F482002

General Info

Members Datasets Scaffolds Average Seq Length
814 452 696 281

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2946041624|2946043353
Length 324
Sequence SESEPTSTQETSVSSRRSASRSTTGTEEIHGSLSETKRREPMAPAQVGVLGGGRMGAGIAHAFLLAGSRVSVVERDDESAAAAAHRVGDSIRRSVERDGGLDETEIRSRLDTGTDATAFGECDLVIEAVPEERTLKETALSRAEAAMPAYAILASNTSSISIDDLASRRLRPERFLGLHFFNPVPASALVEVVQGSATSPDVIDSARVWVSALGKTPIVVRDSPGFASSRLGVMLGLEAIRMLEDGVASAADIDAAMTLGYRHPTGPLRTTDIVGLDVRLGIAEELERAFGERFAPPELLRRMVAEGKLGRKSGQGFYEWNEER

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
10 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
11 2643221546 Microbacterium sp. Root53 Isolate Unclassified
12 2643221549 Agromyces sp. Root1464 Isolate Unclassified
13 2643221553 Microbacterium sp. Root553 Isolate Unclassified
14 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
15 2643221572 Leifsonia sp. Root60 Isolate Unclassified
16 2643221575 Microbacterium sp. Root61 Isolate Unclassified
17 2643221576 Nocardioides sp. Root614 Isolate Unclassified
18 2643221590 Nocardioides sp. Root682 Isolate Unclassified
19 2643221597 Microbacterium sp. Root180 Isolate Unclassified
20 2643221604 Nocardioides sp. Root190 Isolate Unclassified
21 2643221616 Leifsonia sp. Root227 Isolate Unclassified
22 2643221617 Nocardioides sp. Root79 Isolate Unclassified
23 2643221619 Agromyces sp. Root81 Isolate Unclassified
24 2643221620 Nocardioides sp. Root240 Isolate Unclassified
25 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
26 2643221630 Microbacterium sp. Root322 Isolate Unclassified
27 2643221649 Leifsonia sp. Root4 Isolate Unclassified
28 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
29 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
30 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
31 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
32 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
33 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
34 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
35 2739367653 Kocuria sp. OV113 Isolate Unclassified
36 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
37 2739367898 Nocardioides sp. CF479 Isolate Unclassified
38 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
39 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
40 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
41 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
42 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
43 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
44 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
45 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
46 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
47 2808606372 Agromyces sp. 23-23 Isolate Unclassified
48 2808606394 Promicromonospora sp. C35 Isolate Unclassified
49 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
50 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
51 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
52 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
53 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
54 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
55 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
56 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
57 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
58 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
59 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
60 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
61 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
62 2857727296 Kocuria sp. R-72562 Isolate Unclassified
63 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
64 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
65 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
66 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
67 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
68 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
69 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
70 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
71 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
72 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
73 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
74 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
75 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
76 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
77 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
78 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
79 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
80 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
81 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
82 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
83 2919069694 Microbacterium sp. 1154 Isolate Unclassified
84 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
85 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
86 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
87 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
88 2920879853 Kocuria salina CV6 Isolate Unclassified
89 2922554459 Rhodococcus sp. 66b Isolate Unclassified
90 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
91 2928153084 Leifsonia sp. 563 Isolate Unclassified
92 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
93 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
94 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
95 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
96 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
97 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
98 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
99 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
100 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
101 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
102 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
103 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
104 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
105 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
106 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
107 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
108 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
109 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
110 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
111 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
112 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
113 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
114 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
115 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
116 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
117 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
118 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
119 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
120 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
121 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
122 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
123 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
124 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
125 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
128 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
129 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
130 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
131 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
132 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
133 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
134 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
135 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
136 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
139 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
140 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
141 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
144 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
145 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
146 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
147 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
148 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
149 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
150 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
151 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
152 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
157 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
158 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
159 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
160 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
161 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
174 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
178 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
185 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
231 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
232 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
233 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
250 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
251 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
252 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
253 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
263 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
264 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
265 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
266 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
269 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
274 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
275 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
276 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
277 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
278 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
285 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
297 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
306 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
307 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
313 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
314 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
315 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
316 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
317 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
318 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
319 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
336 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
337 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
345 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
346 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
351 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
361 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
362 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
363 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
395 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
396 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
399 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
408 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
411 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
412 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
413 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
414 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
415 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
418 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
421 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
422 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
423 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
424 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
425 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
445 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
446 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
447 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
448 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
449 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
450 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
451 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
452 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.31
Metatranscriptomes 3.19
Isolates 14.5

