | Bacteria | 5326 |
| 617 | Ga0501077_0155961 | 3300049593 | Bacteria | 1449 |
| 618 | Ga0501080_0000134 | 3300049742 | Bacteria | 52384 |
| 619 | Ga0501080_0076432 | 3300049742 | Bacteria | 3114 |
| 620 | Ga0501080_0096254 | 3300049742 | Bacteria | 2748 |
| 621 | Ga0501083_0059557 | 3300049744 | Bacteria | 2554 |
| 622 | Ga0501035_0011940 | 3300049822 | Bacteria | 8039 |
| 623 | Ga0501035_0013921 | 3300049822 | Bacteria | 7422 |
| 624 | Ga0501035_0031423 | 3300049822 | Bacteria | 4836 |
| 625 | Ga0501035_0342307 | 3300049822 | Bacteria | 1253 |
| 626 | Ga0501044_0032155 | 3300049823 | Bacteria | 5516 |
| 627 | Ga0501044_0035611 | 3300049823 | Bacteria | 5211 |
| 628 | Ga0501044_0052806 | 3300049823 | Bacteria | 4184 |
| 629 | Ga0501044_0106641 | 3300049823 | Bacteria | 2813 |
| 630 | Ga0501044_0166603 | 3300049823 | Bacteria | 2177 |
| 631 | Ga0501044_0281133 | 3300049823 | Bacteria | 1598 |
| 632 | Ga0501045_0009279 | 3300049824 | Bacteria | 6881 |
| 633 | Ga0501045_0084610 | 3300049824 | Bacteria | 2340 |
| 634 | nmdc:mga00v17_144910_c1 | 3300050491 | Bacteria | 1524 |
| 635 | nmdc:mga00v17_1997_c1 | 3300050491 | Bacteria | 10521 |
| 636 | nmdc:mga00v17_403171_c1 | 3300050491 | Bacteria | 889 |
| 637 | nmdc:mga00v17_85220_c1 | 3300050491 | Bacteria | 1978 |
| 638 | nmdc:mga0yw44_30856_c1 | 3300050492 | Bacteria | 3112 |
| 639 | nmdc:mga0yw44_359986_c1 | 3300050492 | Bacteria | 980 |
| 640 | nmdc:mga0yw44_46195_c1 | 3300050492 | Bacteria | 2614 |
| 641 | nmdc:mga0yw44_86862_c1 | 3300050492 | Bacteria | 1970 |
| 642 | nmdc:mga07m45_166704_c1 | 3300050496 | Bacteria | 1279 |
| 643 | nmdc:mga07m45_182575_c1 | 3300050496 | Bacteria | 1220 |
| 644 | nmdc:mga07m45_59229_c1 | 3300050496 | Bacteria | 2167 |
| 645 | nmdc:mga0sz30_1528_c1 | 3300050516 | Bacteria | 8242 |
| 646 | nmdc:mga0sz30_26287_c1 | 3300050516 | Bacteria | 2385 |
| 647 | Ga0500635_0000064 | 3300053080 | Bacteria | 70317 |
| 648 | Ga0500635_0036677 | 3300053080 | Bacteria | 1617 |
| 649 | Ga0495655_0001072 | 3300053083 | Bacteria | 4226 |
| 650 | Ga0495595_0033536 | 3300053084 | Bacteria | 2318 |
| 651 | Ga0495619_0028909 | 3300053085 | Bacteria | 3578 |
| 652 | Ga0500578_0144435 | 3300053086 | Bacteria | 1486 |
| 653 | Ga0500651_0007780 | 3300053093 | Bacteria | 6268 |
| 654 | Ga0500641_0000256 | 3300053096 | Bacteria | 19848 |
| 655 | Ga0500641_0012501 | 3300053096 | Bacteria | 3101 |
| 656 | Ga0500556_0000282 | 3300053104 | Bacteria | 39873 |
| 657 | Ga0500560_000276 | 3300053107 | Bacteria | 6448 |
| 658 | Ga0500562_000728 | 3300053108 | Bacteria | 7976 |
| 659 | Ga0500593_000801 | 3300053117 | Bacteria | 11771 |
| 660 | Ga0500655_005387 | 3300053133 | Bacteria | 2309 |
| 661 | Ga0500559_0000373 | 3300053136 | Bacteria | 33009 |
| 662 | Ga0500559_0007855 | 3300053136 | Bacteria | 4710 |
| 663 | Ga0500568_0003755 | 3300053139 | Bacteria | 8317 |
| 664 | Ga0500573_0002950 | 3300053140 | Bacteria | 8678 |
| 665 | Ga0500573_0024767 | 3300053140 | Bacteria | 3451 |
| 666 | Ga0500573_0187854 | 3300053140 | Bacteria | 1106 |
| 667 | Ga0500590_008902 | 3300053148 | Bacteria | 5029 |
| 668 | Ga0500616_0000010 | 3300053153 | Bacteria | 761410 |
| 669 | Ga0500616_0000089 | 3300053153 | Bacteria | 191075 |
| 670 | Ga0500616_0002518 | 3300053153 | Bacteria | 15160 |
| 671 | Ga0500620_001350 | 3300053155 | Bacteria | 4470 |
| 672 | Ga0500624_001992 | 3300053157 | Bacteria | 2894 |
| 673 | Ga0500645_010320 | 3300053730 | Bacteria | 3095 |
| 674 | Ga0500645_023345 | 3300053730 | Bacteria | 1896 |
| 675 | Ga0501084_0363005 | 3300054114 | Bacteria | 1224 |
| 676 | Ga0590075_047614 | 3300059424 | Bacteria | 1099 |
| 677 | Ga0587084_000001 | 3300059477 | Bacteria | 25091 |
| 678 | Ga0587070_003876 | 3300059491 | Bacteria | 1843 |
| 679 | Ga0587077_000012 | 3300059493 | Bacteria | 7540 |
| 680 | Ga0587085_000135 | 3300059506 | Bacteria | 4021 |
| 681 | Ga0587086_000121 | 3300059507 | Bacteria | 4082 |
| 682 | Ga0587088_000056 | 3300059508 | Bacteria | 5596 |
| 683 | Ga0587090_000385 | 3300059510 | Bacteria | 3556 |
| 684 | Ga0587091_000248 | 3300059511 | Bacteria | 4013 |
| 685 | Ga0587092_000031 | 3300059512 | Bacteria | 7735 |
| 686 | Ga0587094_000035 | 3300059513 | Bacteria | 6016 |
| 687 | Ga0587101_000017 | 3300059623 | Bacteria | 7819 |
| 688 | Ga0587117_006144 | 3300059627 | Bacteria | 1328 |
| 689 | Ga0587127_000551 | 3300059629 | Bacteria | 1771 |
| 690 | Ga0587130_000142 | 3300059631 | Bacteria | 3639 |
| 691 | Ga0587069_000061 | 3300059642 | Bacteria | 5440 |
| 692 | Ga0587100_000016 | 3300059648 | Bacteria | 5421 |
| 693 | Ga0587124_000076 | 3300059660 | Bacteria | 3643 |
| 694 | Ga0587111_0000048 | 3300060346 | Bacteria | 7389 |
| 695 | Ga0501082_0316856 | 3300060353 | Bacteria | 1359 |
| 696 | Ga0530510_0323323 | 3300061734 | Bacteria | 1157 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046515 | Ga0495620_0018122 | Ga0495620_0018122_1792_2682 | 215 |
| 2 | 3300046537 | Ga0495598_0015743 | Ga0495598_0015743_771_1661 | 215 |
| 3 | 3300046539 | Ga0495621_0030879 | Ga0495621_0030879_468_1358 | 215 |
| 4 | 3300046675 | Ga0495657_0141715 | Ga0495657_0141715_558_1448 | 215 |
| 5 | 3300046663 | Ga0495635_0219770 | Ga0495635_0219770_79_969 | 216 |
| 6 | 3300037418 | Ga0395900_0269495 | Ga0395900_0269495_967_1677 | 223 |
| 7 | 3300044901 | Ga0466960_0024039 | Ga0466960_0024039_1870_2733 | 224 |
| 8 | 3300046476 | Ga0495662_0226138 | Ga0495662_0226138_37_861 | 231 |
| 9 | 3300013308 | Ga0157375_10282440 | Ga0157375_102824402 | 233 |
| 10 | 3300037853 | Ga0436364_0891096 | Ga0436364_0891096_3729_4538 | 235 |
| 11 | 3300046616 | Ga0495668_0229307 | Ga0495668_0229307_39_929 | 236 |
| 12 | 3300038443 | Ga0395901_0098948 | Ga0395901_0098948_274_1158 | 237 |
| 13 | 3300009174 | Ga0105241_10020164 | Ga0105241_100201644 | 238 |
| 14 | 3300009545 | Ga0105237_10147307 | Ga0105237_101473073 | 238 |
| 15 | 3300010375 | Ga0105239_10735083 | Ga0105239_107350833 | 238 |
| 16 | 3300048920 | Ga0496117_0184411 | Ga0496117_0184411_66_923 | 238 |
| 17 | 3300049586 | Ga0501070_0000569 | Ga0501070_0000569_11_766 | 238 |
| 18 | 3300049586 | Ga0501070_0192141 | Ga0501070_0192141_16_780 | 240 |
| 19 | 3300053084 | Ga0495595_0033536 | Ga0495595_0033536_10_816 | 241 |
| 20 | 3300049573 | Ga0501037_0000225 | Ga0501037_0000225_11489_12364 | 242 |
| 21 | 3300049574 | Ga0501038_0493368 | Ga0501038_0493368_32_907 | 242 |
| 22 | 3300053153 | Ga0500616_0002518 | Ga0500616_0002518_11957_12805 | 242 |
| 23 | iso_pu_bacteria | 2905926851 | 2905929399 | 242 |
| 24 | 3300046511 | Ga0495608_0004783 | Ga0495608_0004783_8150_9022 | 243 |
| 25 | 3300046559 | Ga0495667_0000402 | Ga0495667_0000402_17738_18610 | 243 |
| 26 | iso_pu_bacteria | 2643221576 | 2643892860 | 244 |
| 27 | iso_pu_bacteria | 2643221590 | 2643962309 | 244 |
| 28 | 3300005329 | Ga0070683_100147207 | Ga0070683_1001472072 | 246 |
| 29 | 3300025944 | Ga0207661_10140936 | Ga0207661_101409362 | 246 |
| 30 | 3300033179 | Ga0307507_10082816 | Ga0307507_100828161 | 246 |
| 31 | 3300033180 | Ga0307510_10206826 | Ga0307510_102068262 | 246 |
| 32 | 3300044656 | Ga0466969_0044415 | Ga0466969_0044415_790_1599 | 246 |
| 33 | 3300047472 | Ga0495686_0282525 | Ga0495686_0282525_43_879 | 246 |
| 34 | 3300031731 | Ga0307405_10185122 | Ga0307405_101851222 | 247 |
| 35 | 3300031901 | Ga0307406_10427058 | Ga0307406_104270581 | 247 |
| 36 | 3300009093 | Ga0105240_10099808 | Ga0105240_100998084 | 248 |
| 37 | 3300009551 | Ga0105238_10017275 | Ga0105238_100172753 | 248 |
| 38 | 3300030522 | Ga0307512_10007529 | Ga0307512_100075297 | 248 |
| 39 | 3300049571 | Ga0501034_0023839 | Ga0501034_0023839_5061_5846 | 248 |
| 40 | 3300049573 | Ga0501037_0112354 | Ga0501037_0112354_1068_1853 | 248 |
| 41 | 3300049579 | Ga0501043_0042724 | Ga0501043_0042724_690_1475 | 248 |
| 42 | 3300049579 | Ga0501043_0527595 | Ga0501043_0527595_82_867 | 248 |
| 43 | 3300049580 | Ga0501046_0157522 | Ga0501046_0157522_450_1235 | 248 |
| 44 | 3300049581 | Ga0501047_0045354 | Ga0501047_0045354_2474_3259 | 248 |
| 45 | 3300049589 | Ga0501073_0172242 | Ga0501073_0172242_327_1112 | 248 |
| 46 | 3300049593 | Ga0501077_0155961 | Ga0501077_0155961_545_1330 | 248 |
