F481993

General Info

Members Datasets Scaffolds Average Seq Length
814 572 470 303

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0019884|Ga0495610_0019884_521_1567
Length 348
Sequence MALDASLFFVLTGEACHDTMVRKIRILWMNYPENRDREMRRITFDLDVLRTFATGMDLGNFARAADRLGRSTSAVSAQLKKLEEQAGTPIFRKSGRGLALTEAGETMLAYARRLLDLNDEAVAAVQSVELEGWVRLGLQEDFGENLLPEVLGRFARAHPKVRIEARVVRNAELLERVTTGKLDLALAWSTGTLTAHCEYIADVPMRWIGPANGLPAWAAGGGEPMPLASLEAPCLLRNAATKVLDEAGISWRLSFVSPSLGGLWAATAAGLGITVRTPIGLPAKVRMLTSGEAGLPELPKLGLVLHRAEAEPDAATSRLAELVLQSVHEAVRDISIPSDQEKALRRFG

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
12 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
15 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
16 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
17 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
18 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
19 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
20 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
21 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
28 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
31 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
32 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
33 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
34 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
35 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
36 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
39 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
40 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
41 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
42 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
43 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
44 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
45 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
46 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
47 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
48 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
49 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
50 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
51 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
52 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
53 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
54 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
55 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
56 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
57 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
58 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
59 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
60 2643221599 Rhizobium sp. Root708 Isolate Unclassified
61 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
62 2643221693 Rhizobium sp. Root491 Isolate Unclassified
63 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
64 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
65 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
66 2718217882 Rhizobium sp. N741 Isolate Nodule
67 2718217927 Rhizobium sp. N324 Isolate Nodule
68 2718218009 Rhizobium sp. N561 Isolate Nodule
69 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
70 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
71 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
72 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
73 2718218363 Rhizobium sp. N113 Isolate Nodule
74 2718218365 Rhizobium sp. N731 Isolate Nodule
75 2718218366 Rhizobium sp. N621 Isolate Nodule
76 2718218423 Rhizobium sp. N941 Isolate Nodule
77 2721755514 Rhizobium sp. N6212 Isolate Nodule
78 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
79 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
80 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
81 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
82 2721755809 Rhizobium sp. N541 Isolate Nodule
83 2721755810 Rhizobium sp. N871 Isolate Nodule
84 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
85 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
86 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
87 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
88 2728369365 Rhizobium sp. N1341 Isolate Nodule
89 2728369397 Rhizobium sp. N1314 Isolate Nodule
90 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
91 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
92 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
93 2791355256 Rhizobium sp. M10 Isolate Nodule
94 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
95 2791355260 Rhizobium sp. L9 Isolate Nodule
96 2791355261 Rhizobium sp. J15 Isolate Nodule
97 2791355262 Rhizobium sp. M1 Isolate Nodule
98 2791355263 Rhizobium chutanense C5 Isolate Nodule
99 2791355264 Rhizobium sp. S9 Isolate Nodule
100 2791355265 Rhizobium sp. H4 Isolate Nodule
101 2791355266 Rhizobium sp. L43 Isolate Nodule
102 2791355267 Rhizobium sp. L18 Isolate Nodule
103 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
104 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
105 2802429633 Rhizobium anhuiense J3 Isolate Nodule
106 2802429634 Rhizobium anhuiense S10 Isolate Nodule
107 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
108 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
109 2802429637 Rhizobium anhuiense C15 Isolate Nodule
110 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
111 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
112 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
113 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
114 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
115 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
116 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
117 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
118 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
119 2838061910 Rhizobium phaseoli L15 Isolate Nodule
120 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
121 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
122 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
123 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
124 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
125 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
126 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
127 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
128 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
129 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
130 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
131 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
132 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
133 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
134 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
135 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
136 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
137 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
138 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
139 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
140 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
141 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
142 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
143 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
144 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
145 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
146 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
147 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
148 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
149 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
150 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
151 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
152 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
153 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
154 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
155 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
156 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
157 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
158 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
159 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
160 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
161 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
162 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
163 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
164 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
165 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
166 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
167 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
168 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
169 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
170 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
171 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
172 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
173 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
174 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
175 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
176 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
177 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
178 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
179 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
180 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
181 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
182 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
183 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
184 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
185 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
186 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
187 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
188 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
189 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
190 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
191 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
192 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
193 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
194 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
195 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
196 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
197 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
198 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
199 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
200 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
201 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
202 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
203 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
204 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
205 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
206 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
207 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
208 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
209 2884411467 Dyella sp. AD56 Isolate Rhizosphere
210 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
211 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
212 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
213 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
214 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
215 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
216 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
217 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
218 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
219 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
220 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
221 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
222 2909042592 Labrys sp. LIt4 Isolate Nodule
223 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
224 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
225 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
226 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
227 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
228 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
229 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
230 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
231 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
232 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
233 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
234 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
235 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
236 2933599457 Rhizobium phaseoli M3 Isolate Nodule
237 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
238 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
239 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
240 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
241 2936381700 Rhizobium chutanense C16 Isolate Unclassified
242 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
243 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
244 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
245 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
246 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
247 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
248 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
249 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
250 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
251 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
252 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
253 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
254 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
255 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
256 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
257 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
258 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
259 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
260 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
261 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
262 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
263 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
264 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
265 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
266 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
267 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
268 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
269 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
270 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
271 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
272 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
273 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
274 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
275 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
276 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
277 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
278 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
279 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
280 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
281 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
282 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
283 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
284 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
285 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
286 2996887358 Rhizobium sp. R711 Isolate Nodule
287 2996893221 Rhizobium sp. R635 Isolate Nodule
288 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
289 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
290 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
291 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
292 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
293 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
294 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
295 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
296 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
297 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
298 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
299 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
300 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
301 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
302 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
303 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
304 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
305 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
306 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
307 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
308 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
309 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
310 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
311 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
312 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
313 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
314 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
315 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
316 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
317 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
318 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
319 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
320 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
321 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
322 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