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 8.85
Nodule 0
Rhizoplane 3.32
Rhizosphere 69.04
Stem 0
Stem Tuber 0.12
Unclassified 18.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25164J39214_1000649 3300002772 Bacteria 14285
2 JGI25165J46597_1000174 3300003214 Bacteria 100372
3 rootL2_10035491 3300003322 Bacteria 16840
4 rootH1_10055294 3300003323 Bacteria 1447
5 Ga0006562J51391_1111915 3300003578 Bacteria 26433
6 Ga0006562J51391_1111917 3300003578 Bacteria 16790
7 Ga0006562J51391_1209490 3300003578 Bacteria 7710
8 Ga0006562J51391_1209491 3300003578 Bacteria 7690
9 Ga0055533_1000001 3300003756 Bacteria 1863437
10 Ga0055525_1000330 3300003759 Bacteria 36101
11 Ga0055542_1000427 3300003762 Bacteria 40635
12 Ga0055529_1000571 3300003763 Bacteria 30068
13 Ga0055540_1011213 3300003792 Bacteria 2911
14 Ga0070658_10009760 3300005327 Bacteria 7709
15 Ga0070658_10105547 3300005327 Bacteria 2330
16 Ga0070683_100147207 3300005329 Bacteria 2232
17 Ga0070683_100274017 3300005329 Bacteria 1605
18 Ga0070683_100331821 3300005329 Bacteria 1448
19 Ga0070670_100287151 3300005331 Bacteria 1437
20 Ga0070670_100293247 3300005331 Bacteria 1422
21 Ga0068868_100096268 3300005338 Bacteria 2391
22 Ga0068868_100268046 3300005338 Bacteria 1442
23 Ga0070660_100054836 3300005339 Bacteria 3079
24 Ga0070660_100267364 3300005339 Bacteria 1397
25 Ga0070668_100000560 3300005347 Bacteria 24850
26 Ga0070668_100044032 3300005347 Bacteria 3423
27 Ga0070659_100000749 3300005366 Bacteria 23637
28 Ga0070667_100049296 3300005367 Bacteria 3546
29 Ga0070685_10033968 3300005466 Bacteria 2870
30 Ga0070679_100158901 3300005530 Bacteria 2235
31 Ga0068853_100001645 3300005539 Bacteria 16333
32 Ga0068853_100199644 3300005539 Bacteria 1820
33 Ga0070672_100202532 3300005543 Bacteria 1660
34 Ga0070665_100076240 3300005548 Bacteria 3360
35 Ga0070665_100115555 3300005548 Bacteria 2686
36 Ga0068855_100005522 3300005563 Bacteria 15431
37 Ga0068855_100167483 3300005563 Bacteria 2490
38 Ga0068855_100318733 3300005563 Bacteria 1719
39 Ga0068857_100001028 3300005577 Bacteria 21558
40 Ga0068857_100049400 3300005577 Bacteria 3732
41 Ga0068854_100001906 3300005578 Bacteria 12696
42 Ga0068856_100193332 3300005614 Bacteria 2048
43 Ga0068852_100003952 3300005616 Bacteria 10419
44 Ga0068852_100012604 3300005616 Bacteria 6426
45 Ga0068852_100035556 3300005616 Bacteria 4157
46 Ga0068852_100151450 3300005616 Bacteria 2157
47 Ga0068864_100042847 3300005618 Bacteria 3874
48 Ga0068864_100210238 3300005618 Bacteria 1791
49 Ga0068851_10000008 3300005834 Bacteria 231006
50 Ga0068863_100057676 3300005841 Bacteria 3675
51 Ga0068858_100000096 3300005842 Bacteria 91762
52 Ga0068858_100011201 3300005842 Bacteria 8475
53 Ga0068860_100168878 3300005843 Bacteria 2112
54 Ga0081455_10008614 3300005937 Bacteria 10581
55 Ga0081540_1010901 3300005983 Bacteria 6104
56 Ga0081539_10006285 3300005985 Bacteria 11482
57 Ga0075365_10000074 3300006038 Bacteria 29323
58 Ga0075365_10001691 3300006038 Bacteria 10208
59 Ga0075365_10095488 3300006038 Bacteria 2030
60 Ga0075365_10346357 3300006038 Bacteria 1047
61 Ga0075363_100062469 3300006048 Bacteria 2008
62 Ga0075364_10009137 3300006051 Bacteria 5937
63 Ga0075364_10053696 3300006051 Bacteria 2634
64 Ga0075364_10110763 3300006051 Bacteria 1832
65 Ga0075364_10120647 3300006051 Bacteria 1755
66 Ga0075364_10182612 3300006051 Bacteria 1420
67 Ga0075364_10235609 3300006051 Bacteria 1243
68 Ga0075432_10008430 3300006058 Bacteria 3517
69 Ga0075367_10014844 3300006178 Bacteria 4220
70 Ga0075370_10074719 3300006353 Bacteria 1942
71 Ga0075370_10097603 3300006353 Bacteria 1699
72 Ga0105240_10099808 3300009093 Bacteria 3533
73 Ga0105240_10424377 3300009093 Bacteria 1493
74 Ga0111539_10258735 3300009094 Bacteria 2026
75 Ga0105245_10071744 3300009098 Bacteria 3145
76 Ga0105245_10117434 3300009098 Bacteria 2481
77 Ga0105245_10502714 3300009098 Bacteria 1228
78 Ga0105243_10060287 3300009148 Bacteria 3031
79 Ga0105243_10442023 3300009148 Bacteria 1218
80 Ga0105241_10006075 3300009174 Bacteria 8905
81 Ga0105241_10020164 3300009174 Bacteria 4925
82 Ga0105248_10000713 3300009177 Bacteria 37644
83 Ga0105248_10036889 3300009177 Bacteria 5467
84 Ga0105237_10000688 3300009545 Bacteria 46838
85 Ga0105237_10147307 3300009545 Bacteria 2349
86 Ga0105237_10153998 3300009545 Bacteria 2295
87 Ga0105238_10006959 3300009551 Bacteria 11300
88 Ga0105238_10017275 3300009551 Bacteria 7329
89 Ga0105238_10055894 3300009551 Bacteria 3960
90 Ga0105238_10067508 3300009551 Bacteria 3577
91 Ga0105249_10155161 3300009553 Bacteria 2207
92 Ga0105239_10113586 3300010375 Bacteria 3003
93 Ga0105239_10190119 3300010375 Bacteria 2298
94 Ga0105239_10735083 3300010375 Bacteria 1129
95 Ga0105246_10113931 3300011119 Bacteria 1991
96 Ga0157370_10006011 3300013104 Bacteria 13505
97 Ga0157369_10110300 3300013105 Bacteria 2925
98 Ga0157369_10143141 3300013105 Bacteria 2529
99 Ga0171462_1001 3300013250 Bacteria 1135406
100 Ga0163162_10099567 3300013306 Bacteria 2998
101 Ga0157375_10282440 3300013308 Bacteria 1823
102 Ga0157375_10324619 3300013308 Bacteria 1704
103 Ga0163163_10149343 3300014325 Bacteria 2381
104 Ga0163163_10592093 3300014325 Bacteria 1172
105 Ga0157380_10006897 3300014326 Bacteria 8033
106 Ga0157380_10467656 3300014326 Bacteria 1216
107 Ga0157380_10809113 3300014326 Bacteria 955
108 Ga0157379_10042903 3300014968 Bacteria 4039
109 Ga0157379_10597026 3300014968 Bacteria 1030
110 Ga0157376_10656637 3300014969 Bacteria 1050
111 Ga0163161_10319712 3300017792 Bacteria 1227
112 Ga0206356_10506699 3300020070 Bacteria 2239
113 Ga0206354_10181118 3300020081 Bacteria 2976
114 Ga0206353_10162159 3300020082 Bacteria 6239
115 Ga0206353_11489331 3300020082 Bacteria 2714
116 Ga0213875_10005353 3300021388 Bacteria 6900
117 Ga0209566_100053 3300025225 Bacteria 224436
118 Ga0209674_100001 3300025226 Bacteria 4013750
119 Ga0209672_100039 3300025228 Bacteria 283064
120 Ga0209147_102885 3300025229 Bacteria 3782
121 Ga0209563_100001 3300025230 Bacteria 4013775
122 Ga0207427_100010 3300025231 Bacteria 648610
123 Ga0209646_1000192 3300025246 Bacteria 75005
124 Ga0209677_100001 3300025253 Bacteria 4013787
125 Ga0209677_100378 3300025253 Bacteria 27274
126 Ga0209148_1000004 3300025254 Bacteria 1844481
127 Ga0209148_1002409 3300025254 Bacteria 6501
128 Ga0209233_1000001 3300025261 Bacteria 2992747
129 Ga0209455_1000377 3300025272 Bacteria 40663
130 Ga0209051_1020243 3300025303 Bacteria 2872
131 Ga0207656_10000005 3300025321 Bacteria 490514
132 Ga0207688_10012150 3300025901 Bacteria 4685
133 Ga0207647_10001411 3300025904 Bacteria 18447
134 Ga0207643_10053036 3300025908 Bacteria 2304
135 Ga0207705_10076475 3300025909 Bacteria 2434
136 Ga0207654_10000001 3300025911 Bacteria 1816198
137 Ga0207654_10029988 3300025911 Bacteria 2982
138 Ga0207695_10009355 3300025913 Bacteria 12117
139 Ga0207695_10019929 3300025913 Bacteria 7703
140 Ga0207671_10000016 3300025914 Bacteria 435413
141 Ga0207671_10001866 3300025914 Bacteria 23478
142 Ga0207671_10114909 3300025914 Bacteria 2052
143 Ga0207657_10023164 3300025919 Bacteria 5788
144 Ga0207657_10227729 3300025919 Bacteria 1491
145 Ga0207652_10136467 3300025921 Bacteria 2191
146 Ga0207652_10342280 3300025921 Bacteria 1350
147 Ga0207681_10103573 3300025923 Bacteria 2057
148 Ga0207694_10000196 3300025924 Bacteria 60714
149 Ga0207694_10285495 3300025924 Bacteria 1356
150 Ga0207650_10299270 3300025925 Bacteria 1313
151 Ga0207687_10042745 3300025927 Bacteria 3120
152 Ga0207690_10002298 3300025932 Bacteria 11651
153 Ga0207709_10022715 3300025935 Bacteria 3561
154 Ga0207691_10268967 3300025940 Bacteria 1468
155 Ga0207711_10135194 3300025941 Bacteria 2214
156 Ga0207661_10017840 3300025944 Bacteria 5261
157 Ga0207661_10140936 3300025944 Bacteria 2075
158 Ga0207661_10194858 3300025944 Bacteria 1778
159 Ga0207667_10001482 3300025949 Bacteria 29458
160 Ga0207667_10397099 3300025949 Bacteria 1404
161 Ga0207712_10239305 3300025961 Bacteria 1461
162 Ga0207668_10000481 3300025972 Bacteria 24975
163 Ga0207668_10208879 3300025972 Bacteria 1560
164 Ga0207640_10233276 3300025981 Bacteria 1417
165 Ga0207677_10029357 3300026023 Bacteria 3494
166 Ga0207677_10245924 3300026023 Bacteria 1450
167 Ga0207703_10001625 3300026035 Bacteria 20245
168 Ga0207639_10040609 3300026041 Bacteria 3474
169 Ga0207639_10103246 3300026041 Bacteria 2309
170 Ga0207678_10628044 3300026067 Bacteria 943
171 Ga0207702_10054536 3300026078 Bacteria 3388
172 Ga0207702_10182105 3300026078 Bacteria 1935
173 Ga0207641_10010811 3300026088 Bacteria 7482
174 Ga0207676_10118215 3300026095 Bacteria 2231
175 Ga0207676_10174425 3300026095 Bacteria 1876
176 Ga0207674_10000405 3300026116 Bacteria 55884
177 Ga0207674_10221300 3300026116 Bacteria 1841
178 Ga0207675_100095849 3300026118 Bacteria 2793
179 Ga0207683_10114464 3300026121 Bacteria 2417
180 Ga0207698_10000078 3300026142 Bacteria 65050
181 Ga0207698_10002196 3300026142 Bacteria 11542
182 Ga0207698_10021148 3300026142 Bacteria 4494
183 Ga0207428_10053527 3300027907 Bacteria 3218
184 Ga0268266_10070008 3300028379 Bacteria 3041
185 Ga0268266_10161904 3300028379 Bacteria 2025
186 Ga0268266_10363727 3300028379 Bacteria 1362
187 Ga0268265_10036705 3300028380 Bacteria 3591
188 Ga0268265_10161472 3300028380 Bacteria 1904
189 Ga0307517_10005202 3300028786 Bacteria 19711
190 Ga0307517_10050934 3300028786 Bacteria 4193
191 Ga0307515_10000189 3300028794 Bacteria 150703
192 Ga0307515_10000436 3300028794 Bacteria 100131
193 Ga0307515_10026558 3300028794 Bacteria 9958
194 Ga0307515_10041387 3300028794 Bacteria 7246
195 Ga0307515_10100480 3300028794 Bacteria 3501
196 Ga0307515_10149291 3300028794 Bacteria 2454
197 Ga0307515_10214310 3300028794 Bacteria 1761
198 Ga0307511_10000194 3300030521 Bacteria 60345
199 Ga0307511_10000824 3300030521 Bacteria 33088
200 Ga0307511_10075469 3300030521 Bacteria 2419
201 Ga0307512_10007529 3300030522 Bacteria 10772
202 Ga0307512_10011457 3300030522 Bacteria 8402
203 Ga0307512_10151248 3300030522 Bacteria 1388
204 Ga0307513_10001658 3300031456 Bacteria 31815
205 Ga0307513_10003959 3300031456 Bacteria 19895
206 Ga0307513_10040155 3300031456 Bacteria 5176
207 Ga0307509_10013932 3300031507 Bacteria 9484
208 Ga0307509_10022228 3300031507 Bacteria 7156
209 Ga0307509_10025555 3300031507 Bacteria 6592
210 Ga0307509_10061064 3300031507 Bacteria 3981
211 Ga0307509_10080593 3300031507 Bacteria 3366
212 Ga0307509_10103294 3300031507 Bacteria 2878
213 Ga0307408_100034128 3300031548 Bacteria 3561
214 Ga0307408_100139192 3300031548 Bacteria 1903
215 Ga0307408_100157919 3300031548 Bacteria 1798
216 Ga0307508_10003658 3300031616 Bacteria 15415
217 Ga0307508_10061681 3300031616 Bacteria 3312
218 Ga0307508_10078310 3300031616 Bacteria 2886
219 Ga0307508_10100940 3300031616 Bacteria 2481
220 Ga0307508_10148644 3300031616 Bacteria 1947
221 Ga0307514_10063841 3300031649 Bacteria 2795
222 Ga0307516_10005460 3300031730 Bacteria 15196
223 Ga0307516_10045235 3300031730 Bacteria 4349
224 Ga0307516_10064212 3300031730 Bacteria 3552
225 Ga0307516_10106039 3300031730 Bacteria 2621
226 Ga0307405_10185122 3300031731 Bacteria 1499
227 Ga0307413_10039100 3300031824 Bacteria 2756
228 Ga0307413_10115553 3300031824 Bacteria 1806
229 Ga0307413_10286025 3300031824 Bacteria 1243
230 Ga0307413_10625090 3300031824 Bacteria 885
231 Ga0307518_10000412 3300031838 Bacteria 32912
232 Ga0307518_10175499 3300031838 Bacteria 1455
233 Ga0307410_10018744 3300031852 Bacteria 4190
234 Ga0307410_10021437 3300031852 Bacteria 3974
235 Ga0307410_10138062 3300031852 Bacteria 1800
236 Ga0307410_10138325 3300031852 Bacteria 1798
237 Ga0307410_10369755 3300031852 Bacteria 1151
238 Ga0307406_10001204 3300031901 Bacteria 14485
239 Ga0307406_10052440 3300031901 Bacteria 2594
240 Ga0307406_10072553 3300031901 Bacteria 2260
241 Ga0307406_10137549 3300031901 Bacteria 1724
242 Ga0307406_10427058 3300031901 Bacteria 1057
243 Ga0307407_10199789 3300031903 Bacteria 1339
244 Ga0307407_10267718 3300031903 Bacteria 1178
245 Ga0307412_10024159 3300031911 Bacteria 3749
246 Ga0307412_10057256 3300031911 Bacteria 2601
247 Ga0307412_10392120 3300031911 Bacteria 1128
248 Ga0307409_100006047 3300031995 Bacteria 7064
249 Ga0307409_100288224 3300031995 Bacteria 1521
250 Ga0307409_100327823 3300031995 Bacteria 1435
251 Ga0307416_100002272 3300032002 Bacteria 10949
252 Ga0307416_100225247 3300032002 Bacteria 1802
253 Ga0307416_100317519 3300032002 Bacteria 1558
254 Ga0307416_100456828 3300032002 Bacteria 1331
255 Ga0307414_10066312 3300032004 Bacteria 2580
256 Ga0307414_10117497 3300032004 Bacteria 2038
257 Ga0307414_10219748 3300032004 Bacteria 1559
258 Ga0307414_10392665 3300032004 Bacteria 1203
259 Ga0307411_10083770 3300032005 Bacteria 2204
260 Ga0307411_10310014 3300032005 Bacteria 1270
261 Ga0307415_100369478 3300032126 Bacteria 1214
262 Ga0307507_10009303 3300033179 Bacteria 13156
263 Ga0307507_10023801 3300033179 Bacteria 6701
264 Ga0307507_10057799 3300033179 Bacteria 3649
265 Ga0307507_10082816 3300033179 Bacteria 2810
266 Ga0307507_10165311 3300033179 Bacteria 1623
267 Ga0307507_10188201 3300033179 Bacteria 1457
268 Ga0307510_10033562 3300033180 Bacteria 5761
269 Ga0307510_10103362 3300033180 Bacteria 2626
270 Ga0307510_10206826 3300033180 Bacteria 1490
271 Ga0316214_1002008 3300033545 Bacteria 2467
272 Ga0373938_0011954 3300034957 Bacteria 1623
273 Ga0373940_0001334 3300035088 Bacteria 4403
274 Ga0373942_0001388 3300035207 Bacteria 6263
275 Ga0373962_0000420 3300035242 Bacteria 9243
276 Ga0395899_0011272 3300037312 Bacteria 6848
277 Ga0395899_0020111 3300037312 Bacteria 5065
278 Ga0395899_0046544 3300037312 Bacteria 3231
279 Ga0395899_0050283 3300037312 Bacteria 3095
280 Ga0395900_0054877 3300037418 Bacteria 4102
281 Ga0395900_0088650 3300037418 Bacteria 3181
282 Ga0395900_0116325 3300037418 Bacteria 2744
283 Ga0395900_0269495 3300037418 Bacteria 1698
284 Ga0395898_0000256 3300037466 Bacteria 130878
285 Ga0395898_0003736 3300037466 Bacteria 16878
286 Ga0395898_0006023 3300037466 Bacteria 13025
287 Ga0395898_0009444 3300037466 Bacteria 10246
288 Ga0395898_0038380 3300037466 Bacteria 4747
289 Ga0395898_0076921 3300037466 Bacteria 3222
290 Ga0395898_0232569 3300037466 Bacteria 1758
291 Ga0395905_0034166 3300037471 Bacteria 4774
292 Ga0395905_0445427 3300037471 Bacteria 1193
293 Ga0436364_0891096 3300037853 Bacteria 17632
294 Ga0395901_0001692 3300038443 Bacteria 22752
295 Ga0395901_0005007 3300038443 Bacteria 13377
296 Ga0395901_0023278 3300038443 Bacteria 6350
297 Ga0395901_0095473 3300038443 Bacteria 3116
298 Ga0395901_0098948 3300038443 Bacteria 3058
299 Ga0395901_0144104 3300038443 Bacteria 2504
300 Ga0395901_0288080 3300038443 Bacteria 1705
301 Ga0395901_0382965 3300038443 Bacteria 1447
302 Ga0395901_0412286 3300038443 Bacteria 1387
303 Ga0439436_0020261 3300041404 Bacteria 1981
304 Ga0451837_0641337 3300041494 Bacteria 1190
305 Ga0439433_0007739 3300041999 Bacteria 2323
306 Ga0439449_0035166 3300042007 Bacteria 1865
307 Ga0439449_0038334 3300042007 Bacteria 1782
308 Ga0439457_002025 3300042014 Bacteria 5949
309 Ga0439458_0051848 3300042157 Bacteria 1014
310 Ga0466969_0009413 3300044656 Bacteria 5178
311 Ga0466969_0044415 3300044656 Bacteria 2210
312 Ga0466969_0152838 3300044656 Bacteria 1063
313 Ga0466972_0023059 3300044658 Bacteria 3098
314 Ga0466972_0057218 3300044658 Bacteria 1873
315 Ga0466965_0004730 3300044683 Bacteria 6068
316 Ga0466965_0024111 3300044683 Bacteria 2942
317 Ga0466965_0105219 3300044683 Bacteria 1446
318 Ga0466966_0017223 3300044684 Bacteria 4777
319 Ga0466966_0060069 3300044684 Bacteria 2400
320 Ga0466966_0103107 3300044684 Bacteria 1763
321 Ga0466961_0018907 3300044693 Bacteria 4432
322 Ga0466961_0105952 3300044693 Bacteria 1770
323 Ga0466963_0050792 3300044694 Bacteria 2745
324 Ga0466968_0001871 3300044735 Bacteria 7614
325 Ga0466968_0005778 3300044735 Bacteria 4641
326 Ga0466970_0036417 3300044765 Bacteria 2606
327 Ga0466970_0044839 3300044765 Bacteria 2354
328 Ga0466970_0062493 3300044765 Bacteria 1996
329 Ga0466970_0236514 3300044765 Bacteria 1021
330 Ga0466957_0020653 3300044842 Bacteria 3876
331 Ga0466960_0023405 3300044901 Bacteria 2774
332 Ga0466960_0024039 3300044901 Bacteria 2744
333 Ga0466960_0031329 3300044901 Bacteria 2453
334 Ga0466960_0044342 3300044901 Bacteria 2120
335 Ga0466960_0173329 3300044901 Bacteria 1165
336 Ga0466959_0005086 3300045049 Bacteria 8941
337 Ga0466959_0019351 3300045049 Bacteria 5006
338 Ga0466959_0274148 3300045049 Bacteria 1159
339 Ga0466958_0052816 3300045836 Bacteria 2464
340 Ga0466958_0069880 3300045836 Bacteria 2148
341 Ga0466958_0170159 3300045836 Bacteria 1379
342 Ga0466967_0000584 3300045976 Bacteria 18008
343 Ga0466967_0014483 3300045976 Bacteria 6145
344 Ga0466967_0081394 3300045976 Bacteria 2925