| 47 | 3300049742 | Ga0501080_0000134 | Ga0501080_0000134_23235_24020 | 248 |
| 48 | 3300049744 | Ga0501083_0059557 | Ga0501083_0059557_490_1275 | 248 |
| 49 | 3300049822 | Ga0501035_0342307 | Ga0501035_0342307_28_813 | 248 |
| 50 | 3300054114 | Ga0501084_0363005 | Ga0501084_0363005_73_858 | 248 |
| 51 | 3300021388 | Ga0213875_10005353 | Ga0213875_100053534 | 249 |
| 52 | 3300033545 | Ga0316214_1002008 | Ga0316214_10020082 | 249 |
| 53 | 3300038443 | Ga0395901_0023278 | Ga0395901_0023278_3568_4371 | 249 |
| 54 | 3300038443 | Ga0395901_0288080 | Ga0395901_0288080_794_1579 | 249 |
| 55 | 3300049568 | Ga0501031_0043036 | Ga0501031_0043036_982_1767 | 249 |
| 56 | 3300049569 | Ga0501032_0047557 | Ga0501032_0047557_964_1749 | 249 |
| 57 | 3300049570 | Ga0501033_0000203 | Ga0501033_0000203_11021_11806 | 249 |
| 58 | 3300049571 | Ga0501034_0077122 | Ga0501034_0077122_2407_3192 | 249 |
| 59 | 3300049572 | Ga0501036_0014204 | Ga0501036_0014204_5223_6008 | 249 |
| 60 | 3300049578 | Ga0501042_0144767 | Ga0501042_0144767_883_1668 | 249 |
| 61 | 3300049579 | Ga0501043_0022390 | Ga0501043_0022390_1792_2577 | 249 |
| 62 | 3300049579 | Ga0501043_0099302 | Ga0501043_0099302_34_819 | 249 |
| 63 | 3300049580 | Ga0501046_0018748 | Ga0501046_0018748_1475_2260 | 249 |
| 64 | 3300049583 | Ga0501067_0133645 | Ga0501067_0133645_382_1167 | 249 |
| 65 | 3300049588 | Ga0501072_0273447 | Ga0501072_0273447_310_1095 | 249 |
| 66 | 3300046455 | Ga0495603_0116803 | Ga0495603_0116803_376_1251 | 250 |
| 67 | 3300046492 | Ga0495585_0103279 | Ga0495585_0103279_445_1320 | 250 |
| 68 | 3300046499 | Ga0495594_0031966 | Ga0495594_0031966_1676_2551 | 250 |
| 69 | 3300046501 | Ga0495607_0069964 | Ga0495607_0069964_941_1816 | 250 |
| 70 | 3300046506 | Ga0495583_0074848 | Ga0495583_0074848_305_1180 | 250 |
| 71 | 3300046507 | Ga0495606_0004805 | Ga0495606_0004805_8949_9824 | 250 |
| 72 | 3300046512 | Ga0495610_0063392 | Ga0495610_0063392_100_975 | 250 |
| 73 | 3300046513 | Ga0495616_0013185 | Ga0495616_0013185_1620_2495 | 250 |
| 74 | 3300046515 | Ga0495620_0004461 | Ga0495620_0004461_5803_6678 | 250 |
| 75 | 3300046516 | Ga0495628_0091481 | Ga0495628_0091481_568_1443 | 250 |
| 76 | 3300046518 | Ga0495631_0032324 | Ga0495631_0032324_735_1610 | 250 |
| 77 | 3300046526 | Ga0495666_0036041 | Ga0495666_0036041_721_1596 | 250 |
| 78 | 3300046529 | Ga0495652_0030604 | Ga0495652_0030604_3033_3908 | 250 |
| 79 | 3300046530 | Ga0495654_0128870 | Ga0495654_0128870_154_1029 | 250 |
| 80 | 3300046557 | Ga0495622_0007858 | Ga0495622_0007858_376_1251 | 250 |
| 81 | 3300046616 | Ga0495668_0014227 | Ga0495668_0014227_447_1322 | 250 |
| 82 | 3300046660 | Ga0495625_0025631 | Ga0495625_0025631_3181_4056 | 250 |
| 83 | 3300046663 | Ga0495635_0070706 | Ga0495635_0070706_472_1347 | 250 |
| 84 | 3300046690 | Ga0495624_0261162 | Ga0495624_0261162_128_1003 | 250 |
| 85 | 3300046794 | Ga0495589_0027582 | Ga0495589_0027582_1121_1996 | 250 |
| 86 | 3300046810 | Ga0495660_0081780 | Ga0495660_0081780_623_1498 | 250 |
| 87 | 3300047321 | Ga0495676_0036943 | Ga0495676_0036943_2863_3738 | 250 |
| 88 | 3300047323 | Ga0495683_0057043 | Ga0495683_0057043_876_1751 | 250 |
| 89 | 3300048091 | Ga0495626_0008479 | Ga0495626_0008479_2233_3108 | 250 |
| 90 | 3300005539 | Ga0068853_100199644 | Ga0068853_1001996442 | 251 |
| 91 | 3300005548 | Ga0070665_100076240 | Ga0070665_1000762403 | 251 |
| 92 | 3300005563 | Ga0068855_100005522 | Ga0068855_1000055229 | 251 |
| 93 | 3300005578 | Ga0068854_100001906 | Ga0068854_10000190614 | 251 |
| 94 | 3300005616 | Ga0068852_100035556 | Ga0068852_1000355562 | 251 |
| 95 | 3300025904 | Ga0207647_10001411 | Ga0207647_1000141111 | 251 |
| 96 | 3300025911 | Ga0207654_10029988 | Ga0207654_100299882 | 251 |
| 97 | 3300025913 | Ga0207695_10019929 | Ga0207695_100199293 | 251 |
| 98 | 3300025914 | Ga0207671_10001866 | Ga0207671_1000186610 | 251 |
| 99 | 3300025924 | Ga0207694_10285495 | Ga0207694_102854953 | 251 |
| 100 | 3300025949 | Ga0207667_10397099 | Ga0207667_103970993 | 251 |
| 101 | 3300025981 | Ga0207640_10233276 | Ga0207640_102332761 | 251 |
| 102 | 3300026142 | Ga0207698_10021148 | Ga0207698_100211486 | 251 |
| 103 | 3300028379 | Ga0268266_10070008 | Ga0268266_100700083 | 251 |
| 104 | 3300031730 | Ga0307516_10064212 | Ga0307516_100642123 | 251 |
| 105 | 3300046454 | Ga0495592_0042075 | Ga0495592_0042075_1712_2587 | 251 |
| 106 | 3300046462 | Ga0495651_0278319 | Ga0495651_0278319_58_933 | 251 |
| 107 | 3300046533 | Ga0495640_0260234 | Ga0495640_0260234_64_939 | 251 |
| 108 | 3300046642 | Ga0495634_0151866 | Ga0495634_0151866_34_909 | 251 |
| 109 | 3300046680 | Ga0495646_0057100 | Ga0495646_0057100_227_1102 | 251 |
| 110 | 3300047315 | Ga0495581_0016467 | Ga0495581_0016467_504_1379 | 251 |
| 111 | 3300047321 | Ga0495676_0051383 | Ga0495676_0051383_1989_2864 | 251 |
| 112 | 3300047673 | Ga0495593_0025064 | Ga0495593_0025064_1883_2758 | 251 |
| 113 | 3300046499 | Ga0495594_0136107 | Ga0495594_0136107_508_1356 | 252 |
| 114 | 3300046529 | Ga0495652_0268641 | Ga0495652_0268641_435_1238 | 252 |
| 115 | 3300047472 | Ga0495686_0092048 | Ga0495686_0092048_330_1127 | 252 |
| 116 | 3300053104 | Ga0500556_0000282 | Ga0500556_0000282_30924_31766 | 252 |
| 117 | 3300005331 | Ga0070670_100287151 | Ga0070670_1002871512 | 253 |
| 118 | 3300014326 | Ga0157380_10809113 | Ga0157380_108091131 | 253 |
| 119 | 3300031548 | Ga0307408_100139192 | Ga0307408_1001391922 | 253 |
| 120 | 3300031903 | Ga0307407_10199789 | Ga0307407_101997892 | 253 |
| 121 | 3300044765 | Ga0466970_0044839 | Ga0466970_0044839_1429_2325 | 253 |
| 122 | 3300044901 | Ga0466960_0023405 | Ga0466960_0023405_1247_2143 | 253 |
| 123 | 3300030522 | Ga0307512_10011457 | Ga0307512_100114575 | 254 |
| 124 | 3300031456 | Ga0307513_10003959 | Ga0307513_1000395919 | 254 |
| 125 | 3300031507 | Ga0307509_10013932 | Ga0307509_100139323 | 254 |
| 126 | 3300041494 | Ga0451837_0641337 | Ga0451837_0641337_373_1173 | 254 |
| 127 | 3300044683 | Ga0466965_0004730 | Ga0466965_0004730_3560_4363 | 254 |
| 128 | 3300044735 | Ga0466968_0001871 | Ga0466968_0001871_3790_4593 | 254 |
| 129 | 3300044765 | Ga0466970_0236514 | Ga0466970_0236514_34_837 | 254 |
| 130 | 3300044842 | Ga0466957_0020653 | Ga0466957_0020653_2703_3506 | 254 |
| 131 | 3300044901 | Ga0466960_0173329 | Ga0466960_0173329_195_998 | 254 |
| 132 | 3300045049 | Ga0466959_0019351 | Ga0466959_0019351_4031_4834 | 254 |
| 133 | 3300045836 | Ga0466958_0069880 | Ga0466958_0069880_513_1316 | 254 |
| 134 | 3300045976 | Ga0466967_0081394 | Ga0466967_0081394_1903_2703 | 254 |
| 135 | 3300045976 | Ga0466967_0372360 | Ga0466967_0372360_285_1088 | 254 |
| 136 | 3300049583 | Ga0501067_0300153 | Ga0501067_0300153_23_823 | 254 |
| 137 | 3300049823 | Ga0501044_0281133 | Ga0501044_0281133_611_1471 | 254 |
| 138 | 3300050491 | nmdc:mga00v17_403171_c1 | nmdc:mga00v17_403171_c1_67_867 | 254 |
| 139 | 3300050492 | nmdc:mga0yw44_86862_c1 | nmdc:mga0yw44_86862_c1_26_826 | 254 |
| 140 | 3300053086 | Ga0500578_0144435 | Ga0500578_0144435_639_1445 | 254 |
| 141 | 3300053096 | Ga0500641_0012501 | Ga0500641_0012501_306_1106 | 254 |
| 142 | 3300003323 | rootH1_10055294 | rootH1_100552942 | 255 |
| 143 | 3300005563 | Ga0068855_100318733 | Ga0068855_1003187332 | 255 |
| 144 | 3300013104 | Ga0157370_10006011 | Ga0157370_100060116 | 255 |
| 145 | 3300028786 | Ga0307517_10050934 | Ga0307517_100509342 | 255 |
| 146 | 3300032004 | Ga0307414_10117497 | Ga0307414_101174973 | 255 |
| 147 | 3300044656 | Ga0466969_0009413 | Ga0466969_0009413_4047_4856 | 255 |
| 148 | 3300044684 | Ga0466966_0017223 | Ga0466966_0017223_3699_4508 | 255 |
| 149 | 3300044693 | Ga0466961_0018907 | Ga0466961_0018907_3158_3967 | 255 |
| 150 | 3300046459 | Ga0495629_0003756 | Ga0495629_0003756_10445_11254 | 255 |
| 151 | 3300046459 | Ga0495629_0014354 | Ga0495629_0014354_3933_4742 | 255 |
| 152 | 3300046460 | Ga0495638_0145539 | Ga0495638_0145539_241_1050 | 255 |
| 153 | 3300046462 | Ga0495651_0033791 | Ga0495651_0033791_3099_3908 | 255 |
| 154 | 3300046471 | Ga0495650_0000558 | Ga0495650_0000558_5362_6174 | 255 |
| 155 | 3300046473 | Ga0495582_0013541 | Ga0495582_0013541_3426_4235 | 255 |