323 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
324 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
325 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
326 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
327 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
328 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
329 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
330 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
331 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
332 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
333 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
334 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
335 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
336 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
337 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
338 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
339 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
340 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
341 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
342 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
343 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
344 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
345 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
346 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
347 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
348 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
349 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
350 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
351 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
352 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
353 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
354 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
355 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
356 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
357 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
358 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
359 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
360 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
361 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
362 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
363 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
364 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
365 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
366 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
367 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
369 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
370 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
371 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
373 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
374 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
375 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
376 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
377 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
378 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
379 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
380 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
382 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
383 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
384 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
386 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
387 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
388 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
389 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
390 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
391 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
409 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
411 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
412 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
413 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
414 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
415 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
416 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
419 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
420 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
421 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
422 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
423 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
424 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
425 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
426 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
427 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
428 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
429 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
430 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
431 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
432 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
433 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
434 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
435 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
436 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
437 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
438 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
439 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
440 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
441 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
442 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
443 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
444 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
445 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
446 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
447 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
448 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
449 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
450 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
451 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
452 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
453 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
454 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
455 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
458 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
459 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
460 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
463 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
464 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
465 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
466 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
467 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
468 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
469 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
470 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
471 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
472 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
473 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
474 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
475 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
476 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
477 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
478 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
479 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
480 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
481 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
482 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
483 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
484 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
485 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
486 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
487 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
488 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
490 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
491 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
496 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
498 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
499 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
500 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
501 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
502 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
503 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
504 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
505 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
506 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
507 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
508 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
509 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
510 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
511 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
512 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
513 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
514 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
515 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
516 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
517 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
518 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
519 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
520 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
521 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
522 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
523 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
524 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
525 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
526 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
527 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
528 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
529 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
530 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
531 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
532 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
533 8005258706 Rhizobium sp. R693 Isolate Nodule
534 8005275841 Rhizobium sp. N4311 Isolate Nodule
535 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
536 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
537 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
538 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
539 8005321885 Rhizobium sp. R72 Isolate Nodule
540 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
541 8005382845 Rhizobium sp. R634 Isolate Nodule
542 8005395548 Rhizobium sp. R339 Isolate Nodule
543 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
544 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
545 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
546 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
547 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
548 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
549 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
550 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
551 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
552 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
553 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
554 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
555 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
556 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
557 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
558 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
559 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
560 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
561 8018176218 Rhizobium sp. N122 Isolate Nodule
562 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
563 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
564 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
565 8024501048 Rhizobium sp. H4 Isolate Nodule
566 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
567 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
568 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
569 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
570 8056382006 Rhizobium croatiense 13T Isolate Nodule
571 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
572 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 57.74
Metatranscriptomes 0
Isolates 42.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.57
Nodule 32.8
Rhizoplane 0.98
Rhizosphere 23.96
Stem 0
Stem Tuber 0
Unclassified 17.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012667 3300001979 Bacteria 3172
2 JGI25155J39150_1000007 3300002704 Bacteria 238857
3 JGI25156J39149_1000066 3300002705 Bacteria 82816
4 JGI25156J39149_1005532 3300002705 Bacteria 3624
5 JGI25162J39368_1000521 3300002737 Bacteria 28709
6 JGI25162J39368_1000875 3300002737 Bacteria 19716
7 JGI25154J39366_1000169 3300002738 Bacteria 50665
8 JGI25158J39367_1000180 3300002739 Bacteria 14916
9 JGI25157J39369_1000197 3300002741 Bacteria 51019
10 JGI25157J39369_1000434 3300002741 Bacteria 27188
11 JGI25157J39369_1001050 3300002741 Bacteria 12594
12 JGI25164J39214_1000288 3300002772 Bacteria 35469
13 JGI25152J39213_1000126 3300002773 Bacteria 52109
14 JGI25152J39213_1001981 3300002773 Bacteria 8104
15 JGI25152J39213_1005036 3300002773 Bacteria 3984
16 JGI25150J39212_1000180 3300002774 Bacteria 35477
17 JGI25159J45721_1001406 3300002987 Bacteria 9996
18 JGI25151J46595_10000031 3300003187 Bacteria 197865
19 JGI25151J46595_10000177 3300003187 Bacteria 81432
20 JGI25151J46595_10000247 3300003187 Bacteria 63163
21 JGI25151J46595_10000596 3300003187 Bacteria 32080
22 JGI25151J46595_10001523 3300003187 Bacteria 15502
23 JGI25151J46595_10002206 3300003187 Bacteria 12026
24 JGI25151J46595_10002304 3300003187 Bacteria 11660
25 JGI25151J46595_10016424 3300003187 Bacteria 3237
26 JGI25165J46597_1000016 3300003214 Bacteria 377866
27 JGI25165J46597_1000402 3300003214 Bacteria 45705
28 JGI25165J46597_1000532 3300003214 Bacteria 35455
29 JGI25165J46597_1000734 3300003214 Bacteria 25667
30 JGI25165J46597_1008042 3300003214 Bacteria 1689
31 JGI25153J46596_10000130 3300003215 Bacteria 81432
32 JGI25153J46596_10002106 3300003215 Bacteria 11657
33 JGI25153J46596_10003024 3300003215 Bacteria 9511
34 JGI25153J46596_10008684 3300003215 Bacteria 4826
35 JGI25153J46596_10024468 3300003215 Bacteria 2177
36 rootH2_10039535 3300003320 Bacteria 4083
37 rootH2_10044954 3300003320 Bacteria 11828
38 rootL2_10096740 3300003322 Bacteria 3371
39 rootL2_10226176 3300003322 Bacteria 2262
40 rootH1_10078253 3300003323 Bacteria 2975
41 rootH1_10110352 3300003323 Bacteria 1475
42 JGI25160J50197_1000114 3300003354 Bacteria 75947
43 JGI25160J50197_1000481 3300003354 Bacteria 24245
44 JGI25160J50197_1008267 3300003354 Bacteria 3978
45 JGI25161J50226_1000089 3300003374 Bacteria 73775
46 JGI25161J50226_1000114 3300003374 Bacteria 62957
47 JGI25161J50226_1003256 3300003374 Bacteria 3791
48 Ga0055538_1001162 3300003751 Bacteria 5585
49 Ga0055535_1000429 3300003761 Bacteria 39272
50 Ga0055542_1000648 3300003762 Bacteria 28709
51 Ga0055529_1000467 3300003763 Bacteria 39162
52 Ga0055526_1001606 3300003771 Bacteria 15869
53 Ga0055526_1001815 3300003771 Bacteria 14781
54 Ga0055526_1002324 3300003771 Bacteria 12952
55 Ga0055526_1002600 3300003771 Bacteria 12067
56 Ga0055526_1014316 3300003771 Bacteria 3272
57 Ga0055524_1002110 3300003775 Bacteria 10510
58 Ga0055524_1011549 3300003775 Bacteria 3450
59 Ga0055524_1014713 3300003775 Bacteria 2885
60 Ga0055524_1018277 3300003775 Bacteria 2441
61 Ga0055536_1000033 3300003781 Bacteria 148346
62 Ga0055534_1002018 3300003784 Bacteria 7377
63 Ga0055528_1000485 3300003790 Bacteria 31501
64 Ga0055528_1001469 3300003790 Bacteria 14317
65 Ga0055528_1001954 3300003790 Bacteria 11656
66 Ga0055528_1009892 3300003790 Bacteria 3937
67 Ga0055528_1017797 3300003790 Bacteria 2444
68 Ga0055540_1001114 3300003792 Bacteria 16933
69 Ga0055540_1001218 3300003792 Bacteria 15814
70 Ga0055540_1015978 3300003792 Bacteria 2157
71 Ga0055543_1000002 3300004625 Bacteria 390020
72 Ga0055543_1000077 3300004625 Bacteria 86457
73 Ga0055543_1000711 3300004625 Bacteria 16856
74 Ga0065165_1001020 3300005262 Bacteria 34014
75 Ga0065165_1004729 3300005262 Bacteria 8171
76 Ga0065165_1010241 3300005262 Bacteria 4083
77 Ga0070670_100002407 3300005331 Bacteria 15428
78 Ga0070670_100160644 3300005331 Bacteria 1947
79 Ga0070668_100045007 3300005347 Bacteria 3386
80 Ga0070669_100188653 3300005353 Bacteria 1616
81 Ga0070671_100042321 3300005355 Bacteria 3786
82 Ga0070659_100003983 3300005366 Bacteria 10513
83 Ga0070681_10021500 3300005458 Bacteria 6467
84 Ga0070679_100148422 3300005530 Bacteria 2322
85 Ga0068853_100036598 3300005539 Bacteria 4175
86 Ga0068853_100081475 3300005539 Bacteria 2834
87 Ga0068853_100305665 3300005539 Bacteria 1471
88 Ga0070665_100012115 3300005548 Bacteria 8701
89 Ga0070665_100013795 3300005548 Bacteria 8129
90 Ga0070665_100159477 3300005548 Bacteria 2257
91 Ga0070665_100259226 3300005548 Bacteria 1740
92 Ga0068855_100179404 3300005563 Bacteria 2395
93 Ga0068857_100020664 3300005577 Bacteria 5794
94 Ga0068856_100009870 3300005614 Bacteria 9271
95 Ga0081455_10205297 3300005937 Bacteria 1472
96 Ga0075365_10009275 3300006038 Bacteria 5646
97 Ga0075363_100007136 3300006048 Bacteria 5115
98 Ga0075362_10000128 3300006177 Bacteria 20952
99 Ga0075362_10000940 3300006177 Bacteria 8893
100 Ga0075367_10004695 3300006178 Bacteria 6709
101 Ga0075367_10006455 3300006178 Bacteria 5928