345 Ga0466967_0289063 3300045976 Bacteria 1574
346 Ga0466967_0372360 3300045976 Bacteria 1385
347 Ga0466967_0603939 3300045976 Bacteria 1083
348 Ga0495627_000352 3300046453 Bacteria 43219
349 Ga0495627_010387 3300046453 Bacteria 3387
350 Ga0495592_0042075 3300046454 Bacteria 3422
351 Ga0495603_0116803 3300046455 Bacteria 1555
352 Ga0495590_0000075 3300046457 Bacteria 68919
353 Ga0495629_0003756 3300046459 Bacteria 11441
354 Ga0495629_0006664 3300046459 Bacteria 8547
355 Ga0495629_0014354 3300046459 Bacteria 5698
356 Ga0495638_0145539 3300046460 Bacteria 1379
357 Ga0495651_0033791 3300046462 Bacteria 3988
358 Ga0495651_0278319 3300046462 Bacteria 1131
359 Ga0495650_0000558 3300046471 Bacteria 52874
360 Ga0495580_0030566 3300046472 Bacteria 3899
361 Ga0495580_0114658 3300046472 Bacteria 1872
362 Ga0495582_0013541 3300046473 Bacteria 4491
363 Ga0495582_0103776 3300046473 Bacteria 1593
364 Ga0495662_0002738 3300046476 Bacteria 8908
365 Ga0495662_0010284 3300046476 Bacteria 4586
366 Ga0495662_0226138 3300046476 Bacteria 922
367 Ga0495664_0003195 3300046477 Bacteria 8897
368 Ga0495585_0103279 3300046492 Bacteria 1522
369 Ga0495594_0031966 3300046499 Bacteria 2855
370 Ga0495594_0136107 3300046499 Bacteria 1392
371 Ga0495594_0138606 3300046499 Bacteria 1379
372 Ga0495607_0069964 3300046501 Bacteria 1962
373 Ga0495583_0022213 3300046506 Bacteria 3243
374 Ga0495583_0074848 3300046506 Bacteria 1481
375 Ga0495606_0004805 3300046507 Bacteria 13280
376 Ga0495608_0004783 3300046511 Bacteria 9684
377 Ga0495610_0063392 3300046512 Bacteria 1750
378 Ga0495616_0013185 3300046513 Bacteria 4670
379 Ga0495618_0118948 3300046514 Bacteria 1692
380 Ga0495620_0001179 3300046515 Bacteria 16001
381 Ga0495620_0004461 3300046515 Bacteria 7885
382 Ga0495620_0018122 3300046515 Bacteria 3492
383 Ga0495628_0044346 3300046516 Bacteria 3539
384 Ga0495628_0091481 3300046516 Bacteria 2354
385 Ga0495630_0111222 3300046517 Bacteria 2075
386 Ga0495631_0032324 3300046518 Bacteria 2360
387 Ga0495632_0074653 3300046519 Bacteria 1624
388 Ga0495666_0036041 3300046526 Bacteria 2409
389 Ga0495652_0030604 3300046529 Bacteria 4719
390 Ga0495652_0066264 3300046529 Bacteria 3031
391 Ga0495652_0268641 3300046529 Bacteria 1255
392 Ga0495654_0128870 3300046530 Bacteria 1138
393 Ga0495665_0012080 3300046531 Bacteria 4675
394 Ga0495665_0037615 3300046531 Bacteria 2582
395 Ga0495640_0024818 3300046533 Bacteria 4355
396 Ga0495640_0045740 3300046533 Bacteria 3037
397 Ga0495640_0260234 3300046533 Bacteria 1084
398 Ga0495586_0038016 3300046535 Bacteria 2584
399 Ga0495587_0003896 3300046536 Bacteria 9901
400 Ga0495587_0009303 3300046536 Bacteria 6303
401 Ga0495598_0015743 3300046537 Bacteria 1916
402 Ga0495621_0030879 3300046539 Bacteria 1834
403 Ga0495597_0023607 3300046542 Bacteria 2844
404 Ga0495645_0028098 3300046543 Bacteria 4086
405 Ga0495645_0032423 3300046543 Bacteria 3811
406 Ga0495645_0169134 3300046543 Bacteria 1505
407 Ga0495622_0007858 3300046557 Bacteria 4949
408 Ga0495667_0000402 3300046559 Bacteria 27723
409 Ga0495667_0029993 3300046559 Bacteria 3657
410 Ga0495667_0200542 3300046559 Bacteria 1277
411 Ga0495656_0020545 3300046615 Bacteria 2563
412 Ga0495656_0069864 3300046615 Bacteria 1557
413 Ga0495656_0125319 3300046615 Bacteria 1217
414 Ga0495656_0152308 3300046615 Bacteria 1118
415 Ga0495668_0000360 3300046616 Bacteria 60235
416 Ga0495668_0014227 3300046616 Bacteria 4671
417 Ga0495668_0229307 3300046616 Bacteria 1017
418 Ga0495634_0009470 3300046642 Bacteria 7183
419 Ga0495634_0151866 3300046642 Bacteria 1464
420 Ga0495611_0095848 3300046648 Bacteria 1373
421 Ga0495625_0022500 3300046660 Bacteria 4832
422 Ga0495625_0025631 3300046660 Bacteria 4469
423 Ga0495625_0254465 3300046660 Bacteria 1139
424 Ga0495635_0070706 3300046663 Bacteria 2392
425 Ga0495635_0180113 3300046663 Bacteria 1436
426 Ga0495635_0219770 3300046663 Bacteria 1285
427 Ga0495635_0242347 3300046663 Bacteria 1216
428 Ga0495588_0021027 3300046674 Bacteria 3212
429 Ga0495657_0000206 3300046675 Bacteria 52948
430 Ga0495657_0041189 3300046675 Bacteria 3163
431 Ga0495657_0141715 3300046675 Bacteria 1498
432 Ga0495646_0007542 3300046680 Bacteria 6913
433 Ga0495646_0057100 3300046680 Bacteria 2338
434 Ga0495613_0000367 3300046689 Bacteria 39278
435 Ga0495613_0001326 3300046689 Bacteria 18918
436 Ga0495624_0071602 3300046690 Bacteria 2157
437 Ga0495624_0261162 3300046690 Bacteria 1046
438 Ga0495670_0189227 3300046691 Bacteria 1088
439 Ga0495671_0016857 3300046692 Bacteria 3894
440 Ga0495589_0027582 3300046794 Bacteria 2871
441 Ga0495600_0014480 3300046809 Bacteria 4969
442 Ga0495600_0045170 3300046809 Bacteria 2874
443 Ga0495600_0071668 3300046809 Bacteria 2263
444 Ga0495660_0081780 3300046810 Bacteria 1692
445 Ga0495581_0004793 3300047315 Bacteria 7819
446 Ga0495581_0011256 3300047315 Bacteria 5173
447 Ga0495581_0016467 3300047315 Bacteria 4297
448 Ga0495581_0022959 3300047315 Bacteria 3613
449 Ga0495581_0072907 3300047315 Bacteria 1987
450 Ga0495581_0103739 3300047315 Bacteria 1652
451 Ga0495581_0113894 3300047315 Bacteria 1573
452 Ga0495581_0285079 3300047315 Bacteria 965
453 Ga0495604_0002982 3300047317 Bacteria 13553
454 Ga0495604_0029703 3300047317 Bacteria 4348
455 Ga0495674_0022245 3300047319 Bacteria 5846
456 Ga0495676_0003572 3300047321 Bacteria 14105
457 Ga0495676_0036943 3300047321 Bacteria 4072
458 Ga0495676_0039869 3300047321 Bacteria 3884
459 Ga0495676_0051383 3300047321 Bacteria 3298
460 Ga0495680_0090308 3300047322 Bacteria 2298
461 Ga0495683_0032612 3300047323 Bacteria 2652
462 Ga0495683_0057043 3300047323 Bacteria 1941
463 Ga0495687_005511 3300047443 Bacteria 8035
464 Ga0495687_012184 3300047443 Bacteria 4562
465 Ga0495687_044913 3300047443 Bacteria 1917
466 Ga0495687_080310 3300047443 Bacteria 1279
467 Ga0495675_0045533 3300047444 Bacteria 2793
468 Ga0495685_057869 3300047447 Bacteria 1309
469 Ga0495673_0092469 3300047469 Bacteria 1234
470 Ga0495681_0000253 3300047470 Bacteria 43616
471 Ga0495684_0301623 3300047471 Bacteria 1150
472 Ga0495686_0092048 3300047472 Bacteria 1840
473 Ga0495686_0282525 3300047472 Bacteria 922
474 Ga0495593_0020878 3300047673 Bacteria 3662
475 Ga0495593_0025064 3300047673 Bacteria 3300
476 Ga0495593_0049420 3300047673 Bacteria 2231
477 Ga0495614_0004541 3300048089 Bacteria 6256
478 Ga0495614_0023141 3300048089 Bacteria 2679
479 Ga0495626_0008479 3300048091 Bacteria 5631
480 Ga0496102_0040056 3300048905 Bacteria 4237
481 Ga0496102_0162700 3300048905 Bacteria 2099
482 Ga0496102_0237422 3300048905 Bacteria 1719
483 Ga0496103_0031930 3300048906 Bacteria 3212
484 Ga0496103_0180870 3300048906 Bacteria 1355
485 Ga0496103_0206905 3300048906 Bacteria 1262
486 Ga0496103_0250639 3300048906 Bacteria 1139
487 Ga0496104_0003058 3300048907 Bacteria 14421
488 Ga0496104_0104230 3300048907 Bacteria 2717
489 Ga0496105_0046766 3300048908 Bacteria 3571
490 Ga0496105_0054451 3300048908 Bacteria 3303
491 Ga0496105_0144649 3300048908 Bacteria 1955
492 Ga0496106_0465515 3300048909 Bacteria 1015
493 Ga0496107_0033172 3300048910 Bacteria 3694
494 Ga0496107_0103815 3300048910 Bacteria 2086
495 Ga0496108_0000100 3300048911 Bacteria 89095
496 Ga0496108_0211814 3300048911 Bacteria 1682
497 Ga0496110_0042786 3300048913 Bacteria 3954
498 Ga0496112_0135018 3300048915 Bacteria 2438
499 Ga0496113_0144758 3300048916 Bacteria 1871
500 Ga0496113_0255062 3300048916 Bacteria 1401
501 Ga0496113_0495337 3300048916 Bacteria 981
502 Ga0496114_0045297 3300048917 Bacteria 3653
503 Ga0496114_0048331 3300048917 Bacteria 3539
504 Ga0496114_0155028 3300048917 Bacteria 1988
505 Ga0496115_0354322 3300048918 Bacteria 1196
506 Ga0496115_0412722 3300048918 Bacteria 1094
507 Ga0496116_0109688 3300048919 Bacteria 1626
508 Ga0496117_0000394 3300048920 Bacteria 74632
509 Ga0496117_0008044 3300048920 Bacteria 10109
510 Ga0496117_0070251 3300048920 Bacteria 2353
511 Ga0496117_0184411 3300048920 Bacteria 1196
512 Ga0496118_0037908 3300048921 Bacteria 3871
513 Ga0496118_0084493 3300048921 Bacteria 2214
514 Ga0496119_0000605 3300048922 Bacteria 48474
515 Ga0496120_0002952 3300048923 Bacteria 16205
516 Ga0496120_0047737 3300048923 Bacteria 2467
517 Ga0496122_0011187 3300048925 Bacteria 9131
518 Ga0496122_0029005 3300048925 Bacteria 4679
519 Ga0496122_0033605 3300048925 Bacteria 4215
520 Ga0496122_0072498 3300048925 Bacteria 2448
521 Ga0496122_0091889 3300048925 Bacteria 2065
522 Ga0496123_0005519 3300048926 Bacteria 12698
523 Ga0496124_0104903 3300048927 Bacteria 2285
524 Ga0496125_0012426 3300048928 Bacteria 8453
525 Ga0496125_0027233 3300048928 Bacteria 5185
526 Ga0496125_0092225 3300048928 Bacteria 2265
527 Ga0496125_0130172 3300048928 Bacteria 1773
528 Ga0496126_0016360 3300048929 Bacteria 7420
529 Ga0496126_0042168 3300048929 Bacteria 4216
530 Ga0496126_0150392 3300048929 Bacteria 1996
531 Ga0496126_0175586 3300048929 Bacteria 1822
532 Ga0501031_0043036 3300049568 Bacteria 2948
533 Ga0501032_0021647 3300049569 Bacteria 4468
534 Ga0501032_0047557 3300049569 Bacteria 2896
535 Ga0501032_0110366 3300049569 Bacteria 1820
536 Ga0501033_0000203 3300049570 Bacteria 56963
537 Ga0501033_0000422 3300049570 Bacteria 40484
538 Ga0501033_0004260 3300049570 Bacteria 11503
539 Ga0501033_0019120 3300049570 Bacteria 5179
540 Ga0501033_0118334 3300049570 Bacteria 1924
541 Ga0501033_0266013 3300049570 Bacteria 1213
542 Ga0501034_0000042 3300049571 Bacteria 229124
543 Ga0501034_0001033 3300049571 Bacteria 39834
544 Ga0501034_0010152 3300049571 Bacteria 9825
545 Ga0501034_0012846 3300049571 Bacteria 8637
546 Ga0501034_0023839 3300049571 Bacteria 6231
547 Ga0501034_0036310 3300049571 Bacteria 4992
548 Ga0501034_0077122 3300049571 Bacteria 3338
549 Ga0501034_0132802 3300049571 Bacteria 2472
550 Ga0501034_0139401 3300049571 Bacteria 2405
551 Ga0501034_0346388 3300049571 Bacteria 1415
552 Ga0501036_0007959 3300049572 Bacteria 8675
553 Ga0501036_0014204 3300049572 Bacteria 6625
554 Ga0501036_0055755 3300049572 Bacteria 3348
555 Ga0501036_0071418 3300049572 Bacteria 2935
556 Ga0501036_0119416 3300049572 Bacteria 2226
557 Ga0501037_0000225 3300049573 Bacteria 49210
558 Ga0501037_0011416 3300049573 Bacteria 6535
559 Ga0501037_0012159 3300049573 Bacteria 6335
560 Ga0501037_0021352 3300049573 Bacteria 4783
561 Ga0501037_0023217 3300049573 Bacteria 4587
562 Ga0501037_0112354 3300049573 Bacteria 1962
563 Ga0501037_0153546 3300049573 Bacteria 1644
564 Ga0501038_0001877 3300049574 Bacteria 19413
565 Ga0501038_0008985 3300049574 Bacteria 9168
566 Ga0501038_0317029 3300049574 Bacteria 1220
567 Ga0501038_0430979 3300049574 Bacteria 1016
568 Ga0501038_0493368 3300049574 Bacteria 937
569 Ga0501038_0575449 3300049574 Bacteria 854
570 Ga0501039_0015717 3300049575 Bacteria 5791
571 Ga0501039_0016214 3300049575 Bacteria 5709
572 Ga0501039_0422712 3300049575 Bacteria 1047
573 Ga0501042_0026205 3300049578 Bacteria 4097
574 Ga0501042_0144767 3300049578 Bacteria 1713
575 Ga0501043_0004371 3300049579 Bacteria 11505
576 Ga0501043_0005999 3300049579 Bacteria 9765
577 Ga0501043_0022390 3300049579 Bacteria 4956
578 Ga0501043_0042724 3300049579 Bacteria 3562
579 Ga0501043_0045475 3300049579 Bacteria 3453
580 Ga0501043_0099302 3300049579 Bacteria 2288
581 Ga0501043_0147350 3300049579 Bacteria 1843
582 Ga0501043_0527595 3300049579 Bacteria 879
583 Ga0501046_0000071 3300049580 Bacteria 107260
584 Ga0501046_0002191 3300049580 Bacteria 18452
585 Ga0501046_0002217 3300049580 Bacteria 18328
586 Ga0501046_0008066 3300049580 Bacteria 9201
587 Ga0501046_0018748 3300049580 Bacteria 5751
588 Ga0501046_0093917 3300049580 Bacteria 2305
589 Ga0501046_0157522 3300049580 Bacteria 1710
590 Ga0501047_0036556 3300049581 Bacteria 4747
591 Ga0501047_0044973 3300049581 Bacteria 4267
592 Ga0501047_0045354 3300049581 Bacteria 4251
593 Ga0501047_0049528 3300049581 Bacteria 4056
594 Ga0501047_0055264 3300049581 Bacteria 3839
595 Ga0501047_0139676 3300049581 Bacteria 2301
596 Ga0501048_0000826 3300049582 Bacteria 22836
597 Ga0501048_0009404 3300049582 Bacteria 7338
598 Ga0501067_0085744 3300049583 Bacteria 1748
599 Ga0501067_0133645 3300049583 Bacteria 1381
600 Ga0501067_0300153 3300049583 Bacteria 894
601 Ga0501070_0000524 3300049586 Bacteria 35215
602 Ga0501070_0000569 3300049586 Bacteria 33672
603 Ga0501070_0001028 3300049586 Bacteria 25074
604 Ga0501070_0003400 3300049586 Bacteria 13815
605 Ga0501070_0048064 3300049586 Bacteria 3545
606 Ga0501070_0141255 3300049586 Bacteria 1988
607 Ga0501070_0192141 3300049586 Bacteria 1678
608 Ga0501070_0230528 3300049586 Bacteria 1517
609 Ga0501070_0298765 3300049586 Bacteria 1312
610 Ga0501071_0008372 3300049587 Bacteria 6834
611 Ga0501072_0031955 3300049588 Bacteria 4121
612 Ga0501072_0273447 3300049588 Bacteria 1344
613 Ga0501073_0020944 3300049589 Bacteria 4716
614 Ga0501073_0035250 3300049589 Bacteria 3558
615 Ga0501073_0172242 3300049589 Bacteria 1498
616 Ga0501074_0016706 3300049590 Bacteria 5326
617 Ga0501077_0155961 3300049593 Bacteria 1449
618 Ga0501080_0000134 3300049742 Bacteria 52384
619 Ga0501080_0076432 3300049742 Bacteria 3114
620 Ga0501080_0096254 3300049742 Bacteria 2748
621 Ga0501083_0059557 3300049744 Bacteria 2554
622 Ga0501035_0011940 3300049822 Bacteria 8039
623 Ga0501035_0013921 3300049822 Bacteria 7422
624 Ga0501035_0031423 3300049822 Bacteria 4836
625 Ga0501035_0342307 3300049822 Bacteria 1253
626 Ga0501044_0032155 3300049823 Bacteria 5516
627 Ga0501044_0035611 3300049823 Bacteria 5211
628 Ga0501044_0052806 3300049823 Bacteria 4184
629 Ga0501044_0106641 3300049823 Bacteria 2813
630 Ga0501044_0166603 3300049823 Bacteria 2177
631 Ga0501044_0281133 3300049823 Bacteria 1598
632 Ga0501045_0009279 3300049824 Bacteria 6881
633 Ga0501045_0084610 3300049824 Bacteria 2340
634 nmdc:mga00v17_144910_c1 3300050491 Bacteria 1524
635 nmdc:mga00v17_1997_c1 3300050491 Bacteria 10521
636 nmdc:mga00v17_403171_c1 3300050491 Bacteria 889
637 nmdc:mga00v17_85220_c1 3300050491 Bacteria 1978
638 nmdc:mga0yw44_30856_c1 3300050492 Bacteria 3112
639 nmdc:mga0yw44_359986_c1 3300050492 Bacteria 980
640 nmdc:mga0yw44_46195_c1 3300050492 Bacteria 2614
641 nmdc:mga0yw44_86862_c1 3300050492 Bacteria 1970
642 nmdc:mga07m45_166704_c1 3300050496 Bacteria 1279
643 nmdc:mga07m45_182575_c1 3300050496 Bacteria 1220
644 nmdc:mga07m45_59229_c1 3300050496 Bacteria 2167
645 nmdc:mga0sz30_1528_c1 3300050516 Bacteria 8242
646 nmdc:mga0sz30_26287_c1 3300050516 Bacteria 2385
647 Ga0500635_0000064 3300053080 Bacteria 70317
648 Ga0500635_0036677 3300053080 Bacteria 1617
649 Ga0495655_0001072 3300053083 Bacteria 4226
650 Ga0495595_0033536 3300053084 Bacteria 2318
651 Ga0495619_0028909 3300053085 Bacteria 3578
652 Ga0500578_0144435 3300053086 Bacteria 1486
653 Ga0500651_0007780 3300053093 Bacteria 6268
654 Ga0500641_0000256 3300053096 Bacteria 19848
655 Ga0500641_0012501 3300053096 Bacteria 3101
656 Ga0500556_0000282 3300053104 Bacteria 39873
657 Ga0500560_000276 3300053107 Bacteria 6448
658 Ga0500562_000728 3300053108 Bacteria 7976
659 Ga0500593_000801 3300053117 Bacteria 11771
660 Ga0500655_005387 3300053133 Bacteria 2309
661 Ga0500559_0000373 3300053136 Bacteria 33009
662 Ga0500559_0007855 3300053136 Bacteria 4710
663 Ga0500568_0003755 3300053139 Bacteria 8317
664 Ga0500573_0002950 3300053140 Bacteria 8678
665 Ga0500573_0024767 3300053140 Bacteria 3451
666 Ga0500573_0187854 3300053140 Bacteria 1106
667 Ga0500590_008902 3300053148 Bacteria 5029
668 Ga0500616_0000010 3300053153 Bacteria 761410
669 Ga0500616_0000089 3300053153 Bacteria 191075
670 Ga0500616_0002518 3300053153 Bacteria 15160
671 Ga0500620_001350 3300053155 Bacteria 4470
672 Ga0500624_001992 3300053157 Bacteria 2894
673 Ga0500645_010320 3300053730 Bacteria 3095
674 Ga0500645_023345 3300053730 Bacteria 1896
675 Ga0501084_0363005 3300054114 Bacteria 1224
676 Ga0590075_047614 3300059424 Bacteria 1099
677 Ga0587084_000001 3300059477 Bacteria 25091
678 Ga0587070_003876 3300059491 Bacteria 1843
679 Ga0587077_000012 3300059493 Bacteria 7540
680 Ga0587085_000135 3300059506 Bacteria 4021
681 Ga0587086_000121 3300059507 Bacteria 4082
682 Ga0587088_000056 3300059508 Bacteria 5596
683 Ga0587090_000385 3300059510 Bacteria 3556
684 Ga0587091_000248 3300059511 Bacteria 4013
685 Ga0587092_000031 3300059512 Bacteria 7735
686 Ga0587094_000035 3300059513 Bacteria 6016
687 Ga0587101_000017 3300059623 Bacteria 7819
688 Ga0587117_006144 3300059627 Bacteria 1328
689 Ga0587127_000551 3300059629 Bacteria 1771
690 Ga0587130_000142 3300059631 Bacteria 3639
691 Ga0587069_000061 3300059642 Bacteria 5440
692 Ga0587100_000016 3300059648 Bacteria 5421
693 Ga0587124_000076 3300059660 Bacteria 3643
694 Ga0587111_0000048 3300060346 Bacteria 7389
695 Ga0501082_0316856 3300060353 Bacteria 1359
696 Ga0530510_0323323 3300061734 Bacteria 1157