| 156 | 3300046473 | Ga0495582_0103776 | Ga0495582_0103776_769_1575 | 255 |
| 157 | 3300046476 | Ga0495662_0002738 | Ga0495662_0002738_4968_5777 | 255 |
| 158 | 3300046476 | Ga0495662_0010284 | Ga0495662_0010284_1474_2280 | 255 |
| 159 | 3300046477 | Ga0495664_0003195 | Ga0495664_0003195_5410_6219 | 255 |
| 160 | 3300046499 | Ga0495594_0138606 | Ga0495594_0138606_269_1075 | 255 |
| 161 | 3300046514 | Ga0495618_0118948 | Ga0495618_0118948_86_895 | 255 |
| 162 | 3300046516 | Ga0495628_0044346 | Ga0495628_0044346_311_1120 | 255 |
| 163 | 3300046529 | Ga0495652_0066264 | Ga0495652_0066264_1112_1921 | 255 |
| 164 | 3300046533 | Ga0495640_0045740 | Ga0495640_0045740_1104_1913 | 255 |
| 165 | 3300046536 | Ga0495587_0003896 | Ga0495587_0003896_6601_7407 | 255 |
| 166 | 3300046536 | Ga0495587_0009303 | Ga0495587_0009303_5109_5918 | 255 |
| 167 | 3300046543 | Ga0495645_0028098 | Ga0495645_0028098_1513_2322 | 255 |
| 168 | 3300046543 | Ga0495645_0169134 | Ga0495645_0169134_19_825 | 255 |
| 169 | 3300046559 | Ga0495667_0029993 | Ga0495667_0029993_19_825 | 255 |
| 170 | 3300046615 | Ga0495656_0152308 | Ga0495656_0152308_228_1034 | 255 |
| 171 | 3300046642 | Ga0495634_0009470 | Ga0495634_0009470_3099_3908 | 255 |
| 172 | 3300046660 | Ga0495625_0022500 | Ga0495625_0022500_1079_1888 | 255 |
| 173 | 3300046660 | Ga0495625_0254465 | Ga0495625_0254465_271_1083 | 255 |
| 174 | 3300046663 | Ga0495635_0180113 | Ga0495635_0180113_10_819 | 255 |
| 175 | 3300046663 | Ga0495635_0242347 | Ga0495635_0242347_27_833 | 255 |
| 176 | 3300046674 | Ga0495588_0021027 | Ga0495588_0021027_2329_3135 | 255 |
| 177 | 3300046675 | Ga0495657_0000206 | Ga0495657_0000206_29763_30572 | 255 |
| 178 | 3300046680 | Ga0495646_0007542 | Ga0495646_0007542_4368_5177 | 255 |
| 179 | 3300046689 | Ga0495613_0000367 | Ga0495613_0000367_3773_4582 | 255 |
| 180 | 3300046690 | Ga0495624_0071602 | Ga0495624_0071602_10_819 | 255 |
| 181 | 3300046691 | Ga0495670_0189227 | Ga0495670_0189227_30_836 | 255 |
| 182 | 3300046692 | Ga0495671_0016857 | Ga0495671_0016857_397_1206 | 255 |
| 183 | 3300046809 | Ga0495600_0014480 | Ga0495600_0014480_2119_2925 | 255 |
| 184 | 3300046809 | Ga0495600_0071668 | Ga0495600_0071668_397_1206 | 255 |
| 185 | 3300047315 | Ga0495581_0022959 | Ga0495581_0022959_956_1765 | 255 |
| 186 | 3300047315 | Ga0495581_0285079 | Ga0495581_0285079_115_921 | 255 |
| 187 | 3300047317 | Ga0495604_0002982 | Ga0495604_0002982_11660_12469 | 255 |
| 188 | 3300047321 | Ga0495676_0039869 | Ga0495676_0039869_2018_2827 | 255 |
| 189 | 3300047322 | Ga0495680_0090308 | Ga0495680_0090308_37_843 | 255 |
| 190 | 3300047443 | Ga0495687_005511 | Ga0495687_005511_3587_4396 | 255 |
| 191 | 3300047444 | Ga0495675_0045533 | Ga0495675_0045533_1137_1943 | 255 |
| 192 | 3300047470 | Ga0495681_0000253 | Ga0495681_0000253_4614_5423 | 255 |
| 193 | 3300047471 | Ga0495684_0301623 | Ga0495684_0301623_249_1058 | 255 |
| 194 | 3300047673 | Ga0495593_0020878 | Ga0495593_0020878_1668_2477 | 255 |
| 195 | 3300048089 | Ga0495614_0023141 | Ga0495614_0023141_937_1746 | 255 |
| 196 | 3300048905 | Ga0496102_0162700 | Ga0496102_0162700_42_851 | 255 |
| 197 | 3300048917 | Ga0496114_0048331 | Ga0496114_0048331_2129_2938 | 255 |
| 198 | 3300049574 | Ga0501038_0430979 | Ga0501038_0430979_65_874 | 255 |
| 199 | 3300050491 | nmdc:mga00v17_1997_c1 | nmdc:mga00v17_1997_c1_7492_8304 | 255 |
| 200 | 3300053107 | Ga0500560_000276 | Ga0500560_000276_2775_3584 | 255 |
| 201 | 3300053157 | Ga0500624_001992 | Ga0500624_001992_1201_2010 | 255 |
| 202 | 3300025246 | Ga0209646_1000192 | Ga0209646_100019250 | 256 |
| 203 | 3300037471 | Ga0395905_0034166 | Ga0395905_0034166_1424_2233 | 256 |
| 204 | 3300042007 | Ga0439449_0038334 | Ga0439449_0038334_84_893 | 256 |
| 205 | 3300049574 | Ga0501038_0575449 | Ga0501038_0575449_20_829 | 256 |
| 206 | 3300053153 | Ga0500616_0000089 | Ga0500616_0000089_181933_182742 | 256 |
| 207 | 3300053730 | Ga0500645_023345 | Ga0500645_023345_227_1036 | 256 |
| 208 | 3300059424 | Ga0590075_047614 | Ga0590075_047614_218_1027 | 256 |
| 209 | 3300013105 | Ga0157369_10110300 | Ga0157369_101103003 | 257 |
| 210 | 3300014325 | Ga0163163_10592093 | Ga0163163_105920932 | 257 |
| 211 | 3300032005 | Ga0307411_10310014 | Ga0307411_103100143 | 257 |
| 212 | 3300033179 | Ga0307507_10188201 | Ga0307507_101882012 | 257 |
| 213 | 3300035242 | Ga0373962_0000420 | Ga0373962_0000420_7287_8150 | 257 |
| 214 | 3300045836 | Ga0466958_0052816 | Ga0466958_0052816_1472_2284 | 257 |
| 215 | 3300046453 | Ga0495627_000352 | Ga0495627_000352_25118_25930 | 257 |
| 216 | 3300046543 | Ga0495645_0032423 | Ga0495645_0032423_2107_2970 | 257 |
| 217 | 3300048916 | Ga0496113_0255062 | Ga0496113_0255062_25_837 | 257 |
| 218 | 3300049571 | Ga0501034_0001033 | Ga0501034_0001033_10264_11076 | 257 |
| 219 | 3300049571 | Ga0501034_0139401 | Ga0501034_0139401_526_1341 | 257 |
| 220 | 3300049583 | Ga0501067_0085744 | Ga0501067_0085744_558_1373 | 257 |
| 221 | 3300049588 | Ga0501072_0031955 | Ga0501072_0031955_1571_2386 | 257 |
| 222 | 3300053139 | Ga0500568_0003755 | Ga0500568_0003755_6951_7766 | 257 |
| 223 | 3300061734 | Ga0530510_0323323 | Ga0530510_0323323_26_838 | 257 |
| 224 | 3300037312 | Ga0395899_0046544 | Ga0395899_0046544_1733_2587 | 258 |
| 225 | 3300037418 | Ga0395900_0054877 | Ga0395900_0054877_156_1010 | 258 |
| 226 | 3300037466 | Ga0395898_0038380 | Ga0395898_0038380_167_1021 | 258 |
| 227 | 3300038443 | Ga0395901_0144104 | Ga0395901_0144104_1476_2330 | 258 |
| 228 | 3300048908 | Ga0496105_0054451 | Ga0496105_0054451_208_1023 | 258 |
| 229 | 3300048929 | Ga0496126_0042168 | Ga0496126_0042168_831_1646 | 258 |
| 230 | 3300049574 | Ga0501038_0001877 | Ga0501038_0001877_5788_6642 | 258 |
| 231 | iso_pu_bacteria | 2643221687 | 2644491464 | 258 |
| 232 | iso_pu_bacteria | 2946024296 | 2946025012 | 258 |
| 233 | 3300005331 | Ga0070670_100293247 | Ga0070670_1002932472 | 259 |
| 234 | 3300009098 | Ga0105245_10117434 | Ga0105245_101174341 | 259 |
| 235 | 3300011119 | Ga0105246_10113931 | Ga0105246_101139314 | 259 |
| 236 | 3300013250 | Ga0171462_1001 | Ga0171462_1001462 | 259 |
| 237 | 3300025925 | Ga0207650_10299270 | Ga0207650_102992702 | 259 |
| 238 | 3300048909 | Ga0496106_0465515 | Ga0496106_0465515_135_989 | 259 |
| 239 | 3300048910 | Ga0496107_0103815 | Ga0496107_0103815_1174_2028 | 259 |
| 240 | 3300048927 | Ga0496124_0104903 | Ga0496124_0104903_1142_1960 | 259 |
| 241 | 3300049569 | Ga0501032_0110366 | Ga0501032_0110366_975_1793 | 259 |
| 242 | 3300049572 | Ga0501036_0119416 | Ga0501036_0119416_1262_2080 | 259 |
| 243 | 3300049573 | Ga0501037_0012159 | Ga0501037_0012159_388_1206 | 259 |
| 244 | 3300049574 | Ga0501038_0317029 | Ga0501038_0317029_375_1193 | 259 |
| 245 | 3300049575 | Ga0501039_0015717 | Ga0501039_0015717_311_1129 | 259 |
| 246 | 3300049579 | Ga0501043_0005999 | Ga0501043_0005999_2359_3177 | 259 |
| 247 | 3300049581 | Ga0501047_0139676 | Ga0501047_0139676_1456_2274 | 259 |
| 248 | 3300049582 | Ga0501048_0000826 | Ga0501048_0000826_21889_22707 | 259 |
| 249 | 3300049586 | Ga0501070_0001028 | Ga0501070_0001028_1634_2452 | 259 |
| 250 | 3300049586 | Ga0501070_0141255 | Ga0501070_0141255_119_937 | 259 |
| 251 | 3300049589 | Ga0501073_0035250 | Ga0501073_0035250_416_1234 | 259 |
| 252 | 3300049823 | Ga0501044_0166603 | Ga0501044_0166603_845_1663 | 259 |
| 253 | 3300049824 | Ga0501045_0009279 | Ga0501045_0009279_874_1692 | 259 |
| 254 | 3300060353 | Ga0501082_0316856 | Ga0501082_0316856_100_918 | 259 |
| 255 | 3300005618 | Ga0068864_100042847 | Ga0068864_1000428473 | 260 |
| 256 | 3300006051 | Ga0075364_10120647 | Ga0075364_101206472 | 260 |
| 257 | 3300026095 | Ga0207676_10174425 | Ga0207676_101744251 | 260 |
| 258 | 3300053093 | Ga0500651_0007780 | Ga0500651_0007780_2798_3619 | 260 |
| 259 | 3300053148 | Ga0500590_008902 | Ga0500590_008902_1340_2161 | 260 |
| 260 | 3300053155 | Ga0500620_001350 | Ga0500620_001350_2526_3347 | 260 |
| 261 | 3300059506 | Ga0587085_000135 | Ga0587085_000135_2364_3212 | 260 |
| 262 | 3300059507 | Ga0587086_000121 | Ga0587086_000121_2425_3273 | 260 |
| 263 | 3300059510 | Ga0587090_000385 | Ga0587090_000385_300_1148 | 260 |
| 264 | 3300059511 | Ga0587091_000248 | Ga0587091_000248_2294_3142 | 260 |