102 Ga0075369_10012111 3300006186 Bacteria 3403
103 Ga0075369_10014442 3300006186 Bacteria 3154
104 Ga0075369_10040480 3300006186 Bacteria 1992
105 Ga0075366_10001129 3300006195 Bacteria 13161
106 Ga0075366_10047197 3300006195 Bacteria 2553
107 Ga0075370_10023223 3300006353 Bacteria 3414
108 Ga0105251_10012908 3300009011 Bacteria 4699
109 Ga0105244_10093755 3300009036 Bacteria 1475
110 Ga0105240_10000019 3300009093 Bacteria 406211
111 Ga0105243_10052786 3300009148 Bacteria 3222
112 Ga0105248_10038064 3300009177 Bacteria 5382
113 Ga0105237_10014402 3300009545 Bacteria 8270
114 Ga0105237_10049273 3300009545 Bacteria 4234
115 Ga0105238_10002917 3300009551 Bacteria 17078
116 Ga0123341_1000014 3300009765 Bacteria 91980
117 Ga0123342_1012802 3300009766 Bacteria 8616
118 Ga0123342_1025475 3300009766 Bacteria 3560
119 Ga0105239_10007580 3300010375 Bacteria 12438
120 Ga0105239_10134284 3300010375 Bacteria 2754
121 Ga0105239_10817169 3300010375 Bacteria 1068
122 Ga0157373_10041504 3300013100 Bacteria 3292
123 Ga0157371_10000002 3300013102 Bacteria 665040
124 Ga0157370_10001455 3300013104 Bacteria 29311
125 Ga0157370_10008723 3300013104 Bacteria 10907
126 Ga0157369_10173794 3300013105 Bacteria 2269
127 Ga0182007_10003955 3300015262 Bacteria 6843
128 Ga0213872_10001721 3300021361 Bacteria 13758
129 Ga0213875_10123496 3300021388 Bacteria 1210
130 Ga0209435_100005 3300025206 Bacteria 573745
131 Ga0209760_100646 3300025207 Bacteria 5767
132 Ga0209436_100050 3300025208 Bacteria 65942
133 Ga0209784_100216 3300025224 Bacteria 39416
134 Ga0209672_103804 3300025228 Bacteria 2993
135 Ga0207427_100267 3300025231 Bacteria 39803
136 Ga0209437_100037 3300025233 Bacteria 459730
137 Ga0209437_100058 3300025233 Bacteria 357279
138 Ga0209437_100078 3300025233 Bacteria 278088
139 Ga0209258_100034 3300025242 Bacteria 437372
140 Ga0209258_100620 3300025242 Bacteria 28259
141 Ga0207425_1000058 3300025245 Bacteria 149214
142 Ga0207425_1002746 3300025245 Bacteria 5985
143 Ga0209646_1000011 3300025246 Bacteria 573745
144 Ga0209646_1000436 3300025246 Bacteria 22879
145 Ga0209646_1005372 3300025246 Bacteria 2242
146 Ga0209026_1000005 3300025250 Bacteria 731387
147 Ga0209026_1000008 3300025250 Bacteria 573745
148 Ga0209026_1000255 3300025250 Bacteria 66879
149 Ga0209677_102053 3300025253 Bacteria 7964
150 Ga0209148_1000001 3300025254 Bacteria 2545271
151 Ga0209148_1020332 3300025254 Bacteria 1092
152 Ga0209759_1000004 3300025256 Bacteria 573745
153 Ga0209759_1000292 3300025256 Bacteria 69246
154 Ga0209759_1000678 3300025256 Bacteria 31063
155 Ga0209129_1000080 3300025258 Bacteria 186416
156 Ga0209129_1000107 3300025258 Bacteria 154705
157 Ga0209129_1001456 3300025258 Bacteria 13200
158 Ga0209129_1001687 3300025258 Bacteria 11953
159 Ga0209129_1007430 3300025258 Bacteria 3268
160 Ga0209129_1013081 3300025258 Bacteria 1851
161 Ga0209233_1000002 3300025261 Bacteria 2501366
162 Ga0209233_1000068 3300025261 Bacteria 377969
163 Ga0209233_1000157 3300025261 Bacteria 164269
164 Ga0209233_1000192 3300025261 Bacteria 127171
165 Ga0209233_1000194 3300025261 Bacteria 126185
166 Ga0209455_1000054 3300025272 Bacteria 358936
167 Ga0209673_1000037 3300025273 Bacteria 313804
168 Ga0209673_1000060 3300025273 Bacteria 263602
169 Ga0209673_1000312 3300025273 Bacteria 89594
170 Ga0209673_1000439 3300025273 Bacteria 71645
171 Ga0209673_1002998 3300025273 Bacteria 10499
172 Ga0209673_1003095 3300025273 Bacteria 10198
173 Ga0209673_1003647 3300025273 Bacteria 8902
174 Ga0209673_1008335 3300025273 Bacteria 4622
175 Ga0209673_1008603 3300025273 Bacteria 4526
176 Ga0209673_1014712 3300025273 Bacteria 3017
177 Ga0209130_1000030 3300025284 Bacteria 323323
178 Ga0209130_1000083 3300025284 Bacteria 162582
179 Ga0209130_1000304 3300025284 Bacteria 59784
180 Ga0209675_1000108 3300025291 Bacteria 118134
181 Ga0209675_1030442 3300025291 Bacteria 1287
182 Ga0209676_1000144 3300025292 Bacteria 175244
183 Ga0209025_1000046 3300025294 Bacteria 348962
184 Ga0209025_1000083 3300025294 Bacteria 265556
185 Ga0209025_1000263 3300025294 Bacteria 123578
186 Ga0209025_1000389 3300025294 Bacteria 90997
187 Ga0209025_1004349 3300025294 Bacteria 12365
188 Ga0209025_1013719 3300025294 Bacteria 5063
189 Ga0209025_1019307 3300025294 Bacteria 3795
190 Ga0209025_1021393 3300025294 Bacteria 3486
191 Ga0209025_1032871 3300025294 Bacteria 2414
192 Ga0209564_1000116 3300025295 Bacteria 207889
193 Ga0209564_1000125 3300025295 Bacteria 201709
194 Ga0209564_1000185 3300025295 Bacteria 149925
195 Ga0209564_1000242 3300025295 Bacteria 118134
196 Ga0209564_1000364 3300025295 Bacteria 84138
197 Ga0209564_1007338 3300025295 Bacteria 5714
198 Ga0209564_1008211 3300025295 Bacteria 5209
199 Ga0209564_1013994 3300025295 Bacteria 3366
200 Ga0209758_1000090 3300025297 Bacteria 246564
201 Ga0209758_1000621 3300025297 Bacteria 54479
202 Ga0209758_1001342 3300025297 Bacteria 29705
203 Ga0209758_1001459 3300025297 Bacteria 27768
204 Ga0209758_1007764 3300025297 Bacteria 7184
205 Ga0209758_1010245 3300025297 Bacteria 5648
206 Ga0209758_1012315 3300025297 Bacteria 4801
207 Ga0209758_1021472 3300025297 Bacteria 3008
208 Ga0209050_1021064 3300025298 Bacteria 2396
209 Ga0209256_1001292 3300025299 Bacteria 27015
210 Ga0209256_1001802 3300025299 Bacteria 20182
211 Ga0209256_1001889 3300025299 Bacteria 19249
212 Ga0209256_1002320 3300025299 Bacteria 15934
213 Ga0209256_1004718 3300025299 Bacteria 8348
214 Ga0209256_1010950 3300025299 Bacteria 3711
215 Ga0209256_1018180 3300025299 Bacteria 2299
216 Ga0209256_1023081 3300025299 Bacteria 1864
217 Ga0207426_1000047 3300025302 Bacteria 417011
218 Ga0207426_1000141 3300025302 Bacteria 194453
219 Ga0207426_1000173 3300025302 Bacteria 162697
220 Ga0207426_1001122 3300025302 Bacteria 24415
221 Ga0207426_1009672 3300025302 Bacteria 3794
222 Ga0209051_1000874 3300025303 Bacteria 30458
223 Ga0209051_1001764 3300025303 Bacteria 17175
224 Ga0209051_1002243 3300025303 Bacteria 14208
225 Ga0209051_1010820 3300025303 Bacteria 4565
226 Ga0209257_1004872 3300025304 Bacteria 9914
227 Ga0209257_1016732 3300025304 Bacteria 2944
228 Ga0207647_10039433 3300025904 Bacteria 2980
229 Ga0207707_10288164 3300025912 Bacteria 1421
230 Ga0207695_10000049 3300025913 Bacteria 406233
231 Ga0207671_10000461 3300025914 Bacteria 55726
232 Ga0207671_10000591 3300025914 Bacteria 48440
233 Ga0207652_10117883 3300025921 Bacteria 2359
234 Ga0207681_10113035 3300025923 Bacteria 1979
235 Ga0207694_10005520 3300025924 Bacteria 9700
236 Ga0207650_10001272 3300025925 Bacteria 18294
237 Ga0207690_10006097 3300025932 Bacteria 7143
238 Ga0207667_10154770 3300025949 Bacteria 2359
239 Ga0207639_10062020 3300026041 Bacteria 2890
240 Ga0207639_10105118 3300026041 Bacteria 2290
241 Ga0207678_10028827 3300026067 Bacteria 4847
242 Ga0207702_10033500 3300026078 Bacteria 4291
243 Ga0207674_10153672 3300026116 Bacteria 2257
244 Ga0207683_10498084 3300026121 Bacteria 1125
245 Ga0209371_1005394 3300027312 Bacteria 5099
246 Ga0268266_10000086 3300028379 Bacteria 199443
247 Ga0268266_10014308 3300028379 Bacteria 6824
248 Ga0268266_10024552 3300028379 Bacteria 5127
249 Ga0268266_10201003 3300028379 Bacteria 1824
250 Ga0307515_10013332 3300028794 Bacteria 15375
251 Ga0307515_10027093 3300028794 Bacteria 9817
252 Ga0268256_1019197 3300030500 Bacteria 1877
253 Ga0307513_10066026 3300031456 Bacteria 3804
254 Ga0307513_10235046 3300031456 Bacteria 1643
255 Ga0307516_10331684 3300031730 Bacteria 1190
256 Ga0307412_10067639 3300031911 Bacteria 2426
257 Ga0395899_0014453 3300037312 Bacteria 6025
258 Ga0395899_0172777 3300037312 Bacteria 1521
259 Ga0395900_0216217 3300037418 Bacteria 1934
260 Ga0395905_0003809 3300037471 Bacteria 15946
261 Ga0436364_1290971 3300037853 Bacteria 1475
262 Ga0395901_0134754 3300038443 Bacteria 2596
263 Ga0436361_0001950 3300039447 Bacteria 15059
264 Ga0436361_0575458 3300039447 Bacteria 3162
265 Ga0436361_1068300 3300039447 Bacteria 8393
266 Ga0436363_0747323 3300039450 Bacteria 2900
267 Ga0436363_1503130 3300039450 Bacteria 1244
268 Ga0439461_0035490 3300041410 Bacteria 1058
269 Ga0439465_0001676 3300041413 Bacteria 7224
270 Ga0451839_0744782 3300041496 Bacteria 4139
271 Ga0451845_0430371 3300041501 Bacteria 2597
272 Ga0451845_0700627 3300041501 Bacteria 4876
273 Ga0451851_0474418 3300041507 Bacteria 3068
274 Ga0451853_2207469 3300041512 Bacteria 2872
275 Ga0439449_0017672 3300042007 Bacteria 2678
276 Ga0450907_014728 3300042146 Bacteria 1306
277 Ga0466972_0013621 3300044658 Bacteria 4081
278 Ga0466972_0080689 3300044658 Bacteria 1549
279 Ga0466965_0007376 3300044683 Bacteria 5047
280 Ga0466964_0007153 3300044706 Bacteria 4174
281 Ga0466968_0017068 3300044735 Bacteria 2896
282 Ga0466968_0168838 3300044735 Bacteria 1013
283 Ga0466970_0004245 3300044765 Bacteria 7052
284 Ga0466957_0032121 3300044842 Bacteria 3142
285 Ga0466959_0054439 3300045049 Bacteria 2923
286 Ga0466959_0062249 3300045049 Bacteria 2712
287 Ga0466959_0065897 3300045049 Bacteria 2628
288 Ga0466967_0416201 3300045976 Bacteria 1309
289 Ga0495629_0092130 3300046459 Bacteria 2115
290 Ga0495638_0139536 3300046460 Bacteria 1416
291 Ga0495605_0103654 3300046474 Bacteria 1305
292 Ga0495585_0004599 3300046492 Bacteria 8919
293 Ga0495585_0016700 3300046492 Bacteria 4253
294 Ga0495583_0071333 3300046506 Bacteria 1526
295 Ga0495606_0001207 3300046507 Bacteria 36311
296 Ga0495606_0004192 3300046507 Bacteria 14599
297 Ga0495606_0119161 3300046507 Bacteria 1582
298 Ga0495610_0002928 3300046512 Bacteria 13799
299 Ga0495610_0019884 3300046512 Bacteria 3743
300 Ga0495610_0024712 3300046512 Bacteria 3237
301 Ga0495616_0017890 3300046513 Bacteria 3905
302 Ga0495616_0047965 3300046513 Bacteria 2148
303 Ga0495620_0043193 3300046515 Bacteria 1965
304 Ga0495631_0000815 3300046518 Bacteria 19942
305 Ga0495632_0025506 3300046519 Bacteria 3125
306 Ga0495643_0009269 3300046522 Bacteria 6132
307 Ga0495643_0011453 3300046522 Bacteria 5401
308 Ga0495643_0125268 3300046522 Bacteria 1294
309 Ga0495644_0078941 3300046523 Bacteria 1240
310 Ga0495654_0159965 3300046530 Bacteria 989
311 Ga0495597_0119689 3300046542 Bacteria 1098
312 Ga0495622_0035953 3300046557 Bacteria 2310
313 Ga0495622_0070780 3300046557 Bacteria 1610
314 Ga0495633_0019846 3300046558 Bacteria 3392
315 Ga0495656_0078455 3300046615 Bacteria 1484
316 Ga0495668_0005275 3300046616 Bacteria 8840
317 Ga0495668_0233572 3300046616 Bacteria 1007
318 Ga0495625_0005983 3300046660 Bacteria 10932
319 Ga0495625_0057398 3300046660 Bacteria 2768
320 Ga0495625_0080571 3300046660 Bacteria 2267
321 Ga0495588_0125700 3300046674 Bacteria 1352
322 Ga0495657_0042631 3300046675 Bacteria 3097
323 Ga0495670_0135433 3300046691 Bacteria 1286
324 Ga0495649_0053272 3300046694 Bacteria 2190
325 Ga0495660_0090766 3300046810 Bacteria 1588
326 Ga0495636_0083623 3300047318 Bacteria 1378
327 Ga0495672_0004852 3300047320 Bacteria 10834
328 Ga0495676_0070218 3300047321 Bacteria 2699
329 Ga0495683_0084906 3300047323 Bacteria 1540
330 Ga0495687_016127 3300047443 Bacteria 3768
331 Ga0495687_107547 3300047443 Bacteria 1033
332 Ga0495681_0008178 3300047470 Bacteria 6584
333 Ga0495681_0014765 3300047470 Bacteria 4458
334 Ga0495681_0067053 3300047470 Bacteria 1636
335 Ga0495686_0000685 3300047472 Bacteria 45846
336 Ga0495686_0013797 3300047472 Bacteria 5598
337 Ga0495686_0228521 3300047472 Bacteria 1055
338 Ga0495626_0091177 3300048091 Bacteria 1340
339 Ga0496102_0012405 3300048905 Bacteria 7374
340 Ga0496103_0020699 3300048906 Bacteria 3954
341 Ga0496106_0000106 3300048909 Bacteria 64785
342 Ga0496106_0078865 3300048909 Bacteria 2528
343 Ga0496107_0205830 3300048910 Bacteria 1462
344 Ga0496110_0021717 3300048913 Bacteria 5439
345 Ga0496116_0001128 3300048919 Bacteria 31826
346 Ga0496116_0006341 3300048919 Bacteria 10758
347 Ga0496116_0014942 3300048919 Bacteria 6162
348 Ga0496116_0022292 3300048919 Bacteria 4749
349 Ga0496116_0036053 3300048919 Bacteria 3467
350 Ga0496116_0073111 3300048919 Bacteria 2163
351 Ga0496117_0000052 3300048920 Bacteria 280463
352 Ga0496117_0001714 3300048920 Bacteria 30347
353 Ga0496117_0009481 3300048920 Bacteria 9050
354 Ga0496117_0042063 3300048920 Bacteria 3339
355 Ga0496118_0000432 3300048921 Bacteria 69605
356 Ga0496118_0000991 3300048921 Bacteria 44233
357 Ga0496118_0011482 3300048921 Bacteria 8637
358 Ga0496118_0016317 3300048921 Bacteria 6819
359 Ga0496118_0059136 3300048921 Bacteria 2857
360 Ga0496118_0091904 3300048921 Bacteria 2085
361 Ga0496118_0187605 3300048921 Bacteria 1241
362 Ga0496119_0012399 3300048922 Bacteria 6927
363 Ga0496119_0019736 3300048922 Bacteria 4946
364 Ga0496119_0024824 3300048922 Bacteria 4204
365 Ga0496119_0031096 3300048922 Bacteria 3587
366 Ga0496120_0000019 3300048923 Bacteria 260115
367 Ga0496120_0002959 3300048923 Bacteria 16173
368 Ga0496120_0006425 3300048923 Bacteria 9032
369 Ga0496120_0043832 3300048923 Bacteria 2604
370 Ga0496121_0003374 3300048924 Bacteria 22891
371 Ga0496121_0010544 3300048924 Bacteria 10398
372 Ga0496121_0014862 3300048924 Bacteria 8212
373 Ga0496121_0028161 3300048924 Bacteria 5237
374 Ga0496121_0033035 3300048924 Bacteria 4691
375 Ga0496121_0034768 3300048924 Bacteria 4530
376 Ga0496121_0036220 3300048924 Bacteria 4400
377 Ga0496121_0079147 3300048924 Bacteria 2610
378 Ga0496121_0107573 3300048924 Bacteria 2135
379 Ga0496122_0000053 3300048925 Bacteria 260120
380 Ga0496122_0007183 3300048925 Bacteria 12471
381 Ga0496122_0014363 3300048925 Bacteria 7663
382 Ga0496122_0018058 3300048925 Bacteria 6539
383 Ga0496122_0018232 3300048925 Bacteria 6499
384 Ga0496122_0029057 3300048925 Bacteria 4674
385 Ga0496122_0075034 3300048925 Bacteria 2388
386 Ga0496122_0101310 3300048925 Bacteria 1924
387 Ga0496123_0000038 3300048926 Bacteria 260120
388 Ga0496123_0005151 3300048926 Bacteria 13309
389 Ga0496123_0010370 3300048926 Bacteria 8248
390 Ga0496123_0022351 3300048926 Bacteria 4877
391 Ga0496123_0030152 3300048926 Bacteria 3975
392 Ga0496123_0125665 3300048926 Bacteria 1432
393 Ga0496123_0143306 3300048926 Bacteria 1302
394 Ga0496124_0002819 3300048927 Bacteria 22009
395 Ga0496124_0003535 3300048927 Bacteria 19011
396 Ga0496124_0015621 3300048927 Bacteria 7267
397 Ga0496124_0056962 3300048927 Bacteria 3294
398 Ga0496124_0084150 3300048927 Bacteria 2609
399 Ga0496124_0111043 3300048927 Bacteria 2206
400 Ga0496125_0009740 3300048928 Bacteria 9807
401 Ga0496125_0013718 3300048928 Bacteria 7948
402 Ga0496125_0015447 3300048928 Bacteria 7383
403 Ga0496125_0023218 3300048928 Bacteria 5731
404 Ga0496125_0041418 3300048928 Bacteria 3937
405 Ga0496125_0155438 3300048928 Bacteria 1563
406 Ga0496125_0179161 3300048928 Bacteria 1414
407 Ga0496126_0041314 3300048929 Bacteria 4269
408 Ga0496126_0051373 3300048929 Bacteria 3753
409 Ga0496126_0202070 3300048929 Bacteria 1677
410 Ga0496126_0270789 3300048929 Bacteria 1409
411 Ga0496126_0306556 3300048929 Bacteria 1308
412 Ga0496126_0329387 3300048929 Bacteria 1253
413 Ga0495678_006144 3300049459 Bacteria 6446
414 Ga0501032_0044104 3300049569 Bacteria 3019
415 Ga0501034_0430599 3300049571 Bacteria 1239
416 Ga0501036_0078192 3300049572 Bacteria 2798
417 Ga0501037_0048757 3300049573 Bacteria 3102
418 Ga0501038_0362206 3300049574 Bacteria 1127
419 Ga0501039_0301727 3300049575 Bacteria 1259
420 Ga0501043_0123591 3300049579 Bacteria 2029
421 Ga0501046_0037729 3300049580 Bacteria 3882
422 Ga0501046_0127832 3300049580 Bacteria 1929
423 Ga0501047_0079547 3300049581 Bacteria 3151
424 Ga0501068_0189544 3300049584 Bacteria 1302
425 Ga0501073_0256484 3300049589 Bacteria 1207
426 Ga0501280_006411 3300049776 Bacteria 1658
427 Ga0501035_0010471 3300049822 Bacteria 8593
428 Ga0501035_0026921 3300049822 Bacteria 5257
429 Ga0501044_0034629 3300049823 Bacteria 5294
430 Ga0501044_0050776 3300049823 Bacteria 4278
431 Ga0501044_0528375 3300049823 Bacteria 1079
432 nmdc:mga03683_132_c1 3300050489 Bacteria 24967
433 nmdc:mga03683_71120_c1 3300050489 Bacteria 1488
434 nmdc:mga03n38_2283_c1 3300050490 Bacteria 5872
435 nmdc:mga00v17_11_c1 3300050491 Bacteria 135478
436 nmdc:mga0yw44_171786_c1 3300050492 Bacteria 1424
437 nmdc:mga0yw44_6595_c1 3300050492 Bacteria 5623
438 nmdc:mga0yw44_96_c1 3300050492 Bacteria 30976
439 nmdc:mga0yw44_97381_c1 3300050492 Bacteria 1869
440 nmdc:mga0k408_101017_c1 3300050493 Bacteria 1700
441 nmdc:mga0k408_25102_c1 3300050493 Bacteria 3373
442 nmdc:mga0k408_6874_c1 3300050493 Bacteria 2641
443 nmdc:mga06z11_4851_c1 3300050494 Bacteria 5327
444 nmdc:mga07m45_144675_c1 3300050496 Bacteria 1378
445 nmdc:mga07m45_46502_c1 3300050496 Bacteria 2439
446 nmdc:mga07m45_7876_c1 3300050496 Bacteria 5454
447 nmdc:mga0sz30_19380_c1 3300050516 Bacteria 2735
448 nmdc:mga0sz30_41479_c1 3300050516 Bacteria 1935
449 Ga0500610_0002770 3300053079 Bacteria 6559
450 Ga0500610_0061674 3300053079 Bacteria 1957
451 Ga0500578_0040535 3300053086 Bacteria 2992
452 Ga0500560_000510 3300053107 Bacteria 5461
453 Ga0500562_025884 3300053108 Bacteria 1537
454 Ga0500569_001114 3300053109 Bacteria 4934
455 Ga0500607_060903 3300053121 Bacteria 1978
456 Ga0500658_0000067 3300053134 Bacteria 48662
457 Ga0500658_0066098 3300053134 Bacteria 1516
458 Ga0500561_0000033 3300053137 Bacteria 28489
459 Ga0500568_0000185 3300053139 Bacteria 54765
460 Ga0500568_0002618 3300053139 Bacteria 10468
461 Ga0500590_000103 3300053148 Bacteria 22489
462 Ga0500604_0006906 3300053151 Bacteria 3005
463 Ga0500604_0010952 3300053151 Bacteria 2431
464 Ga0500616_0000526 3300053153 Bacteria 48257
465 Ga0500616_0027770 3300053153 Bacteria 3123
466 Ga0500616_0101333 3300053153 Bacteria 1407
467 Ga0500622_0000237 3300053156 Bacteria 57253
468 Ga0500633_0003057 3300053160 Bacteria 3579
469 Ga0500611_005194 3300053727 Bacteria 1816
470 Ga0501082_0072958 3300060353 Bacteria 2956