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0018122 Ga0495620_0018122_1792_2682 215
2 3300046537 Ga0495598_0015743 Ga0495598_0015743_771_1661 215
3 3300046539 Ga0495621_0030879 Ga0495621_0030879_468_1358 215
4 3300046675 Ga0495657_0141715 Ga0495657_0141715_558_1448 215
5 3300046663 Ga0495635_0219770 Ga0495635_0219770_79_969 216
6 3300037418 Ga0395900_0269495 Ga0395900_0269495_967_1677 223
7 3300044901 Ga0466960_0024039 Ga0466960_0024039_1870_2733 224
8 3300046476 Ga0495662_0226138 Ga0495662_0226138_37_861 231
9 3300013308 Ga0157375_10282440 Ga0157375_102824402 233
10 3300037853 Ga0436364_0891096 Ga0436364_0891096_3729_4538 235
11 3300046616 Ga0495668_0229307 Ga0495668_0229307_39_929 236
12 3300038443 Ga0395901_0098948 Ga0395901_0098948_274_1158 237
13 3300009174 Ga0105241_10020164 Ga0105241_100201644 238
14 3300009545 Ga0105237_10147307 Ga0105237_101473073 238
15 3300010375 Ga0105239_10735083 Ga0105239_107350833 238
16 3300048920 Ga0496117_0184411 Ga0496117_0184411_66_923 238
17 3300049586 Ga0501070_0000569 Ga0501070_0000569_11_766 238
18 3300049586 Ga0501070_0192141 Ga0501070_0192141_16_780 240
19 3300053084 Ga0495595_0033536 Ga0495595_0033536_10_816 241
20 3300049573 Ga0501037_0000225 Ga0501037_0000225_11489_12364 242
21 3300049574 Ga0501038_0493368 Ga0501038_0493368_32_907 242
22 3300053153 Ga0500616_0002518 Ga0500616_0002518_11957_12805 242
23 iso_pu_bacteria 2905926851 2905929399 242
24 3300046511 Ga0495608_0004783 Ga0495608_0004783_8150_9022 243
25 3300046559 Ga0495667_0000402 Ga0495667_0000402_17738_18610 243
26 iso_pu_bacteria 2643221576 2643892860 244
27 iso_pu_bacteria 2643221590 2643962309 244
28 3300005329 Ga0070683_100147207 Ga0070683_1001472072 246
29 3300025944 Ga0207661_10140936 Ga0207661_101409362 246
30 3300033179 Ga0307507_10082816 Ga0307507_100828161 246
31 3300033180 Ga0307510_10206826 Ga0307510_102068262 246
32 3300044656 Ga0466969_0044415 Ga0466969_0044415_790_1599 246
33 3300047472 Ga0495686_0282525 Ga0495686_0282525_43_879 246
34 3300031731 Ga0307405_10185122 Ga0307405_101851222 247
35 3300031901 Ga0307406_10427058 Ga0307406_104270581 247
36 3300009093 Ga0105240_10099808 Ga0105240_100998084 248
37 3300009551 Ga0105238_10017275 Ga0105238_100172753 248
38 3300030522 Ga0307512_10007529 Ga0307512_100075297 248
39 3300049571 Ga0501034_0023839 Ga0501034_0023839_5061_5846 248
40 3300049573 Ga0501037_0112354 Ga0501037_0112354_1068_1853 248
41 3300049579 Ga0501043_0042724 Ga0501043_0042724_690_1475 248
42 3300049579 Ga0501043_0527595 Ga0501043_0527595_82_867 248
43 3300049580 Ga0501046_0157522 Ga0501046_0157522_450_1235 248
44 3300049581 Ga0501047_0045354 Ga0501047_0045354_2474_3259 248
45 3300049589 Ga0501073_0172242 Ga0501073_0172242_327_1112 248
46 3300049593 Ga0501077_0155961 Ga0501077_0155961_545_1330 248
47 3300049742 Ga0501080_0000134 Ga0501080_0000134_23235_24020 248
48 3300049744 Ga0501083_0059557 Ga0501083_0059557_490_1275 248
49 3300049822 Ga0501035_0342307 Ga0501035_0342307_28_813 248
50 3300054114 Ga0501084_0363005 Ga0501084_0363005_73_858 248
51 3300021388 Ga0213875_10005353 Ga0213875_100053534 249
52 3300033545 Ga0316214_1002008 Ga0316214_10020082 249
53 3300038443 Ga0395901_0023278 Ga0395901_0023278_3568_4371 249
54 3300038443 Ga0395901_0288080 Ga0395901_0288080_794_1579 249
55 3300049568 Ga0501031_0043036 Ga0501031_0043036_982_1767 249
56 3300049569 Ga0501032_0047557 Ga0501032_0047557_964_1749 249
57 3300049570 Ga0501033_0000203 Ga0501033_0000203_11021_11806 249
58 3300049571 Ga0501034_0077122 Ga0501034_0077122_2407_3192 249
59 3300049572 Ga0501036_0014204 Ga0501036_0014204_5223_6008 249
60 3300049578 Ga0501042_0144767 Ga0501042_0144767_883_1668 249
61 3300049579 Ga0501043_0022390 Ga0501043_0022390_1792_2577 249
62 3300049579 Ga0501043_0099302 Ga0501043_0099302_34_819 249
63 3300049580 Ga0501046_0018748 Ga0501046_0018748_1475_2260 249
64 3300049583 Ga0501067_0133645 Ga0501067_0133645_382_1167 249
65 3300049588 Ga0501072_0273447 Ga0501072_0273447_310_1095 249
66 3300046455 Ga0495603_0116803 Ga0495603_0116803_376_1251 250
67 3300046492 Ga0495585_0103279 Ga0495585_0103279_445_1320 250
68 3300046499 Ga0495594_0031966 Ga0495594_0031966_1676_2551 250
69 3300046501 Ga0495607_0069964 Ga0495607_0069964_941_1816 250
70 3300046506 Ga0495583_0074848 Ga0495583_0074848_305_1180 250
71 3300046507 Ga0495606_0004805 Ga0495606_0004805_8949_9824 250
72 3300046512 Ga0495610_0063392 Ga0495610_0063392_100_975 250
73 3300046513 Ga0495616_0013185 Ga0495616_0013185_1620_2495 250
74 3300046515 Ga0495620_0004461 Ga0495620_0004461_5803_6678 250
75 3300046516 Ga0495628_0091481 Ga0495628_0091481_568_1443 250
76 3300046518 Ga0495631_0032324 Ga0495631_0032324_735_1610 250
77 3300046526 Ga0495666_0036041 Ga0495666_0036041_721_1596 250
78 3300046529 Ga0495652_0030604 Ga0495652_0030604_3033_3908 250
79 3300046530 Ga0495654_0128870 Ga0495654_0128870_154_1029 250
80 3300046557 Ga0495622_0007858 Ga0495622_0007858_376_1251 250
81 3300046616 Ga0495668_0014227 Ga0495668_0014227_447_1322 250
82 3300046660 Ga0495625_0025631 Ga0495625_0025631_3181_4056 250
83 3300046663 Ga0495635_0070706 Ga0495635_0070706_472_1347 250
84 3300046690 Ga0495624_0261162 Ga0495624_0261162_128_1003 250
85 3300046794 Ga0495589_0027582 Ga0495589_0027582_1121_1996 250
86 3300046810 Ga0495660_0081780 Ga0495660_0081780_623_1498 250
87 3300047321 Ga0495676_0036943 Ga0495676_0036943_2863_3738 250
88 3300047323 Ga0495683_0057043 Ga0495683_0057043_876_1751 250
89 3300048091 Ga0495626_0008479 Ga0495626_0008479_2233_3108 250
90 3300005539 Ga0068853_100199644 Ga0068853_1001996442 251
91 3300005548 Ga0070665_100076240 Ga0070665_1000762403 251
92 3300005563 Ga0068855_100005522 Ga0068855_1000055229 251
93 3300005578 Ga0068854_100001906 Ga0068854_10000190614 251
94 3300005616 Ga0068852_100035556 Ga0068852_1000355562 251
95 3300025904 Ga0207647_10001411 Ga0207647_1000141111 251
96 3300025911 Ga0207654_10029988 Ga0207654_100299882 251
97 3300025913 Ga0207695_10019929 Ga0207695_100199293 251
98 3300025914 Ga0207671_10001866 Ga0207671_1000186610 251
99 3300025924 Ga0207694_10285495 Ga0207694_102854953 251
100 3300025949 Ga0207667_10397099 Ga0207667_103970993 251
101 3300025981 Ga0207640_10233276 Ga0207640_102332761 251
102 3300026142 Ga0207698_10021148 Ga0207698_100211486 251
103 3300028379 Ga0268266_10070008 Ga0268266_100700083 251
104 3300031730 Ga0307516_10064212 Ga0307516_100642123 251
105 3300046454 Ga0495592_0042075 Ga0495592_0042075_1712_2587 251
106 3300046462 Ga0495651_0278319 Ga0495651_0278319_58_933 251
107 3300046533 Ga0495640_0260234 Ga0495640_0260234_64_939 251
108 3300046642 Ga0495634_0151866 Ga0495634_0151866_34_909 251
109 3300046680 Ga0495646_0057100 Ga0495646_0057100_227_1102 251
110 3300047315 Ga0495581_0016467 Ga0495581_0016467_504_1379 251
111 3300047321 Ga0495676_0051383 Ga0495676_0051383_1989_2864 251
112 3300047673 Ga0495593_0025064 Ga0495593_0025064_1883_2758 251
113 3300046499 Ga0495594_0136107 Ga0495594_0136107_508_1356 252
114 3300046529 Ga0495652_0268641 Ga0495652_0268641_435_1238 252
115 3300047472 Ga0495686_0092048 Ga0495686_0092048_330_1127 252
116 3300053104 Ga0500556_0000282 Ga0500556_0000282_30924_31766 252
117 3300005331 Ga0070670_100287151 Ga0070670_1002871512 253
118 3300014326 Ga0157380_10809113 Ga0157380_108091131 253
119 3300031548 Ga0307408_100139192 Ga0307408_1001391922 253
120 3300031903 Ga0307407_10199789 Ga0307407_101997892 253
121 3300044765 Ga0466970_0044839 Ga0466970_0044839_1429_2325 253
122 3300044901 Ga0466960_0023405 Ga0466960_0023405_1247_2143 253
123 3300030522 Ga0307512_10011457 Ga0307512_100114575 254
124 3300031456 Ga0307513_10003959 Ga0307513_1000395919 254
125 3300031507 Ga0307509_10013932 Ga0307509_100139323 254
126 3300041494 Ga0451837_0641337 Ga0451837_0641337_373_1173 254
127 3300044683 Ga0466965_0004730 Ga0466965_0004730_3560_4363 254
128 3300044735 Ga0466968_0001871 Ga0466968_0001871_3790_4593 254
129 3300044765 Ga0466970_0236514 Ga0466970_0236514_34_837 254
130 3300044842 Ga0466957_0020653 Ga0466957_0020653_2703_3506 254
131 3300044901 Ga0466960_0173329 Ga0466960_0173329_195_998 254
132 3300045049 Ga0466959_0019351 Ga0466959_0019351_4031_4834 254
133 3300045836 Ga0466958_0069880 Ga0466958_0069880_513_1316 254
134 3300045976 Ga0466967_0081394 Ga0466967_0081394_1903_2703 254
135 3300045976 Ga0466967_0372360 Ga0466967_0372360_285_1088 254
136 3300049583 Ga0501067_0300153 Ga0501067_0300153_23_823 254
137 3300049823 Ga0501044_0281133 Ga0501044_0281133_611_1471 254
138 3300050491 nmdc:mga00v17_403171_c1 nmdc:mga00v17_403171_c1_67_867 254
139 3300050492 nmdc:mga0yw44_86862_c1 nmdc:mga0yw44_86862_c1_26_826 254
140 3300053086 Ga0500578_0144435 Ga0500578_0144435_639_1445 254
141 3300053096 Ga0500641_0012501 Ga0500641_0012501_306_1106 254
142 3300003323 rootH1_10055294 rootH1_100552942 255
143 3300005563 Ga0068855_100318733 Ga0068855_1003187332 255
144 3300013104 Ga0157370_10006011 Ga0157370_100060116 255
145 3300028786 Ga0307517_10050934 Ga0307517_100509342 255
146 3300032004 Ga0307414_10117497 Ga0307414_101174973 255
147 3300044656 Ga0466969_0009413 Ga0466969_0009413_4047_4856 255
148 3300044684 Ga0466966_0017223 Ga0466966_0017223_3699_4508 255
149 3300044693 Ga0466961_0018907 Ga0466961_0018907_3158_3967 255
150 3300046459 Ga0495629_0003756 Ga0495629_0003756_10445_11254 255
151 3300046459 Ga0495629_0014354 Ga0495629_0014354_3933_4742 255
152 3300046460 Ga0495638_0145539 Ga0495638_0145539_241_1050 255
153 3300046462 Ga0495651_0033791 Ga0495651_0033791_3099_3908 255
154 3300046471 Ga0495650_0000558 Ga0495650_0000558_5362_6174 255
155 3300046473 Ga0495582_0013541 Ga0495582_0013541_3426_4235 255
156 3300046473 Ga0495582_0103776 Ga0495582_0103776_769_1575 255
157 3300046476 Ga0495662_0002738 Ga0495662_0002738_4968_5777 255
158 3300046476 Ga0495662_0010284 Ga0495662_0010284_1474_2280 255
159 3300046477 Ga0495664_0003195 Ga0495664_0003195_5410_6219 255
160 3300046499 Ga0495594_0138606 Ga0495594_0138606_269_1075 255
161 3300046514 Ga0495618_0118948 Ga0495618_0118948_86_895 255
162 3300046516 Ga0495628_0044346 Ga0495628_0044346_311_1120 255
163 3300046529 Ga0495652_0066264 Ga0495652_0066264_1112_1921 255
164 3300046533 Ga0495640_0045740 Ga0495640_0045740_1104_1913 255
165 3300046536 Ga0495587_0003896 Ga0495587_0003896_6601_7407 255
166 3300046536 Ga0495587_0009303 Ga0495587_0009303_5109_5918 255
167 3300046543 Ga0495645_0028098 Ga0495645_0028098_1513_2322 255
168 3300046543 Ga0495645_0169134 Ga0495645_0169134_19_825 255
169 3300046559 Ga0495667_0029993 Ga0495667_0029993_19_825 255
170 3300046615 Ga0495656_0152308 Ga0495656_0152308_228_1034 255
171 3300046642 Ga0495634_0009470 Ga0495634_0009470_3099_3908 255
172 3300046660 Ga0495625_0022500 Ga0495625_0022500_1079_1888 255
173 3300046660 Ga0495625_0254465 Ga0495625_0254465_271_1083 255
174 3300046663 Ga0495635_0180113 Ga0495635_0180113_10_819 255
175 3300046663 Ga0495635_0242347 Ga0495635_0242347_27_833 255
176 3300046674 Ga0495588_0021027 Ga0495588_0021027_2329_3135 255
177 3300046675 Ga0495657_0000206 Ga0495657_0000206_29763_30572 255
178 3300046680 Ga0495646_0007542 Ga0495646_0007542_4368_5177 255
179 3300046689 Ga0495613_0000367 Ga0495613_0000367_3773_4582 255
180 3300046690 Ga0495624_0071602 Ga0495624_0071602_10_819 255
181 3300046691 Ga0495670_0189227 Ga0495670_0189227_30_836 255
182 3300046692 Ga0495671_0016857 Ga0495671_0016857_397_1206 255
183 3300046809 Ga0495600_0014480 Ga0495600_0014480_2119_2925 255
184 3300046809 Ga0495600_0071668 Ga0495600_0071668_397_1206 255
185 3300047315 Ga0495581_0022959 Ga0495581_0022959_956_1765 255
186 3300047315 Ga0495581_0285079 Ga0495581_0285079_115_921 255
187 3300047317 Ga0495604_0002982 Ga0495604_0002982_11660_12469 255
188 3300047321 Ga0495676_0039869 Ga0495676_0039869_2018_2827 255
189 3300047322 Ga0495680_0090308 Ga0495680_0090308_37_843 255
190 3300047443 Ga0495687_005511 Ga0495687_005511_3587_4396 255
191 3300047444 Ga0495675_0045533 Ga0495675_0045533_1137_1943 255
192 3300047470 Ga0495681_0000253 Ga0495681_0000253_4614_5423 255
193 3300047471 Ga0495684_0301623 Ga0495684_0301623_249_1058 255
194 3300047673 Ga0495593_0020878 Ga0495593_0020878_1668_2477 255
195 3300048089 Ga0495614_0023141 Ga0495614_0023141_937_1746 255