| 265 | 3300059631 | Ga0587130_000142 | Ga0587130_000142_342_1190 | 260 |
| 266 | iso_pu_bacteria | 2558860280 | 2559425556 | 260 |
| 267 | 3300031507 | Ga0307509_10080593 | Ga0307509_100805932 | 261 |
| 268 | 3300031730 | Ga0307516_10106039 | Ga0307516_101060392 | 261 |
| 269 | 3300032126 | Ga0307415_100369478 | Ga0307415_1003694782 | 261 |
| 270 | 3300046517 | Ga0495630_0111222 | Ga0495630_0111222_427_1260 | 261 |
| 271 | 3300047319 | Ga0495674_0022245 | Ga0495674_0022245_3243_4076 | 261 |
| 272 | 3300049571 | Ga0501034_0346388 | Ga0501034_0346388_382_1215 | 261 |
| 273 | 3300049573 | Ga0501037_0021352 | Ga0501037_0021352_1850_2674 | 261 |
| 274 | 3300049580 | Ga0501046_0000071 | Ga0501046_0000071_82270_83115 | 261 |
| 275 | 3300050496 | nmdc:mga07m45_166704_c1 | nmdc:mga07m45_166704_c1_159_1013 | 261 |
| 276 | 3300003322 | rootL2_10035491 | rootL2_100354913 | 262 |
| 277 | 3300003792 | Ga0055540_1011213 | Ga0055540_10112133 | 262 |
| 278 | 3300009148 | Ga0105243_10442023 | Ga0105243_104420232 | 262 |
| 279 | 3300009545 | Ga0105237_10153998 | Ga0105237_101539982 | 262 |
| 280 | 3300009551 | Ga0105238_10067508 | Ga0105238_100675082 | 262 |
| 281 | 3300013306 | Ga0163162_10099567 | Ga0163162_100995674 | 262 |
| 282 | 3300025303 | Ga0209051_1020243 | Ga0209051_10202433 | 262 |
| 283 | 3300025914 | Ga0207671_10114909 | Ga0207671_101149092 | 262 |
| 284 | 3300031824 | Ga0307413_10625090 | Ga0307413_106250901 | 262 |
| 285 | 3300047447 | Ga0495685_057869 | Ga0495685_057869_454_1287 | 262 |
| 286 | 3300048905 | Ga0496102_0040056 | Ga0496102_0040056_2988_3824 | 262 |
| 287 | 3300048906 | Ga0496103_0180870 | Ga0496103_0180870_271_1107 | 262 |
| 288 | 3300048907 | Ga0496104_0104230 | Ga0496104_0104230_337_1173 | 262 |
| 289 | 3300048908 | Ga0496105_0144649 | Ga0496105_0144649_23_859 | 262 |
| 290 | 3300048910 | Ga0496107_0033172 | Ga0496107_0033172_1176_2012 | 262 |
| 291 | 3300048913 | Ga0496110_0042786 | Ga0496110_0042786_1168_2004 | 262 |
| 292 | 3300048915 | Ga0496112_0135018 | Ga0496112_0135018_1194_2030 | 262 |
| 293 | 3300048916 | Ga0496113_0144758 | Ga0496113_0144758_700_1536 | 262 |
| 294 | 3300048917 | Ga0496114_0045297 | Ga0496114_0045297_1451_2287 | 262 |
| 295 | 3300048918 | Ga0496115_0412722 | Ga0496115_0412722_50_886 | 262 |
| 296 | 3300049579 | Ga0501043_0045475 | Ga0501043_0045475_81_908 | 262 |
| 297 | 3300049580 | Ga0501046_0008066 | Ga0501046_0008066_3162_3989 | 262 |
| 298 | iso_pu_bacteria | 2643221604 | 2644031882 | 262 |
| 299 | iso_pu_bacteria | 2643221617 | 2644102809 | 262 |
| 300 | iso_pu_bacteria | 2643221620 | 2644118471 | 262 |
| 301 | iso_pu_bacteria | 2738541272 | 2738696292 | 262 |
| 302 | iso_pu_bacteria | 2852646457 | 2852648003 | 262 |
| 303 | iso_pu_bacteria | 2945968032 | 2945969265 | 262 |
| 304 | 3300046459 | Ga0495629_0006664 | Ga0495629_0006664_3784_4647 | 263 |
| 305 | 3300046689 | Ga0495613_0001326 | Ga0495613_0001326_3517_4380 | 263 |
| 306 | 3300047321 | Ga0495676_0003572 | Ga0495676_0003572_12733_13596 | 263 |
| 307 | 3300048089 | Ga0495614_0004541 | Ga0495614_0004541_4930_5793 | 263 |
| 308 | 3300048906 | Ga0496103_0206905 | Ga0496103_0206905_289_1119 | 263 |
| 309 | 3300049571 | Ga0501034_0132802 | Ga0501034_0132802_1273_2106 | 263 |
| 310 | iso_pu_bacteria | 2739367898 | 2740169542 | 263 |
| 311 | iso_pu_bacteria | 2751185788 | 2753303322 | 263 |
| 312 | iso_pu_bacteria | 2811994917 | 2812483449 | 263 |
| 313 | iso_pu_bacteria | 2908811453 | 2908815514 | 263 |
| 314 | 3300006058 | Ga0075432_10008430 | Ga0075432_100084303 | 264 |
| 315 | 3300025944 | Ga0207661_10017840 | Ga0207661_100178402 | 264 |
| 316 | 3300027907 | Ga0207428_10053527 | Ga0207428_100535272 | 264 |
| 317 | 3300028794 | Ga0307515_10100480 | Ga0307515_101004804 | 264 |
| 318 | 3300030521 | Ga0307511_10000194 | Ga0307511_1000019440 | 264 |
| 319 | 3300044684 | Ga0466966_0060069 | Ga0466966_0060069_259_1098 | 264 |
| 320 | 3300044765 | Ga0466970_0062493 | Ga0466970_0062493_67_906 | 264 |
| 321 | 3300045976 | Ga0466967_0603939 | Ga0466967_0603939_38_877 | 264 |
| 322 | iso_pu_bacteria | 2643221697 | 2644539117 | 264 |
| 323 | iso_pu_bacteria | 2866612099 | 2866612606 | 264 |
| 324 | iso_pu_bacteria | 2868088558 | 2868090310 | 264 |
| 325 | iso_pu_bacteria | 2984576629 | 2984578109 | 264 |
| 326 | iso_pu_bacteria | 2990256926 | 2990257623 | 264 |
| 327 | 3300031456 | Ga0307513_10040155 | Ga0307513_100401553 | 265 |
| 328 | 3300037466 | Ga0395898_0006023 | Ga0395898_0006023_4580_5422 | 265 |
| 329 | 3300038443 | Ga0395901_0005007 | Ga0395901_0005007_8889_9731 | 265 |
| 330 | 3300042157 | Ga0439458_0051848 | Ga0439458_0051848_11_865 | 265 |
| 331 | 3300044694 | Ga0466963_0050792 | Ga0466963_0050792_368_1210 | 265 |
| 332 | 3300045836 | Ga0466958_0170159 | Ga0466958_0170159_463_1305 | 265 |
| 333 | 3300045976 | Ga0466967_0014483 | Ga0466967_0014483_1242_2084 | 265 |
| 334 | 3300046457 | Ga0495590_0000075 | Ga0495590_0000075_58191_59030 | 265 |
| 335 | 3300046472 | Ga0495580_0114658 | Ga0495580_0114658_616_1470 | 265 |
| 336 | 3300046531 | Ga0495665_0012080 | Ga0495665_0012080_3240_4094 | 265 |
| 337 | 3300046615 | Ga0495656_0069864 | Ga0495656_0069864_394_1248 | 265 |
| 338 | 3300047315 | Ga0495581_0103739 | Ga0495581_0103739_257_1111 | 265 |
| 339 | 3300047469 | Ga0495673_0092469 | Ga0495673_0092469_180_1061 | 265 |
| 340 | 3300048922 | Ga0496119_0000605 | Ga0496119_0000605_42502_43542 | 265 |
| 341 | 3300053080 | Ga0500635_0000064 | Ga0500635_0000064_13706_14617 | 265 |
| 342 | 3300053153 | Ga0500616_0000010 | Ga0500616_0000010_747459_748340 | 265 |
| 343 | iso_pu_bacteria | 2565956761 | 2566993830 | 265 |
| 344 | iso_pu_bacteria | 2582581313 | 2585310760 | 265 |
| 345 | iso_pu_bacteria | 2622736605 | 2623500618 | 265 |
| 346 | iso_pu_bacteria | 2739367654 | 2739607616 | 265 |
| 347 | iso_pu_bacteria | 2784746763 | 2785338888 | 265 |
| 348 | iso_pu_bacteria | 2808606394 | 2809026496 | 265 |
| 349 | iso_pu_bacteria | 2811994879 | 2812354923 | 265 |
| 350 | iso_pu_bacteria | 2863404153 | 2863407732 | 265 |
| 351 | iso_pu_bacteria | 2904535858 | 2904536920 | 265 |
| 352 | iso_pu_bacteria | 2922554459 | 2922555343 | 265 |
| 353 | iso_pu_bacteria | 8004212874 | 8004215425 | 265 |
| 354 | iso_pu_bacteria | 8055037949 | 8055039726 | 265 |
| 355 | 3300005339 | Ga0070660_100267364 | Ga0070660_1002673642 | 266 |
| 356 | 3300006048 | Ga0075363_100062469 | Ga0075363_1000624691 | 266 |
| 357 | 3300006051 | Ga0075364_10235609 | Ga0075364_102356092 | 266 |
| 358 | 3300006353 | Ga0075370_10074719 | Ga0075370_100747192 | 266 |
| 359 | 3300025919 | Ga0207657_10227729 | Ga0207657_102277292 | 266 |
| 360 | 3300026041 | Ga0207639_10103246 | Ga0207639_101032462 | 266 |
| 361 | 3300028794 | Ga0307515_10026558 | Ga0307515_1002655811 | 266 |
| 362 | 3300028794 | Ga0307515_10041387 | Ga0307515_100413874 | 266 |
| 363 | 3300031616 | Ga0307508_10078310 | Ga0307508_100783105 | 266 |
| 364 | 3300031616 | Ga0307508_10148644 | Ga0307508_101486442 | 266 |
| 365 | 3300031824 | Ga0307413_10286025 | Ga0307413_102860252 | 266 |
| 366 | 3300031852 | Ga0307410_10138325 | Ga0307410_101383252 | 266 |
| 367 | 3300032004 | Ga0307414_10392665 | Ga0307414_103926652 | 266 |
| 368 | 3300032005 | Ga0307411_10083770 | Ga0307411_100837703 | 266 |
| 369 | 3300044683 | Ga0466965_0105219 | Ga0466965_0105219_14_862 | 266 |
| 370 | 3300044735 | Ga0466968_0005778 | Ga0466968_0005778_174_1055 | 266 |
| 371 | 3300044901 | Ga0466960_0031329 | Ga0466960_0031329_412_1260 | 266 |
| 372 | 3300045976 | Ga0466967_0000584 | Ga0466967_0000584_13447_14289 | 266 |
| 373 | 3300045976 | Ga0466967_0289063 | Ga0466967_0289063_315_1163 | 266 |
| 374 | 3300046519 | Ga0495632_0074653 | Ga0495632_0074653_360_1211 | 266 |
| 375 | 3300046616 | Ga0495668_0000360 | Ga0495668_0000360_36116_36973 | 266 |
| 376 | 3300048928 | Ga0496125_0092225 | Ga0496125_0092225_1256_2113 | 266 |
| 377 | 3300050496 | nmdc:mga07m45_59229_c1 | nmdc:mga07m45_59229_c1_111_968 | 266 |
| 378 | 3300053140 | Ga0500573_0002950 | Ga0500573_0002950_2717_3568 | 266 |
| 379 | iso_pu_bacteria | 2758568621 | 2760623853 | 266 |
| 380 | iso_pu_bacteria | 2833709550 | 2833709695 | 266 |