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0125268 Ga0495643_0125268_537_1283 246
2 3300002773 JGI25152J39213_1000126 JGI25152J39213_100012615 268
3 3300002774 JGI25150J39212_1000180 JGI25150J39212_100018016 268
4 3300003187 JGI25151J46595_10000177 JGI25151J46595_1000017734 268
5 3300003215 JGI25153J46596_10000130 JGI25153J46596_1000013031 268
6 3300045049 Ga0466959_0065897 Ga0466959_0065897_649_1614 273
7 3300009766 Ga0123342_1012802 Ga0123342_10128022 274
8 3300005539 Ga0068853_100081475 Ga0068853_1000814752 275
9 3300026041 Ga0207639_10062020 Ga0207639_100620202 275
10 3300044658 Ga0466972_0013621 Ga0466972_0013621_3020_3898 280
11 3300044683 Ga0466965_0007376 Ga0466965_0007376_3070_3948 280
12 3300044706 Ga0466964_0007153 Ga0466964_0007153_249_1127 280
13 3300044735 Ga0466968_0017068 Ga0466968_0017068_1894_2772 280
14 iso_pu_bacteria 2977858184 2977861949 280
15 3300046460 Ga0495638_0139536 Ga0495638_0139536_544_1389 281
16 3300046616 Ga0495668_0233572 Ga0495668_0233572_128_985 282
17 iso_pu_bacteria 2834641062 2834642493 282
18 iso_pu_bacteria 8003400568 8003404001 282
19 3300005331 Ga0070670_100002407 Ga0070670_10000240712 284
20 3300025925 Ga0207650_10001272 Ga0207650_100012723 284
21 3300021388 Ga0213875_10123496 Ga0213875_101234961 285
22 3300037312 Ga0395899_0014453 Ga0395899_0014453_4198_5142 285
23 3300037853 Ga0436364_1290971 Ga0436364_1290971_365_1228 285
24 3300049573 Ga0501037_0048757 Ga0501037_0048757_1306_2238 285
25 3300049575 Ga0501039_0301727 Ga0501039_0301727_193_1125 285
26 3300049584 Ga0501068_0189544 Ga0501068_0189544_274_1179 285
27 3300049589 Ga0501073_0256484 Ga0501073_0256484_15_947 285
28 3300025291 Ga0209675_1030442 Ga0209675_10304421 286
29 3300042007 Ga0439449_0017672 Ga0439449_0017672_29_895 286
30 3300047443 Ga0495687_107547 Ga0495687_107547_149_1018 286
31 3300048910 Ga0496107_0205830 Ga0496107_0205830_569_1447 286
32 3300046558 Ga0495633_0019846 Ga0495633_0019846_33_914 289
33 3300048926 Ga0496123_0143306 Ga0496123_0143306_56_976 289
34 iso_pu_bacteria 2509276033 2509447844 291
35 iso_pu_bacteria 2529292951 2530646888 291
36 iso_pu_bacteria 2791355259 2793313137 291
37 iso_pu_bacteria 2791355263 2793344243 291
38 iso_pu_bacteria 2884411467 2884412741 291
39 iso_pu_bacteria 2936381700 2936382196 291
40 iso_pu_bacteria 2996893221 2996896307 291
41 3300003320 rootH2_10044954 rootH2_100449542 292
42 3300003323 rootH1_10078253 rootH1_100782534 292
43 iso_pu_bacteria 2838042994 2838046320 292
44 iso_pu_bacteria 2852649853 2852650706 292
45 iso_pu_bacteria 2909042592 2909048198 292
46 iso_pu_bacteria 2941475908 2941478437 292
47 3300013100 Ga0157373_10041504 Ga0157373_100415043 293
48 3300013102 Ga0157371_10000002 Ga0157371_1000000227 293
49 3300021361 Ga0213872_10001721 Ga0213872_100017216 293
50 3300039447 Ga0436361_0001950 Ga0436361_0001950_6947_7861 293
51 3300048919 Ga0496116_0014942 Ga0496116_0014942_2290_3177 293
52 3300048920 Ga0496117_0000052 Ga0496117_0000052_131263_132150 293
53 3300048921 Ga0496118_0000432 Ga0496118_0000432_27337_28224 293
54 3300048923 Ga0496120_0000019 Ga0496120_0000019_131263_132150 293
55 3300048925 Ga0496122_0000053 Ga0496122_0000053_131263_132150 293
56 3300048926 Ga0496123_0000038 Ga0496123_0000038_131263_132150 293
57 3300048928 Ga0496125_0041418 Ga0496125_0041418_2738_3625 293
58 3300048929 Ga0496126_0329387 Ga0496126_0329387_272_1159 293
59 3300050489 nmdc:mga03683_132_c1 nmdc:mga03683_132_c1_14081_14968 293
60 3300050491 nmdc:mga00v17_11_c1 nmdc:mga00v17_11_c1_17190_18077 293
61 3300050493 nmdc:mga0k408_25102_c1 nmdc:mga0k408_25102_c1_2316_3203 293
62 3300050496 nmdc:mga07m45_46502_c1 nmdc:mga07m45_46502_c1_1281_2168 293
63 iso_pu_bacteria 2718217927 2719387205 293
64 iso_pu_bacteria 2718218232 2720614739 293
65 iso_pu_bacteria 2718218233 2720621512 293
66 iso_pu_bacteria 2718218235 2720632840 293
67 iso_pu_bacteria 2718218269 2720776564 293
68 iso_pu_bacteria 2718218423 2721400840 293
69 iso_pu_bacteria 2721755556 2723028152 293
70 iso_pu_bacteria 2721755684 2723561783 293
71 iso_pu_bacteria 2721755685 2723568412 293
72 iso_pu_bacteria 2721755809 2724039653 293
73 iso_pu_bacteria 2721755819 2724091171 293
74 iso_pu_bacteria 2721755822 2724105677 293
75 iso_pu_bacteria 2728369352 2730109088 293
76 iso_pu_bacteria 2791355256 2793293712 293
77 iso_pu_bacteria 2791355261 2793328210 293
78 iso_pu_bacteria 2791355262 2793333303 293
79 iso_pu_bacteria 2791355265 2793353633 293
80 iso_pu_bacteria 2802429605 2805930560 293
81 iso_pu_bacteria 2802429606 2805934261 293
82 iso_pu_bacteria 2838061910 2838063782 293
83 iso_pu_bacteria 2838068647 2838073265 293
84 iso_pu_bacteria 2838668709 2838671207 293
85 iso_pu_bacteria 2838701080 2838703613 293
86 iso_pu_bacteria 2842146304 2842149385 293
87 iso_pu_bacteria 2842192696 2842197848 293
88 iso_pu_bacteria 2842205361 2842208235 293
89 iso_pu_bacteria 2842250916 2842253977 293
90 iso_pu_bacteria 2842264693 2842266546 293
91 iso_pu_bacteria 2842278818 2842281756 293
92 iso_pu_bacteria 2842311132 2842315529 293
93 iso_pu_bacteria 2842317721 2842321459 293
94 iso_pu_bacteria 2842395702 2842398588 293
95 iso_pu_bacteria 2842422224 2842426899 293
96 iso_pu_bacteria 2842428310 2842429865 293
97 iso_pu_bacteria 2842434925 2842436475 293
98 iso_pu_bacteria 2842441272 2842444178 293
99 iso_pu_bacteria 2842447887 2842450963 293
100 iso_pu_bacteria 2842462802 2842464286 293
101 iso_pu_bacteria 2842469257 2842470804 293
102 iso_pu_bacteria 2842489311 2842493207 293
103 iso_pu_bacteria 2842495871 2842499225 293
104 iso_pu_bacteria 2933599457 2933603605 293
105 iso_pu_bacteria 8005275841 8005281934 293
106 iso_pu_bacteria 8005282627 8005288921 293
107 iso_pu_bacteria 8005497431 8005501595 293
108 iso_pu_bacteria 8005619151 8005622952 293
109 iso_pu_bacteria 8005626139 8005631745 293
110 iso_pu_bacteria 8005668836 8005673016 293
111 iso_pu_bacteria 8005695170 8005700788 293
112 iso_pu_bacteria 8018176218 8018178532 293
113 iso_pu_bacteria 8024501048 8024506010 293
114 iso_pu_bacteria 8056382006 8056386951 293
115 3300005577 Ga0068857_100020664 Ga0068857_1000206647 294
116 3300025242 Ga0209258_100620 Ga0209258_10062027 294
117 iso_pu_bacteria 2509276021 2509386413 294
118 iso_pu_bacteria 2509276021 2509389909 294
119 iso_pu_bacteria 2510065019 2510134777 294
120 iso_pu_bacteria 2510461076 2510896129 294
121 iso_pu_bacteria 2513237085 2513581257 294
122 iso_pu_bacteria 2513237093 2513631384 294
123 iso_pu_bacteria 2513237103 2513710681 294
124 iso_pu_bacteria 2513237162 2514022400 294
125 iso_pu_bacteria 2515075009 2515113863 294
126 iso_pu_bacteria 2515154113 2515634735 294
127 iso_pu_bacteria 2515154114 2515645963 294
128 iso_pu_bacteria 2515154116 2515656844 294
129 iso_pu_bacteria 2515154134 2515743589 294
130 iso_pu_bacteria 2516653085 2517077777 294
131 iso_pu_bacteria 2517287029 2517410669 294
132 iso_pu_bacteria 2554235003 2554245150 294
133 iso_pu_bacteria 2558860242 2559297019 294
134 iso_pu_bacteria 2585427526 2585530206 294
135 iso_pu_bacteria 2585427528 2585541083 294
136 iso_pu_bacteria 2585427593 2585839846 294
137 iso_pu_bacteria 2615840624 2616295493 294
138 iso_pu_bacteria 2643221693 2644521262 294
139 iso_pu_bacteria 2718217882 2719182536 294
140 iso_pu_bacteria 2718218009 2719733255 294
141 iso_pu_bacteria 2718218363 2721148649 294
142 iso_pu_bacteria 2718218365 2721160035 294
143 iso_pu_bacteria 2718218366 2721165463 294
144 iso_pu_bacteria 2721755514 2722841633 294
145 iso_pu_bacteria 2721755810 2724046011 294
146 iso_pu_bacteria 2724679232 2725947764 294
147 iso_pu_bacteria 2728369365 2730165771 294
148 iso_pu_bacteria 2728369397 2730299667 294
149 iso_pu_bacteria 2738541333 2739035636 294
150 iso_pu_bacteria 2765235942 2766065387 294
151 iso_pu_bacteria 2791355264 2793347309 294
152 iso_pu_bacteria 2791355266 2793359800 294
153 iso_pu_bacteria 2791355267 2793369517 294
154 iso_pu_bacteria 2802429633 2806044624 294
155 iso_pu_bacteria 2802429634 2806052824 294
156 iso_pu_bacteria 2802429635 2806059124 294
157 iso_pu_bacteria 2802429636 2806068213 294
158 iso_pu_bacteria 2802429637 2806074333 294
159 iso_pu_bacteria 2808606387 2808989020 294
160 iso_pu_bacteria 2821443989 2821449461 294
161 iso_pu_bacteria 2838022645 2838024363 294
162 iso_pu_bacteria 2838680041 2838685025 294
163 iso_pu_bacteria 2838686498 2838691389 294
164 iso_pu_bacteria 2838694306 2838699138 294
165 iso_pu_bacteria 2838707686 2838712619 294
166 iso_pu_bacteria 2838729681 2838733348 294
167 iso_pu_bacteria 2838742623 2838746080 294
168 iso_pu_bacteria 2841851746 2841853792 294
169 iso_pu_bacteria 2841864319 2841868248 294
170 iso_pu_bacteria 2842077413 2842082096 294
171 iso_pu_bacteria 2842110456 2842113503 294
172 iso_pu_bacteria 2842118031 2842123018 294
173 iso_pu_bacteria 2842156927 2842162201 294
174 iso_pu_bacteria 2842163707 2842169756 294
175 iso_pu_bacteria 2842180545 2842185127 294
176 iso_pu_bacteria 2842198810 2842199906 294
177 iso_pu_bacteria 2842217011 2842220145 294
178 iso_pu_bacteria 2842229732 2842233614 294
179 iso_pu_bacteria 2842237096 2842242079 294
180 iso_pu_bacteria 2842243621 2842247658 294
181 iso_pu_bacteria 2842257432 2842262074 294
182 iso_pu_bacteria 2842271015 2842275863 294
183 iso_pu_bacteria 2842291075 2842296096 294