196 3300048905 Ga0496102_0162700 Ga0496102_0162700_42_851 255
197 3300048917 Ga0496114_0048331 Ga0496114_0048331_2129_2938 255
198 3300049574 Ga0501038_0430979 Ga0501038_0430979_65_874 255
199 3300050491 nmdc:mga00v17_1997_c1 nmdc:mga00v17_1997_c1_7492_8304 255
200 3300053107 Ga0500560_000276 Ga0500560_000276_2775_3584 255
201 3300053157 Ga0500624_001992 Ga0500624_001992_1201_2010 255
202 3300025246 Ga0209646_1000192 Ga0209646_100019250 256
203 3300037471 Ga0395905_0034166 Ga0395905_0034166_1424_2233 256
204 3300042007 Ga0439449_0038334 Ga0439449_0038334_84_893 256
205 3300049574 Ga0501038_0575449 Ga0501038_0575449_20_829 256
206 3300053153 Ga0500616_0000089 Ga0500616_0000089_181933_182742 256
207 3300053730 Ga0500645_023345 Ga0500645_023345_227_1036 256
208 3300059424 Ga0590075_047614 Ga0590075_047614_218_1027 256
209 3300013105 Ga0157369_10110300 Ga0157369_101103003 257
210 3300014325 Ga0163163_10592093 Ga0163163_105920932 257
211 3300032005 Ga0307411_10310014 Ga0307411_103100143 257
212 3300033179 Ga0307507_10188201 Ga0307507_101882012 257
213 3300035242 Ga0373962_0000420 Ga0373962_0000420_7287_8150 257
214 3300045836 Ga0466958_0052816 Ga0466958_0052816_1472_2284 257
215 3300046453 Ga0495627_000352 Ga0495627_000352_25118_25930 257
216 3300046543 Ga0495645_0032423 Ga0495645_0032423_2107_2970 257
217 3300048916 Ga0496113_0255062 Ga0496113_0255062_25_837 257
218 3300049571 Ga0501034_0001033 Ga0501034_0001033_10264_11076 257
219 3300049571 Ga0501034_0139401 Ga0501034_0139401_526_1341 257
220 3300049583 Ga0501067_0085744 Ga0501067_0085744_558_1373 257
221 3300049588 Ga0501072_0031955 Ga0501072_0031955_1571_2386 257
222 3300053139 Ga0500568_0003755 Ga0500568_0003755_6951_7766 257
223 3300061734 Ga0530510_0323323 Ga0530510_0323323_26_838 257
224 3300037312 Ga0395899_0046544 Ga0395899_0046544_1733_2587 258
225 3300037418 Ga0395900_0054877 Ga0395900_0054877_156_1010 258
226 3300037466 Ga0395898_0038380 Ga0395898_0038380_167_1021 258
227 3300038443 Ga0395901_0144104 Ga0395901_0144104_1476_2330 258
228 3300048908 Ga0496105_0054451 Ga0496105_0054451_208_1023 258
229 3300048929 Ga0496126_0042168 Ga0496126_0042168_831_1646 258
230 3300049574 Ga0501038_0001877 Ga0501038_0001877_5788_6642 258
231 iso_pu_bacteria 2643221687 2644491464 258
232 iso_pu_bacteria 2946024296 2946025012 258
233 3300005331 Ga0070670_100293247 Ga0070670_1002932472 259
234 3300009098 Ga0105245_10117434 Ga0105245_101174341 259
235 3300011119 Ga0105246_10113931 Ga0105246_101139314 259
236 3300013250 Ga0171462_1001 Ga0171462_1001462 259
237 3300025925 Ga0207650_10299270 Ga0207650_102992702 259
238 3300048909 Ga0496106_0465515 Ga0496106_0465515_135_989 259
239 3300048910 Ga0496107_0103815 Ga0496107_0103815_1174_2028 259
240 3300048927 Ga0496124_0104903 Ga0496124_0104903_1142_1960 259
241 3300049569 Ga0501032_0110366 Ga0501032_0110366_975_1793 259
242 3300049572 Ga0501036_0119416 Ga0501036_0119416_1262_2080 259
243 3300049573 Ga0501037_0012159 Ga0501037_0012159_388_1206 259
244 3300049574 Ga0501038_0317029 Ga0501038_0317029_375_1193 259
245 3300049575 Ga0501039_0015717 Ga0501039_0015717_311_1129 259
246 3300049579 Ga0501043_0005999 Ga0501043_0005999_2359_3177 259
247 3300049581 Ga0501047_0139676 Ga0501047_0139676_1456_2274 259
248 3300049582 Ga0501048_0000826 Ga0501048_0000826_21889_22707 259
249 3300049586 Ga0501070_0001028 Ga0501070_0001028_1634_2452 259
250 3300049586 Ga0501070_0141255 Ga0501070_0141255_119_937 259
251 3300049589 Ga0501073_0035250 Ga0501073_0035250_416_1234 259
252 3300049823 Ga0501044_0166603 Ga0501044_0166603_845_1663 259
253 3300049824 Ga0501045_0009279 Ga0501045_0009279_874_1692 259
254 3300060353 Ga0501082_0316856 Ga0501082_0316856_100_918 259
255 3300005618 Ga0068864_100042847 Ga0068864_1000428473 260
256 3300006051 Ga0075364_10120647 Ga0075364_101206472 260
257 3300026095 Ga0207676_10174425 Ga0207676_101744251 260
258 3300053093 Ga0500651_0007780 Ga0500651_0007780_2798_3619 260
259 3300053148 Ga0500590_008902 Ga0500590_008902_1340_2161 260
260 3300053155 Ga0500620_001350 Ga0500620_001350_2526_3347 260
261 3300059506 Ga0587085_000135 Ga0587085_000135_2364_3212 260
262 3300059507 Ga0587086_000121 Ga0587086_000121_2425_3273 260
263 3300059510 Ga0587090_000385 Ga0587090_000385_300_1148 260
264 3300059511 Ga0587091_000248 Ga0587091_000248_2294_3142 260
265 3300059631 Ga0587130_000142 Ga0587130_000142_342_1190 260
266 iso_pu_bacteria 2558860280 2559425556 260
267 3300031507 Ga0307509_10080593 Ga0307509_100805932 261
268 3300031730 Ga0307516_10106039 Ga0307516_101060392 261
269 3300032126 Ga0307415_100369478 Ga0307415_1003694782 261
270 3300046517 Ga0495630_0111222 Ga0495630_0111222_427_1260 261
271 3300047319 Ga0495674_0022245 Ga0495674_0022245_3243_4076 261
272 3300049571 Ga0501034_0346388 Ga0501034_0346388_382_1215 261
273 3300049573 Ga0501037_0021352 Ga0501037_0021352_1850_2674 261
274 3300049580 Ga0501046_0000071 Ga0501046_0000071_82270_83115 261
275 3300050496 nmdc:mga07m45_166704_c1 nmdc:mga07m45_166704_c1_159_1013 261
276 3300003322 rootL2_10035491 rootL2_100354913 262
277 3300003792 Ga0055540_1011213 Ga0055540_10112133 262
278 3300009148 Ga0105243_10442023 Ga0105243_104420232 262
279 3300009545 Ga0105237_10153998 Ga0105237_101539982 262
280 3300009551 Ga0105238_10067508 Ga0105238_100675082 262
281 3300013306 Ga0163162_10099567 Ga0163162_100995674 262
282 3300025303 Ga0209051_1020243 Ga0209051_10202433 262
283 3300025914 Ga0207671_10114909 Ga0207671_101149092 262
284 3300031824 Ga0307413_10625090 Ga0307413_106250901 262
285 3300047447 Ga0495685_057869 Ga0495685_057869_454_1287 262
286 3300048905 Ga0496102_0040056 Ga0496102_0040056_2988_3824 262
287 3300048906 Ga0496103_0180870 Ga0496103_0180870_271_1107 262
288 3300048907 Ga0496104_0104230 Ga0496104_0104230_337_1173 262
289 3300048908 Ga0496105_0144649 Ga0496105_0144649_23_859 262
290 3300048910 Ga0496107_0033172 Ga0496107_0033172_1176_2012 262
291 3300048913 Ga0496110_0042786 Ga0496110_0042786_1168_2004 262
292 3300048915 Ga0496112_0135018 Ga0496112_0135018_1194_2030 262
293 3300048916 Ga0496113_0144758 Ga0496113_0144758_700_1536 262
294 3300048917 Ga0496114_0045297 Ga0496114_0045297_1451_2287 262
295 3300048918 Ga0496115_0412722 Ga0496115_0412722_50_886 262
296 3300049579 Ga0501043_0045475 Ga0501043_0045475_81_908 262
297 3300049580 Ga0501046_0008066 Ga0501046_0008066_3162_3989 262
298 iso_pu_bacteria 2643221604 2644031882 262
299 iso_pu_bacteria 2643221617 2644102809 262
300 iso_pu_bacteria 2643221620 2644118471 262
301 iso_pu_bacteria 2738541272 2738696292 262
302 iso_pu_bacteria 2852646457 2852648003 262
303 iso_pu_bacteria 2945968032 2945969265 262
304 3300046459 Ga0495629_0006664 Ga0495629_0006664_3784_4647 263
305 3300046689 Ga0495613_0001326 Ga0495613_0001326_3517_4380 263
306 3300047321 Ga0495676_0003572 Ga0495676_0003572_12733_13596 263
307 3300048089 Ga0495614_0004541 Ga0495614_0004541_4930_5793 263
308 3300048906 Ga0496103_0206905 Ga0496103_0206905_289_1119 263
309 3300049571 Ga0501034_0132802 Ga0501034_0132802_1273_2106 263
310 iso_pu_bacteria 2739367898 2740169542 263
311 iso_pu_bacteria 2751185788 2753303322 263
312 iso_pu_bacteria 2811994917 2812483449 263
313 iso_pu_bacteria 2908811453 2908815514 263
314 3300006058 Ga0075432_10008430 Ga0075432_100084303 264
315 3300025944 Ga0207661_10017840 Ga0207661_100178402 264
316 3300027907 Ga0207428_10053527 Ga0207428_100535272 264
317 3300028794 Ga0307515_10100480 Ga0307515_101004804 264
318 3300030521 Ga0307511_10000194 Ga0307511_1000019440 264
319 3300044684 Ga0466966_0060069 Ga0466966_0060069_259_1098 264
320 3300044765 Ga0466970_0062493 Ga0466970_0062493_67_906 264
321 3300045976 Ga0466967_0603939 Ga0466967_0603939_38_877 264
322 iso_pu_bacteria 2643221697 2644539117 264
323 iso_pu_bacteria 2866612099 2866612606 264
324 iso_pu_bacteria 2868088558 2868090310 264
325 iso_pu_bacteria 2984576629 2984578109 264
326 iso_pu_bacteria 2990256926 2990257623 264
327 3300031456 Ga0307513_10040155 Ga0307513_100401553 265
328 3300037466 Ga0395898_0006023 Ga0395898_0006023_4580_5422 265
329 3300038443 Ga0395901_0005007 Ga0395901_0005007_8889_9731 265
330 3300042157 Ga0439458_0051848 Ga0439458_0051848_11_865 265
331 3300044694 Ga0466963_0050792 Ga0466963_0050792_368_1210 265
332 3300045836 Ga0466958_0170159 Ga0466958_0170159_463_1305 265
333 3300045976 Ga0466967_0014483 Ga0466967_0014483_1242_2084 265
334 3300046457 Ga0495590_0000075 Ga0495590_0000075_58191_59030 265
335 3300046472 Ga0495580_0114658 Ga0495580_0114658_616_1470 265
336 3300046531 Ga0495665_0012080 Ga0495665_0012080_3240_4094 265
337 3300046615 Ga0495656_0069864 Ga0495656_0069864_394_1248 265
338 3300047315 Ga0495581_0103739 Ga0495581_0103739_257_1111 265
339 3300047469 Ga0495673_0092469 Ga0495673_0092469_180_1061 265
340 3300048922 Ga0496119_0000605 Ga0496119_0000605_42502_43542 265
341 3300053080 Ga0500635_0000064 Ga0500635_0000064_13706_14617 265
342 3300053153 Ga0500616_0000010 Ga0500616_0000010_747459_748340 265
343 iso_pu_bacteria 2565956761 2566993830 265
344 iso_pu_bacteria 2582581313 2585310760 265
345 iso_pu_bacteria 2622736605 2623500618 265
346 iso_pu_bacteria 2739367654 2739607616 265
347 iso_pu_bacteria 2784746763 2785338888 265
348 iso_pu_bacteria 2808606394 2809026496 265
349 iso_pu_bacteria 2811994879 2812354923 265
350 iso_pu_bacteria 2863404153 2863407732 265
351 iso_pu_bacteria 2904535858 2904536920 265
352 iso_pu_bacteria 2922554459 2922555343 265
353 iso_pu_bacteria 8004212874 8004215425 265
354 iso_pu_bacteria 8055037949 8055039726 265
355 3300005339 Ga0070660_100267364 Ga0070660_1002673642 266
356 3300006048 Ga0075363_100062469 Ga0075363_1000624691 266
357 3300006051 Ga0075364_10235609 Ga0075364_102356092 266
358 3300006353 Ga0075370_10074719 Ga0075370_100747192 266
359 3300025919 Ga0207657_10227729 Ga0207657_102277292 266
360 3300026041 Ga0207639_10103246 Ga0207639_101032462 266
361 3300028794 Ga0307515_10026558 Ga0307515_1002655811 266
362 3300028794 Ga0307515_10041387 Ga0307515_100413874 266
363 3300031616 Ga0307508_10078310 Ga0307508_100783105 266
364 3300031616 Ga0307508_10148644 Ga0307508_101486442 266
365 3300031824 Ga0307413_10286025 Ga0307413_102860252 266
366 3300031852 Ga0307410_10138325 Ga0307410_101383252 266
367 3300032004 Ga0307414_10392665 Ga0307414_103926652 266
368 3300032005 Ga0307411_10083770 Ga0307411_100837703 266
369 3300044683 Ga0466965_0105219 Ga0466965_0105219_14_862 266
370 3300044735 Ga0466968_0005778 Ga0466968_0005778_174_1055 266
371 3300044901 Ga0466960_0031329 Ga0466960_0031329_412_1260 266
372 3300045976 Ga0466967_0000584 Ga0466967_0000584_13447_14289 266
373 3300045976 Ga0466967_0289063 Ga0466967_0289063_315_1163 266
374 3300046519 Ga0495632_0074653 Ga0495632_0074653_360_1211 266
375 3300046616 Ga0495668_0000360 Ga0495668_0000360_36116_36973 266
376 3300048928 Ga0496125_0092225 Ga0496125_0092225_1256_2113 266
377 3300050496 nmdc:mga07m45_59229_c1 nmdc:mga07m45_59229_c1_111_968 266
378 3300053140 Ga0500573_0002950 Ga0500573_0002950_2717_3568 266
379 iso_pu_bacteria 2758568621 2760623853 266
380 iso_pu_bacteria 2833709550 2833709695 266
381 iso_pu_bacteria 2904509784 2904511379 266
382 iso_pu_bacteria 2919391150 2919393525 266
383 iso_pu_bacteria 2939657138 2939659606 266
384 iso_pu_bacteria 2945956166 2945960523 266
385 iso_pu_bacteria 2946033335 2946034579 266
386 iso_pu_bacteria 2977228692 2977232031 266
387 iso_pu_bacteria 2977236895 2977237386 266
388 iso_pu_bacteria 2984542743 2984544829 266
389 3300006038 Ga0075365_10346357 Ga0075365_103463572 267
390 3300006051 Ga0075364_10009137 Ga0075364_100091375 267
391 3300006051 Ga0075364_10110763 Ga0075364_101107632 267
392 3300013308 Ga0157375_10324619 Ga0157375_103246191 267
393 3300026067 Ga0207678_10628044 Ga0207678_106280441 267
394 3300028794 Ga0307515_10149291 Ga0307515_101492912 267
395 3300028794 Ga0307515_10214310 Ga0307515_102143102 267
396 3300031456 Ga0307513_10001658 Ga0307513_1000165822 267
397 3300031548 Ga0307408_100034128 Ga0307408_1000341282 267
398 3300031824 Ga0307413_10115553 Ga0307413_101155532 267
399 3300031838 Ga0307518_10000412 Ga0307518_1000041228 267
400 3300031852 Ga0307410_10018744 Ga0307410_100187443 267
401 3300031901 Ga0307406_10052440 Ga0307406_100524404 267