| 381 | iso_pu_bacteria | 2904509784 | 2904511379 | 266 |
| 382 | iso_pu_bacteria | 2919391150 | 2919393525 | 266 |
| 383 | iso_pu_bacteria | 2939657138 | 2939659606 | 266 |
| 384 | iso_pu_bacteria | 2945956166 | 2945960523 | 266 |
| 385 | iso_pu_bacteria | 2946033335 | 2946034579 | 266 |
| 386 | iso_pu_bacteria | 2977228692 | 2977232031 | 266 |
| 387 | iso_pu_bacteria | 2977236895 | 2977237386 | 266 |
| 388 | iso_pu_bacteria | 2984542743 | 2984544829 | 266 |
| 389 | 3300006038 | Ga0075365_10346357 | Ga0075365_103463572 | 267 |
| 390 | 3300006051 | Ga0075364_10009137 | Ga0075364_100091375 | 267 |
| 391 | 3300006051 | Ga0075364_10110763 | Ga0075364_101107632 | 267 |
| 392 | 3300013308 | Ga0157375_10324619 | Ga0157375_103246191 | 267 |
| 393 | 3300026067 | Ga0207678_10628044 | Ga0207678_106280441 | 267 |
| 394 | 3300028794 | Ga0307515_10149291 | Ga0307515_101492912 | 267 |
| 395 | 3300028794 | Ga0307515_10214310 | Ga0307515_102143102 | 267 |
| 396 | 3300031456 | Ga0307513_10001658 | Ga0307513_1000165822 | 267 |
| 397 | 3300031548 | Ga0307408_100034128 | Ga0307408_1000341282 | 267 |
| 398 | 3300031824 | Ga0307413_10115553 | Ga0307413_101155532 | 267 |
| 399 | 3300031838 | Ga0307518_10000412 | Ga0307518_1000041228 | 267 |
| 400 | 3300031852 | Ga0307410_10018744 | Ga0307410_100187443 | 267 |
| 401 | 3300031901 | Ga0307406_10052440 | Ga0307406_100524404 | 267 |
| 402 | 3300031995 | Ga0307409_100006047 | Ga0307409_1000060477 | 267 |
| 403 | 3300031995 | Ga0307409_100288224 | Ga0307409_1002882242 | 267 |
| 404 | 3300032002 | Ga0307416_100225247 | Ga0307416_1002252472 | 267 |
| 405 | 3300032004 | Ga0307414_10219748 | Ga0307414_102197481 | 267 |
| 406 | 3300033179 | Ga0307507_10009303 | Ga0307507_100093035 | 267 |
| 407 | 3300044658 | Ga0466972_0057218 | Ga0466972_0057218_470_1351 | 267 |
| 408 | 3300044684 | Ga0466966_0103107 | Ga0466966_0103107_286_1164 | 267 |
| 409 | 3300044765 | Ga0466970_0036417 | Ga0466970_0036417_279_1157 | 267 |
| 410 | 3300045049 | Ga0466959_0005086 | Ga0466959_0005086_404_1282 | 267 |
| 411 | 3300046453 | Ga0495627_010387 | Ga0495627_010387_1838_2689 | 267 |
| 412 | 3300049580 | Ga0501046_0002217 | Ga0501046_0002217_1689_2564 | 267 |
| 413 | 3300049586 | Ga0501070_0048064 | Ga0501070_0048064_429_1280 | 267 |
| 414 | 3300050492 | nmdc:mga0yw44_359986_c1 | nmdc:mga0yw44_359986_c1_112_954 | 267 |
| 415 | 3300053140 | Ga0500573_0024767 | Ga0500573_0024767_1147_1989 | 267 |
| 416 | iso_pu_bacteria | 2523231044 | 2523384334 | 267 |
| 417 | iso_pu_bacteria | 2643221567 | 2643851247 | 267 |
| 418 | iso_pu_bacteria | 2643221624 | 2644138118 | 267 |
| 419 | iso_pu_bacteria | 2773857758 | 2774381890 | 267 |
| 420 | iso_pu_bacteria | 2773857763 | 2774400400 | 267 |
| 421 | iso_pu_bacteria | 2821268502 | 2821268863 | 267 |
| 422 | iso_pu_bacteria | 2844841374 | 2844843168 | 267 |
| 423 | iso_pu_bacteria | 2908678064 | 2908679902 | 267 |
| 424 | iso_pu_bacteria | 2919055335 | 2919058657 | 267 |
| 425 | iso_pu_bacteria | 2928153084 | 2928153305 | 267 |
| 426 | iso_pu_bacteria | 2977264416 | 2977267378 | 267 |
| 427 | iso_pu_bacteria | 8056579771 | 8056582505 | 267 |
| 428 | 3300006038 | Ga0075365_10000074 | Ga0075365_1000007413 | 268 |
| 429 | 3300006038 | Ga0075365_10001691 | Ga0075365_100016919 | 268 |
| 430 | 3300006051 | Ga0075364_10053696 | Ga0075364_100536962 | 268 |
| 431 | 3300006051 | Ga0075364_10182612 | Ga0075364_101826122 | 268 |
| 432 | 3300006178 | Ga0075367_10014844 | Ga0075367_100148443 | 268 |
| 433 | 3300006353 | Ga0075370_10097603 | Ga0075370_100976032 | 268 |
| 434 | 3300020082 | Ga0206353_11489331 | Ga0206353_114893312 | 268 |
| 435 | 3300028379 | Ga0268266_10363727 | Ga0268266_103637272 | 268 |
| 436 | 3300031649 | Ga0307514_10063841 | Ga0307514_100638411 | 268 |
| 437 | 3300031824 | Ga0307413_10039100 | Ga0307413_100391003 | 268 |
| 438 | 3300031911 | Ga0307412_10024159 | Ga0307412_100241593 | 268 |
| 439 | 3300031911 | Ga0307412_10057256 | Ga0307412_100572562 | 268 |
| 440 | 3300032002 | Ga0307416_100002272 | Ga0307416_1000022722 | 268 |
| 441 | 3300032002 | Ga0307416_100317519 | Ga0307416_1003175192 | 268 |
| 442 | 3300037466 | Ga0395898_0000256 | Ga0395898_0000256_46349_47254 | 268 |
| 443 | 3300044683 | Ga0466965_0024111 | Ga0466965_0024111_1544_2416 | 268 |
| 444 | 3300047443 | Ga0495687_044913 | Ga0495687_044913_68_919 | 268 |
| 445 | 3300048907 | Ga0496104_0003058 | Ga0496104_0003058_13117_13986 | 268 |
| 446 | 3300048911 | Ga0496108_0211814 | Ga0496108_0211814_519_1388 | 268 |
| 447 | 3300049586 | Ga0501070_0000524 | Ga0501070_0000524_21174_22085 | 268 |
| 448 | 3300050491 | nmdc:mga00v17_85220_c1 | nmdc:mga00v17_85220_c1_298_1152 | 268 |
| 449 | 3300050492 | nmdc:mga0yw44_30856_c1 | nmdc:mga0yw44_30856_c1_12_860 | 268 |
| 450 | 3300050496 | nmdc:mga07m45_182575_c1 | nmdc:mga07m45_182575_c1_11_880 | 268 |
| 451 | 3300050516 | nmdc:mga0sz30_1528_c1 | nmdc:mga0sz30_1528_c1_3069_3923 | 268 |
| 452 | 3300053085 | Ga0495619_0028909 | Ga0495619_0028909_228_1079 | 268 |
| 453 | 3300053096 | Ga0500641_0000256 | Ga0500641_0000256_4622_5470 | 268 |
| 454 | 3300053108 | Ga0500562_000728 | Ga0500562_000728_2359_3213 | 268 |
| 455 | 3300053117 | Ga0500593_000801 | Ga0500593_000801_2351_3205 | 268 |
| 456 | 3300053133 | Ga0500655_005387 | Ga0500655_005387_1290_2144 | 268 |
| 457 | 3300053136 | Ga0500559_0000373 | Ga0500559_0000373_826_1680 | 268 |
| 458 | 3300059477 | Ga0587084_000001 | Ga0587084_000001_13696_14544 | 268 |
| 459 | 3300059491 | Ga0587070_003876 | Ga0587070_003876_855_1703 | 268 |
| 460 | 3300059493 | Ga0587077_000012 | Ga0587077_000012_5883_6731 | 268 |
| 461 | 3300059508 | Ga0587088_000056 | Ga0587088_000056_4356_5204 | 268 |
| 462 | 3300059512 | Ga0587092_000031 | Ga0587092_000031_6078_6926 | 268 |
| 463 | 3300059513 | Ga0587094_000035 | Ga0587094_000035_4360_5208 | 268 |
| 464 | 3300059623 | Ga0587101_000017 | Ga0587101_000017_810_1658 | 268 |
| 465 | 3300059627 | Ga0587117_006144 | Ga0587117_006144_203_1051 | 268 |
| 466 | 3300059629 | Ga0587127_000551 | Ga0587127_000551_805_1653 | 268 |
| 467 | 3300059642 | Ga0587069_000061 | Ga0587069_000061_3784_4632 | 268 |
| 468 | 3300059648 | Ga0587100_000016 | Ga0587100_000016_880_1728 | 268 |
| 469 | 3300059660 | Ga0587124_000076 | Ga0587124_000076_2126_2974 | 268 |
| 470 | 3300060346 | Ga0587111_0000048 | Ga0587111_0000048_805_1653 | 268 |
| 471 | iso_pu_bacteria | 2582581312 | 2585297155 | 268 |
| 472 | iso_pu_bacteria | 2643221546 | 2643753322 | 268 |
| 473 | iso_pu_bacteria | 2643221575 | 2643888358 | 268 |
| 474 | iso_pu_bacteria | 2654587600 | 2655033417 | 268 |
| 475 | iso_pu_bacteria | 2808606306 | 2808629854 | 268 |
| 476 | iso_pu_bacteria | 2862507626 | 2862515615 | 268 |
| 477 | iso_pu_bacteria | 2897561785 | 2897562360 | 268 |
| 478 | iso_pu_bacteria | 2899359706 | 2899361575 | 268 |
| 479 | iso_pu_bacteria | 2919446982 | 2919448308 | 268 |
| 480 | iso_pu_bacteria | 2939660829 | 2939661207 | 268 |
| 481 | iso_pu_bacteria | 8004025490 | 8004025644 | 268 |
| 482 | 3300003578 | Ga0006562J51391_1209490 | Ga0006562J51391_12094903 | 269 |
| 483 | 3300003578 | Ga0006562J51391_1209491 | Ga0006562J51391_12094917 | 269 |
| 484 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011504 | 269 |
| 485 | 3300003759 | Ga0055525_1000330 | Ga0055525_100033013 | 269 |
| 486 | 3300005937 | Ga0081455_10008614 | Ga0081455_100086143 | 269 |
| 487 | 3300025225 | Ga0209566_100053 | Ga0209566_10005390 | 269 |
| 488 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011505 | 269 |
| 489 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011505 | 269 |
| 490 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011505 | 269 |
| 491 | 3300025972 | Ga0207668_10208879 | Ga0207668_102088792 | 269 |
| 492 | 3300028786 | Ga0307517_10005202 | Ga0307517_1000520210 | 269 |
| 493 | 3300028794 | Ga0307515_10000189 | Ga0307515_10000189128 | 269 |
| 494 | 3300030521 | Ga0307511_10000824 | Ga0307511_100008249 | 269 |
| 495 | 3300030521 | Ga0307511_10075469 | Ga0307511_100754693 | 269 |
| 496 | 3300030522 | Ga0307512_10151248 | Ga0307512_101512482 | 269 |
| 497 | 3300031507 | Ga0307509_10025555 | Ga0307509_100255554 | 269 |