184 iso_pu_bacteria 2842304105 2842308153 294
185 iso_pu_bacteria 2842363717 2842370326 294
186 iso_pu_bacteria 2842370503 2842375703 294
187 iso_pu_bacteria 2842377471 2842382495 294
188 iso_pu_bacteria 2842384541 2842389896 294
189 iso_pu_bacteria 2844454524 2844457563 294
190 iso_pu_bacteria 2857516855 2857518970 294
191 iso_pu_bacteria 2899845264 2899845380 294
192 iso_pu_bacteria 2926760298 2926763985 294
193 iso_pu_bacteria 2933570622 2933574602 294
194 iso_pu_bacteria 2933586486 2933589207 294
195 iso_pu_bacteria 2935894831 2935899800 294
196 iso_pu_bacteria 2935901341 2935906965 294
197 iso_pu_bacteria 2936367885 2936374938 294
198 iso_pu_bacteria 2936375103 2936380629 294
199 iso_pu_bacteria 2979089926 2979090917 294
200 iso_pu_bacteria 2979095461 2979096442 294
201 iso_pu_bacteria 2989776772 2989777185 294
202 iso_pu_bacteria 639633055 639649935 294
203 iso_pu_bacteria 650716007 650843446 294
204 iso_pu_bacteria 8005301065 8005306741 294
205 iso_pu_bacteria 8005307578 8005311234 294
206 iso_pu_bacteria 8005376324 8005378261 294
207 iso_pu_bacteria 8005382845 8005383907 294
208 iso_pu_bacteria 8005395548 8005401233 294
209 iso_pu_bacteria 8005430974 8005434187 294
210 iso_pu_bacteria 8005460587 8005464550 294
211 iso_pu_bacteria 8005556819 8005558450 294
212 iso_pu_bacteria 8005563573 8005566706 294
213 iso_pu_bacteria 8005570704 8005575010 294
214 iso_pu_bacteria 8005688590 8005693564 294
215 iso_pu_bacteria 8018127388 8018133679 294
216 iso_pu_bacteria 8018150411 8018155064 294
217 iso_pu_bacteria 8018163183 8018170150 294
218 iso_pu_bacteria 8023680758 8023687618 294
219 iso_pu_bacteria 8024479707 8024481713 294
220 3300002737 JGI25162J39368_1000521 JGI25162J39368_100052117 295
221 3300002741 JGI25157J39369_1000434 JGI25157J39369_10004342 295
222 3300002772 JGI25164J39214_1000288 JGI25164J39214_100028823 295
223 3300003214 JGI25165J46597_1000532 JGI25165J46597_100053223 295
224 3300003323 rootH1_10110352 rootH1_101103521 295
225 3300003751 Ga0055538_1001162 Ga0055538_10011624 295
226 3300003761 Ga0055535_1000429 Ga0055535_100042927 295
227 3300003762 Ga0055542_1000648 Ga0055542_100064817 295
228 3300003763 Ga0055529_1000467 Ga0055529_100046727 295
229 3300009765 Ga0123341_1000014 Ga0123341_100001486 295
230 3300009766 Ga0123342_1025475 Ga0123342_10254754 295
231 3300025207 Ga0209760_100646 Ga0209760_1006464 295
232 3300025224 Ga0209784_100216 Ga0209784_10021627 295
233 3300025231 Ga0207427_100267 Ga0207427_10026727 295
234 3300025233 Ga0209437_100037 Ga0209437_10003717 295
235 3300025242 Ga0209258_100034 Ga0209258_100034211 295
236 3300025246 Ga0209646_1000436 Ga0209646_100043613 295
237 3300025250 Ga0209026_1000255 Ga0209026_100025523 295
238 3300025254 Ga0209148_1000001 Ga0209148_1000001493 295
239 3300025256 Ga0209759_1000678 Ga0209759_100067820 295
240 3300025261 Ga0209233_1000002 Ga0209233_10000021738 295
241 3300025272 Ga0209455_1000054 Ga0209455_1000054180 295
242 3300049572 Ga0501036_0078192 Ga0501036_0078192_1833_2726 295
243 3300049574 Ga0501038_0362206 Ga0501038_0362206_157_1050 295
244 3300049579 Ga0501043_0123591 Ga0501043_0123591_1064_1957 295
245 3300049580 Ga0501046_0037729 Ga0501046_0037729_36_929 295
246 3300049581 Ga0501047_0079547 Ga0501047_0079547_1846_2739 295
247 3300049822 Ga0501035_0026921 Ga0501035_0026921_3419_4312 295
248 3300049823 Ga0501044_0034629 Ga0501044_0034629_413_1306 295
249 iso_pu_bacteria 2842341865 2842344931 295
250 iso_pu_bacteria 2937822353 2937828564 295
251 iso_pu_bacteria 8056375014 8056381517 295
252 3300003771 Ga0055526_1001815 Ga0055526_10018157 296
253 3300003790 Ga0055528_1001469 Ga0055528_10014696 296
254 3300006186 Ga0075369_10040480 Ga0075369_100404802 296
255 3300010375 Ga0105239_10134284 Ga0105239_101342842 296
256 3300025273 Ga0209673_1000060 Ga0209673_1000060143 296
257 3300025295 Ga0209564_1000116 Ga0209564_1000116143 296
258 3300025299 Ga0209256_1001292 Ga0209256_100129211 296
259 3300044735 Ga0466968_0168838 Ga0466968_0168838_13_903 296
260 3300048921 Ga0496118_0011482 Ga0496118_0011482_5451_6398 296
261 3300048927 Ga0496124_0002819 Ga0496124_0002819_20275_21171 296
262 iso_pu_bacteria 3002141150 3002144741 296
263 3300003187 JGI25151J46595_10000247 JGI25151J46595_1000024747 297
264 3300003187 JGI25151J46595_10000596 JGI25151J46595_100005965 297
265 3300003790 Ga0055528_1000485 Ga0055528_100048525 297
266 3300025273 Ga0209673_1000037 Ga0209673_1000037223 297
267 3300025284 Ga0209130_1000304 Ga0209130_100030410 297
268 3300025294 Ga0209025_1000263 Ga0209025_100026385 297
269 3300025294 Ga0209025_1004349 Ga0209025_10043498 297
270 3300025295 Ga0209564_1007338 Ga0209564_10073386 297
271 3300025297 Ga0209758_1007764 Ga0209758_100776410 297
272 3300025299 Ga0209256_1001802 Ga0209256_10018026 297
273 3300025302 Ga0207426_1000141 Ga0207426_1000141128 297
274 3300042146 Ga0450907_014728 Ga0450907_014728_27_935 297
275 3300046507 Ga0495606_0001207 Ga0495606_0001207_15897_16805 297
276 3300046512 Ga0495610_0002928 Ga0495610_0002928_2921_3820 297
277 iso_pu_bacteria 2517093000 2517096576 297
278 iso_pu_bacteria 2791355260 2793319784 297
279 iso_pu_bacteria 2842285085 2842288862 297
280 iso_pu_bacteria 2842402390 2842406471 297
281 iso_pu_bacteria 2842409023 2842413102 297
282 iso_pu_bacteria 2842415677 2842419745 297
283 3300003187 JGI25151J46595_10001523 JGI25151J46595_100015235 298
284 3300003187 JGI25151J46595_10002304 JGI25151J46595_100023046 298
285 3300003215 JGI25153J46596_10002106 JGI25153J46596_100021063 298
286 3300003215 JGI25153J46596_10024468 JGI25153J46596_100244683 298
287 3300003322 rootL2_10096740 rootL2_100967401 298
288 3300003354 JGI25160J50197_1000481 JGI25160J50197_100048111 298
289 3300003374 JGI25161J50226_1003256 JGI25161J50226_10032565 298
290 3300003771 Ga0055526_1001606 Ga0055526_100160612 298
291 3300003771 Ga0055526_1002324 Ga0055526_10023249 298
292 3300003771 Ga0055526_1014316 Ga0055526_10143163 298
293 3300003775 Ga0055524_1002110 Ga0055524_10021106 298
294 3300003781 Ga0055536_1000033 Ga0055536_100003355 298
295 3300003784 Ga0055534_1002018 Ga0055534_10020182 298
296 3300003790 Ga0055528_1001954 Ga0055528_10019546 298
297 3300003790 Ga0055528_1017797 Ga0055528_10177973 298
298 3300003792 Ga0055540_1001114 Ga0055540_100111411 298
299 3300003792 Ga0055540_1015978 Ga0055540_10159782 298
300 3300004625 Ga0055543_1000711 Ga0055543_100071111 298
301 3300005262 Ga0065165_1004729 Ga0065165_10047296 298
302 3300005347 Ga0070668_100045007 Ga0070668_1000450073 298
303 3300005353 Ga0070669_100188653 Ga0070669_1001886533 298
304 3300005539 Ga0068853_100305665 Ga0068853_1003056651 298
305 3300005548 Ga0070665_100012115 Ga0070665_1000121158 298
306 3300006177 Ga0075362_10000128 Ga0075362_1000012815 298
307 3300006177 Ga0075362_10000940 Ga0075362_100009406 298
308 3300006178 Ga0075367_10006455 Ga0075367_100064554 298
309 3300006186 Ga0075369_10012111 Ga0075369_100121114 298
310 3300006195 Ga0075366_10001129 Ga0075366_1000112913 298
311 3300006195 Ga0075366_10047197 Ga0075366_100471972 298
312 3300009036 Ga0105244_10093755 Ga0105244_100937552 298
313 3300010375 Ga0105239_10817169 Ga0105239_108171691 298
314 3300013104 Ga0157370_10001455 Ga0157370_100014553 298
315 3300025245 Ga0207425_1002746 Ga0207425_10027462 298
316 3300025258 Ga0209129_1001456 Ga0209129_10014566 298
317 3300025258 Ga0209129_1013081 Ga0209129_10130812 298
318 3300025273 Ga0209673_1000312 Ga0209673_100031229 298
319 3300025273 Ga0209673_1000439 Ga0209673_100043915 298
320 3300025273 Ga0209673_1003095 Ga0209673_10030956 298
321 3300025273 Ga0209673_1014712 Ga0209673_10147125 298
322 3300025291 Ga0209675_1000108 Ga0209675_100010830 298
323 3300025292 Ga0209676_1000144 Ga0209676_100014474 298
324 3300025294 Ga0209025_1000046 Ga0209025_1000046244 298
325 3300025294 Ga0209025_1000389 Ga0209025_100038971 298
326 3300025295 Ga0209564_1000125 Ga0209564_100012557 298
327 3300025295 Ga0209564_1000185 Ga0209564_100018579 298
328 3300025295 Ga0209564_1000242 Ga0209564_100024275 298
329 3300025297 Ga0209758_1000621 Ga0209758_100062126 298
330 3300025297 Ga0209758_1010245 Ga0209758_10102455 298
331 3300025298 Ga0209050_1021064 Ga0209050_10210644 298
332 3300025299 Ga0209256_1001889 Ga0209256_100188913 298
333 3300025302 Ga0207426_1001122 Ga0207426_100112218 298
334 3300025303 Ga0209051_1000874 Ga0209051_100087423 298
335 3300025303 Ga0209051_1002243 Ga0209051_10022439 298
336 3300025303 Ga0209051_1010820 Ga0209051_10108202 298
337 3300025304 Ga0209257_1004872 Ga0209257_10048728 298
338 3300025923 Ga0207681_10113035 Ga0207681_101130352 298
339 3300026041 Ga0207639_10105118 Ga0207639_101051181 298
340 3300028379 Ga0268266_10014308 Ga0268266_100143081 298
341 3300028794 Ga0307515_10013332 Ga0307515_1001333210 298
342 3300031456 Ga0307513_10066026 Ga0307513_100660264 298
343 3300037471 Ga0395905_0003809 Ga0395905_0003809_1687_2598 298
344 3300039447 Ga0436361_1068300 Ga0436361_1068300_580_1509 298
345 3300041496 Ga0451839_0744782 Ga0451839_0744782_2037_2990 298
346 3300041501 Ga0451845_0430371 Ga0451845_0430371_1509_2462 298
347 3300041501 Ga0451845_0700627 Ga0451845_0700627_2828_3781 298
348 3300041512 Ga0451853_2207469 Ga0451853_2207469_758_1711 298
349 3300046474 Ga0495605_0103654 Ga0495605_0103654_203_1099 298