402 3300031995 Ga0307409_100006047 Ga0307409_1000060477 267
403 3300031995 Ga0307409_100288224 Ga0307409_1002882242 267
404 3300032002 Ga0307416_100225247 Ga0307416_1002252472 267
405 3300032004 Ga0307414_10219748 Ga0307414_102197481 267
406 3300033179 Ga0307507_10009303 Ga0307507_100093035 267
407 3300044658 Ga0466972_0057218 Ga0466972_0057218_470_1351 267
408 3300044684 Ga0466966_0103107 Ga0466966_0103107_286_1164 267
409 3300044765 Ga0466970_0036417 Ga0466970_0036417_279_1157 267
410 3300045049 Ga0466959_0005086 Ga0466959_0005086_404_1282 267
411 3300046453 Ga0495627_010387 Ga0495627_010387_1838_2689 267
412 3300049580 Ga0501046_0002217 Ga0501046_0002217_1689_2564 267
413 3300049586 Ga0501070_0048064 Ga0501070_0048064_429_1280 267
414 3300050492 nmdc:mga0yw44_359986_c1 nmdc:mga0yw44_359986_c1_112_954 267
415 3300053140 Ga0500573_0024767 Ga0500573_0024767_1147_1989 267
416 iso_pu_bacteria 2523231044 2523384334 267
417 iso_pu_bacteria 2643221567 2643851247 267
418 iso_pu_bacteria 2643221624 2644138118 267
419 iso_pu_bacteria 2773857758 2774381890 267
420 iso_pu_bacteria 2773857763 2774400400 267
421 iso_pu_bacteria 2821268502 2821268863 267
422 iso_pu_bacteria 2844841374 2844843168 267
423 iso_pu_bacteria 2908678064 2908679902 267
424 iso_pu_bacteria 2919055335 2919058657 267
425 iso_pu_bacteria 2928153084 2928153305 267
426 iso_pu_bacteria 2977264416 2977267378 267
427 iso_pu_bacteria 8056579771 8056582505 267
428 3300006038 Ga0075365_10000074 Ga0075365_1000007413 268
429 3300006038 Ga0075365_10001691 Ga0075365_100016919 268
430 3300006051 Ga0075364_10053696 Ga0075364_100536962 268
431 3300006051 Ga0075364_10182612 Ga0075364_101826122 268
432 3300006178 Ga0075367_10014844 Ga0075367_100148443 268
433 3300006353 Ga0075370_10097603 Ga0075370_100976032 268
434 3300020082 Ga0206353_11489331 Ga0206353_114893312 268
435 3300028379 Ga0268266_10363727 Ga0268266_103637272 268
436 3300031649 Ga0307514_10063841 Ga0307514_100638411 268
437 3300031824 Ga0307413_10039100 Ga0307413_100391003 268
438 3300031911 Ga0307412_10024159 Ga0307412_100241593 268
439 3300031911 Ga0307412_10057256 Ga0307412_100572562 268
440 3300032002 Ga0307416_100002272 Ga0307416_1000022722 268
441 3300032002 Ga0307416_100317519 Ga0307416_1003175192 268
442 3300037466 Ga0395898_0000256 Ga0395898_0000256_46349_47254 268
443 3300044683 Ga0466965_0024111 Ga0466965_0024111_1544_2416 268
444 3300047443 Ga0495687_044913 Ga0495687_044913_68_919 268
445 3300048907 Ga0496104_0003058 Ga0496104_0003058_13117_13986 268
446 3300048911 Ga0496108_0211814 Ga0496108_0211814_519_1388 268
447 3300049586 Ga0501070_0000524 Ga0501070_0000524_21174_22085 268
448 3300050491 nmdc:mga00v17_85220_c1 nmdc:mga00v17_85220_c1_298_1152 268
449 3300050492 nmdc:mga0yw44_30856_c1 nmdc:mga0yw44_30856_c1_12_860 268
450 3300050496 nmdc:mga07m45_182575_c1 nmdc:mga07m45_182575_c1_11_880 268
451 3300050516 nmdc:mga0sz30_1528_c1 nmdc:mga0sz30_1528_c1_3069_3923 268
452 3300053085 Ga0495619_0028909 Ga0495619_0028909_228_1079 268
453 3300053096 Ga0500641_0000256 Ga0500641_0000256_4622_5470 268
454 3300053108 Ga0500562_000728 Ga0500562_000728_2359_3213 268
455 3300053117 Ga0500593_000801 Ga0500593_000801_2351_3205 268
456 3300053133 Ga0500655_005387 Ga0500655_005387_1290_2144 268
457 3300053136 Ga0500559_0000373 Ga0500559_0000373_826_1680 268
458 3300059477 Ga0587084_000001 Ga0587084_000001_13696_14544 268
459 3300059491 Ga0587070_003876 Ga0587070_003876_855_1703 268
460 3300059493 Ga0587077_000012 Ga0587077_000012_5883_6731 268
461 3300059508 Ga0587088_000056 Ga0587088_000056_4356_5204 268
462 3300059512 Ga0587092_000031 Ga0587092_000031_6078_6926 268
463 3300059513 Ga0587094_000035 Ga0587094_000035_4360_5208 268
464 3300059623 Ga0587101_000017 Ga0587101_000017_810_1658 268
465 3300059627 Ga0587117_006144 Ga0587117_006144_203_1051 268
466 3300059629 Ga0587127_000551 Ga0587127_000551_805_1653 268
467 3300059642 Ga0587069_000061 Ga0587069_000061_3784_4632 268
468 3300059648 Ga0587100_000016 Ga0587100_000016_880_1728 268
469 3300059660 Ga0587124_000076 Ga0587124_000076_2126_2974 268
470 3300060346 Ga0587111_0000048 Ga0587111_0000048_805_1653 268
471 iso_pu_bacteria 2582581312 2585297155 268
472 iso_pu_bacteria 2643221546 2643753322 268
473 iso_pu_bacteria 2643221575 2643888358 268
474 iso_pu_bacteria 2654587600 2655033417 268
475 iso_pu_bacteria 2808606306 2808629854 268
476 iso_pu_bacteria 2862507626 2862515615 268
477 iso_pu_bacteria 2897561785 2897562360 268
478 iso_pu_bacteria 2899359706 2899361575 268
479 iso_pu_bacteria 2919446982 2919448308 268
480 iso_pu_bacteria 2939660829 2939661207 268
481 iso_pu_bacteria 8004025490 8004025644 268
482 3300003578 Ga0006562J51391_1209490 Ga0006562J51391_12094903 269
483 3300003578 Ga0006562J51391_1209491 Ga0006562J51391_12094917 269
484 3300003756 Ga0055533_1000001 Ga0055533_10000011504 269
485 3300003759 Ga0055525_1000330 Ga0055525_100033013 269
486 3300005937 Ga0081455_10008614 Ga0081455_100086143 269
487 3300025225 Ga0209566_100053 Ga0209566_10005390 269
488 3300025226 Ga0209674_100001 Ga0209674_1000011505 269
489 3300025230 Ga0209563_100001 Ga0209563_1000011505 269
490 3300025253 Ga0209677_100001 Ga0209677_1000011505 269
491 3300025972 Ga0207668_10208879 Ga0207668_102088792 269
492 3300028786 Ga0307517_10005202 Ga0307517_1000520210 269
493 3300028794 Ga0307515_10000189 Ga0307515_10000189128 269
494 3300030521 Ga0307511_10000824 Ga0307511_100008249 269
495 3300030521 Ga0307511_10075469 Ga0307511_100754693 269
496 3300030522 Ga0307512_10151248 Ga0307512_101512482 269
497 3300031507 Ga0307509_10025555 Ga0307509_100255554 269
498 3300031507 Ga0307509_10061064 Ga0307509_100610643 269
499 3300031507 Ga0307509_10103294 Ga0307509_101032943 269
500 3300031616 Ga0307508_10061681 Ga0307508_100616812 269
501 3300031616 Ga0307508_10100940 Ga0307508_101009402 269
502 3300031730 Ga0307516_10045235 Ga0307516_100452352 269
503 3300031838 Ga0307518_10175499 Ga0307518_101754991 269
504 3300031995 Ga0307409_100327823 Ga0307409_1003278232 269
505 3300032004 Ga0307414_10066312 Ga0307414_100663122 269
506 3300033179 Ga0307507_10023801 Ga0307507_100238012 269
507 3300033179 Ga0307507_10057799 Ga0307507_100577992 269
508 3300033180 Ga0307510_10033562 Ga0307510_100335625 269
509 3300033180 Ga0307510_10103362 Ga0307510_101033622 269
510 3300037312 Ga0395899_0011272 Ga0395899_0011272_1729_2598 269
511 3300037312 Ga0395899_0020111 Ga0395899_0020111_2213_3082 269
512 3300037466 Ga0395898_0003736 Ga0395898_0003736_14047_14916 269
513 3300037466 Ga0395898_0076921 Ga0395898_0076921_1803_2672 269
514 3300037466 Ga0395898_0232569 Ga0395898_0232569_22_903 269
515 3300037471 Ga0395905_0445427 Ga0395905_0445427_244_1113 269
516 3300038443 Ga0395901_0001692 Ga0395901_0001692_8714_9583 269
517 3300038443 Ga0395901_0095473 Ga0395901_0095473_1751_2632 269
518 3300038443 Ga0395901_0382965 Ga0395901_0382965_376_1245 269
519 3300038443 Ga0395901_0412286 Ga0395901_0412286_122_1036 269
520 3300041404 Ga0439436_0020261 Ga0439436_0020261_1073_1927 269
521 3300041999 Ga0439433_0007739 Ga0439433_0007739_203_1057 269
522 3300042007 Ga0439449_0035166 Ga0439449_0035166_815_1669 269
523 3300042014 Ga0439457_002025 Ga0439457_002025_4339_5193 269
524 3300044656 Ga0466969_0152838 Ga0466969_0152838_101_970 269
525 3300044693 Ga0466961_0105952 Ga0466961_0105952_241_1110 269
526 3300046506 Ga0495583_0022213 Ga0495583_0022213_470_1345 269
527 3300046515 Ga0495620_0001179 Ga0495620_0001179_4642_5517 269
528 3300046531 Ga0495665_0037615 Ga0495665_0037615_1011_1898 269
529 3300046533 Ga0495640_0024818 Ga0495640_0024818_711_1586 269
530 3300046535 Ga0495586_0038016 Ga0495586_0038016_382_1269 269
531 3300046542 Ga0495597_0023607 Ga0495597_0023607_1032_1907 269
532 3300046559 Ga0495667_0200542 Ga0495667_0200542_307_1182 269
533 3300046648 Ga0495611_0095848 Ga0495611_0095848_187_1062 269
534 3300046675 Ga0495657_0041189 Ga0495657_0041189_1481_2356 269
535 3300046809 Ga0495600_0045170 Ga0495600_0045170_66_941 269
536 3300047315 Ga0495581_0004793 Ga0495581_0004793_1656_2543 269
537 3300047315 Ga0495581_0011256 Ga0495581_0011256_3487_4365 269
538 3300047315 Ga0495581_0072907 Ga0495581_0072907_420_1310 269
539 3300047317 Ga0495604_0029703 Ga0495604_0029703_1178_2053 269
540 3300047323 Ga0495683_0032612 Ga0495683_0032612_902_1777 269
541 3300047443 Ga0495687_012184 Ga0495687_012184_3374_4249 269
542 3300047443 Ga0495687_080310 Ga0495687_080310_223_1098 269
543 3300047673 Ga0495593_0049420 Ga0495593_0049420_1100_1975 269
544 3300048919 Ga0496116_0109688 Ga0496116_0109688_29_916 269
545 3300048920 Ga0496117_0008044 Ga0496117_0008044_6351_7238 269
546 3300048920 Ga0496117_0070251 Ga0496117_0070251_330_1217 269
547 3300048921 Ga0496118_0037908 Ga0496118_0037908_892_1779 269
548 3300048925 Ga0496122_0029005 Ga0496122_0029005_2783_3661 269
549 3300048928 Ga0496125_0027233 Ga0496125_0027233_1914_2792 269
550 3300048929 Ga0496126_0150392 Ga0496126_0150392_987_1865 269
551 3300049570 Ga0501033_0000422 Ga0501033_0000422_5893_6777 269
552 3300049570 Ga0501033_0266013 Ga0501033_0266013_103_954 269
553 iso_pu_bacteria 2537561592 2537899229 269
554 iso_pu_bacteria 2616644814 2616696124 269
555 iso_pu_bacteria 2643221597 2643995000 269
556 iso_pu_bacteria 2739367653 2739603329 269
557 iso_pu_bacteria 2816332305 2817508119 269
558 iso_pu_bacteria 2857479173 2857479192 269
559 iso_pu_bacteria 2857632687 2857632804 269
560 iso_pu_bacteria 2857723135 2857727161 269
561 iso_pu_bacteria 2857727296 2857727405 269
562 iso_pu_bacteria 2870804320 2870806006 269
563 iso_pu_bacteria 2910809715 2910814430 269
564 iso_pu_bacteria 2919034639 2919038221 269
565 iso_pu_bacteria 2919051321 2919053513 269
566 iso_pu_bacteria 2919069694 2919072829 269
567 iso_pu_bacteria 2919538618 2919541155 269
568 iso_pu_bacteria 2932426870 2932427298 269
569 iso_pu_bacteria 2939582691 2939582743 269
570 iso_pu_bacteria 2939674588 2939676851 269
571 3300003578 Ga0006562J51391_1111915 Ga0006562J51391_111191515 270
572 3300003578 Ga0006562J51391_1111917 Ga0006562J51391_11119178 270
573 3300005985 Ga0081539_10006285 Ga0081539_100062857 270
574 3300031548 Ga0307408_100157919 Ga0307408_1001579192 270
575 3300031852 Ga0307410_10021437 Ga0307410_100214372 270
576 3300031852 Ga0307410_10369755 Ga0307410_103697552 270
577 3300031903 Ga0307407_10267718 Ga0307407_102677182 270
578 3300032002 Ga0307416_100456828 Ga0307416_1004568282 270
579 3300045049 Ga0466959_0274148 Ga0466959_0274148_252_1112 270
580 3300046472 Ga0495580_0030566 Ga0495580_0030566_1585_2448 270
581 3300048905 Ga0496102_0237422 Ga0496102_0237422_692_1555 270
582 3300048906 Ga0496103_0250639 Ga0496103_0250639_145_1008 270
583 3300048916 Ga0496113_0495337 Ga0496113_0495337_24_887 270
584 3300048925 Ga0496122_0011187 Ga0496122_0011187_1881_2783 270
585 3300048926 Ga0496123_0005519 Ga0496123_0005519_4446_5348 270
586 3300049569 Ga0501032_0021647 Ga0501032_0021647_39_902 270
587 3300049570 Ga0501033_0004260 Ga0501033_0004260_4198_5052 270
588 3300049570 Ga0501033_0019120 Ga0501033_0019120_2614_3468 270
589 3300049570 Ga0501033_0118334 Ga0501033_0118334_445_1299 270
590 3300049571 Ga0501034_0000042 Ga0501034_0000042_165059_165922 270
591 3300049571 Ga0501034_0010152 Ga0501034_0010152_6630_7484 270
592 3300049572 Ga0501036_0007959 Ga0501036_0007959_6102_6956 270
593 3300049572 Ga0501036_0055755 Ga0501036_0055755_1566_2420 270
594 3300049572 Ga0501036_0071418 Ga0501036_0071418_224_1078 270
595 3300049573 Ga0501037_0011416 Ga0501037_0011416_1474_2328 270
596 3300049573 Ga0501037_0023217 Ga0501037_0023217_1800_2654 270
597 3300049573 Ga0501037_0153546 Ga0501037_0153546_542_1396 270
598 3300049574 Ga0501038_0008985 Ga0501038_0008985_3327_4181 270
599 3300049575 Ga0501039_0016214 Ga0501039_0016214_2013_2867 270
600 3300049578 Ga0501042_0026205 Ga0501042_0026205_819_1673 270
601 3300049579 Ga0501043_0004371 Ga0501043_0004371_5314_6168 270
602 3300049580 Ga0501046_0002191 Ga0501046_0002191_11562_12416 270
603 3300049580 Ga0501046_0093917 Ga0501046_0093917_584_1438 270
604 3300049581 Ga0501047_0036556 Ga0501047_0036556_347_1201 270
605 3300049581 Ga0501047_0044973 Ga0501047_0044973_1931_2785 270
606 3300049581 Ga0501047_0049528 Ga0501047_0049528_1483_2337 270