| 498 | 3300031507 | Ga0307509_10061064 | Ga0307509_100610643 | 269 |
| 499 | 3300031507 | Ga0307509_10103294 | Ga0307509_101032943 | 269 |
| 500 | 3300031616 | Ga0307508_10061681 | Ga0307508_100616812 | 269 |
| 501 | 3300031616 | Ga0307508_10100940 | Ga0307508_101009402 | 269 |
| 502 | 3300031730 | Ga0307516_10045235 | Ga0307516_100452352 | 269 |
| 503 | 3300031838 | Ga0307518_10175499 | Ga0307518_101754991 | 269 |
| 504 | 3300031995 | Ga0307409_100327823 | Ga0307409_1003278232 | 269 |
| 505 | 3300032004 | Ga0307414_10066312 | Ga0307414_100663122 | 269 |
| 506 | 3300033179 | Ga0307507_10023801 | Ga0307507_100238012 | 269 |
| 507 | 3300033179 | Ga0307507_10057799 | Ga0307507_100577992 | 269 |
| 508 | 3300033180 | Ga0307510_10033562 | Ga0307510_100335625 | 269 |
| 509 | 3300033180 | Ga0307510_10103362 | Ga0307510_101033622 | 269 |
| 510 | 3300037312 | Ga0395899_0011272 | Ga0395899_0011272_1729_2598 | 269 |
| 511 | 3300037312 | Ga0395899_0020111 | Ga0395899_0020111_2213_3082 | 269 |
| 512 | 3300037466 | Ga0395898_0003736 | Ga0395898_0003736_14047_14916 | 269 |
| 513 | 3300037466 | Ga0395898_0076921 | Ga0395898_0076921_1803_2672 | 269 |
| 514 | 3300037466 | Ga0395898_0232569 | Ga0395898_0232569_22_903 | 269 |
| 515 | 3300037471 | Ga0395905_0445427 | Ga0395905_0445427_244_1113 | 269 |
| 516 | 3300038443 | Ga0395901_0001692 | Ga0395901_0001692_8714_9583 | 269 |
| 517 | 3300038443 | Ga0395901_0095473 | Ga0395901_0095473_1751_2632 | 269 |
| 518 | 3300038443 | Ga0395901_0382965 | Ga0395901_0382965_376_1245 | 269 |
| 519 | 3300038443 | Ga0395901_0412286 | Ga0395901_0412286_122_1036 | 269 |
| 520 | 3300041404 | Ga0439436_0020261 | Ga0439436_0020261_1073_1927 | 269 |
| 521 | 3300041999 | Ga0439433_0007739 | Ga0439433_0007739_203_1057 | 269 |
| 522 | 3300042007 | Ga0439449_0035166 | Ga0439449_0035166_815_1669 | 269 |
| 523 | 3300042014 | Ga0439457_002025 | Ga0439457_002025_4339_5193 | 269 |
| 524 | 3300044656 | Ga0466969_0152838 | Ga0466969_0152838_101_970 | 269 |
| 525 | 3300044693 | Ga0466961_0105952 | Ga0466961_0105952_241_1110 | 269 |
| 526 | 3300046506 | Ga0495583_0022213 | Ga0495583_0022213_470_1345 | 269 |
| 527 | 3300046515 | Ga0495620_0001179 | Ga0495620_0001179_4642_5517 | 269 |
| 528 | 3300046531 | Ga0495665_0037615 | Ga0495665_0037615_1011_1898 | 269 |
| 529 | 3300046533 | Ga0495640_0024818 | Ga0495640_0024818_711_1586 | 269 |
| 530 | 3300046535 | Ga0495586_0038016 | Ga0495586_0038016_382_1269 | 269 |
| 531 | 3300046542 | Ga0495597_0023607 | Ga0495597_0023607_1032_1907 | 269 |
| 532 | 3300046559 | Ga0495667_0200542 | Ga0495667_0200542_307_1182 | 269 |
| 533 | 3300046648 | Ga0495611_0095848 | Ga0495611_0095848_187_1062 | 269 |
| 534 | 3300046675 | Ga0495657_0041189 | Ga0495657_0041189_1481_2356 | 269 |
| 535 | 3300046809 | Ga0495600_0045170 | Ga0495600_0045170_66_941 | 269 |
| 536 | 3300047315 | Ga0495581_0004793 | Ga0495581_0004793_1656_2543 | 269 |
| 537 | 3300047315 | Ga0495581_0011256 | Ga0495581_0011256_3487_4365 | 269 |
| 538 | 3300047315 | Ga0495581_0072907 | Ga0495581_0072907_420_1310 | 269 |
| 539 | 3300047317 | Ga0495604_0029703 | Ga0495604_0029703_1178_2053 | 269 |
| 540 | 3300047323 | Ga0495683_0032612 | Ga0495683_0032612_902_1777 | 269 |
| 541 | 3300047443 | Ga0495687_012184 | Ga0495687_012184_3374_4249 | 269 |
| 542 | 3300047443 | Ga0495687_080310 | Ga0495687_080310_223_1098 | 269 |
| 543 | 3300047673 | Ga0495593_0049420 | Ga0495593_0049420_1100_1975 | 269 |
| 544 | 3300048919 | Ga0496116_0109688 | Ga0496116_0109688_29_916 | 269 |
| 545 | 3300048920 | Ga0496117_0008044 | Ga0496117_0008044_6351_7238 | 269 |
| 546 | 3300048920 | Ga0496117_0070251 | Ga0496117_0070251_330_1217 | 269 |
| 547 | 3300048921 | Ga0496118_0037908 | Ga0496118_0037908_892_1779 | 269 |
| 548 | 3300048925 | Ga0496122_0029005 | Ga0496122_0029005_2783_3661 | 269 |
| 549 | 3300048928 | Ga0496125_0027233 | Ga0496125_0027233_1914_2792 | 269 |
| 550 | 3300048929 | Ga0496126_0150392 | Ga0496126_0150392_987_1865 | 269 |
| 551 | 3300049570 | Ga0501033_0000422 | Ga0501033_0000422_5893_6777 | 269 |
| 552 | 3300049570 | Ga0501033_0266013 | Ga0501033_0266013_103_954 | 269 |
| 553 | iso_pu_bacteria | 2537561592 | 2537899229 | 269 |
| 554 | iso_pu_bacteria | 2616644814 | 2616696124 | 269 |
| 555 | iso_pu_bacteria | 2643221597 | 2643995000 | 269 |
| 556 | iso_pu_bacteria | 2739367653 | 2739603329 | 269 |
| 557 | iso_pu_bacteria | 2816332305 | 2817508119 | 269 |
| 558 | iso_pu_bacteria | 2857479173 | 2857479192 | 269 |
| 559 | iso_pu_bacteria | 2857632687 | 2857632804 | 269 |
| 560 | iso_pu_bacteria | 2857723135 | 2857727161 | 269 |
| 561 | iso_pu_bacteria | 2857727296 | 2857727405 | 269 |
| 562 | iso_pu_bacteria | 2870804320 | 2870806006 | 269 |
| 563 | iso_pu_bacteria | 2910809715 | 2910814430 | 269 |
| 564 | iso_pu_bacteria | 2919034639 | 2919038221 | 269 |
| 565 | iso_pu_bacteria | 2919051321 | 2919053513 | 269 |
| 566 | iso_pu_bacteria | 2919069694 | 2919072829 | 269 |
| 567 | iso_pu_bacteria | 2919538618 | 2919541155 | 269 |
| 568 | iso_pu_bacteria | 2932426870 | 2932427298 | 269 |
| 569 | iso_pu_bacteria | 2939582691 | 2939582743 | 269 |
| 570 | iso_pu_bacteria | 2939674588 | 2939676851 | 269 |
| 571 | 3300003578 | Ga0006562J51391_1111915 | Ga0006562J51391_111191515 | 270 |
| 572 | 3300003578 | Ga0006562J51391_1111917 | Ga0006562J51391_11119178 | 270 |
| 573 | 3300005985 | Ga0081539_10006285 | Ga0081539_100062857 | 270 |
| 574 | 3300031548 | Ga0307408_100157919 | Ga0307408_1001579192 | 270 |
| 575 | 3300031852 | Ga0307410_10021437 | Ga0307410_100214372 | 270 |
| 576 | 3300031852 | Ga0307410_10369755 | Ga0307410_103697552 | 270 |
| 577 | 3300031903 | Ga0307407_10267718 | Ga0307407_102677182 | 270 |
| 578 | 3300032002 | Ga0307416_100456828 | Ga0307416_1004568282 | 270 |
| 579 | 3300045049 | Ga0466959_0274148 | Ga0466959_0274148_252_1112 | 270 |
| 580 | 3300046472 | Ga0495580_0030566 | Ga0495580_0030566_1585_2448 | 270 |
| 581 | 3300048905 | Ga0496102_0237422 | Ga0496102_0237422_692_1555 | 270 |
| 582 | 3300048906 | Ga0496103_0250639 | Ga0496103_0250639_145_1008 | 270 |
| 583 | 3300048916 | Ga0496113_0495337 | Ga0496113_0495337_24_887 | 270 |
| 584 | 3300048925 | Ga0496122_0011187 | Ga0496122_0011187_1881_2783 | 270 |
| 585 | 3300048926 | Ga0496123_0005519 | Ga0496123_0005519_4446_5348 | 270 |
| 586 | 3300049569 | Ga0501032_0021647 | Ga0501032_0021647_39_902 | 270 |
| 587 | 3300049570 | Ga0501033_0004260 | Ga0501033_0004260_4198_5052 | 270 |
| 588 | 3300049570 | Ga0501033_0019120 | Ga0501033_0019120_2614_3468 | 270 |
| 589 | 3300049570 | Ga0501033_0118334 | Ga0501033_0118334_445_1299 | 270 |
| 590 | 3300049571 | Ga0501034_0000042 | Ga0501034_0000042_165059_165922 | 270 |
| 591 | 3300049571 | Ga0501034_0010152 | Ga0501034_0010152_6630_7484 | 270 |
| 592 | 3300049572 | Ga0501036_0007959 | Ga0501036_0007959_6102_6956 | 270 |
| 593 | 3300049572 | Ga0501036_0055755 | Ga0501036_0055755_1566_2420 | 270 |
| 594 | 3300049572 | Ga0501036_0071418 | Ga0501036_0071418_224_1078 | 270 |
| 595 | 3300049573 | Ga0501037_0011416 | Ga0501037_0011416_1474_2328 | 270 |
| 596 | 3300049573 | Ga0501037_0023217 | Ga0501037_0023217_1800_2654 | 270 |
| 597 | 3300049573 | Ga0501037_0153546 | Ga0501037_0153546_542_1396 | 270 |
| 598 | 3300049574 | Ga0501038_0008985 | Ga0501038_0008985_3327_4181 | 270 |
| 599 | 3300049575 | Ga0501039_0016214 | Ga0501039_0016214_2013_2867 | 270 |
| 600 | 3300049578 | Ga0501042_0026205 | Ga0501042_0026205_819_1673 | 270 |
| 601 | 3300049579 | Ga0501043_0004371 | Ga0501043_0004371_5314_6168 | 270 |
| 602 | 3300049580 | Ga0501046_0002191 | Ga0501046_0002191_11562_12416 | 270 |
| 603 | 3300049580 | Ga0501046_0093917 | Ga0501046_0093917_584_1438 | 270 |
| 604 | 3300049581 | Ga0501047_0036556 | Ga0501047_0036556_347_1201 | 270 |
| 605 | 3300049581 | Ga0501047_0044973 | Ga0501047_0044973_1931_2785 | 270 |
| 606 | 3300049581 | Ga0501047_0049528 | Ga0501047_0049528_1483_2337 | 270 |
| 607 | 3300049581 | Ga0501047_0055264 | Ga0501047_0055264_1220_2074 | 270 |
| 608 | 3300049582 | Ga0501048_0009404 | Ga0501048_0009404_1483_2337 | 270 |
| 609 | 3300049586 | Ga0501070_0230528 | Ga0501070_0230528_523_1377 | 270 |