350 3300046512 Ga0495610_0024712 Ga0495610_0024712_1533_2429 298
351 3300046513 Ga0495616_0047965 Ga0495616_0047965_348_1244 298
352 3300046515 Ga0495620_0043193 Ga0495620_0043193_818_1771 298
353 3300046522 Ga0495643_0011453 Ga0495643_0011453_2014_2910 298
354 3300046523 Ga0495644_0078941 Ga0495644_0078941_304_1200 298
355 3300046530 Ga0495654_0159965 Ga0495654_0159965_21_974 298
356 3300046542 Ga0495597_0119689 Ga0495597_0119689_160_1056 298
357 3300046660 Ga0495625_0005983 Ga0495625_0005983_6903_7799 298
358 3300046810 Ga0495660_0090766 Ga0495660_0090766_214_1110 298
359 3300047318 Ga0495636_0083623 Ga0495636_0083623_238_1134 298
360 3300047323 Ga0495683_0084906 Ga0495683_0084906_430_1326 298
361 3300047443 Ga0495687_016127 Ga0495687_016127_406_1302 298
362 3300048928 Ga0496125_0179161 Ga0496125_0179161_313_1215 298
363 3300048929 Ga0496126_0202070 Ga0496126_0202070_265_1167 298
364 3300049776 Ga0501280_006411 Ga0501280_006411_164_1075 298
365 3300050489 nmdc:mga03683_71120_c1 nmdc:mga03683_71120_c1_561_1457 298
366 3300050490 nmdc:mga03n38_2283_c1 nmdc:mga03n38_2283_c1_2563_3459 298
367 3300050492 nmdc:mga0yw44_171786_c1 nmdc:mga0yw44_171786_c1_156_1058 298
368 3300050492 nmdc:mga0yw44_96_c1 nmdc:mga0yw44_96_c1_5177_6079 298
369 3300050492 nmdc:mga0yw44_97381_c1 nmdc:mga0yw44_97381_c1_780_1676 298
370 3300050493 nmdc:mga0k408_101017_c1 nmdc:mga0k408_101017_c1_444_1343 298
371 3300050493 nmdc:mga0k408_6874_c1 nmdc:mga0k408_6874_c1_449_1345 298
372 3300050494 nmdc:mga06z11_4851_c1 nmdc:mga06z11_4851_c1_1754_2650 298
373 3300050496 nmdc:mga07m45_144675_c1 nmdc:mga07m45_144675_c1_220_1122 298
374 3300050496 nmdc:mga07m45_7876_c1 nmdc:mga07m45_7876_c1_2663_3559 298
375 3300050516 nmdc:mga0sz30_41479_c1 nmdc:mga0sz30_41479_c1_846_1742 298
376 3300053086 Ga0500578_0040535 Ga0500578_0040535_2013_2909 298
377 3300053134 Ga0500658_0000067 Ga0500658_0000067_22345_23241 298
378 3300053137 Ga0500561_0000033 Ga0500561_0000033_2931_3833 298
379 3300053153 Ga0500616_0027770 Ga0500616_0027770_1101_1997 298
380 iso_pu_bacteria 2871495908 2871497431 298
381 iso_pu_bacteria 2878760144 2878761649 298
382 iso_pu_bacteria 2878767105 2878768616 298
383 iso_pu_bacteria 2903540706 2903542226 298
384 iso_pu_bacteria 2922130491 2922138075 298
385 iso_pu_bacteria 2922158528 2922162389 298
386 iso_pu_bacteria 2924726620 2924726995 298
387 iso_pu_bacteria 2937994558 2937996079 298
388 iso_pu_bacteria 2958165035 2958166551 298
389 iso_pu_bacteria 2961163497 2961165016 298
390 iso_pu_bacteria 2965018300 2965019841 298
391 iso_pu_bacteria 2965062239 2965063856 298
392 iso_pu_bacteria 2968097103 2968103333 298
393 iso_pu_bacteria 2968128360 2968132330 298
394 iso_pu_bacteria 2968171901 2968173416 298
395 iso_pu_bacteria 2970554993 2970556505 298
396 iso_pu_bacteria 2977971508 2977977991 298
397 iso_pu_bacteria 2979779861 2979781620 298
398 iso_pu_bacteria 2987659509 2987661023 298
399 iso_pu_bacteria 2996341866 2996345874 298
400 iso_pu_bacteria 2996887358 2996890576 298
401 iso_pu_bacteria 3004188549 3004190073 298
402 iso_pu_bacteria 8004640170 8004645974 298
403 iso_pu_bacteria 8005258706 8005264305 298
404 iso_pu_bacteria 8005321885 8005325103 298
405 iso_pu_bacteria 8054002106 8054003667 298
406 iso_pu_bacteria 8057874678 8057876758 298
407 3300031730 Ga0307516_10331684 Ga0307516_103316842 299
408 3300039450 Ga0436363_1503130 Ga0436363_1503130_32_931 299
409 3300053151 Ga0500604_0010952 Ga0500604_0010952_155_1063 299
410 iso_pu_bacteria 2503198000 2503203741 299
411 iso_pu_bacteria 2508501123 2509113899 299
412 iso_pu_bacteria 2509276022 2509398103 299
413 iso_pu_bacteria 2510917028 2511187129 299
414 iso_pu_bacteria 2510917030 2511198471 299
415 iso_pu_bacteria 2513237084 2513572543 299
416 iso_pu_bacteria 2513237088 2513599150 299
417 iso_pu_bacteria 2513237090 2513608042 299
418 iso_pu_bacteria 2513237138 2513869738 299
419 iso_pu_bacteria 2513237144 2513908259 299
420 iso_pu_bacteria 2513237146 2513926879 299
421 iso_pu_bacteria 2513237305 2514423188 299
422 iso_pu_bacteria 2534681796 2535519516 299
423 iso_pu_bacteria 2582581294 2585202554 299
424 iso_pu_bacteria 2582581867 2585403313 299
425 iso_pu_bacteria 2585427590 2585823610 299
426 iso_pu_bacteria 2599185170 2599420627 299
427 iso_pu_bacteria 2599185301 2599938583 299
428 iso_pu_bacteria 2643221599 2644006330 299
429 iso_pu_bacteria 2643221634 2644191465 299
430 iso_pu_bacteria 2693429783 2694632683 299
431 iso_pu_bacteria 2693429784 2694639588 299
432 iso_pu_bacteria 2721755686 2723577778 299
433 iso_pu_bacteria 2838035591 2838040699 299
434 iso_pu_bacteria 2838661181 2838664914 299
435 iso_pu_bacteria 2856349417 2856352094 299
436 iso_pu_bacteria 2856356410 2856356493 299
437 iso_pu_bacteria 2856364286 2856365289 299
438 iso_pu_bacteria 2857349434 2857354718 299
439 iso_pu_bacteria 2869162929 2869163111 299
440 iso_pu_bacteria 2869285874 2869289200 299
441 iso_pu_bacteria 2871429161 2871431268 299
442 iso_pu_bacteria 2871488783 2871492710 299
443 iso_pu_bacteria 2874146452 2874148467 299
444 iso_pu_bacteria 2874155637 2874156211 299
445 iso_pu_bacteria 2876392853 2876398968 299
446 iso_pu_bacteria 2876413966 2876415246 299
447 iso_pu_bacteria 2878745973 2878747872 299
448 iso_pu_bacteria 2878753008 2878758590 299
449 iso_pu_bacteria 2881147464 2881154118 299
450 iso_pu_bacteria 2881155292 2881157853 299
451 iso_pu_bacteria 2881161766 2881163185 299
452 iso_pu_bacteria 2881845957 2881848107 299
453 iso_pu_bacteria 2881861095 2881861852 299
454 iso_pu_bacteria 2882632389 2882639956 299
455 iso_pu_bacteria 2882912400 2882916390 299
456 iso_pu_bacteria 2885305155 2885312147 299
457 iso_pu_bacteria 2885318864 2885319759 299
458 iso_pu_bacteria 2885326080 2885326798 299
459 iso_pu_bacteria 2888350351 2888351117 299
460 iso_pu_bacteria 2889010040 2889013506 299
461 iso_pu_bacteria 2889016732 2889021776 299
462 iso_pu_bacteria 2903492973 2903496558 299
463 iso_pu_bacteria 2903492973 2903505872 299
464 iso_pu_bacteria 2904659560 2904665500 299
465 iso_pu_bacteria 2906308376 2906311490 299
466 iso_pu_bacteria 2906321335 2906323230 299
467 iso_pu_bacteria 2919100787 2919104496 299
468 iso_pu_bacteria 2922185730 2922187059 299
469 iso_pu_bacteria 2923556063 2923558855 299
470 iso_pu_bacteria 2924784321 2924785165 299
471 iso_pu_bacteria 2933016740 2933017462 299
472 iso_pu_bacteria 2937813078 2937818689 299
473 iso_pu_bacteria 2938014810 2938018581 299
474 iso_pu_bacteria 2958041894 2958048122 299
475 iso_pu_bacteria 2958064165 2958066292 299
476 iso_pu_bacteria 2958100919 2958103928 299
477 iso_pu_bacteria 2958130278 2958133576 299
478 iso_pu_bacteria 2958172287 2958174277 299
479 iso_pu_bacteria 2958179912 2958183220 299
480 iso_pu_bacteria 2961077736 2961081187 299
481 iso_pu_bacteria 2961114664 2961120500 299
482 iso_pu_bacteria 2961170736 2961173214 299
483 iso_pu_bacteria 2965119406 2965127225 299
484 iso_pu_bacteria 2967996073 2967998385 299
485 iso_pu_bacteria 2968003550 2968006189 299
486 iso_pu_bacteria 2968110612 2968116967 299
487 iso_pu_bacteria 2968117919 2968118693 299
488 iso_pu_bacteria 2970503327 2970505808 299
489 iso_pu_bacteria 2977821940 2977827124 299
490 iso_pu_bacteria 2977828996 2977830598 299
491 iso_pu_bacteria 2977843712 2977844514 299
492 iso_pu_bacteria 2977864932 2977870438 299
493 iso_pu_bacteria 2977942078 2977946498 299
494 iso_pu_bacteria 2979710463 2979716205 299
495 iso_pu_bacteria 2979808191 2979810529 299
496 iso_pu_bacteria 2987636660 2987643320 299
497 iso_pu_bacteria 3000135777 3000141232 299
498 iso_pu_bacteria 3004203850 3004206866 299
499 iso_pu_bacteria 3005445848 3005449211 299
500 iso_pu_bacteria 3005452660 3005455474 299
501 iso_pu_bacteria 8004374579 8004380107 299
502 iso_pu_bacteria 8004387939 8004391079 299
503 iso_pu_bacteria 8004714634 8004716450 299
504 iso_pu_bacteria 8005542996 8005547209 299
505 3300005548 Ga0070665_100013795 Ga0070665_1000137953 300
506 3300005548 Ga0070665_100159477 Ga0070665_1001594773 300
507 3300010375 Ga0105239_10007580 Ga0105239_100075808 300
508 3300025914 Ga0207671_10000461 Ga0207671_1000046144 300
509 3300028379 Ga0268266_10000086 Ga0268266_10000086114 300
510 3300028379 Ga0268266_10201003 Ga0268266_102010033 300
511 3300041413 Ga0439465_0001676 Ga0439465_0001676_5376_6284 300
512 3300046492 Ga0495585_0004599 Ga0495585_0004599_5613_6527 300
513 3300046507 Ga0495606_0119161 Ga0495606_0119161_604_1506 300
514 3300046660 Ga0495625_0080571 Ga0495625_0080571_1056_1970 300
515 3300046691 Ga0495670_0135433 Ga0495670_0135433_350_1258 300
516 3300047472 Ga0495686_0228521 Ga0495686_0228521_23_934 300
517 3300053153 Ga0500616_0101333 Ga0500616_0101333_123_1031 300
518 iso_pu_bacteria 2876377896 2876385177 300
519 3300006048 Ga0075363_100007136 Ga0075363_1000071364 301
520 3300041507 Ga0451851_0474418 Ga0451851_0474418_200_1168 301
521 iso_pu_bacteria 2929199973 2929202327 301
522 iso_pu_bacteria 3005409236 3005415566 301
523 iso_pu_bacteria 8055909800 8055913786 301
524 3300005539 Ga0068853_100036598 Ga0068853_1000365981 302
525 3300005937 Ga0081455_10205297 Ga0081455_102052972 302
526 3300009545 Ga0105237_10049273 Ga0105237_100492732 302
527 3300009551 Ga0105238_10002917 Ga0105238_1000291717 302
528 3300025294 Ga0209025_1032871 Ga0209025_10328713 302
529 3300025297 Ga0209758_1021472 Ga0209758_10214724 302