607 3300049581 Ga0501047_0055264 Ga0501047_0055264_1220_2074 270
608 3300049582 Ga0501048_0009404 Ga0501048_0009404_1483_2337 270
609 3300049586 Ga0501070_0230528 Ga0501070_0230528_523_1377 270
610 3300049586 Ga0501070_0298765 Ga0501070_0298765_264_1118 270
611 3300049589 Ga0501073_0020944 Ga0501073_0020944_538_1392 270
612 3300049590 Ga0501074_0016706 Ga0501074_0016706_3799_4653 270
613 3300049742 Ga0501080_0076432 Ga0501080_0076432_326_1180 270
614 3300049742 Ga0501080_0096254 Ga0501080_0096254_1496_2350 270
615 3300049822 Ga0501035_0011940 Ga0501035_0011940_1425_2279 270
616 3300049822 Ga0501035_0013921 Ga0501035_0013921_1654_2508 270
617 3300049822 Ga0501035_0031423 Ga0501035_0031423_2504_3358 270
618 3300049823 Ga0501044_0032155 Ga0501044_0032155_3419_4273 270
619 3300049823 Ga0501044_0035611 Ga0501044_0035611_4198_5052 270
620 3300049823 Ga0501044_0052806 Ga0501044_0052806_1483_2337 270
621 3300049823 Ga0501044_0106641 Ga0501044_0106641_477_1331 270
622 3300049824 Ga0501045_0084610 Ga0501045_0084610_647_1501 270
623 3300053083 Ga0495655_0001072 Ga0495655_0001072_1302_2165 270
624 3300053730 Ga0500645_010320 Ga0500645_010320_1624_2508 270
625 iso_pu_bacteria 2585428157 2588109082 270
626 iso_pu_bacteria 2643221724 2644679333 270
627 iso_pu_bacteria 2728369380 2730228852 270
628 iso_pu_bacteria 2857737099 2857739644 270
629 iso_pu_bacteria 2920879853 2920881380 270
630 iso_pu_bacteria 2928142448 2928146591 270
631 iso_pu_bacteria 8004182704 8004183679 270
632 iso_pu_bacteria 8057345674 8057346269 270
633 3300003762 Ga0055542_1000427 Ga0055542_100042728 271
634 3300003763 Ga0055529_1000571 Ga0055529_100057116 271
635 3300005327 Ga0070658_10105547 Ga0070658_101055472 271
636 3300005347 Ga0070668_100000560 Ga0070668_1000005608 271
637 3300005347 Ga0070668_100044032 Ga0070668_1000440325 271
638 3300005530 Ga0070679_100158901 Ga0070679_1001589012 271
639 3300005548 Ga0070665_100115555 Ga0070665_1001155554 271
640 3300005618 Ga0068864_100210238 Ga0068864_1002102382 271
641 3300005842 Ga0068858_100011201 Ga0068858_1000112016 271
642 3300005843 Ga0068860_100168878 Ga0068860_1001688783 271
643 3300005983 Ga0081540_1010901 Ga0081540_10109014 271
644 3300009094 Ga0111539_10258735 Ga0111539_102587352 271
645 3300009098 Ga0105245_10502714 Ga0105245_105027142 271
646 3300009148 Ga0105243_10060287 Ga0105243_100602872 271
647 3300009553 Ga0105249_10155161 Ga0105249_101551612 271
648 3300013105 Ga0157369_10143141 Ga0157369_101431413 271
649 3300014326 Ga0157380_10006897 Ga0157380_100068975 271
650 3300014326 Ga0157380_10467656 Ga0157380_104676562 271
651 3300014968 Ga0157379_10597026 Ga0157379_105970262 271
652 3300017792 Ga0163161_10319712 Ga0163161_103197122 271
653 3300020070 Ga0206356_10506699 Ga0206356_105066992 271
654 3300020081 Ga0206354_10181118 Ga0206354_101811183 271
655 3300020082 Ga0206353_10162159 Ga0206353_101621595 271
656 3300025228 Ga0209672_100039 Ga0209672_100039268 271
657 3300025229 Ga0209147_102885 Ga0209147_1028853 271
658 3300025253 Ga0209677_100378 Ga0209677_10037826 271
659 3300025254 Ga0209148_1000004 Ga0209148_1000004268 271
660 3300025272 Ga0209455_1000377 Ga0209455_100037729 271
661 3300025901 Ga0207688_10012150 Ga0207688_100121502 271
662 3300025908 Ga0207643_10053036 Ga0207643_100530362 271
663 3300025909 Ga0207705_10076475 Ga0207705_100764752 271
664 3300025921 Ga0207652_10136467 Ga0207652_101364672 271
665 3300025923 Ga0207681_10103573 Ga0207681_101035732 271
666 3300025935 Ga0207709_10022715 Ga0207709_100227152 271
667 3300025961 Ga0207712_10239305 Ga0207712_102393052 271
668 3300025972 Ga0207668_10000481 Ga0207668_100004818 271
669 3300026095 Ga0207676_10118215 Ga0207676_101182152 271
670 3300026116 Ga0207674_10221300 Ga0207674_102213002 271
671 3300026118 Ga0207675_100095849 Ga0207675_1000958492 271
672 3300026121 Ga0207683_10114464 Ga0207683_101144642 271
673 3300028379 Ga0268266_10161904 Ga0268266_101619043 271
674 3300028380 Ga0268265_10036705 Ga0268265_100367054 271
675 3300028380 Ga0268265_10161472 Ga0268265_101614722 271
676 3300031507 Ga0307509_10022228 Ga0307509_100222283 271
677 3300031616 Ga0307508_10003658 Ga0307508_1000365817 271
678 3300031852 Ga0307410_10138062 Ga0307410_101380622 271
679 3300031901 Ga0307406_10072553 Ga0307406_100725532 271
680 3300031901 Ga0307406_10137549 Ga0307406_101375492 271
681 3300031911 Ga0307412_10392120 Ga0307412_103921202 271
682 3300033179 Ga0307507_10165311 Ga0307507_101653111 271
683 3300034957 Ga0373938_0011954 Ga0373938_0011954_56_919 271
684 3300035088 Ga0373940_0001334 Ga0373940_0001334_300_1163 271
685 3300035207 Ga0373942_0001388 Ga0373942_0001388_4034_4897 271
686 3300037312 Ga0395899_0050283 Ga0395899_0050283_1901_2869 271
687 3300037418 Ga0395900_0088650 Ga0395900_0088650_663_1631 271
688 3300037418 Ga0395900_0116325 Ga0395900_0116325_767_1627 271
689 3300037466 Ga0395898_0009444 Ga0395898_0009444_7669_8559 271
690 3300044658 Ga0466972_0023059 Ga0466972_0023059_2103_2963 271
691 3300044901 Ga0466960_0044342 Ga0466960_0044342_1199_2059 271
692 3300047315 Ga0495581_0113894 Ga0495581_0113894_398_1294 271
693 3300048906 Ga0496103_0031930 Ga0496103_0031930_436_1356 271
694 3300048908 Ga0496105_0046766 Ga0496105_0046766_811_1731 271
695 3300048911 Ga0496108_0000100 Ga0496108_0000100_52923_53813 271
696 3300048917 Ga0496114_0155028 Ga0496114_0155028_956_1876 271
697 3300048918 Ga0496115_0354322 Ga0496115_0354322_148_1068 271
698 3300048920 Ga0496117_0000394 Ga0496117_0000394_2686_3543 271
699 3300048921 Ga0496118_0084493 Ga0496118_0084493_1148_2005 271
700 3300048925 Ga0496122_0033605 Ga0496122_0033605_2104_2961 271
701 3300048928 Ga0496125_0012426 Ga0496125_0012426_2811_3668 271
702 3300048928 Ga0496125_0130172 Ga0496125_0130172_711_1568 271
703 3300048929 Ga0496126_0016360 Ga0496126_0016360_2012_2869 271
704 3300048929 Ga0496126_0175586 Ga0496126_0175586_176_1096 271
705 3300049571 Ga0501034_0012846 Ga0501034_0012846_3146_4042 271
706 3300049575 Ga0501039_0422712 Ga0501039_0422712_95_1015 271
707 3300050491 nmdc:mga00v17_144910_c1 nmdc:mga00v17_144910_c1_414_1280 271
708 iso_pu_bacteria 2643221542 2643734962 271
709 iso_pu_bacteria 2643221549 2643768978 271
710 iso_pu_bacteria 2643221553 2643783427 271
711 iso_pu_bacteria 2643221619 2644112404 271
712 iso_pu_bacteria 2643221630 2644173122 271
713 iso_pu_bacteria 2747842429 2747954324 271
714 iso_pu_bacteria 2751185782 2753263784 271
715 iso_pu_bacteria 2808606372 2808900546 271
716 iso_pu_bacteria 2852632344 2852633855 271
717 iso_pu_bacteria 2870801768 2870804147 271
718 iso_pu_bacteria 2919443155 2919445129 271
719 iso_pu_bacteria 2935409751 2935411671 271
720 iso_pu_bacteria 2946041624 2946043353 271
721 iso_pu_bacteria 2946080515 2946081700 271
722 3300005329 Ga0070683_100331821 Ga0070683_1003318212 272
723 3300028794 Ga0307515_10000436 Ga0307515_1000043688 272
724 3300031730 Ga0307516_10005460 Ga0307516_1000546014 272
725 3300031901 Ga0307406_10001204 Ga0307406_100012043 272
726 3300046615 Ga0495656_0020545 Ga0495656_0020545_321_1181 272
727 3300046615 Ga0495656_0125319 Ga0495656_0125319_75_935 272
728 3300048925 Ga0496122_0072498 Ga0496122_0072498_1178_2065 272
729 iso_pu_bacteria 2643221649 2644279684 272
730 iso_pu_bacteria 2802429296 2804847151 272
731 iso_pu_bacteria 8025413630 8025414379 272
732 iso_pu_bacteria 8055172936 8055181567 272
733 3300005327 Ga0070658_10009760 Ga0070658_100097603 273
734 3300005338 Ga0068868_100268046 Ga0068868_1002680462 273
735 3300005563 Ga0068855_100167483 Ga0068855_1001674832 273
736 3300005577 Ga0068857_100001028 Ga0068857_1000010286 273
737 3300005577 Ga0068857_100049400 Ga0068857_1000494002 273
738 3300005614 Ga0068856_100193332 Ga0068856_1001933322 273
739 3300005616 Ga0068852_100003952 Ga0068852_1000039522 273
740 3300005616 Ga0068852_100012604 Ga0068852_1000126047 273
741 3300005834 Ga0068851_10000008 Ga0068851_10000008171 273
742 3300005842 Ga0068858_100000096 Ga0068858_10000009622 273
743 3300009093 Ga0105240_10424377 Ga0105240_104243772 273
744 3300009098 Ga0105245_10071744 Ga0105245_100717443 273
745 3300009174 Ga0105241_10006075 Ga0105241_100060758 273
746 3300009177 Ga0105248_10036889 Ga0105248_100368895 273
747 3300009545 Ga0105237_10000688 Ga0105237_1000068827 273
748 3300009551 Ga0105238_10006959 Ga0105238_100069592 273
749 3300010375 Ga0105239_10113586 Ga0105239_101135862 273
750 3300010375 Ga0105239_10190119 Ga0105239_101901192 273
751 3300014969 Ga0157376_10656637 Ga0157376_106566372 273
752 3300025254 Ga0209148_1002409 Ga0209148_10024094 273
753 3300025321 Ga0207656_10000005 Ga0207656_10000005172 273
754 3300025911 Ga0207654_10000001 Ga0207654_10000001714 273
755 3300025914 Ga0207671_10000016 Ga0207671_10000016288 273
756 3300025924 Ga0207694_10000196 Ga0207694_1000019647 273
757 3300025927 Ga0207687_10042745 Ga0207687_100427453 273
758 3300025941 Ga0207711_10135194 Ga0207711_101351942 273
759 3300026023 Ga0207677_10245924 Ga0207677_102459242 273
760 3300026035 Ga0207703_10001625 Ga0207703_1000162522 273
761 3300026078 Ga0207702_10054536 Ga0207702_100545362 273
762 3300026078 Ga0207702_10182105 Ga0207702_101821051 273
763 3300026116 Ga0207674_10000405 Ga0207674_1000040535 273
764 3300026142 Ga0207698_10000078 Ga0207698_1000007850 273
765 3300026142 Ga0207698_10002196 Ga0207698_1000219610 273
766 3300048923 Ga0496120_0002952 Ga0496120_0002952_288_1151 273
767 3300048925 Ga0496122_0091889 Ga0496122_0091889_384_1256 273
768 3300049571 Ga0501034_0036310 Ga0501034_0036310_1664_2542 273
769 3300049579 Ga0501043_0147350 Ga0501043_0147350_57_935 273
770 3300049586 Ga0501070_0003400 Ga0501070_0003400_8312_9190 273
771 3300049587 Ga0501071_0008372 Ga0501071_0008372_3718_4596 273
772 iso_pu_bacteria 2643221572 2643877045 273
773 iso_pu_bacteria 2643221669 2644384100 273
774 3300005329 Ga0070683_100274017 Ga0070683_1002740172 274
775 3300005338 Ga0068868_100096268 Ga0068868_1000962682 274
776 3300005339 Ga0070660_100054836 Ga0070660_1000548363 274
777 3300005366 Ga0070659_100000749 Ga0070659_10000074912 274
778 3300005367 Ga0070667_100049296 Ga0070667_1000492963 274
779 3300005466 Ga0070685_10033968 Ga0070685_100339683 274
780 3300005539 Ga0068853_100001645 Ga0068853_10000164515 274
781 3300005543 Ga0070672_100202532 Ga0070672_1002025322 274
782 3300005616 Ga0068852_100151450 Ga0068852_1001514502 274
783 3300005841 Ga0068863_100057676 Ga0068863_1000576762 274
784 3300006038 Ga0075365_10095488 Ga0075365_100954882 274
785 3300009177 Ga0105248_10000713 Ga0105248_1000071326 274
786 3300009551 Ga0105238_10055894 Ga0105238_100558944 274
787 3300014325 Ga0163163_10149343 Ga0163163_101493432 274
788 3300014968 Ga0157379_10042903 Ga0157379_100429032 274
789 3300025913 Ga0207695_10009355 Ga0207695_100093554 274
790 3300025919 Ga0207657_10023164 Ga0207657_100231642 274
791 3300025921 Ga0207652_10342280 Ga0207652_103422802 274
792 3300025932 Ga0207690_10002298 Ga0207690_100022988 274
793 3300025940 Ga0207691_10268967 Ga0207691_102689672 274
794 3300025944 Ga0207661_10194858 Ga0207661_101948582 274
795 3300025949 Ga0207667_10001482 Ga0207667_1000148221 274
796 3300026023 Ga0207677_10029357 Ga0207677_100293572 274
797 3300026041 Ga0207639_10040609 Ga0207639_100406092 274
798 3300026088 Ga0207641_10010811 Ga0207641_100108115 274
799 3300048923 Ga0496120_0047737 Ga0496120_0047737_1560_2441 274
800 3300050492 nmdc:mga0yw44_46195_c1 nmdc:mga0yw44_46195_c1_30_896 274
801 3300050516 nmdc:mga0sz30_26287_c1 nmdc:mga0sz30_26287_c1_156_1022 274
802 3300053080 Ga0500635_0036677 Ga0500635_0036677_257_1138 274
803 3300053136 Ga0500559_0007855 Ga0500559_0007855_3567_4433 274
804 3300053140 Ga0500573_0187854 Ga0500573_0187854_118_1014 274
805 iso_pu_bacteria 2808606700 2810362858 274
806 iso_pu_bacteria 2895660088 2895662173 274
807 iso_pu_bacteria 2852663356 2852665727 275
808 iso_pu_bacteria 2946003308 2946005808 275
809 iso_pu_bacteria 2643221616 2644096630 277
810 3300002772 JGI25164J39214_1000649 JGI25164J39214_10006498 278
811 3300003214 JGI25165J46597_1000174 JGI25165J46597_100017416 278
812 3300025231 Ga0207427_100010 Ga0207427_100010595 278
813 3300025261 Ga0209233_1000001 Ga0209233_10000011354 278
814 iso_pu_bacteria 2884763398 2884766153 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

225

320

0.99

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

46

223

0.97

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

46

146

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 0.9448 6 35
6aa8-assembly1.cif.gz_F crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with nad+ 0.9437 7 268
3hdh-assembly1.cif.gz_B pig heart short chain l-3-hydroxyacyl coa dehydrogenase revisited: sequence analysis and crystal structure determination 0.9435 4 268
4r1n-assembly1.cif.gz_A crystal structure of (s)-3-hydroxybutylryl-coa dehydrogenase form the n-butanol sysnthesizing bacterium, clostridium butyricum. 0.9423 6 268
6hrd-assembly2.cif.gz_D crystal structure of m. tuberculosis fadb2 (rv0468) 0.9421 4 268
ID Description Score Start End Superfamily
6hrdD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9881 181 264 1.10.1040.10
4kueA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9831 181 264 1.10.1040.10
4kueB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9825 181 264 1.10.1040.10
6acqA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9824 181 264 1.10.1040.10
4kuhF02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9823 181 264 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A537GWX2-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9896 120 268 GO:0006631
GO:0016616
GO:0070403
AF-A0A7Y2M4B1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9847 2 270 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A7W0XUR0-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase family protein 0.9838 117 268 GO:0006631
GO:0009056
GO:0016616
GO:0070403
AF-A0A537GIM5-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9829 103 268 GO:0006631
GO:0016616
GO:0070403
AF-A0A7V2TWC1-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase 0.9828 118 268 GO:0006635
GO:0008691
GO:0070403

Feature Viewer

pLDDT pTM Quality
90.25 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map