| 610 | 3300049586 | Ga0501070_0298765 | Ga0501070_0298765_264_1118 | 270 |
| 611 | 3300049589 | Ga0501073_0020944 | Ga0501073_0020944_538_1392 | 270 |
| 612 | 3300049590 | Ga0501074_0016706 | Ga0501074_0016706_3799_4653 | 270 |
| 613 | 3300049742 | Ga0501080_0076432 | Ga0501080_0076432_326_1180 | 270 |
| 614 | 3300049742 | Ga0501080_0096254 | Ga0501080_0096254_1496_2350 | 270 |
| 615 | 3300049822 | Ga0501035_0011940 | Ga0501035_0011940_1425_2279 | 270 |
| 616 | 3300049822 | Ga0501035_0013921 | Ga0501035_0013921_1654_2508 | 270 |
| 617 | 3300049822 | Ga0501035_0031423 | Ga0501035_0031423_2504_3358 | 270 |
| 618 | 3300049823 | Ga0501044_0032155 | Ga0501044_0032155_3419_4273 | 270 |
| 619 | 3300049823 | Ga0501044_0035611 | Ga0501044_0035611_4198_5052 | 270 |
| 620 | 3300049823 | Ga0501044_0052806 | Ga0501044_0052806_1483_2337 | 270 |
| 621 | 3300049823 | Ga0501044_0106641 | Ga0501044_0106641_477_1331 | 270 |
| 622 | 3300049824 | Ga0501045_0084610 | Ga0501045_0084610_647_1501 | 270 |
| 623 | 3300053083 | Ga0495655_0001072 | Ga0495655_0001072_1302_2165 | 270 |
| 624 | 3300053730 | Ga0500645_010320 | Ga0500645_010320_1624_2508 | 270 |
| 625 | iso_pu_bacteria | 2585428157 | 2588109082 | 270 |
| 626 | iso_pu_bacteria | 2643221724 | 2644679333 | 270 |
| 627 | iso_pu_bacteria | 2728369380 | 2730228852 | 270 |
| 628 | iso_pu_bacteria | 2857737099 | 2857739644 | 270 |
| 629 | iso_pu_bacteria | 2920879853 | 2920881380 | 270 |
| 630 | iso_pu_bacteria | 2928142448 | 2928146591 | 270 |
| 631 | iso_pu_bacteria | 8004182704 | 8004183679 | 270 |
| 632 | iso_pu_bacteria | 8057345674 | 8057346269 | 270 |
| 633 | 3300003762 | Ga0055542_1000427 | Ga0055542_100042728 | 271 |
| 634 | 3300003763 | Ga0055529_1000571 | Ga0055529_100057116 | 271 |
| 635 | 3300005327 | Ga0070658_10105547 | Ga0070658_101055472 | 271 |
| 636 | 3300005347 | Ga0070668_100000560 | Ga0070668_1000005608 | 271 |
| 637 | 3300005347 | Ga0070668_100044032 | Ga0070668_1000440325 | 271 |
| 638 | 3300005530 | Ga0070679_100158901 | Ga0070679_1001589012 | 271 |
| 639 | 3300005548 | Ga0070665_100115555 | Ga0070665_1001155554 | 271 |
| 640 | 3300005618 | Ga0068864_100210238 | Ga0068864_1002102382 | 271 |
| 641 | 3300005842 | Ga0068858_100011201 | Ga0068858_1000112016 | 271 |
| 642 | 3300005843 | Ga0068860_100168878 | Ga0068860_1001688783 | 271 |
| 643 | 3300005983 | Ga0081540_1010901 | Ga0081540_10109014 | 271 |
| 644 | 3300009094 | Ga0111539_10258735 | Ga0111539_102587352 | 271 |
| 645 | 3300009098 | Ga0105245_10502714 | Ga0105245_105027142 | 271 |
| 646 | 3300009148 | Ga0105243_10060287 | Ga0105243_100602872 | 271 |
| 647 | 3300009553 | Ga0105249_10155161 | Ga0105249_101551612 | 271 |
| 648 | 3300013105 | Ga0157369_10143141 | Ga0157369_101431413 | 271 |
| 649 | 3300014326 | Ga0157380_10006897 | Ga0157380_100068975 | 271 |
| 650 | 3300014326 | Ga0157380_10467656 | Ga0157380_104676562 | 271 |
| 651 | 3300014968 | Ga0157379_10597026 | Ga0157379_105970262 | 271 |
| 652 | 3300017792 | Ga0163161_10319712 | Ga0163161_103197122 | 271 |
| 653 | 3300020070 | Ga0206356_10506699 | Ga0206356_105066992 | 271 |
| 654 | 3300020081 | Ga0206354_10181118 | Ga0206354_101811183 | 271 |
| 655 | 3300020082 | Ga0206353_10162159 | Ga0206353_101621595 | 271 |
| 656 | 3300025228 | Ga0209672_100039 | Ga0209672_100039268 | 271 |
| 657 | 3300025229 | Ga0209147_102885 | Ga0209147_1028853 | 271 |
| 658 | 3300025253 | Ga0209677_100378 | Ga0209677_10037826 | 271 |
| 659 | 3300025254 | Ga0209148_1000004 | Ga0209148_1000004268 | 271 |
| 660 | 3300025272 | Ga0209455_1000377 | Ga0209455_100037729 | 271 |
| 661 | 3300025901 | Ga0207688_10012150 | Ga0207688_100121502 | 271 |
| 662 | 3300025908 | Ga0207643_10053036 | Ga0207643_100530362 | 271 |
| 663 | 3300025909 | Ga0207705_10076475 | Ga0207705_100764752 | 271 |
| 664 | 3300025921 | Ga0207652_10136467 | Ga0207652_101364672 | 271 |
| 665 | 3300025923 | Ga0207681_10103573 | Ga0207681_101035732 | 271 |
| 666 | 3300025935 | Ga0207709_10022715 | Ga0207709_100227152 | 271 |
| 667 | 3300025961 | Ga0207712_10239305 | Ga0207712_102393052 | 271 |
| 668 | 3300025972 | Ga0207668_10000481 | Ga0207668_100004818 | 271 |
| 669 | 3300026095 | Ga0207676_10118215 | Ga0207676_101182152 | 271 |
| 670 | 3300026116 | Ga0207674_10221300 | Ga0207674_102213002 | 271 |
| 671 | 3300026118 | Ga0207675_100095849 | Ga0207675_1000958492 | 271 |
| 672 | 3300026121 | Ga0207683_10114464 | Ga0207683_101144642 | 271 |
| 673 | 3300028379 | Ga0268266_10161904 | Ga0268266_101619043 | 271 |
| 674 | 3300028380 | Ga0268265_10036705 | Ga0268265_100367054 | 271 |
| 675 | 3300028380 | Ga0268265_10161472 | Ga0268265_101614722 | 271 |
| 676 | 3300031507 | Ga0307509_10022228 | Ga0307509_100222283 | 271 |
| 677 | 3300031616 | Ga0307508_10003658 | Ga0307508_1000365817 | 271 |
| 678 | 3300031852 | Ga0307410_10138062 | Ga0307410_101380622 | 271 |
| 679 | 3300031901 | Ga0307406_10072553 | Ga0307406_100725532 | 271 |
| 680 | 3300031901 | Ga0307406_10137549 | Ga0307406_101375492 | 271 |
| 681 | 3300031911 | Ga0307412_10392120 | Ga0307412_103921202 | 271 |
| 682 | 3300033179 | Ga0307507_10165311 | Ga0307507_101653111 | 271 |
| 683 | 3300034957 | Ga0373938_0011954 | Ga0373938_0011954_56_919 | 271 |
| 684 | 3300035088 | Ga0373940_0001334 | Ga0373940_0001334_300_1163 | 271 |
| 685 | 3300035207 | Ga0373942_0001388 | Ga0373942_0001388_4034_4897 | 271 |
| 686 | 3300037312 | Ga0395899_0050283 | Ga0395899_0050283_1901_2869 | 271 |
| 687 | 3300037418 | Ga0395900_0088650 | Ga0395900_0088650_663_1631 | 271 |
| 688 | 3300037418 | Ga0395900_0116325 | Ga0395900_0116325_767_1627 | 271 |
| 689 | 3300037466 | Ga0395898_0009444 | Ga0395898_0009444_7669_8559 | 271 |
| 690 | 3300044658 | Ga0466972_0023059 | Ga0466972_0023059_2103_2963 | 271 |
| 691 | 3300044901 | Ga0466960_0044342 | Ga0466960_0044342_1199_2059 | 271 |
| 692 | 3300047315 | Ga0495581_0113894 | Ga0495581_0113894_398_1294 | 271 |
| 693 | 3300048906 | Ga0496103_0031930 | Ga0496103_0031930_436_1356 | 271 |
| 694 | 3300048908 | Ga0496105_0046766 | Ga0496105_0046766_811_1731 | 271 |
| 695 | 3300048911 | Ga0496108_0000100 | Ga0496108_0000100_52923_53813 | 271 |
| 696 | 3300048917 | Ga0496114_0155028 | Ga0496114_0155028_956_1876 | 271 |
| 697 | 3300048918 | Ga0496115_0354322 | Ga0496115_0354322_148_1068 | 271 |
| 698 | 3300048920 | Ga0496117_0000394 | Ga0496117_0000394_2686_3543 | 271 |
| 699 | 3300048921 | Ga0496118_0084493 | Ga0496118_0084493_1148_2005 | 271 |
| 700 | 3300048925 | Ga0496122_0033605 | Ga0496122_0033605_2104_2961 | 271 |
| 701 | 3300048928 | Ga0496125_0012426 | Ga0496125_0012426_2811_3668 | 271 |
| 702 | 3300048928 | Ga0496125_0130172 | Ga0496125_0130172_711_1568 | 271 |
| 703 | 3300048929 | Ga0496126_0016360 | Ga0496126_0016360_2012_2869 | 271 |
| 704 | 3300048929 | Ga0496126_0175586 | Ga0496126_0175586_176_1096 | 271 |
| 705 | 3300049571 | Ga0501034_0012846 | Ga0501034_0012846_3146_4042 | 271 |
| 706 | 3300049575 | Ga0501039_0422712 | Ga0501039_0422712_95_1015 | 271 |
| 707 | 3300050491 | nmdc:mga00v17_144910_c1 | nmdc:mga00v17_144910_c1_414_1280 | 271 |
| 708 | iso_pu_bacteria | 2643221542 | 2643734962 | 271 |
| 709 | iso_pu_bacteria | 2643221549 | 2643768978 | 271 |
| 710 | iso_pu_bacteria | 2643221553 | 2643783427 | 271 |
| 711 | iso_pu_bacteria | 2643221619 | 2644112404 | 271 |
| 712 | iso_pu_bacteria | 2643221630 | 2644173122 | 271 |
| 713 | iso_pu_bacteria | 2747842429 | 2747954324 | 271 |
| 714 | iso_pu_bacteria | 2751185782 | 2753263784 | 271 |
| 715 | iso_pu_bacteria | 2808606372 | 2808900546 | 271 |
| 716 | iso_pu_bacteria | 2852632344 | 2852633855 | 271 |
| 717 | iso_pu_bacteria | 2870801768 | 2870804147 | 271 |
| 718 | iso_pu_bacteria | 2919443155 | 2919445129 | 271 |
| 719 | iso_pu_bacteria | 2935409751 | 2935411671 | 271 |
| 720 | iso_pu_bacteria | 2946041624 | 2946043353 | 271 |
| 721 | iso_pu_bacteria | 2946080515 | 2946081700 | 271 |
| 722 | 3300005329 | Ga0070683_100331821 | Ga0070683_1003318212 | 272 |
| 723 | 3300028794 | Ga0307515_10000436 | Ga0307515_1000043688 | 272 |
| 724 | 3300031730 | Ga0307516_10005460 | Ga0307516_1000546014 | 272 |
| 725 | 3300031901 | Ga0307406_10001204 | Ga0307406_100012043 | 272 |