530 3300025904 Ga0207647_10039433 Ga0207647_100394332 302
531 3300025924 Ga0207694_10005520 Ga0207694_100055202 302
532 3300026116 Ga0207674_10153672 Ga0207674_101536722 302
533 3300037312 Ga0395899_0172777 Ga0395899_0172777_117_1034 302
534 3300048921 Ga0496118_0187605 Ga0496118_0187605_19_930 302
535 3300048925 Ga0496122_0101310 Ga0496122_0101310_301_1215 302
536 3300048929 Ga0496126_0051373 Ga0496126_0051373_2687_3607 302
537 3300049822 Ga0501035_0010471 Ga0501035_0010471_2901_3824 302
538 3300049823 Ga0501044_0050776 Ga0501044_0050776_3137_4060 302
539 3300049823 Ga0501044_0528375 Ga0501044_0528375_16_939 302
540 3300002705 JGI25156J39149_1005532 JGI25156J39149_10055322 303
541 3300002739 JGI25158J39367_1000180 JGI25158J39367_100018010 303
542 3300002741 JGI25157J39369_1001050 JGI25157J39369_10010502 303
543 3300002773 JGI25152J39213_1001981 JGI25152J39213_100198110 303
544 3300002773 JGI25152J39213_1005036 JGI25152J39213_10050363 303
545 3300002987 JGI25159J45721_1001406 JGI25159J45721_10014067 303
546 3300003187 JGI25151J46595_10002206 JGI25151J46595_100022067 303
547 3300003187 JGI25151J46595_10016424 JGI25151J46595_100164241 303
548 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016278 303
549 3300003215 JGI25153J46596_10003024 JGI25153J46596_100030247 303
550 3300003354 JGI25160J50197_1008267 JGI25160J50197_10082672 303
551 3300003374 JGI25161J50226_1000114 JGI25161J50226_100011432 303
552 3300003771 Ga0055526_1002600 Ga0055526_10026005 303
553 3300003775 Ga0055524_1011549 Ga0055524_10115493 303
554 3300003775 Ga0055524_1014713 Ga0055524_10147131 303
555 3300003775 Ga0055524_1018277 Ga0055524_10182772 303
556 3300003790 Ga0055528_1009892 Ga0055528_10098922 303
557 3300003792 Ga0055540_1001218 Ga0055540_10012183 303
558 3300004625 Ga0055543_1000077 Ga0055543_100007727 303
559 3300005262 Ga0065165_1010241 Ga0065165_10102412 303
560 3300005331 Ga0070670_100160644 Ga0070670_1001606442 303
561 3300005355 Ga0070671_100042321 Ga0070671_1000423212 303
562 3300006038 Ga0075365_10009275 Ga0075365_100092756 303
563 3300006178 Ga0075367_10004695 Ga0075367_100046956 303
564 3300006186 Ga0075369_10014442 Ga0075369_100144422 303
565 3300009011 Ga0105251_10012908 Ga0105251_100129085 303
566 3300009177 Ga0105248_10038064 Ga0105248_100380644 303
567 3300025208 Ga0209436_100050 Ga0209436_10005032 303
568 3300025246 Ga0209646_1005372 Ga0209646_10053722 303
569 3300025250 Ga0209026_1000005 Ga0209026_1000005400 303
570 3300025256 Ga0209759_1000292 Ga0209759_100029247 303
571 3300025258 Ga0209129_1000080 Ga0209129_100008083 303
572 3300025258 Ga0209129_1001687 Ga0209129_100168710 303
573 3300025258 Ga0209129_1007430 Ga0209129_10074306 303
574 3300025261 Ga0209233_1000068 Ga0209233_1000068280 303
575 3300025273 Ga0209673_1003647 Ga0209673_100364710 303
576 3300025273 Ga0209673_1008335 Ga0209673_10083352 303
577 3300025273 Ga0209673_1008603 Ga0209673_10086034 303
578 3300025284 Ga0209130_1000030 Ga0209130_1000030234 303
579 3300025294 Ga0209025_1013719 Ga0209025_10137192 303
580 3300025294 Ga0209025_1019307 Ga0209025_10193071 303
581 3300025294 Ga0209025_1021393 Ga0209025_10213933 303
582 3300025295 Ga0209564_1000364 Ga0209564_100036414 303
583 3300025295 Ga0209564_1008211 Ga0209564_10082116 303
584 3300025295 Ga0209564_1013994 Ga0209564_10139946 303
585 3300025297 Ga0209758_1001342 Ga0209758_100134216 303
586 3300025297 Ga0209758_1001459 Ga0209758_100145926 303
587 3300025297 Ga0209758_1012315 Ga0209758_10123152 303
588 3300025299 Ga0209256_1002320 Ga0209256_100232016 303
589 3300025299 Ga0209256_1004718 Ga0209256_100471812 303
590 3300025299 Ga0209256_1010950 Ga0209256_10109506 303
591 3300025299 Ga0209256_1018180 Ga0209256_10181802 303
592 3300025299 Ga0209256_1023081 Ga0209256_10230812 303
593 3300025302 Ga0207426_1000047 Ga0207426_1000047167 303
594 3300025302 Ga0207426_1009672 Ga0207426_10096724 303
595 3300025303 Ga0209051_1001764 Ga0209051_100176413 303
596 3300025304 Ga0209257_1016732 Ga0209257_10167322 303
597 3300026067 Ga0207678_10028827 Ga0207678_100288275 303
598 3300026121 Ga0207683_10498084 Ga0207683_104980842 303
599 3300037418 Ga0395900_0216217 Ga0395900_0216217_518_1438 303
600 3300038443 Ga0395901_0134754 Ga0395901_0134754_87_1040 303
601 3300041410 Ga0439461_0035490 Ga0439461_0035490_87_1007 303
602 3300044658 Ga0466972_0080689 Ga0466972_0080689_426_1346 303
603 3300046512 Ga0495610_0019884 Ga0495610_0019884_521_1567 303
604 3300046522 Ga0495643_0009269 Ga0495643_0009269_1870_2916 303
605 3300046694 Ga0495649_0053272 Ga0495649_0053272_862_1908 303
606 3300048091 Ga0495626_0091177 Ga0495626_0091177_13_933 303
607 3300048909 Ga0496106_0000106 Ga0496106_0000106_8450_9436 303
608 3300048909 Ga0496106_0078865 Ga0496106_0078865_965_1885 303
609 3300048913 Ga0496110_0021717 Ga0496110_0021717_2552_3481 303
610 3300048919 Ga0496116_0022292 Ga0496116_0022292_1959_2888 303
611 3300048919 Ga0496116_0036053 Ga0496116_0036053_445_1491 303
612 3300048920 Ga0496117_0042063 Ga0496117_0042063_668_1714 303
613 3300048921 Ga0496118_0016317 Ga0496118_0016317_2113_3159 303
614 3300048921 Ga0496118_0091904 Ga0496118_0091904_532_1461 303
615 3300048922 Ga0496119_0012399 Ga0496119_0012399_2558_3487 303
616 3300048922 Ga0496119_0031096 Ga0496119_0031096_2019_2969 303
617 3300048923 Ga0496120_0002959 Ga0496120_0002959_8389_9339 303
618 3300048924 Ga0496121_0028161 Ga0496121_0028161_3572_4540 303
619 3300048924 Ga0496121_0033035 Ga0496121_0033035_1973_3019 303
620 3300048924 Ga0496121_0036220 Ga0496121_0036220_1790_2710 303
621 3300048924 Ga0496121_0107573 Ga0496121_0107573_383_1312 303
622 3300048925 Ga0496122_0018058 Ga0496122_0018058_2327_3256 303
623 3300048925 Ga0496122_0029057 Ga0496122_0029057_2073_3119 303
624 3300048926 Ga0496123_0022351 Ga0496123_0022351_1993_2922 303
625 3300048926 Ga0496123_0030152 Ga0496123_0030152_1299_2345 303
626 3300048927 Ga0496124_0056962 Ga0496124_0056962_1197_2126 303
627 3300048928 Ga0496125_0013718 Ga0496125_0013718_5029_6075 303
628 3300048928 Ga0496125_0023218 Ga0496125_0023218_2032_2961 303
629 3300048929 Ga0496126_0041314 Ga0496126_0041314_133_1101 303
630 3300048929 Ga0496126_0270789 Ga0496126_0270789_168_1097 303
631 3300049569 Ga0501032_0044104 Ga0501032_0044104_1504_2436 303
632 3300049571 Ga0501034_0430599 Ga0501034_0430599_52_984 303
633 3300049580 Ga0501046_0127832 Ga0501046_0127832_414_1346 303
634 3300050492 nmdc:mga0yw44_6595_c1 nmdc:mga0yw44_6595_c1_4095_5015 303
635 3300050516 nmdc:mga0sz30_19380_c1 nmdc:mga0sz30_19380_c1_858_1811 303
636 3300053079 Ga0500610_0061674 Ga0500610_0061674_233_1153 303
637 3300053134 Ga0500658_0066098 Ga0500658_0066098_411_1343 303
638 3300053139 Ga0500568_0002618 Ga0500568_0002618_7889_8821 303
639 3300053151 Ga0500604_0006906 Ga0500604_0006906_908_1840 303
640 3300053156 Ga0500622_0000237 Ga0500622_0000237_2947_3993 303
641 3300053160 Ga0500633_0003057 Ga0500633_0003057_1576_2562 303
642 3300060353 Ga0501082_0072958 Ga0501082_0072958_1878_2810 303
643 iso_pu_bacteria 2582581304 2585257738 303
644 iso_pu_bacteria 2585427594 2585845264 303
645 3300039450 Ga0436363_0747323 Ga0436363_0747323_426_1373 304
646 3300039447 Ga0436361_0575458 Ga0436361_0575458_362_1327 305
647 3300045049 Ga0466959_0062249 Ga0466959_0062249_1518_2462 305
648 3300048929 Ga0496126_0306556 Ga0496126_0306556_231_1172 305
649 iso_pu_bacteria 2582581308 2585280381 305
650 iso_pu_bacteria 2582581315 2585322658 305
651 iso_pu_bacteria 2585427527 2585532611 305
652 iso_pu_bacteria 2585427530 2585554373 305
653 iso_pu_bacteria 2615840626 2616307319 305
654 iso_pu_bacteria 2818991453 2819639780 305
655 iso_pu_bacteria 8024486573 8024489285 305
656 3300003187 JGI25151J46595_10000031 JGI25151J46595_1000003194 306
657 3300003215 JGI25153J46596_10008684 JGI25153J46596_100086843 306
658 3300025245 Ga0207425_1000058 Ga0207425_1000058138 306
659 3300025258 Ga0209129_1000107 Ga0209129_1000107138 306
660 3300025273 Ga0209673_1002998 Ga0209673_100299812 306
661 3300025294 Ga0209025_1000083 Ga0209025_1000083138 306
662 3300025297 Ga0209758_1000090 Ga0209758_1000090125 306
663 3300028794 Ga0307515_10027093 Ga0307515_100270938 306
664 3300046492 Ga0495585_0016700 Ga0495585_0016700_3002_3934 306
665 3300046507 Ga0495606_0004192 Ga0495606_0004192_7790_8716 306
666 3300046557 Ga0495622_0070780 Ga0495622_0070780_613_1545 306
667 3300046615 Ga0495656_0078455 Ga0495656_0078455_301_1233 306
668 3300046674 Ga0495588_0125700 Ga0495588_0125700_372_1304 306
669 3300047470 Ga0495681_0008178 Ga0495681_0008178_291_1229 306
670 3300047470 Ga0495681_0014765 Ga0495681_0014765_2843_3787 306
671 3300047472 Ga0495686_0000685 Ga0495686_0000685_6509_7432 306
672 3300047472 Ga0495686_0013797 Ga0495686_0013797_4487_5437 306
673 3300048919 Ga0496116_0001128 Ga0496116_0001128_28035_28973 306
674 3300048919 Ga0496116_0006341 Ga0496116_0006341_7048_7986 306
675 3300048920 Ga0496117_0009481 Ga0496117_0009481_6934_7872 306
676 3300048921 Ga0496118_0059136 Ga0496118_0059136_364_1314 306
677 3300048924 Ga0496121_0010544 Ga0496121_0010544_8970_9908 306
678 3300048924 Ga0496121_0014862 Ga0496121_0014862_6396_7322 306
679 3300048925 Ga0496122_0007183 Ga0496122_0007183_5154_6092 306
680 3300048926 Ga0496123_0005151 Ga0496123_0005151_5176_6114 306
681 3300048927 Ga0496124_0003535 Ga0496124_0003535_2929_3867 306
682 3300048928 Ga0496125_0009740 Ga0496125_0009740_1785_2723 306
683 3300053107 Ga0500560_000510 Ga0500560_000510_2041_2979 306
684 3300031911 Ga0307412_10067639 Ga0307412_100676393 307
685 3300046459 Ga0495629_0092130 Ga0495629_0092130_733_1656 307
686 3300046557 Ga0495622_0035953 Ga0495622_0035953_35_958 307
687 3300046675 Ga0495657_0042631 Ga0495657_0042631_1592_2515 307
688 3300047321 Ga0495676_0070218 Ga0495676_0070218_988_1911 307
689 3300048919 Ga0496116_0073111 Ga0496116_0073111_1177_2118 307
690 3300048924 Ga0496121_0034768 Ga0496121_0034768_344_1285 307
691 3300048925 Ga0496122_0075034 Ga0496122_0075034_1236_2177 307
692 3300048926 Ga0496123_0125665 Ga0496123_0125665_474_1415 307
693 3300048927 Ga0496124_0084150 Ga0496124_0084150_463_1404 307
694 3300048927 Ga0496124_0111043 Ga0496124_0111043_1198_2139 307
695 3300053121 Ga0500607_060903 Ga0500607_060903_162_1085 307
696 3300053148 Ga0500590_000103 Ga0500590_000103_3192_4115 307
697 iso_pu_bacteria 2582581299 2585227727 307
698 3300003322 rootL2_10226176 rootL2_102261761 308
699 3300003214 JGI25165J46597_1008042 JGI25165J46597_10080422 309
700 3300005548 Ga0070665_100259226 Ga0070665_1002592261 309
701 3300005563 Ga0068855_100179404 Ga0068855_1001794042 309
702 3300009093 Ga0105240_10000019 Ga0105240_10000019262 309
703 3300009148 Ga0105243_10052786 Ga0105243_100527861 309
704 3300009545 Ga0105237_10014402 Ga0105237_100144022 309
705 3300013104 Ga0157370_10008723 Ga0157370_1000872312 309
706 3300013105 Ga0157369_10173794 Ga0157369_101737942 309
707 3300015262 Ga0182007_10003955 Ga0182007_100039556 309
708 3300025253 Ga0209677_102053 Ga0209677_1020539 309
709 3300025261 Ga0209233_1000194 Ga0209233_100019499 309
710 3300025913 Ga0207695_10000049 Ga0207695_10000049264 309
711 3300025914 Ga0207671_10000591 Ga0207671_1000059118 309
712 3300025949 Ga0207667_10154770 Ga0207667_101547702 309
713 3300028379 Ga0268266_10024552 Ga0268266_100245528 309
714 3300031456 Ga0307513_10235046 Ga0307513_102350462 309
715 3300046506 Ga0495583_0071333 Ga0495583_0071333_416_1351 309
716 3300046513 Ga0495616_0017890 Ga0495616_0017890_2209_3144 309
717 3300046518 Ga0495631_0000815 Ga0495631_0000815_2805_3740 309
718 3300046519 Ga0495632_0025506 Ga0495632_0025506_289_1224 309
719 3300046616 Ga0495668_0005275 Ga0495668_0005275_4945_5880 309
720 3300046660 Ga0495625_0057398 Ga0495625_0057398_1391_2326 309
721 3300047320 Ga0495672_0004852 Ga0495672_0004852_4528_5490 309
722 3300048905 Ga0496102_0012405 Ga0496102_0012405_1930_2883 309
723 3300048906 Ga0496103_0020699 Ga0496103_0020699_1634_2587 309
724 3300048920 Ga0496117_0001714 Ga0496117_0001714_27421_28374 309
725 3300048921 Ga0496118_0000991 Ga0496118_0000991_27422_28375 309
726 3300048922 Ga0496119_0019736 Ga0496119_0019736_3482_4435 309
727 3300048923 Ga0496120_0006425 Ga0496120_0006425_493_1446 309
728 3300048924 Ga0496121_0003374 Ga0496121_0003374_2351_3304 309
729 3300048925 Ga0496122_0018232 Ga0496122_0018232_4485_5438 309
730 3300048926 Ga0496123_0010370 Ga0496123_0010370_2812_3765 309
731 3300048928 Ga0496125_0015447 Ga0496125_0015447_4481_5434 309
732 3300049459 Ga0495678_006144 Ga0495678_006144_4090_5025 309
733 3300053079 Ga0500610_0002770 Ga0500610_0002770_4619_5554 309
734 3300053108 Ga0500562_025884 Ga0500562_025884_251_1213 309
735 3300053109 Ga0500569_001114 Ga0500569_001114_3959_4894 309
736 3300053139 Ga0500568_0000185 Ga0500568_0000185_41736_42698 309
737 3300053153 Ga0500616_0000526 Ga0500616_0000526_30030_30992 309
738 3300053727 Ga0500611_005194 Ga0500611_005194_550_1512 309
739 iso_pu_bacteria 2510917022 2511136636 309
740 iso_pu_bacteria 2524023209 2524460148 309
741 iso_pu_bacteria 2582581307 2585274208 309
742 iso_pu_bacteria 2582581316 2585330772 309
743 iso_pu_bacteria 2585427531 2585560657 309
744 iso_pu_bacteria 2585427608 2585898865 309
745 iso_pu_bacteria 2585427609 2585903545 309
746 iso_pu_bacteria 2585428125 2587981336 309
747 iso_pu_bacteria 2615840698 2616554863 309
748 iso_pu_bacteria 2617270742 2617383532 309
749 iso_pu_bacteria 2667528174 2671112113 309
750 iso_pu_bacteria 2775507266 2778175928 309
751 iso_pu_bacteria 2818991448 2819609680 309
752 iso_pu_bacteria 2838029111 2838033054 309
753 iso_pu_bacteria 2842298080 2842298626 309
754 iso_pu_bacteria 2842357229 2842359507 309
755 iso_pu_bacteria 2842475841 2842479787 309
756 iso_pu_bacteria 2842482326 2842483473 309
757 iso_pu_bacteria 2842502639 2842506963 309
758 iso_pu_bacteria 2842509118 2842510654 309
759 iso_pu_bacteria 2852387548 2852391119 309
760 iso_pu_bacteria 2919408235 2919410598 309
761 iso_pu_bacteria 3005416602 3005418564 309
762 iso_pu_bacteria 8005314921 8005318544 309
763 iso_pu_bacteria 8005484373 8005488574 309
764 iso_pu_bacteria 8005645114 8005649041 309
765 iso_pu_bacteria 8005682033 8005682280 309
766 iso_pu_bacteria 8046767195 8046773298 309
767 iso_pu_bacteria 8057575449 8057580969 309
768 3300005366 Ga0070659_100003983 Ga0070659_1000039839 312
769 3300005458 Ga0070681_10021500 Ga0070681_100215004 312
770 3300005530 Ga0070679_100148422 Ga0070679_1001484222 312
771 3300025912 Ga0207707_10288164 Ga0207707_102881642 312
772 3300025921 Ga0207652_10117883 Ga0207652_101178832 312
773 3300025932 Ga0207690_10006097 Ga0207690_100060972 312
774 3300001979 JGI24740J21852_10012667 JGI24740J21852_100126673 313
775 3300002704 JGI25155J39150_1000007 JGI25155J39150_100000782 313
776 3300002705 JGI25156J39149_1000066 JGI25156J39149_100006683 313
777 3300002737 JGI25162J39368_1000875 JGI25162J39368_100087514 313
778 3300002738 JGI25154J39366_1000169 JGI25154J39366_10001694 313
779 3300002741 JGI25157J39369_1000197 JGI25157J39369_10001976 313
780 3300003214 JGI25165J46597_1000402 JGI25165J46597_100040223 313
781 3300003214 JGI25165J46597_1000734 JGI25165J46597_10007344 313
782 3300003320 rootH2_10039535 rootH2_100395353 313
783 3300003354 JGI25160J50197_1000114 JGI25160J50197_100011418 313
784 3300003374 JGI25161J50226_1000089 JGI25161J50226_100008965 313
785 3300004625 Ga0055543_1000002 Ga0055543_1000002395 313
786 3300005262 Ga0065165_1001020 Ga0065165_100102022 313
787 3300005614 Ga0068856_100009870 Ga0068856_10000987010 313
788 3300006353 Ga0075370_10023223 Ga0075370_100232235 313
789 3300025206 Ga0209435_100005 Ga0209435_100005233 313
790 3300025228 Ga0209672_103804 Ga0209672_1038045 313
791 3300025233 Ga0209437_100058 Ga0209437_100058339 313
792 3300025233 Ga0209437_100078 Ga0209437_100078258 313
793 3300025246 Ga0209646_1000011 Ga0209646_1000011233 313
794 3300025250 Ga0209026_1000008 Ga0209026_1000008233 313
795 3300025254 Ga0209148_1020332 Ga0209148_10203322 313
796 3300025256 Ga0209759_1000004 Ga0209759_1000004233 313
797 3300025261 Ga0209233_1000157 Ga0209233_100015782 313
798 3300025261 Ga0209233_1000192 Ga0209233_1000192104 313
799 3300025284 Ga0209130_1000083 Ga0209130_1000083104 313
800 3300025302 Ga0207426_1000173 Ga0207426_1000173104 313
801 3300026078 Ga0207702_10033500 Ga0207702_100335001 313
802 3300027312 Ga0209371_1005394 Ga0209371_10053946 313
803 3300030500 Ga0268256_1019197 Ga0268256_10191972 313
804 3300044765 Ga0466970_0004245 Ga0466970_0004245_1596_2537 313
805 3300044842 Ga0466957_0032121 Ga0466957_0032121_51_992 313
806 3300045049 Ga0466959_0054439 Ga0466959_0054439_1829_2770 313
807 3300045976 Ga0466967_0416201 Ga0466967_0416201_47_988 313
808 3300047470 Ga0495681_0067053 Ga0495681_0067053_203_1144 313
809 3300048922 Ga0496119_0024824 Ga0496119_0024824_1526_2467 313
810 3300048923 Ga0496120_0043832 Ga0496120_0043832_1115_2056 313
811 3300048924 Ga0496121_0079147 Ga0496121_0079147_1448_2389 313
812 3300048925 Ga0496122_0014363 Ga0496122_0014363_1766_2707 313
813 3300048927 Ga0496124_0015621 Ga0496124_0015621_4006_4947 313
814 3300048928 Ga0496125_0155438 Ga0496125_0155438_121_1062 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

46

105

0.97

PF03466

LysR_substrate

LysR substrate binding domain

127

327

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z4y-assembly1.cif.gz_B crystal structure of pacysb ntd domain with space group p4 0.9041 5 87
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.901 7 87
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.8984 7 84
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.8974 7 87
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.8958 7 87
ID Description Score Start End Superfamily
af_P33634_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9549 7 88 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9446 6 77 1.10.10.10
af_P36771_5_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9433 1 86 1.10.10.10
4gwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9398 92 149 3.40.190.10
af_Q2FZS7_1_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9392 7 88 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A658JMP9-F1-model_v4 deleted 0.9288 7 84
AF-U1BSD3-F1-model_v4 deleted 0.9142 7 202
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9109 8 87 GO:0003700
GO:0006351
GO:0043565
AF-U1BSD3-F1-model_v4 deleted 0.8966 7 202
AF-A0A2G6K8T7-F1-model_v4 LysR family transcriptional regulator 0.8965 5 77 GO:0003700
GO:0005829

Feature Viewer

pLDDT pTM Quality
88.66 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map