| 726 | 3300046615 | Ga0495656_0020545 | Ga0495656_0020545_321_1181 | 272 |
| 727 | 3300046615 | Ga0495656_0125319 | Ga0495656_0125319_75_935 | 272 |
| 728 | 3300048925 | Ga0496122_0072498 | Ga0496122_0072498_1178_2065 | 272 |
| 729 | iso_pu_bacteria | 2643221649 | 2644279684 | 272 |
| 730 | iso_pu_bacteria | 2802429296 | 2804847151 | 272 |
| 731 | iso_pu_bacteria | 8025413630 | 8025414379 | 272 |
| 732 | iso_pu_bacteria | 8055172936 | 8055181567 | 272 |
| 733 | 3300005327 | Ga0070658_10009760 | Ga0070658_100097603 | 273 |
| 734 | 3300005338 | Ga0068868_100268046 | Ga0068868_1002680462 | 273 |
| 735 | 3300005563 | Ga0068855_100167483 | Ga0068855_1001674832 | 273 |
| 736 | 3300005577 | Ga0068857_100001028 | Ga0068857_1000010286 | 273 |
| 737 | 3300005577 | Ga0068857_100049400 | Ga0068857_1000494002 | 273 |
| 738 | 3300005614 | Ga0068856_100193332 | Ga0068856_1001933322 | 273 |
| 739 | 3300005616 | Ga0068852_100003952 | Ga0068852_1000039522 | 273 |
| 740 | 3300005616 | Ga0068852_100012604 | Ga0068852_1000126047 | 273 |
| 741 | 3300005834 | Ga0068851_10000008 | Ga0068851_10000008171 | 273 |
| 742 | 3300005842 | Ga0068858_100000096 | Ga0068858_10000009622 | 273 |
| 743 | 3300009093 | Ga0105240_10424377 | Ga0105240_104243772 | 273 |
| 744 | 3300009098 | Ga0105245_10071744 | Ga0105245_100717443 | 273 |
| 745 | 3300009174 | Ga0105241_10006075 | Ga0105241_100060758 | 273 |
| 746 | 3300009177 | Ga0105248_10036889 | Ga0105248_100368895 | 273 |
| 747 | 3300009545 | Ga0105237_10000688 | Ga0105237_1000068827 | 273 |
| 748 | 3300009551 | Ga0105238_10006959 | Ga0105238_100069592 | 273 |
| 749 | 3300010375 | Ga0105239_10113586 | Ga0105239_101135862 | 273 |
| 750 | 3300010375 | Ga0105239_10190119 | Ga0105239_101901192 | 273 |
| 751 | 3300014969 | Ga0157376_10656637 | Ga0157376_106566372 | 273 |
| 752 | 3300025254 | Ga0209148_1002409 | Ga0209148_10024094 | 273 |
| 753 | 3300025321 | Ga0207656_10000005 | Ga0207656_10000005172 | 273 |
| 754 | 3300025911 | Ga0207654_10000001 | Ga0207654_10000001714 | 273 |
| 755 | 3300025914 | Ga0207671_10000016 | Ga0207671_10000016288 | 273 |
| 756 | 3300025924 | Ga0207694_10000196 | Ga0207694_1000019647 | 273 |
| 757 | 3300025927 | Ga0207687_10042745 | Ga0207687_100427453 | 273 |
| 758 | 3300025941 | Ga0207711_10135194 | Ga0207711_101351942 | 273 |
| 759 | 3300026023 | Ga0207677_10245924 | Ga0207677_102459242 | 273 |
| 760 | 3300026035 | Ga0207703_10001625 | Ga0207703_1000162522 | 273 |
| 761 | 3300026078 | Ga0207702_10054536 | Ga0207702_100545362 | 273 |
| 762 | 3300026078 | Ga0207702_10182105 | Ga0207702_101821051 | 273 |
| 763 | 3300026116 | Ga0207674_10000405 | Ga0207674_1000040535 | 273 |
| 764 | 3300026142 | Ga0207698_10000078 | Ga0207698_1000007850 | 273 |
| 765 | 3300026142 | Ga0207698_10002196 | Ga0207698_1000219610 | 273 |
| 766 | 3300048923 | Ga0496120_0002952 | Ga0496120_0002952_288_1151 | 273 |
| 767 | 3300048925 | Ga0496122_0091889 | Ga0496122_0091889_384_1256 | 273 |
| 768 | 3300049571 | Ga0501034_0036310 | Ga0501034_0036310_1664_2542 | 273 |
| 769 | 3300049579 | Ga0501043_0147350 | Ga0501043_0147350_57_935 | 273 |
| 770 | 3300049586 | Ga0501070_0003400 | Ga0501070_0003400_8312_9190 | 273 |
| 771 | 3300049587 | Ga0501071_0008372 | Ga0501071_0008372_3718_4596 | 273 |
| 772 | iso_pu_bacteria | 2643221572 | 2643877045 | 273 |
| 773 | iso_pu_bacteria | 2643221669 | 2644384100 | 273 |
| 774 | 3300005329 | Ga0070683_100274017 | Ga0070683_1002740172 | 274 |
| 775 | 3300005338 | Ga0068868_100096268 | Ga0068868_1000962682 | 274 |
| 776 | 3300005339 | Ga0070660_100054836 | Ga0070660_1000548363 | 274 |
| 777 | 3300005366 | Ga0070659_100000749 | Ga0070659_10000074912 | 274 |
| 778 | 3300005367 | Ga0070667_100049296 | Ga0070667_1000492963 | 274 |
| 779 | 3300005466 | Ga0070685_10033968 | Ga0070685_100339683 | 274 |
| 780 | 3300005539 | Ga0068853_100001645 | Ga0068853_10000164515 | 274 |
| 781 | 3300005543 | Ga0070672_100202532 | Ga0070672_1002025322 | 274 |
| 782 | 3300005616 | Ga0068852_100151450 | Ga0068852_1001514502 | 274 |
| 783 | 3300005841 | Ga0068863_100057676 | Ga0068863_1000576762 | 274 |
| 784 | 3300006038 | Ga0075365_10095488 | Ga0075365_100954882 | 274 |
| 785 | 3300009177 | Ga0105248_10000713 | Ga0105248_1000071326 | 274 |
| 786 | 3300009551 | Ga0105238_10055894 | Ga0105238_100558944 | 274 |
| 787 | 3300014325 | Ga0163163_10149343 | Ga0163163_101493432 | 274 |
| 788 | 3300014968 | Ga0157379_10042903 | Ga0157379_100429032 | 274 |
| 789 | 3300025913 | Ga0207695_10009355 | Ga0207695_100093554 | 274 |
| 790 | 3300025919 | Ga0207657_10023164 | Ga0207657_100231642 | 274 |
| 791 | 3300025921 | Ga0207652_10342280 | Ga0207652_103422802 | 274 |
| 792 | 3300025932 | Ga0207690_10002298 | Ga0207690_100022988 | 274 |
| 793 | 3300025940 | Ga0207691_10268967 | Ga0207691_102689672 | 274 |
| 794 | 3300025944 | Ga0207661_10194858 | Ga0207661_101948582 | 274 |
| 795 | 3300025949 | Ga0207667_10001482 | Ga0207667_1000148221 | 274 |
| 796 | 3300026023 | Ga0207677_10029357 | Ga0207677_100293572 | 274 |
| 797 | 3300026041 | Ga0207639_10040609 | Ga0207639_100406092 | 274 |
| 798 | 3300026088 | Ga0207641_10010811 | Ga0207641_100108115 | 274 |
| 799 | 3300048923 | Ga0496120_0047737 | Ga0496120_0047737_1560_2441 | 274 |
| 800 | 3300050492 | nmdc:mga0yw44_46195_c1 | nmdc:mga0yw44_46195_c1_30_896 | 274 |
| 801 | 3300050516 | nmdc:mga0sz30_26287_c1 | nmdc:mga0sz30_26287_c1_156_1022 | 274 |
| 802 | 3300053080 | Ga0500635_0036677 | Ga0500635_0036677_257_1138 | 274 |
| 803 | 3300053136 | Ga0500559_0007855 | Ga0500559_0007855_3567_4433 | 274 |
| 804 | 3300053140 | Ga0500573_0187854 | Ga0500573_0187854_118_1014 | 274 |
| 805 | iso_pu_bacteria | 2808606700 | 2810362858 | 274 |
| 806 | iso_pu_bacteria | 2895660088 | 2895662173 | 274 |
| 807 | iso_pu_bacteria | 2852663356 | 2852665727 | 275 |
| 808 | iso_pu_bacteria | 2946003308 | 2946005808 | 275 |
| 809 | iso_pu_bacteria | 2643221616 | 2644096630 | 277 |
| 810 | 3300002772 | JGI25164J39214_1000649 | JGI25164J39214_10006498 | 278 |
| 811 | 3300003214 | JGI25165J46597_1000174 | JGI25165J46597_100017416 | 278 |
| 812 | 3300025231 | Ga0207427_100010 | Ga0207427_100010595 | 278 |
| 813 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011354 | 278 |
| 814 | iso_pu_bacteria | 2884763398 | 2884766153 | 278 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lkd-assembly1.cif.gz_A | in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor | 0.9448 | 6 | 35 |
| 6aa8-assembly1.cif.gz_F | crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ | 0.9437 | 7 | 268 |
| 3hdh-assembly1.cif.gz_B | pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination | 0.9435 | 4 | 268 |
| 4r1n-assembly1.cif.gz_A | crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum. | 0.9423 | 6 | 268 |
| 6hrd-assembly2.cif.gz_D | crystal structure of m. tuberculosis fadb2 (rv0468) | 0.9421 | 4 | 268 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hrdD02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9881 | 181 | 264 | 1.10.1040.10 |
| 4kueA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9831 | 181 | 264 | 1.10.1040.10 |
| 4kueB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9825 | 181 | 264 | 1.10.1040.10 |
| 6acqA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9824 | 181 | 264 | 1.10.1040.10 |
| 4kuhF02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9823 | 181 | 264 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537GWX2-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9896 | 120 | 268 |
GO:0006631
GO:0016616 GO:0070403 |
| AF-A0A7Y2M4B1-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase family protein | 0.9847 | 2 | 270 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
| AF-A0A7W0XUR0-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase family protein | 0.9838 | 117 | 268 |
GO:0006631
GO:0009056 GO:0016616 GO:0070403 |
| AF-A0A537GIM5-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9829 | 103 | 268 |
GO:0006631
GO:0016616 GO:0070403 |
| AF-A0A7V2TWC1-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase | 0.9828 | 118 | 268 |
GO:0006635
GO:0008691 GO:0070403 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar