F481993
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 814 | 572 | 470 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0019884|Ga0495610_0019884_521_1567 |
| Length | 348 |
| Sequence | MALDASLFFVLTGEACHDTMVRKIRILWMNYPENRDREMRRITFDLDVLRTFATGMDLGNFARAADRLGRSTSAVSAQLKKLEEQAGTPIFRKSGRGLALTEAGETMLAYARRLLDLNDEAVAAVQSVELEGWVRLGLQEDFGENLLPEVLGRFARAHPKVRIEARVVRNAELLERVTTGKLDLALAWSTGTLTAHCEYIADVPMRWIGPANGLPAWAAGGGEPMPLASLEAPCLLRNAATKVLDEAGISWRLSFVSPSLGGLWAATAAGLGITVRTPIGLPAKVRMLTSGEAGLPELPKLGLVLHRAEAEPDAATSRLAELVLQSVHEAVRDISIPSDQEKALRRFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 12 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 13 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 14 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 15 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 16 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 17 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 18 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 19 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 20 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 21 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 22 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 23 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 24 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 25 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 26 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 27 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 28 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 29 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 30 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 31 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 32 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 33 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 34 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 35 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 36 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 37 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 38 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 39 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 40 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 41 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 42 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 43 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 44 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 45 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 46 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 47 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 48 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 49 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 50 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 51 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 52 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 53 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 54 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 55 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 56 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 57 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 58 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 59 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 60 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 61 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 62 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 63 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 64 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 65 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 66 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 67 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 68 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 69 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 70 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 71 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 72 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 73 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 74 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 75 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 76 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 77 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 78 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 79 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 80 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 81 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 82 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 83 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 84 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 85 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 86 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 87 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 88 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 89 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 90 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 91 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 92 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 93 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 94 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 95 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 96 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 97 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 98 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 99 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 100 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 101 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 102 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 103 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 104 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 105 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 106 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 107 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 108 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 109 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 110 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 111 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 112 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 113 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 114 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 115 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 116 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 117 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 118 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 119 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 120 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 121 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 122 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 123 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 124 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 125 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 126 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 127 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 128 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 129 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 130 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 131 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 132 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 133 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 134 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 135 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 136 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 137 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 138 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 139 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 140 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 141 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 142 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 143 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 144 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 145 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 146 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 147 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 148 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 149 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 150 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 151 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 152 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 153 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 154 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 155 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 156 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 157 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 158 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 159 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 160 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 161 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 162 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 163 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 164 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 165 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 166 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 167 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 168 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 169 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 170 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 171 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 172 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 173 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 174 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 175 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 176 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 177 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 178 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 179 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 180 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 181 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 182 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 183 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 184 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 185 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 186 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 187 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 188 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 189 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 190 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 191 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 192 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 193 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 194 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 195 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 196 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 197 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 198 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 199 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 200 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 201 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 202 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 203 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 204 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 205 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 206 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 207 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 208 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 209 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 210 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 211 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 212 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 213 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 214 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 215 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 216 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 217 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 218 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 219 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 220 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 221 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 222 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 223 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 224 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 225 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 226 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 227 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 228 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 229 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 230 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 231 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 232 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 233 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 234 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 235 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 236 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 237 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 238 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 239 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 240 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 241 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 242 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 243 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 244 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 245 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 246 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 247 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 248 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 249 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 250 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 251 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 252 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 253 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 254 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 255 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 256 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 257 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 258 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 259 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 260 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 261 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 262 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 263 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 264 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 265 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 266 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 267 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 268 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 269 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 270 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 271 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 272 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 273 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 274 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 275 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 276 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 277 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 278 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 279 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 280 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 281 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 282 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 283 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 284 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 285 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 286 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 287 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 288 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 289 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 290 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 291 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 292 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 293 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 294 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 295 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 296 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 297 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 298 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 299 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 300 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 301 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 302 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 303 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 304 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 305 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 306 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 307 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 308 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 309 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 310 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 311 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 312 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 313 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 314 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 315 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 316 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 317 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 318 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 319 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 320 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 321 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 322 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 323 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 324 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 325 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 326 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 327 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 328 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 333 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 334 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 335 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 337 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 338 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 339 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 340 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 341 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 342 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 343 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 344 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 345 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 346 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 347 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 348 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 352 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 353 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 355 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 356 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 357 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 359 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 360 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 362 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 363 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 364 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 365 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 367 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 370 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 373 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 374 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 375 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 377 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 378 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 379 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 382 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 383 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 384 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 385 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 386 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 387 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 388 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 389 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 390 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 391 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 392 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 393 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 411 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 412 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 413 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 414 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 415 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 416 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 417 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 418 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 419 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 420 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 421 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 422 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 423 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 424 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 425 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 426 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 427 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 428 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 429 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 430 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 431 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 432 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 433 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 434 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 435 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 436 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 437 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 438 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 472 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 473 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 474 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 475 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 476 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 477 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 478 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 479 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 480 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 481 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 482 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 483 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 484 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 485 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 486 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 487 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 490 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 496 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 497 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 499 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 500 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 501 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 503 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 504 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 505 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 506 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 507 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 508 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 509 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 510 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 511 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 512 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 513 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 514 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 515 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 516 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 518 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 519 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 520 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 521 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 522 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 523 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 524 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 525 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 526 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 527 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 528 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 529 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 530 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 531 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 532 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 533 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 534 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 535 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 536 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 537 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 538 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 539 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 540 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 541 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 542 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 543 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 544 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 545 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 546 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 547 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 548 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 549 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 550 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 551 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 552 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 553 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 554 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 555 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 556 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 557 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 558 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 559 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 560 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 561 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 562 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 563 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 564 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 565 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 566 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 567 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 568 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 569 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 570 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 571 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 572 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 57.74 |
| Metatranscriptomes | 0 |
| Isolates | 42.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.57 |
| Nodule | 32.8 |
| Rhizoplane | 0.98 |
| Rhizosphere | 23.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10012667 | 3300001979 | Bacteria | 3172 |
| 2 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 3 | JGI25156J39149_1000066 | 3300002705 | Bacteria | 82816 |
| 4 | JGI25156J39149_1005532 | 3300002705 | Bacteria | 3624 |
| 5 | JGI25162J39368_1000521 | 3300002737 | Bacteria | 28709 |
| 6 | JGI25162J39368_1000875 | 3300002737 | Bacteria | 19716 |
| 7 | JGI25154J39366_1000169 | 3300002738 | Bacteria | 50665 |
| 8 | JGI25158J39367_1000180 | 3300002739 | Bacteria | 14916 |
| 9 | JGI25157J39369_1000197 | 3300002741 | Bacteria | 51019 |
| 10 | JGI25157J39369_1000434 | 3300002741 | Bacteria | 27188 |
| 11 | JGI25157J39369_1001050 | 3300002741 | Bacteria | 12594 |
| 12 | JGI25164J39214_1000288 | 3300002772 | Bacteria | 35469 |
| 13 | JGI25152J39213_1000126 | 3300002773 | Bacteria | 52109 |
| 14 | JGI25152J39213_1001981 | 3300002773 | Bacteria | 8104 |
| 15 | JGI25152J39213_1005036 | 3300002773 | Bacteria | 3984 |
| 16 | JGI25150J39212_1000180 | 3300002774 | Bacteria | 35477 |
| 17 | JGI25159J45721_1001406 | 3300002987 | Bacteria | 9996 |
| 18 | JGI25151J46595_10000031 | 3300003187 | Bacteria | 197865 |
| 19 | JGI25151J46595_10000177 | 3300003187 | Bacteria | 81432 |
| 20 | JGI25151J46595_10000247 | 3300003187 | Bacteria | 63163 |
| 21 | JGI25151J46595_10000596 | 3300003187 | Bacteria | 32080 |
| 22 | JGI25151J46595_10001523 | 3300003187 | Bacteria | 15502 |
| 23 | JGI25151J46595_10002206 | 3300003187 | Bacteria | 12026 |
| 24 | JGI25151J46595_10002304 | 3300003187 | Bacteria | 11660 |
| 25 | JGI25151J46595_10016424 | 3300003187 | Bacteria | 3237 |
| 26 | JGI25165J46597_1000016 | 3300003214 | Bacteria | 377866 |
| 27 | JGI25165J46597_1000402 | 3300003214 | Bacteria | 45705 |
| 28 | JGI25165J46597_1000532 | 3300003214 | Bacteria | 35455 |
| 29 | JGI25165J46597_1000734 | 3300003214 | Bacteria | 25667 |
| 30 | JGI25165J46597_1008042 | 3300003214 | Bacteria | 1689 |
| 31 | JGI25153J46596_10000130 | 3300003215 | Bacteria | 81432 |
| 32 | JGI25153J46596_10002106 | 3300003215 | Bacteria | 11657 |
| 33 | JGI25153J46596_10003024 | 3300003215 | Bacteria | 9511 |
| 34 | JGI25153J46596_10008684 | 3300003215 | Bacteria | 4826 |
| 35 | JGI25153J46596_10024468 | 3300003215 | Bacteria | 2177 |
| 36 | rootH2_10039535 | 3300003320 | Bacteria | 4083 |
| 37 | rootH2_10044954 | 3300003320 | Bacteria | 11828 |
| 38 | rootL2_10096740 | 3300003322 | Bacteria | 3371 |
| 39 | rootL2_10226176 | 3300003322 | Bacteria | 2262 |
| 40 | rootH1_10078253 | 3300003323 | Bacteria | 2975 |
| 41 | rootH1_10110352 | 3300003323 | Bacteria | 1475 |
| 42 | JGI25160J50197_1000114 | 3300003354 | Bacteria | 75947 |
| 43 | JGI25160J50197_1000481 | 3300003354 | Bacteria | 24245 |
| 44 | JGI25160J50197_1008267 | 3300003354 | Bacteria | 3978 |
| 45 | JGI25161J50226_1000089 | 3300003374 | Bacteria | 73775 |
| 46 | JGI25161J50226_1000114 | 3300003374 | Bacteria | 62957 |
| 47 | JGI25161J50226_1003256 | 3300003374 | Bacteria | 3791 |
| 48 | Ga0055538_1001162 | 3300003751 | Bacteria | 5585 |
| 49 | Ga0055535_1000429 | 3300003761 | Bacteria | 39272 |
| 50 | Ga0055542_1000648 | 3300003762 | Bacteria | 28709 |
| 51 | Ga0055529_1000467 | 3300003763 | Bacteria | 39162 |
| 52 | Ga0055526_1001606 | 3300003771 | Bacteria | 15869 |
| 53 | Ga0055526_1001815 | 3300003771 | Bacteria | 14781 |
| 54 | Ga0055526_1002324 | 3300003771 | Bacteria | 12952 |
| 55 | Ga0055526_1002600 | 3300003771 | Bacteria | 12067 |
| 56 | Ga0055526_1014316 | 3300003771 | Bacteria | 3272 |
| 57 | Ga0055524_1002110 | 3300003775 | Bacteria | 10510 |
| 58 | Ga0055524_1011549 | 3300003775 | Bacteria | 3450 |
| 59 | Ga0055524_1014713 | 3300003775 | Bacteria | 2885 |
| 60 | Ga0055524_1018277 | 3300003775 | Bacteria | 2441 |
| 61 | Ga0055536_1000033 | 3300003781 | Bacteria | 148346 |
| 62 | Ga0055534_1002018 | 3300003784 | Bacteria | 7377 |
| 63 | Ga0055528_1000485 | 3300003790 | Bacteria | 31501 |
| 64 | Ga0055528_1001469 | 3300003790 | Bacteria | 14317 |
| 65 | Ga0055528_1001954 | 3300003790 | Bacteria | 11656 |
| 66 | Ga0055528_1009892 | 3300003790 | Bacteria | 3937 |
| 67 | Ga0055528_1017797 | 3300003790 | Bacteria | 2444 |
| 68 | Ga0055540_1001114 | 3300003792 | Bacteria | 16933 |
| 69 | Ga0055540_1001218 | 3300003792 | Bacteria | 15814 |
| 70 | Ga0055540_1015978 | 3300003792 | Bacteria | 2157 |
| 71 | Ga0055543_1000002 | 3300004625 | Bacteria | 390020 |
| 72 | Ga0055543_1000077 | 3300004625 | Bacteria | 86457 |
| 73 | Ga0055543_1000711 | 3300004625 | Bacteria | 16856 |
| 74 | Ga0065165_1001020 | 3300005262 | Bacteria | 34014 |
| 75 | Ga0065165_1004729 | 3300005262 | Bacteria | 8171 |
| 76 | Ga0065165_1010241 | 3300005262 | Bacteria | 4083 |
| 77 | Ga0070670_100002407 | 3300005331 | Bacteria | 15428 |
| 78 | Ga0070670_100160644 | 3300005331 | Bacteria | 1947 |
| 79 | Ga0070668_100045007 | 3300005347 | Bacteria | 3386 |
| 80 | Ga0070669_100188653 | 3300005353 | Bacteria | 1616 |
| 81 | Ga0070671_100042321 | 3300005355 | Bacteria | 3786 |
| 82 | Ga0070659_100003983 | 3300005366 | Bacteria | 10513 |
| 83 | Ga0070681_10021500 | 3300005458 | Bacteria | 6467 |
| 84 | Ga0070679_100148422 | 3300005530 | Bacteria | 2322 |
| 85 | Ga0068853_100036598 | 3300005539 | Bacteria | 4175 |
| 86 | Ga0068853_100081475 | 3300005539 | Bacteria | 2834 |
| 87 | Ga0068853_100305665 | 3300005539 | Bacteria | 1471 |
| 88 | Ga0070665_100012115 | 3300005548 | Bacteria | 8701 |
| 89 | Ga0070665_100013795 | 3300005548 | Bacteria | 8129 |
| 90 | Ga0070665_100159477 | 3300005548 | Bacteria | 2257 |
| 91 | Ga0070665_100259226 | 3300005548 | Bacteria | 1740 |
| 92 | Ga0068855_100179404 | 3300005563 | Bacteria | 2395 |
| 93 | Ga0068857_100020664 | 3300005577 | Bacteria | 5794 |
| 94 | Ga0068856_100009870 | 3300005614 | Bacteria | 9271 |
| 95 | Ga0081455_10205297 | 3300005937 | Bacteria | 1472 |
| 96 | Ga0075365_10009275 | 3300006038 | Bacteria | 5646 |
| 97 | Ga0075363_100007136 | 3300006048 | Bacteria | 5115 |
| 98 | Ga0075362_10000128 | 3300006177 | Bacteria | 20952 |
| 99 | Ga0075362_10000940 | 3300006177 | Bacteria | 8893 |
| 100 | Ga0075367_10004695 | 3300006178 | Bacteria | 6709 |
| 101 | Ga0075367_10006455 | 3300006178 | Bacteria | 5928 |
| 102 | Ga0075369_10012111 | 3300006186 | Bacteria | 3403 |
| 103 | Ga0075369_10014442 | 3300006186 | Bacteria | 3154 |
| 104 | Ga0075369_10040480 | 3300006186 | Bacteria | 1992 |
| 105 | Ga0075366_10001129 | 3300006195 | Bacteria | 13161 |
| 106 | Ga0075366_10047197 | 3300006195 | Bacteria | 2553 |
| 107 | Ga0075370_10023223 | 3300006353 | Bacteria | 3414 |
| 108 | Ga0105251_10012908 | 3300009011 | Bacteria | 4699 |
| 109 | Ga0105244_10093755 | 3300009036 | Bacteria | 1475 |
| 110 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 111 | Ga0105243_10052786 | 3300009148 | Bacteria | 3222 |
| 112 | Ga0105248_10038064 | 3300009177 | Bacteria | 5382 |
| 113 | Ga0105237_10014402 | 3300009545 | Bacteria | 8270 |
| 114 | Ga0105237_10049273 | 3300009545 | Bacteria | 4234 |
| 115 | Ga0105238_10002917 | 3300009551 | Bacteria | 17078 |
| 116 | Ga0123341_1000014 | 3300009765 | Bacteria | 91980 |
| 117 | Ga0123342_1012802 | 3300009766 | Bacteria | 8616 |
| 118 | Ga0123342_1025475 | 3300009766 | Bacteria | 3560 |
| 119 | Ga0105239_10007580 | 3300010375 | Bacteria | 12438 |
| 120 | Ga0105239_10134284 | 3300010375 | Bacteria | 2754 |
| 121 | Ga0105239_10817169 | 3300010375 | Bacteria | 1068 |
| 122 | Ga0157373_10041504 | 3300013100 | Bacteria | 3292 |
| 123 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 124 | Ga0157370_10001455 | 3300013104 | Bacteria | 29311 |
| 125 | Ga0157370_10008723 | 3300013104 | Bacteria | 10907 |
| 126 | Ga0157369_10173794 | 3300013105 | Bacteria | 2269 |
| 127 | Ga0182007_10003955 | 3300015262 | Bacteria | 6843 |
| 128 | Ga0213872_10001721 | 3300021361 | Bacteria | 13758 |
| 129 | Ga0213875_10123496 | 3300021388 | Bacteria | 1210 |
| 130 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 131 | Ga0209760_100646 | 3300025207 | Bacteria | 5767 |
| 132 | Ga0209436_100050 | 3300025208 | Bacteria | 65942 |
| 133 | Ga0209784_100216 | 3300025224 | Bacteria | 39416 |
| 134 | Ga0209672_103804 | 3300025228 | Bacteria | 2993 |
| 135 | Ga0207427_100267 | 3300025231 | Bacteria | 39803 |
| 136 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 137 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 138 | Ga0209437_100078 | 3300025233 | Bacteria | 278088 |
| 139 | Ga0209258_100034 | 3300025242 | Bacteria | 437372 |
| 140 | Ga0209258_100620 | 3300025242 | Bacteria | 28259 |
| 141 | Ga0207425_1000058 | 3300025245 | Bacteria | 149214 |
| 142 | Ga0207425_1002746 | 3300025245 | Bacteria | 5985 |
| 143 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 144 | Ga0209646_1000436 | 3300025246 | Bacteria | 22879 |
| 145 | Ga0209646_1005372 | 3300025246 | Bacteria | 2242 |
| 146 | Ga0209026_1000005 | 3300025250 | Bacteria | 731387 |
| 147 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 148 | Ga0209026_1000255 | 3300025250 | Bacteria | 66879 |
| 149 | Ga0209677_102053 | 3300025253 | Bacteria | 7964 |
| 150 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 151 | Ga0209148_1020332 | 3300025254 | Bacteria | 1092 |
| 152 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 153 | Ga0209759_1000292 | 3300025256 | Bacteria | 69246 |
| 154 | Ga0209759_1000678 | 3300025256 | Bacteria | 31063 |
| 155 | Ga0209129_1000080 | 3300025258 | Bacteria | 186416 |
| 156 | Ga0209129_1000107 | 3300025258 | Bacteria | 154705 |
| 157 | Ga0209129_1001456 | 3300025258 | Bacteria | 13200 |
| 158 | Ga0209129_1001687 | 3300025258 | Bacteria | 11953 |
| 159 | Ga0209129_1007430 | 3300025258 | Bacteria | 3268 |
| 160 | Ga0209129_1013081 | 3300025258 | Bacteria | 1851 |
| 161 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 162 | Ga0209233_1000068 | 3300025261 | Bacteria | 377969 |
| 163 | Ga0209233_1000157 | 3300025261 | Bacteria | 164269 |
| 164 | Ga0209233_1000192 | 3300025261 | Bacteria | 127171 |
| 165 | Ga0209233_1000194 | 3300025261 | Bacteria | 126185 |
| 166 | Ga0209455_1000054 | 3300025272 | Bacteria | 358936 |
| 167 | Ga0209673_1000037 | 3300025273 | Bacteria | 313804 |
| 168 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 169 | Ga0209673_1000312 | 3300025273 | Bacteria | 89594 |
| 170 | Ga0209673_1000439 | 3300025273 | Bacteria | 71645 |
| 171 | Ga0209673_1002998 | 3300025273 | Bacteria | 10499 |
| 172 | Ga0209673_1003095 | 3300025273 | Bacteria | 10198 |
| 173 | Ga0209673_1003647 | 3300025273 | Bacteria | 8902 |
| 174 | Ga0209673_1008335 | 3300025273 | Bacteria | 4622 |
| 175 | Ga0209673_1008603 | 3300025273 | Bacteria | 4526 |
| 176 | Ga0209673_1014712 | 3300025273 | Bacteria | 3017 |
| 177 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 178 | Ga0209130_1000083 | 3300025284 | Bacteria | 162582 |
| 179 | Ga0209130_1000304 | 3300025284 | Bacteria | 59784 |
| 180 | Ga0209675_1000108 | 3300025291 | Bacteria | 118134 |
| 181 | Ga0209675_1030442 | 3300025291 | Bacteria | 1287 |
| 182 | Ga0209676_1000144 | 3300025292 | Bacteria | 175244 |
| 183 | Ga0209025_1000046 | 3300025294 | Bacteria | 348962 |
| 184 | Ga0209025_1000083 | 3300025294 | Bacteria | 265556 |
| 185 | Ga0209025_1000263 | 3300025294 | Bacteria | 123578 |
| 186 | Ga0209025_1000389 | 3300025294 | Bacteria | 90997 |
| 187 | Ga0209025_1004349 | 3300025294 | Bacteria | 12365 |
| 188 | Ga0209025_1013719 | 3300025294 | Bacteria | 5063 |
| 189 | Ga0209025_1019307 | 3300025294 | Bacteria | 3795 |
| 190 | Ga0209025_1021393 | 3300025294 | Bacteria | 3486 |
| 191 | Ga0209025_1032871 | 3300025294 | Bacteria | 2414 |
| 192 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 193 | Ga0209564_1000125 | 3300025295 | Bacteria | 201709 |
| 194 | Ga0209564_1000185 | 3300025295 | Bacteria | 149925 |
| 195 | Ga0209564_1000242 | 3300025295 | Bacteria | 118134 |
| 196 | Ga0209564_1000364 | 3300025295 | Bacteria | 84138 |
| 197 | Ga0209564_1007338 | 3300025295 | Bacteria | 5714 |
| 198 | Ga0209564_1008211 | 3300025295 | Bacteria | 5209 |
| 199 | Ga0209564_1013994 | 3300025295 | Bacteria | 3366 |
| 200 | Ga0209758_1000090 | 3300025297 | Bacteria | 246564 |
| 201 | Ga0209758_1000621 | 3300025297 | Bacteria | 54479 |
| 202 | Ga0209758_1001342 | 3300025297 | Bacteria | 29705 |
| 203 | Ga0209758_1001459 | 3300025297 | Bacteria | 27768 |
| 204 | Ga0209758_1007764 | 3300025297 | Bacteria | 7184 |
| 205 | Ga0209758_1010245 | 3300025297 | Bacteria | 5648 |
| 206 | Ga0209758_1012315 | 3300025297 | Bacteria | 4801 |
| 207 | Ga0209758_1021472 | 3300025297 | Bacteria | 3008 |
| 208 | Ga0209050_1021064 | 3300025298 | Bacteria | 2396 |
| 209 | Ga0209256_1001292 | 3300025299 | Bacteria | 27015 |
| 210 | Ga0209256_1001802 | 3300025299 | Bacteria | 20182 |
| 211 | Ga0209256_1001889 | 3300025299 | Bacteria | 19249 |
| 212 | Ga0209256_1002320 | 3300025299 | Bacteria | 15934 |
| 213 | Ga0209256_1004718 | 3300025299 | Bacteria | 8348 |
| 214 | Ga0209256_1010950 | 3300025299 | Bacteria | 3711 |
| 215 | Ga0209256_1018180 | 3300025299 | Bacteria | 2299 |
| 216 | Ga0209256_1023081 | 3300025299 | Bacteria | 1864 |
| 217 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 218 | Ga0207426_1000141 | 3300025302 | Bacteria | 194453 |
| 219 | Ga0207426_1000173 | 3300025302 | Bacteria | 162697 |
| 220 | Ga0207426_1001122 | 3300025302 | Bacteria | 24415 |
| 221 | Ga0207426_1009672 | 3300025302 | Bacteria | 3794 |
| 222 | Ga0209051_1000874 | 3300025303 | Bacteria | 30458 |
| 223 | Ga0209051_1001764 | 3300025303 | Bacteria | 17175 |
| 224 | Ga0209051_1002243 | 3300025303 | Bacteria | 14208 |
| 225 | Ga0209051_1010820 | 3300025303 | Bacteria | 4565 |
| 226 | Ga0209257_1004872 | 3300025304 | Bacteria | 9914 |
| 227 | Ga0209257_1016732 | 3300025304 | Bacteria | 2944 |
| 228 | Ga0207647_10039433 | 3300025904 | Bacteria | 2980 |
| 229 | Ga0207707_10288164 | 3300025912 | Bacteria | 1421 |
| 230 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 231 | Ga0207671_10000461 | 3300025914 | Bacteria | 55726 |
| 232 | Ga0207671_10000591 | 3300025914 | Bacteria | 48440 |
| 233 | Ga0207652_10117883 | 3300025921 | Bacteria | 2359 |
| 234 | Ga0207681_10113035 | 3300025923 | Bacteria | 1979 |
| 235 | Ga0207694_10005520 | 3300025924 | Bacteria | 9700 |
| 236 | Ga0207650_10001272 | 3300025925 | Bacteria | 18294 |
| 237 | Ga0207690_10006097 | 3300025932 | Bacteria | 7143 |
| 238 | Ga0207667_10154770 | 3300025949 | Bacteria | 2359 |
| 239 | Ga0207639_10062020 | 3300026041 | Bacteria | 2890 |
| 240 | Ga0207639_10105118 | 3300026041 | Bacteria | 2290 |
| 241 | Ga0207678_10028827 | 3300026067 | Bacteria | 4847 |
| 242 | Ga0207702_10033500 | 3300026078 | Bacteria | 4291 |
| 243 | Ga0207674_10153672 | 3300026116 | Bacteria | 2257 |
| 244 | Ga0207683_10498084 | 3300026121 | Bacteria | 1125 |
| 245 | Ga0209371_1005394 | 3300027312 | Bacteria | 5099 |
| 246 | Ga0268266_10000086 | 3300028379 | Bacteria | 199443 |
| 247 | Ga0268266_10014308 | 3300028379 | Bacteria | 6824 |
| 248 | Ga0268266_10024552 | 3300028379 | Bacteria | 5127 |
| 249 | Ga0268266_10201003 | 3300028379 | Bacteria | 1824 |
| 250 | Ga0307515_10013332 | 3300028794 | Bacteria | 15375 |
| 251 | Ga0307515_10027093 | 3300028794 | Bacteria | 9817 |
| 252 | Ga0268256_1019197 | 3300030500 | Bacteria | 1877 |
| 253 | Ga0307513_10066026 | 3300031456 | Bacteria | 3804 |
| 254 | Ga0307513_10235046 | 3300031456 | Bacteria | 1643 |
| 255 | Ga0307516_10331684 | 3300031730 | Bacteria | 1190 |
| 256 | Ga0307412_10067639 | 3300031911 | Bacteria | 2426 |
| 257 | Ga0395899_0014453 | 3300037312 | Bacteria | 6025 |
| 258 | Ga0395899_0172777 | 3300037312 | Bacteria | 1521 |
| 259 | Ga0395900_0216217 | 3300037418 | Bacteria | 1934 |
| 260 | Ga0395905_0003809 | 3300037471 | Bacteria | 15946 |
| 261 | Ga0436364_1290971 | 3300037853 | Bacteria | 1475 |
| 262 | Ga0395901_0134754 | 3300038443 | Bacteria | 2596 |
| 263 | Ga0436361_0001950 | 3300039447 | Bacteria | 15059 |
| 264 | Ga0436361_0575458 | 3300039447 | Bacteria | 3162 |
| 265 | Ga0436361_1068300 | 3300039447 | Bacteria | 8393 |
| 266 | Ga0436363_0747323 | 3300039450 | Bacteria | 2900 |
| 267 | Ga0436363_1503130 | 3300039450 | Bacteria | 1244 |
| 268 | Ga0439461_0035490 | 3300041410 | Bacteria | 1058 |
| 269 | Ga0439465_0001676 | 3300041413 | Bacteria | 7224 |
| 270 | Ga0451839_0744782 | 3300041496 | Bacteria | 4139 |
| 271 | Ga0451845_0430371 | 3300041501 | Bacteria | 2597 |
| 272 | Ga0451845_0700627 | 3300041501 | Bacteria | 4876 |
| 273 | Ga0451851_0474418 | 3300041507 | Bacteria | 3068 |
| 274 | Ga0451853_2207469 | 3300041512 | Bacteria | 2872 |
| 275 | Ga0439449_0017672 | 3300042007 | Bacteria | 2678 |
| 276 | Ga0450907_014728 | 3300042146 | Bacteria | 1306 |
| 277 | Ga0466972_0013621 | 3300044658 | Bacteria | 4081 |
| 278 | Ga0466972_0080689 | 3300044658 | Bacteria | 1549 |
| 279 | Ga0466965_0007376 | 3300044683 | Bacteria | 5047 |
| 280 | Ga0466964_0007153 | 3300044706 | Bacteria | 4174 |
| 281 | Ga0466968_0017068 | 3300044735 | Bacteria | 2896 |
| 282 | Ga0466968_0168838 | 3300044735 | Bacteria | 1013 |
| 283 | Ga0466970_0004245 | 3300044765 | Bacteria | 7052 |
| 284 | Ga0466957_0032121 | 3300044842 | Bacteria | 3142 |
| 285 | Ga0466959_0054439 | 3300045049 | Bacteria | 2923 |
| 286 | Ga0466959_0062249 | 3300045049 | Bacteria | 2712 |
| 287 | Ga0466959_0065897 | 3300045049 | Bacteria | 2628 |
| 288 | Ga0466967_0416201 | 3300045976 | Bacteria | 1309 |
| 289 | Ga0495629_0092130 | 3300046459 | Bacteria | 2115 |
| 290 | Ga0495638_0139536 | 3300046460 | Bacteria | 1416 |
| 291 | Ga0495605_0103654 | 3300046474 | Bacteria | 1305 |
| 292 | Ga0495585_0004599 | 3300046492 | Bacteria | 8919 |
| 293 | Ga0495585_0016700 | 3300046492 | Bacteria | 4253 |
| 294 | Ga0495583_0071333 | 3300046506 | Bacteria | 1526 |
| 295 | Ga0495606_0001207 | 3300046507 | Bacteria | 36311 |
| 296 | Ga0495606_0004192 | 3300046507 | Bacteria | 14599 |
| 297 | Ga0495606_0119161 | 3300046507 | Bacteria | 1582 |
| 298 | Ga0495610_0002928 | 3300046512 | Bacteria | 13799 |
| 299 | Ga0495610_0019884 | 3300046512 | Bacteria | 3743 |
| 300 | Ga0495610_0024712 | 3300046512 | Bacteria | 3237 |
| 301 | Ga0495616_0017890 | 3300046513 | Bacteria | 3905 |
| 302 | Ga0495616_0047965 | 3300046513 | Bacteria | 2148 |
| 303 | Ga0495620_0043193 | 3300046515 | Bacteria | 1965 |
| 304 | Ga0495631_0000815 | 3300046518 | Bacteria | 19942 |
| 305 | Ga0495632_0025506 | 3300046519 | Bacteria | 3125 |
| 306 | Ga0495643_0009269 | 3300046522 | Bacteria | 6132 |
| 307 | Ga0495643_0011453 | 3300046522 | Bacteria | 5401 |
| 308 | Ga0495643_0125268 | 3300046522 | Bacteria | 1294 |
| 309 | Ga0495644_0078941 | 3300046523 | Bacteria | 1240 |
| 310 | Ga0495654_0159965 | 3300046530 | Bacteria | 989 |
| 311 | Ga0495597_0119689 | 3300046542 | Bacteria | 1098 |
| 312 | Ga0495622_0035953 | 3300046557 | Bacteria | 2310 |
| 313 | Ga0495622_0070780 | 3300046557 | Bacteria | 1610 |
| 314 | Ga0495633_0019846 | 3300046558 | Bacteria | 3392 |
| 315 | Ga0495656_0078455 | 3300046615 | Bacteria | 1484 |
| 316 | Ga0495668_0005275 | 3300046616 | Bacteria | 8840 |
| 317 | Ga0495668_0233572 | 3300046616 | Bacteria | 1007 |
| 318 | Ga0495625_0005983 | 3300046660 | Bacteria | 10932 |
| 319 | Ga0495625_0057398 | 3300046660 | Bacteria | 2768 |
| 320 | Ga0495625_0080571 | 3300046660 | Bacteria | 2267 |
| 321 | Ga0495588_0125700 | 3300046674 | Bacteria | 1352 |
| 322 | Ga0495657_0042631 | 3300046675 | Bacteria | 3097 |
| 323 | Ga0495670_0135433 | 3300046691 | Bacteria | 1286 |
| 324 | Ga0495649_0053272 | 3300046694 | Bacteria | 2190 |
| 325 | Ga0495660_0090766 | 3300046810 | Bacteria | 1588 |
| 326 | Ga0495636_0083623 | 3300047318 | Bacteria | 1378 |
| 327 | Ga0495672_0004852 | 3300047320 | Bacteria | 10834 |
| 328 | Ga0495676_0070218 | 3300047321 | Bacteria | 2699 |
| 329 | Ga0495683_0084906 | 3300047323 | Bacteria | 1540 |
| 330 | Ga0495687_016127 | 3300047443 | Bacteria | 3768 |
| 331 | Ga0495687_107547 | 3300047443 | Bacteria | 1033 |
| 332 | Ga0495681_0008178 | 3300047470 | Bacteria | 6584 |
| 333 | Ga0495681_0014765 | 3300047470 | Bacteria | 4458 |
| 334 | Ga0495681_0067053 | 3300047470 | Bacteria | 1636 |
| 335 | Ga0495686_0000685 | 3300047472 | Bacteria | 45846 |
| 336 | Ga0495686_0013797 | 3300047472 | Bacteria | 5598 |
| 337 | Ga0495686_0228521 | 3300047472 | Bacteria | 1055 |
| 338 | Ga0495626_0091177 | 3300048091 | Bacteria | 1340 |
| 339 | Ga0496102_0012405 | 3300048905 | Bacteria | 7374 |
| 340 | Ga0496103_0020699 | 3300048906 | Bacteria | 3954 |
| 341 | Ga0496106_0000106 | 3300048909 | Bacteria | 64785 |
| 342 | Ga0496106_0078865 | 3300048909 | Bacteria | 2528 |
| 343 | Ga0496107_0205830 | 3300048910 | Bacteria | 1462 |
| 344 | Ga0496110_0021717 | 3300048913 | Bacteria | 5439 |
| 345 | Ga0496116_0001128 | 3300048919 | Bacteria | 31826 |
| 346 | Ga0496116_0006341 | 3300048919 | Bacteria | 10758 |
| 347 | Ga0496116_0014942 | 3300048919 | Bacteria | 6162 |
| 348 | Ga0496116_0022292 | 3300048919 | Bacteria | 4749 |
| 349 | Ga0496116_0036053 | 3300048919 | Bacteria | 3467 |
| 350 | Ga0496116_0073111 | 3300048919 | Bacteria | 2163 |
| 351 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 352 | Ga0496117_0001714 | 3300048920 | Bacteria | 30347 |
| 353 | Ga0496117_0009481 | 3300048920 | Bacteria | 9050 |
| 354 | Ga0496117_0042063 | 3300048920 | Bacteria | 3339 |
| 355 | Ga0496118_0000432 | 3300048921 | Bacteria | 69605 |
| 356 | Ga0496118_0000991 | 3300048921 | Bacteria | 44233 |
| 357 | Ga0496118_0011482 | 3300048921 | Bacteria | 8637 |
| 358 | Ga0496118_0016317 | 3300048921 | Bacteria | 6819 |
| 359 | Ga0496118_0059136 | 3300048921 | Bacteria | 2857 |
| 360 | Ga0496118_0091904 | 3300048921 | Bacteria | 2085 |
| 361 | Ga0496118_0187605 | 3300048921 | Bacteria | 1241 |
| 362 | Ga0496119_0012399 | 3300048922 | Bacteria | 6927 |
| 363 | Ga0496119_0019736 | 3300048922 | Bacteria | 4946 |
| 364 | Ga0496119_0024824 | 3300048922 | Bacteria | 4204 |
| 365 | Ga0496119_0031096 | 3300048922 | Bacteria | 3587 |
| 366 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 367 | Ga0496120_0002959 | 3300048923 | Bacteria | 16173 |
| 368 | Ga0496120_0006425 | 3300048923 | Bacteria | 9032 |
| 369 | Ga0496120_0043832 | 3300048923 | Bacteria | 2604 |
| 370 | Ga0496121_0003374 | 3300048924 | Bacteria | 22891 |
| 371 | Ga0496121_0010544 | 3300048924 | Bacteria | 10398 |
| 372 | Ga0496121_0014862 | 3300048924 | Bacteria | 8212 |
| 373 | Ga0496121_0028161 | 3300048924 | Bacteria | 5237 |
| 374 | Ga0496121_0033035 | 3300048924 | Bacteria | 4691 |
| 375 | Ga0496121_0034768 | 3300048924 | Bacteria | 4530 |
| 376 | Ga0496121_0036220 | 3300048924 | Bacteria | 4400 |
| 377 | Ga0496121_0079147 | 3300048924 | Bacteria | 2610 |
| 378 | Ga0496121_0107573 | 3300048924 | Bacteria | 2135 |
| 379 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 380 | Ga0496122_0007183 | 3300048925 | Bacteria | 12471 |
| 381 | Ga0496122_0014363 | 3300048925 | Bacteria | 7663 |
| 382 | Ga0496122_0018058 | 3300048925 | Bacteria | 6539 |
| 383 | Ga0496122_0018232 | 3300048925 | Bacteria | 6499 |
| 384 | Ga0496122_0029057 | 3300048925 | Bacteria | 4674 |
| 385 | Ga0496122_0075034 | 3300048925 | Bacteria | 2388 |
| 386 | Ga0496122_0101310 | 3300048925 | Bacteria | 1924 |
| 387 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 388 | Ga0496123_0005151 | 3300048926 | Bacteria | 13309 |
| 389 | Ga0496123_0010370 | 3300048926 | Bacteria | 8248 |
| 390 | Ga0496123_0022351 | 3300048926 | Bacteria | 4877 |
| 391 | Ga0496123_0030152 | 3300048926 | Bacteria | 3975 |
| 392 | Ga0496123_0125665 | 3300048926 | Bacteria | 1432 |
| 393 | Ga0496123_0143306 | 3300048926 | Bacteria | 1302 |
| 394 | Ga0496124_0002819 | 3300048927 | Bacteria | 22009 |
| 395 | Ga0496124_0003535 | 3300048927 | Bacteria | 19011 |
| 396 | Ga0496124_0015621 | 3300048927 | Bacteria | 7267 |
| 397 | Ga0496124_0056962 | 3300048927 | Bacteria | 3294 |
| 398 | Ga0496124_0084150 | 3300048927 | Bacteria | 2609 |
| 399 | Ga0496124_0111043 | 3300048927 | Bacteria | 2206 |
| 400 | Ga0496125_0009740 | 3300048928 | Bacteria | 9807 |
| 401 | Ga0496125_0013718 | 3300048928 | Bacteria | 7948 |
| 402 | Ga0496125_0015447 | 3300048928 | Bacteria | 7383 |
| 403 | Ga0496125_0023218 | 3300048928 | Bacteria | 5731 |
| 404 | Ga0496125_0041418 | 3300048928 | Bacteria | 3937 |
| 405 | Ga0496125_0155438 | 3300048928 | Bacteria | 1563 |
| 406 | Ga0496125_0179161 | 3300048928 | Bacteria | 1414 |
| 407 | Ga0496126_0041314 | 3300048929 | Bacteria | 4269 |
| 408 | Ga0496126_0051373 | 3300048929 | Bacteria | 3753 |
| 409 | Ga0496126_0202070 | 3300048929 | Bacteria | 1677 |
| 410 | Ga0496126_0270789 | 3300048929 | Bacteria | 1409 |
| 411 | Ga0496126_0306556 | 3300048929 | Bacteria | 1308 |
| 412 | Ga0496126_0329387 | 3300048929 | Bacteria | 1253 |
| 413 | Ga0495678_006144 | 3300049459 | Bacteria | 6446 |
| 414 | Ga0501032_0044104 | 3300049569 | Bacteria | 3019 |
| 415 | Ga0501034_0430599 | 3300049571 | Bacteria | 1239 |
| 416 | Ga0501036_0078192 | 3300049572 | Bacteria | 2798 |
| 417 | Ga0501037_0048757 | 3300049573 | Bacteria | 3102 |
| 418 | Ga0501038_0362206 | 3300049574 | Bacteria | 1127 |
| 419 | Ga0501039_0301727 | 3300049575 | Bacteria | 1259 |
| 420 | Ga0501043_0123591 | 3300049579 | Bacteria | 2029 |
| 421 | Ga0501046_0037729 | 3300049580 | Bacteria | 3882 |
| 422 | Ga0501046_0127832 | 3300049580 | Bacteria | 1929 |
| 423 | Ga0501047_0079547 | 3300049581 | Bacteria | 3151 |
| 424 | Ga0501068_0189544 | 3300049584 | Bacteria | 1302 |
| 425 | Ga0501073_0256484 | 3300049589 | Bacteria | 1207 |
| 426 | Ga0501280_006411 | 3300049776 | Bacteria | 1658 |
| 427 | Ga0501035_0010471 | 3300049822 | Bacteria | 8593 |
| 428 | Ga0501035_0026921 | 3300049822 | Bacteria | 5257 |
| 429 | Ga0501044_0034629 | 3300049823 | Bacteria | 5294 |
| 430 | Ga0501044_0050776 | 3300049823 | Bacteria | 4278 |
| 431 | Ga0501044_0528375 | 3300049823 | Bacteria | 1079 |
| 432 | nmdc:mga03683_132_c1 | 3300050489 | Bacteria | 24967 |
| 433 | nmdc:mga03683_71120_c1 | 3300050489 | Bacteria | 1488 |
| 434 | nmdc:mga03n38_2283_c1 | 3300050490 | Bacteria | 5872 |
| 435 | nmdc:mga00v17_11_c1 | 3300050491 | Bacteria | 135478 |
| 436 | nmdc:mga0yw44_171786_c1 | 3300050492 | Bacteria | 1424 |
| 437 | nmdc:mga0yw44_6595_c1 | 3300050492 | Bacteria | 5623 |
| 438 | nmdc:mga0yw44_96_c1 | 3300050492 | Bacteria | 30976 |
| 439 | nmdc:mga0yw44_97381_c1 | 3300050492 | Bacteria | 1869 |
| 440 | nmdc:mga0k408_101017_c1 | 3300050493 | Bacteria | 1700 |
| 441 | nmdc:mga0k408_25102_c1 | 3300050493 | Bacteria | 3373 |
| 442 | nmdc:mga0k408_6874_c1 | 3300050493 | Bacteria | 2641 |
| 443 | nmdc:mga06z11_4851_c1 | 3300050494 | Bacteria | 5327 |
| 444 | nmdc:mga07m45_144675_c1 | 3300050496 | Bacteria | 1378 |
| 445 | nmdc:mga07m45_46502_c1 | 3300050496 | Bacteria | 2439 |
| 446 | nmdc:mga07m45_7876_c1 | 3300050496 | Bacteria | 5454 |
| 447 | nmdc:mga0sz30_19380_c1 | 3300050516 | Bacteria | 2735 |
| 448 | nmdc:mga0sz30_41479_c1 | 3300050516 | Bacteria | 1935 |
| 449 | Ga0500610_0002770 | 3300053079 | Bacteria | 6559 |
| 450 | Ga0500610_0061674 | 3300053079 | Bacteria | 1957 |
| 451 | Ga0500578_0040535 | 3300053086 | Bacteria | 2992 |
| 452 | Ga0500560_000510 | 3300053107 | Bacteria | 5461 |
| 453 | Ga0500562_025884 | 3300053108 | Bacteria | 1537 |
| 454 | Ga0500569_001114 | 3300053109 | Bacteria | 4934 |
| 455 | Ga0500607_060903 | 3300053121 | Bacteria | 1978 |
| 456 | Ga0500658_0000067 | 3300053134 | Bacteria | 48662 |
| 457 | Ga0500658_0066098 | 3300053134 | Bacteria | 1516 |
| 458 | Ga0500561_0000033 | 3300053137 | Bacteria | 28489 |
| 459 | Ga0500568_0000185 | 3300053139 | Bacteria | 54765 |
| 460 | Ga0500568_0002618 | 3300053139 | Bacteria | 10468 |
| 461 | Ga0500590_000103 | 3300053148 | Bacteria | 22489 |
| 462 | Ga0500604_0006906 | 3300053151 | Bacteria | 3005 |
| 463 | Ga0500604_0010952 | 3300053151 | Bacteria | 2431 |
| 464 | Ga0500616_0000526 | 3300053153 | Bacteria | 48257 |
| 465 | Ga0500616_0027770 | 3300053153 | Bacteria | 3123 |
| 466 | Ga0500616_0101333 | 3300053153 | Bacteria | 1407 |
| 467 | Ga0500622_0000237 | 3300053156 | Bacteria | 57253 |
| 468 | Ga0500633_0003057 | 3300053160 | Bacteria | 3579 |
| 469 | Ga0500611_005194 | 3300053727 | Bacteria | 1816 |
| 470 | Ga0501082_0072958 | 3300060353 | Bacteria | 2956 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046522 | Ga0495643_0125268 | Ga0495643_0125268_537_1283 | 246 |
| 2 | 3300002773 | JGI25152J39213_1000126 | JGI25152J39213_100012615 | 268 |
| 3 | 3300002774 | JGI25150J39212_1000180 | JGI25150J39212_100018016 | 268 |
| 4 | 3300003187 | JGI25151J46595_10000177 | JGI25151J46595_1000017734 | 268 |
| 5 | 3300003215 | JGI25153J46596_10000130 | JGI25153J46596_1000013031 | 268 |
| 6 | 3300045049 | Ga0466959_0065897 | Ga0466959_0065897_649_1614 | 273 |
| 7 | 3300009766 | Ga0123342_1012802 | Ga0123342_10128022 | 274 |
| 8 | 3300005539 | Ga0068853_100081475 | Ga0068853_1000814752 | 275 |
| 9 | 3300026041 | Ga0207639_10062020 | Ga0207639_100620202 | 275 |
| 10 | 3300044658 | Ga0466972_0013621 | Ga0466972_0013621_3020_3898 | 280 |
| 11 | 3300044683 | Ga0466965_0007376 | Ga0466965_0007376_3070_3948 | 280 |
| 12 | 3300044706 | Ga0466964_0007153 | Ga0466964_0007153_249_1127 | 280 |
| 13 | 3300044735 | Ga0466968_0017068 | Ga0466968_0017068_1894_2772 | 280 |
| 14 | iso_pu_bacteria | 2977858184 | 2977861949 | 280 |
| 15 | 3300046460 | Ga0495638_0139536 | Ga0495638_0139536_544_1389 | 281 |
| 16 | 3300046616 | Ga0495668_0233572 | Ga0495668_0233572_128_985 | 282 |
| 17 | iso_pu_bacteria | 2834641062 | 2834642493 | 282 |
| 18 | iso_pu_bacteria | 8003400568 | 8003404001 | 282 |
| 19 | 3300005331 | Ga0070670_100002407 | Ga0070670_10000240712 | 284 |
| 20 | 3300025925 | Ga0207650_10001272 | Ga0207650_100012723 | 284 |
| 21 | 3300021388 | Ga0213875_10123496 | Ga0213875_101234961 | 285 |
| 22 | 3300037312 | Ga0395899_0014453 | Ga0395899_0014453_4198_5142 | 285 |
| 23 | 3300037853 | Ga0436364_1290971 | Ga0436364_1290971_365_1228 | 285 |
| 24 | 3300049573 | Ga0501037_0048757 | Ga0501037_0048757_1306_2238 | 285 |
| 25 | 3300049575 | Ga0501039_0301727 | Ga0501039_0301727_193_1125 | 285 |
| 26 | 3300049584 | Ga0501068_0189544 | Ga0501068_0189544_274_1179 | 285 |
| 27 | 3300049589 | Ga0501073_0256484 | Ga0501073_0256484_15_947 | 285 |
| 28 | 3300025291 | Ga0209675_1030442 | Ga0209675_10304421 | 286 |
| 29 | 3300042007 | Ga0439449_0017672 | Ga0439449_0017672_29_895 | 286 |
| 30 | 3300047443 | Ga0495687_107547 | Ga0495687_107547_149_1018 | 286 |
| 31 | 3300048910 | Ga0496107_0205830 | Ga0496107_0205830_569_1447 | 286 |
| 32 | 3300046558 | Ga0495633_0019846 | Ga0495633_0019846_33_914 | 289 |
| 33 | 3300048926 | Ga0496123_0143306 | Ga0496123_0143306_56_976 | 289 |
| 34 | iso_pu_bacteria | 2509276033 | 2509447844 | 291 |
| 35 | iso_pu_bacteria | 2529292951 | 2530646888 | 291 |
| 36 | iso_pu_bacteria | 2791355259 | 2793313137 | 291 |
| 37 | iso_pu_bacteria | 2791355263 | 2793344243 | 291 |
| 38 | iso_pu_bacteria | 2884411467 | 2884412741 | 291 |
| 39 | iso_pu_bacteria | 2936381700 | 2936382196 | 291 |
| 40 | iso_pu_bacteria | 2996893221 | 2996896307 | 291 |
| 41 | 3300003320 | rootH2_10044954 | rootH2_100449542 | 292 |
| 42 | 3300003323 | rootH1_10078253 | rootH1_100782534 | 292 |
| 43 | iso_pu_bacteria | 2838042994 | 2838046320 | 292 |
| 44 | iso_pu_bacteria | 2852649853 | 2852650706 | 292 |
| 45 | iso_pu_bacteria | 2909042592 | 2909048198 | 292 |
| 46 | iso_pu_bacteria | 2941475908 | 2941478437 | 292 |
| 47 | 3300013100 | Ga0157373_10041504 | Ga0157373_100415043 | 293 |
| 48 | 3300013102 | Ga0157371_10000002 | Ga0157371_1000000227 | 293 |
| 49 | 3300021361 | Ga0213872_10001721 | Ga0213872_100017216 | 293 |
| 50 | 3300039447 | Ga0436361_0001950 | Ga0436361_0001950_6947_7861 | 293 |
| 51 | 3300048919 | Ga0496116_0014942 | Ga0496116_0014942_2290_3177 | 293 |
| 52 | 3300048920 | Ga0496117_0000052 | Ga0496117_0000052_131263_132150 | 293 |
| 53 | 3300048921 | Ga0496118_0000432 | Ga0496118_0000432_27337_28224 | 293 |
| 54 | 3300048923 | Ga0496120_0000019 | Ga0496120_0000019_131263_132150 | 293 |
| 55 | 3300048925 | Ga0496122_0000053 | Ga0496122_0000053_131263_132150 | 293 |
| 56 | 3300048926 | Ga0496123_0000038 | Ga0496123_0000038_131263_132150 | 293 |
| 57 | 3300048928 | Ga0496125_0041418 | Ga0496125_0041418_2738_3625 | 293 |
| 58 | 3300048929 | Ga0496126_0329387 | Ga0496126_0329387_272_1159 | 293 |
| 59 | 3300050489 | nmdc:mga03683_132_c1 | nmdc:mga03683_132_c1_14081_14968 | 293 |
| 60 | 3300050491 | nmdc:mga00v17_11_c1 | nmdc:mga00v17_11_c1_17190_18077 | 293 |
| 61 | 3300050493 | nmdc:mga0k408_25102_c1 | nmdc:mga0k408_25102_c1_2316_3203 | 293 |
| 62 | 3300050496 | nmdc:mga07m45_46502_c1 | nmdc:mga07m45_46502_c1_1281_2168 | 293 |
| 63 | iso_pu_bacteria | 2718217927 | 2719387205 | 293 |
| 64 | iso_pu_bacteria | 2718218232 | 2720614739 | 293 |
| 65 | iso_pu_bacteria | 2718218233 | 2720621512 | 293 |
| 66 | iso_pu_bacteria | 2718218235 | 2720632840 | 293 |
| 67 | iso_pu_bacteria | 2718218269 | 2720776564 | 293 |
| 68 | iso_pu_bacteria | 2718218423 | 2721400840 | 293 |
| 69 | iso_pu_bacteria | 2721755556 | 2723028152 | 293 |
| 70 | iso_pu_bacteria | 2721755684 | 2723561783 | 293 |
| 71 | iso_pu_bacteria | 2721755685 | 2723568412 | 293 |
| 72 | iso_pu_bacteria | 2721755809 | 2724039653 | 293 |
| 73 | iso_pu_bacteria | 2721755819 | 2724091171 | 293 |
| 74 | iso_pu_bacteria | 2721755822 | 2724105677 | 293 |
| 75 | iso_pu_bacteria | 2728369352 | 2730109088 | 293 |
| 76 | iso_pu_bacteria | 2791355256 | 2793293712 | 293 |
| 77 | iso_pu_bacteria | 2791355261 | 2793328210 | 293 |
| 78 | iso_pu_bacteria | 2791355262 | 2793333303 | 293 |
| 79 | iso_pu_bacteria | 2791355265 | 2793353633 | 293 |
| 80 | iso_pu_bacteria | 2802429605 | 2805930560 | 293 |
| 81 | iso_pu_bacteria | 2802429606 | 2805934261 | 293 |
| 82 | iso_pu_bacteria | 2838061910 | 2838063782 | 293 |
| 83 | iso_pu_bacteria | 2838068647 | 2838073265 | 293 |
| 84 | iso_pu_bacteria | 2838668709 | 2838671207 | 293 |
| 85 | iso_pu_bacteria | 2838701080 | 2838703613 | 293 |
| 86 | iso_pu_bacteria | 2842146304 | 2842149385 | 293 |
| 87 | iso_pu_bacteria | 2842192696 | 2842197848 | 293 |
| 88 | iso_pu_bacteria | 2842205361 | 2842208235 | 293 |
| 89 | iso_pu_bacteria | 2842250916 | 2842253977 | 293 |
| 90 | iso_pu_bacteria | 2842264693 | 2842266546 | 293 |
| 91 | iso_pu_bacteria | 2842278818 | 2842281756 | 293 |
| 92 | iso_pu_bacteria | 2842311132 | 2842315529 | 293 |
| 93 | iso_pu_bacteria | 2842317721 | 2842321459 | 293 |
| 94 | iso_pu_bacteria | 2842395702 | 2842398588 | 293 |
| 95 | iso_pu_bacteria | 2842422224 | 2842426899 | 293 |
| 96 | iso_pu_bacteria | 2842428310 | 2842429865 | 293 |
| 97 | iso_pu_bacteria | 2842434925 | 2842436475 | 293 |
| 98 | iso_pu_bacteria | 2842441272 | 2842444178 | 293 |
| 99 | iso_pu_bacteria | 2842447887 | 2842450963 | 293 |
| 100 | iso_pu_bacteria | 2842462802 | 2842464286 | 293 |
| 101 | iso_pu_bacteria | 2842469257 | 2842470804 | 293 |
| 102 | iso_pu_bacteria | 2842489311 | 2842493207 | 293 |
| 103 | iso_pu_bacteria | 2842495871 | 2842499225 | 293 |
| 104 | iso_pu_bacteria | 2933599457 | 2933603605 | 293 |
| 105 | iso_pu_bacteria | 8005275841 | 8005281934 | 293 |
| 106 | iso_pu_bacteria | 8005282627 | 8005288921 | 293 |
| 107 | iso_pu_bacteria | 8005497431 | 8005501595 | 293 |
| 108 | iso_pu_bacteria | 8005619151 | 8005622952 | 293 |
| 109 | iso_pu_bacteria | 8005626139 | 8005631745 | 293 |
| 110 | iso_pu_bacteria | 8005668836 | 8005673016 | 293 |
| 111 | iso_pu_bacteria | 8005695170 | 8005700788 | 293 |
| 112 | iso_pu_bacteria | 8018176218 | 8018178532 | 293 |
| 113 | iso_pu_bacteria | 8024501048 | 8024506010 | 293 |
| 114 | iso_pu_bacteria | 8056382006 | 8056386951 | 293 |
| 115 | 3300005577 | Ga0068857_100020664 | Ga0068857_1000206647 | 294 |
| 116 | 3300025242 | Ga0209258_100620 | Ga0209258_10062027 | 294 |
| 117 | iso_pu_bacteria | 2509276021 | 2509386413 | 294 |
| 118 | iso_pu_bacteria | 2509276021 | 2509389909 | 294 |
| 119 | iso_pu_bacteria | 2510065019 | 2510134777 | 294 |
| 120 | iso_pu_bacteria | 2510461076 | 2510896129 | 294 |
| 121 | iso_pu_bacteria | 2513237085 | 2513581257 | 294 |
| 122 | iso_pu_bacteria | 2513237093 | 2513631384 | 294 |
| 123 | iso_pu_bacteria | 2513237103 | 2513710681 | 294 |
| 124 | iso_pu_bacteria | 2513237162 | 2514022400 | 294 |
| 125 | iso_pu_bacteria | 2515075009 | 2515113863 | 294 |
| 126 | iso_pu_bacteria | 2515154113 | 2515634735 | 294 |
| 127 | iso_pu_bacteria | 2515154114 | 2515645963 | 294 |
| 128 | iso_pu_bacteria | 2515154116 | 2515656844 | 294 |
| 129 | iso_pu_bacteria | 2515154134 | 2515743589 | 294 |
| 130 | iso_pu_bacteria | 2516653085 | 2517077777 | 294 |
| 131 | iso_pu_bacteria | 2517287029 | 2517410669 | 294 |
| 132 | iso_pu_bacteria | 2554235003 | 2554245150 | 294 |
| 133 | iso_pu_bacteria | 2558860242 | 2559297019 | 294 |
| 134 | iso_pu_bacteria | 2585427526 | 2585530206 | 294 |
| 135 | iso_pu_bacteria | 2585427528 | 2585541083 | 294 |
| 136 | iso_pu_bacteria | 2585427593 | 2585839846 | 294 |
| 137 | iso_pu_bacteria | 2615840624 | 2616295493 | 294 |
| 138 | iso_pu_bacteria | 2643221693 | 2644521262 | 294 |
| 139 | iso_pu_bacteria | 2718217882 | 2719182536 | 294 |
| 140 | iso_pu_bacteria | 2718218009 | 2719733255 | 294 |
| 141 | iso_pu_bacteria | 2718218363 | 2721148649 | 294 |
| 142 | iso_pu_bacteria | 2718218365 | 2721160035 | 294 |
| 143 | iso_pu_bacteria | 2718218366 | 2721165463 | 294 |
| 144 | iso_pu_bacteria | 2721755514 | 2722841633 | 294 |
| 145 | iso_pu_bacteria | 2721755810 | 2724046011 | 294 |
| 146 | iso_pu_bacteria | 2724679232 | 2725947764 | 294 |
| 147 | iso_pu_bacteria | 2728369365 | 2730165771 | 294 |
| 148 | iso_pu_bacteria | 2728369397 | 2730299667 | 294 |
| 149 | iso_pu_bacteria | 2738541333 | 2739035636 | 294 |
| 150 | iso_pu_bacteria | 2765235942 | 2766065387 | 294 |
| 151 | iso_pu_bacteria | 2791355264 | 2793347309 | 294 |
| 152 | iso_pu_bacteria | 2791355266 | 2793359800 | 294 |
| 153 | iso_pu_bacteria | 2791355267 | 2793369517 | 294 |
| 154 | iso_pu_bacteria | 2802429633 | 2806044624 | 294 |
| 155 | iso_pu_bacteria | 2802429634 | 2806052824 | 294 |
| 156 | iso_pu_bacteria | 2802429635 | 2806059124 | 294 |
| 157 | iso_pu_bacteria | 2802429636 | 2806068213 | 294 |
| 158 | iso_pu_bacteria | 2802429637 | 2806074333 | 294 |
| 159 | iso_pu_bacteria | 2808606387 | 2808989020 | 294 |
| 160 | iso_pu_bacteria | 2821443989 | 2821449461 | 294 |
| 161 | iso_pu_bacteria | 2838022645 | 2838024363 | 294 |
| 162 | iso_pu_bacteria | 2838680041 | 2838685025 | 294 |
| 163 | iso_pu_bacteria | 2838686498 | 2838691389 | 294 |
| 164 | iso_pu_bacteria | 2838694306 | 2838699138 | 294 |
| 165 | iso_pu_bacteria | 2838707686 | 2838712619 | 294 |
| 166 | iso_pu_bacteria | 2838729681 | 2838733348 | 294 |
| 167 | iso_pu_bacteria | 2838742623 | 2838746080 | 294 |
| 168 | iso_pu_bacteria | 2841851746 | 2841853792 | 294 |
| 169 | iso_pu_bacteria | 2841864319 | 2841868248 | 294 |
| 170 | iso_pu_bacteria | 2842077413 | 2842082096 | 294 |
| 171 | iso_pu_bacteria | 2842110456 | 2842113503 | 294 |
| 172 | iso_pu_bacteria | 2842118031 | 2842123018 | 294 |
| 173 | iso_pu_bacteria | 2842156927 | 2842162201 | 294 |
| 174 | iso_pu_bacteria | 2842163707 | 2842169756 | 294 |
| 175 | iso_pu_bacteria | 2842180545 | 2842185127 | 294 |
| 176 | iso_pu_bacteria | 2842198810 | 2842199906 | 294 |
| 177 | iso_pu_bacteria | 2842217011 | 2842220145 | 294 |
| 178 | iso_pu_bacteria | 2842229732 | 2842233614 | 294 |
| 179 | iso_pu_bacteria | 2842237096 | 2842242079 | 294 |
| 180 | iso_pu_bacteria | 2842243621 | 2842247658 | 294 |
| 181 | iso_pu_bacteria | 2842257432 | 2842262074 | 294 |
| 182 | iso_pu_bacteria | 2842271015 | 2842275863 | 294 |
| 183 | iso_pu_bacteria | 2842291075 | 2842296096 | 294 |
| 184 | iso_pu_bacteria | 2842304105 | 2842308153 | 294 |
| 185 | iso_pu_bacteria | 2842363717 | 2842370326 | 294 |
| 186 | iso_pu_bacteria | 2842370503 | 2842375703 | 294 |
| 187 | iso_pu_bacteria | 2842377471 | 2842382495 | 294 |
| 188 | iso_pu_bacteria | 2842384541 | 2842389896 | 294 |
| 189 | iso_pu_bacteria | 2844454524 | 2844457563 | 294 |
| 190 | iso_pu_bacteria | 2857516855 | 2857518970 | 294 |
| 191 | iso_pu_bacteria | 2899845264 | 2899845380 | 294 |
| 192 | iso_pu_bacteria | 2926760298 | 2926763985 | 294 |
| 193 | iso_pu_bacteria | 2933570622 | 2933574602 | 294 |
| 194 | iso_pu_bacteria | 2933586486 | 2933589207 | 294 |
| 195 | iso_pu_bacteria | 2935894831 | 2935899800 | 294 |
| 196 | iso_pu_bacteria | 2935901341 | 2935906965 | 294 |
| 197 | iso_pu_bacteria | 2936367885 | 2936374938 | 294 |
| 198 | iso_pu_bacteria | 2936375103 | 2936380629 | 294 |
| 199 | iso_pu_bacteria | 2979089926 | 2979090917 | 294 |
| 200 | iso_pu_bacteria | 2979095461 | 2979096442 | 294 |
| 201 | iso_pu_bacteria | 2989776772 | 2989777185 | 294 |
| 202 | iso_pu_bacteria | 639633055 | 639649935 | 294 |
| 203 | iso_pu_bacteria | 650716007 | 650843446 | 294 |
| 204 | iso_pu_bacteria | 8005301065 | 8005306741 | 294 |
| 205 | iso_pu_bacteria | 8005307578 | 8005311234 | 294 |
| 206 | iso_pu_bacteria | 8005376324 | 8005378261 | 294 |
| 207 | iso_pu_bacteria | 8005382845 | 8005383907 | 294 |
| 208 | iso_pu_bacteria | 8005395548 | 8005401233 | 294 |
| 209 | iso_pu_bacteria | 8005430974 | 8005434187 | 294 |
| 210 | iso_pu_bacteria | 8005460587 | 8005464550 | 294 |
| 211 | iso_pu_bacteria | 8005556819 | 8005558450 | 294 |
| 212 | iso_pu_bacteria | 8005563573 | 8005566706 | 294 |
| 213 | iso_pu_bacteria | 8005570704 | 8005575010 | 294 |
| 214 | iso_pu_bacteria | 8005688590 | 8005693564 | 294 |
| 215 | iso_pu_bacteria | 8018127388 | 8018133679 | 294 |
| 216 | iso_pu_bacteria | 8018150411 | 8018155064 | 294 |
| 217 | iso_pu_bacteria | 8018163183 | 8018170150 | 294 |
| 218 | iso_pu_bacteria | 8023680758 | 8023687618 | 294 |
| 219 | iso_pu_bacteria | 8024479707 | 8024481713 | 294 |
| 220 | 3300002737 | JGI25162J39368_1000521 | JGI25162J39368_100052117 | 295 |
| 221 | 3300002741 | JGI25157J39369_1000434 | JGI25157J39369_10004342 | 295 |
| 222 | 3300002772 | JGI25164J39214_1000288 | JGI25164J39214_100028823 | 295 |
| 223 | 3300003214 | JGI25165J46597_1000532 | JGI25165J46597_100053223 | 295 |
| 224 | 3300003323 | rootH1_10110352 | rootH1_101103521 | 295 |
| 225 | 3300003751 | Ga0055538_1001162 | Ga0055538_10011624 | 295 |
| 226 | 3300003761 | Ga0055535_1000429 | Ga0055535_100042927 | 295 |
| 227 | 3300003762 | Ga0055542_1000648 | Ga0055542_100064817 | 295 |
| 228 | 3300003763 | Ga0055529_1000467 | Ga0055529_100046727 | 295 |
| 229 | 3300009765 | Ga0123341_1000014 | Ga0123341_100001486 | 295 |
| 230 | 3300009766 | Ga0123342_1025475 | Ga0123342_10254754 | 295 |
| 231 | 3300025207 | Ga0209760_100646 | Ga0209760_1006464 | 295 |
| 232 | 3300025224 | Ga0209784_100216 | Ga0209784_10021627 | 295 |
| 233 | 3300025231 | Ga0207427_100267 | Ga0207427_10026727 | 295 |
| 234 | 3300025233 | Ga0209437_100037 | Ga0209437_10003717 | 295 |
| 235 | 3300025242 | Ga0209258_100034 | Ga0209258_100034211 | 295 |
| 236 | 3300025246 | Ga0209646_1000436 | Ga0209646_100043613 | 295 |
| 237 | 3300025250 | Ga0209026_1000255 | Ga0209026_100025523 | 295 |
| 238 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001493 | 295 |
| 239 | 3300025256 | Ga0209759_1000678 | Ga0209759_100067820 | 295 |
| 240 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021738 | 295 |
| 241 | 3300025272 | Ga0209455_1000054 | Ga0209455_1000054180 | 295 |
| 242 | 3300049572 | Ga0501036_0078192 | Ga0501036_0078192_1833_2726 | 295 |
| 243 | 3300049574 | Ga0501038_0362206 | Ga0501038_0362206_157_1050 | 295 |
| 244 | 3300049579 | Ga0501043_0123591 | Ga0501043_0123591_1064_1957 | 295 |
| 245 | 3300049580 | Ga0501046_0037729 | Ga0501046_0037729_36_929 | 295 |
| 246 | 3300049581 | Ga0501047_0079547 | Ga0501047_0079547_1846_2739 | 295 |
| 247 | 3300049822 | Ga0501035_0026921 | Ga0501035_0026921_3419_4312 | 295 |
| 248 | 3300049823 | Ga0501044_0034629 | Ga0501044_0034629_413_1306 | 295 |
| 249 | iso_pu_bacteria | 2842341865 | 2842344931 | 295 |
| 250 | iso_pu_bacteria | 2937822353 | 2937828564 | 295 |
| 251 | iso_pu_bacteria | 8056375014 | 8056381517 | 295 |
| 252 | 3300003771 | Ga0055526_1001815 | Ga0055526_10018157 | 296 |
| 253 | 3300003790 | Ga0055528_1001469 | Ga0055528_10014696 | 296 |
| 254 | 3300006186 | Ga0075369_10040480 | Ga0075369_100404802 | 296 |
| 255 | 3300010375 | Ga0105239_10134284 | Ga0105239_101342842 | 296 |
| 256 | 3300025273 | Ga0209673_1000060 | Ga0209673_1000060143 | 296 |
| 257 | 3300025295 | Ga0209564_1000116 | Ga0209564_1000116143 | 296 |
| 258 | 3300025299 | Ga0209256_1001292 | Ga0209256_100129211 | 296 |
| 259 | 3300044735 | Ga0466968_0168838 | Ga0466968_0168838_13_903 | 296 |
| 260 | 3300048921 | Ga0496118_0011482 | Ga0496118_0011482_5451_6398 | 296 |
| 261 | 3300048927 | Ga0496124_0002819 | Ga0496124_0002819_20275_21171 | 296 |
| 262 | iso_pu_bacteria | 3002141150 | 3002144741 | 296 |
| 263 | 3300003187 | JGI25151J46595_10000247 | JGI25151J46595_1000024747 | 297 |
| 264 | 3300003187 | JGI25151J46595_10000596 | JGI25151J46595_100005965 | 297 |
| 265 | 3300003790 | Ga0055528_1000485 | Ga0055528_100048525 | 297 |
| 266 | 3300025273 | Ga0209673_1000037 | Ga0209673_1000037223 | 297 |
| 267 | 3300025284 | Ga0209130_1000304 | Ga0209130_100030410 | 297 |
| 268 | 3300025294 | Ga0209025_1000263 | Ga0209025_100026385 | 297 |
| 269 | 3300025294 | Ga0209025_1004349 | Ga0209025_10043498 | 297 |
| 270 | 3300025295 | Ga0209564_1007338 | Ga0209564_10073386 | 297 |
| 271 | 3300025297 | Ga0209758_1007764 | Ga0209758_100776410 | 297 |
| 272 | 3300025299 | Ga0209256_1001802 | Ga0209256_10018026 | 297 |
| 273 | 3300025302 | Ga0207426_1000141 | Ga0207426_1000141128 | 297 |
| 274 | 3300042146 | Ga0450907_014728 | Ga0450907_014728_27_935 | 297 |
| 275 | 3300046507 | Ga0495606_0001207 | Ga0495606_0001207_15897_16805 | 297 |
| 276 | 3300046512 | Ga0495610_0002928 | Ga0495610_0002928_2921_3820 | 297 |
| 277 | iso_pu_bacteria | 2517093000 | 2517096576 | 297 |
| 278 | iso_pu_bacteria | 2791355260 | 2793319784 | 297 |
| 279 | iso_pu_bacteria | 2842285085 | 2842288862 | 297 |
| 280 | iso_pu_bacteria | 2842402390 | 2842406471 | 297 |
| 281 | iso_pu_bacteria | 2842409023 | 2842413102 | 297 |
| 282 | iso_pu_bacteria | 2842415677 | 2842419745 | 297 |
| 283 | 3300003187 | JGI25151J46595_10001523 | JGI25151J46595_100015235 | 298 |
| 284 | 3300003187 | JGI25151J46595_10002304 | JGI25151J46595_100023046 | 298 |
| 285 | 3300003215 | JGI25153J46596_10002106 | JGI25153J46596_100021063 | 298 |
| 286 | 3300003215 | JGI25153J46596_10024468 | JGI25153J46596_100244683 | 298 |
| 287 | 3300003322 | rootL2_10096740 | rootL2_100967401 | 298 |
| 288 | 3300003354 | JGI25160J50197_1000481 | JGI25160J50197_100048111 | 298 |
| 289 | 3300003374 | JGI25161J50226_1003256 | JGI25161J50226_10032565 | 298 |
| 290 | 3300003771 | Ga0055526_1001606 | Ga0055526_100160612 | 298 |
| 291 | 3300003771 | Ga0055526_1002324 | Ga0055526_10023249 | 298 |
| 292 | 3300003771 | Ga0055526_1014316 | Ga0055526_10143163 | 298 |
| 293 | 3300003775 | Ga0055524_1002110 | Ga0055524_10021106 | 298 |
| 294 | 3300003781 | Ga0055536_1000033 | Ga0055536_100003355 | 298 |
| 295 | 3300003784 | Ga0055534_1002018 | Ga0055534_10020182 | 298 |
| 296 | 3300003790 | Ga0055528_1001954 | Ga0055528_10019546 | 298 |
| 297 | 3300003790 | Ga0055528_1017797 | Ga0055528_10177973 | 298 |
| 298 | 3300003792 | Ga0055540_1001114 | Ga0055540_100111411 | 298 |
| 299 | 3300003792 | Ga0055540_1015978 | Ga0055540_10159782 | 298 |
| 300 | 3300004625 | Ga0055543_1000711 | Ga0055543_100071111 | 298 |
| 301 | 3300005262 | Ga0065165_1004729 | Ga0065165_10047296 | 298 |
| 302 | 3300005347 | Ga0070668_100045007 | Ga0070668_1000450073 | 298 |
| 303 | 3300005353 | Ga0070669_100188653 | Ga0070669_1001886533 | 298 |
| 304 | 3300005539 | Ga0068853_100305665 | Ga0068853_1003056651 | 298 |
| 305 | 3300005548 | Ga0070665_100012115 | Ga0070665_1000121158 | 298 |
| 306 | 3300006177 | Ga0075362_10000128 | Ga0075362_1000012815 | 298 |
| 307 | 3300006177 | Ga0075362_10000940 | Ga0075362_100009406 | 298 |
| 308 | 3300006178 | Ga0075367_10006455 | Ga0075367_100064554 | 298 |
| 309 | 3300006186 | Ga0075369_10012111 | Ga0075369_100121114 | 298 |
| 310 | 3300006195 | Ga0075366_10001129 | Ga0075366_1000112913 | 298 |
| 311 | 3300006195 | Ga0075366_10047197 | Ga0075366_100471972 | 298 |
| 312 | 3300009036 | Ga0105244_10093755 | Ga0105244_100937552 | 298 |
| 313 | 3300010375 | Ga0105239_10817169 | Ga0105239_108171691 | 298 |
| 314 | 3300013104 | Ga0157370_10001455 | Ga0157370_100014553 | 298 |
| 315 | 3300025245 | Ga0207425_1002746 | Ga0207425_10027462 | 298 |
| 316 | 3300025258 | Ga0209129_1001456 | Ga0209129_10014566 | 298 |
| 317 | 3300025258 | Ga0209129_1013081 | Ga0209129_10130812 | 298 |
| 318 | 3300025273 | Ga0209673_1000312 | Ga0209673_100031229 | 298 |
| 319 | 3300025273 | Ga0209673_1000439 | Ga0209673_100043915 | 298 |
| 320 | 3300025273 | Ga0209673_1003095 | Ga0209673_10030956 | 298 |
| 321 | 3300025273 | Ga0209673_1014712 | Ga0209673_10147125 | 298 |
| 322 | 3300025291 | Ga0209675_1000108 | Ga0209675_100010830 | 298 |
| 323 | 3300025292 | Ga0209676_1000144 | Ga0209676_100014474 | 298 |
| 324 | 3300025294 | Ga0209025_1000046 | Ga0209025_1000046244 | 298 |
| 325 | 3300025294 | Ga0209025_1000389 | Ga0209025_100038971 | 298 |
| 326 | 3300025295 | Ga0209564_1000125 | Ga0209564_100012557 | 298 |
| 327 | 3300025295 | Ga0209564_1000185 | Ga0209564_100018579 | 298 |
| 328 | 3300025295 | Ga0209564_1000242 | Ga0209564_100024275 | 298 |
| 329 | 3300025297 | Ga0209758_1000621 | Ga0209758_100062126 | 298 |
| 330 | 3300025297 | Ga0209758_1010245 | Ga0209758_10102455 | 298 |
| 331 | 3300025298 | Ga0209050_1021064 | Ga0209050_10210644 | 298 |
| 332 | 3300025299 | Ga0209256_1001889 | Ga0209256_100188913 | 298 |
| 333 | 3300025302 | Ga0207426_1001122 | Ga0207426_100112218 | 298 |
| 334 | 3300025303 | Ga0209051_1000874 | Ga0209051_100087423 | 298 |
| 335 | 3300025303 | Ga0209051_1002243 | Ga0209051_10022439 | 298 |
| 336 | 3300025303 | Ga0209051_1010820 | Ga0209051_10108202 | 298 |
| 337 | 3300025304 | Ga0209257_1004872 | Ga0209257_10048728 | 298 |
| 338 | 3300025923 | Ga0207681_10113035 | Ga0207681_101130352 | 298 |
| 339 | 3300026041 | Ga0207639_10105118 | Ga0207639_101051181 | 298 |
| 340 | 3300028379 | Ga0268266_10014308 | Ga0268266_100143081 | 298 |
| 341 | 3300028794 | Ga0307515_10013332 | Ga0307515_1001333210 | 298 |
| 342 | 3300031456 | Ga0307513_10066026 | Ga0307513_100660264 | 298 |
| 343 | 3300037471 | Ga0395905_0003809 | Ga0395905_0003809_1687_2598 | 298 |
| 344 | 3300039447 | Ga0436361_1068300 | Ga0436361_1068300_580_1509 | 298 |
| 345 | 3300041496 | Ga0451839_0744782 | Ga0451839_0744782_2037_2990 | 298 |
| 346 | 3300041501 | Ga0451845_0430371 | Ga0451845_0430371_1509_2462 | 298 |
| 347 | 3300041501 | Ga0451845_0700627 | Ga0451845_0700627_2828_3781 | 298 |
| 348 | 3300041512 | Ga0451853_2207469 | Ga0451853_2207469_758_1711 | 298 |
| 349 | 3300046474 | Ga0495605_0103654 | Ga0495605_0103654_203_1099 | 298 |
| 350 | 3300046512 | Ga0495610_0024712 | Ga0495610_0024712_1533_2429 | 298 |
| 351 | 3300046513 | Ga0495616_0047965 | Ga0495616_0047965_348_1244 | 298 |
| 352 | 3300046515 | Ga0495620_0043193 | Ga0495620_0043193_818_1771 | 298 |
| 353 | 3300046522 | Ga0495643_0011453 | Ga0495643_0011453_2014_2910 | 298 |
| 354 | 3300046523 | Ga0495644_0078941 | Ga0495644_0078941_304_1200 | 298 |
| 355 | 3300046530 | Ga0495654_0159965 | Ga0495654_0159965_21_974 | 298 |
| 356 | 3300046542 | Ga0495597_0119689 | Ga0495597_0119689_160_1056 | 298 |
| 357 | 3300046660 | Ga0495625_0005983 | Ga0495625_0005983_6903_7799 | 298 |
| 358 | 3300046810 | Ga0495660_0090766 | Ga0495660_0090766_214_1110 | 298 |
| 359 | 3300047318 | Ga0495636_0083623 | Ga0495636_0083623_238_1134 | 298 |
| 360 | 3300047323 | Ga0495683_0084906 | Ga0495683_0084906_430_1326 | 298 |
| 361 | 3300047443 | Ga0495687_016127 | Ga0495687_016127_406_1302 | 298 |
| 362 | 3300048928 | Ga0496125_0179161 | Ga0496125_0179161_313_1215 | 298 |
| 363 | 3300048929 | Ga0496126_0202070 | Ga0496126_0202070_265_1167 | 298 |
| 364 | 3300049776 | Ga0501280_006411 | Ga0501280_006411_164_1075 | 298 |
| 365 | 3300050489 | nmdc:mga03683_71120_c1 | nmdc:mga03683_71120_c1_561_1457 | 298 |
| 366 | 3300050490 | nmdc:mga03n38_2283_c1 | nmdc:mga03n38_2283_c1_2563_3459 | 298 |
| 367 | 3300050492 | nmdc:mga0yw44_171786_c1 | nmdc:mga0yw44_171786_c1_156_1058 | 298 |
| 368 | 3300050492 | nmdc:mga0yw44_96_c1 | nmdc:mga0yw44_96_c1_5177_6079 | 298 |
| 369 | 3300050492 | nmdc:mga0yw44_97381_c1 | nmdc:mga0yw44_97381_c1_780_1676 | 298 |
| 370 | 3300050493 | nmdc:mga0k408_101017_c1 | nmdc:mga0k408_101017_c1_444_1343 | 298 |
| 371 | 3300050493 | nmdc:mga0k408_6874_c1 | nmdc:mga0k408_6874_c1_449_1345 | 298 |
| 372 | 3300050494 | nmdc:mga06z11_4851_c1 | nmdc:mga06z11_4851_c1_1754_2650 | 298 |
| 373 | 3300050496 | nmdc:mga07m45_144675_c1 | nmdc:mga07m45_144675_c1_220_1122 | 298 |
| 374 | 3300050496 | nmdc:mga07m45_7876_c1 | nmdc:mga07m45_7876_c1_2663_3559 | 298 |
| 375 | 3300050516 | nmdc:mga0sz30_41479_c1 | nmdc:mga0sz30_41479_c1_846_1742 | 298 |
| 376 | 3300053086 | Ga0500578_0040535 | Ga0500578_0040535_2013_2909 | 298 |
| 377 | 3300053134 | Ga0500658_0000067 | Ga0500658_0000067_22345_23241 | 298 |
| 378 | 3300053137 | Ga0500561_0000033 | Ga0500561_0000033_2931_3833 | 298 |
| 379 | 3300053153 | Ga0500616_0027770 | Ga0500616_0027770_1101_1997 | 298 |
| 380 | iso_pu_bacteria | 2871495908 | 2871497431 | 298 |
| 381 | iso_pu_bacteria | 2878760144 | 2878761649 | 298 |
| 382 | iso_pu_bacteria | 2878767105 | 2878768616 | 298 |
| 383 | iso_pu_bacteria | 2903540706 | 2903542226 | 298 |
| 384 | iso_pu_bacteria | 2922130491 | 2922138075 | 298 |
| 385 | iso_pu_bacteria | 2922158528 | 2922162389 | 298 |
| 386 | iso_pu_bacteria | 2924726620 | 2924726995 | 298 |
| 387 | iso_pu_bacteria | 2937994558 | 2937996079 | 298 |
| 388 | iso_pu_bacteria | 2958165035 | 2958166551 | 298 |
| 389 | iso_pu_bacteria | 2961163497 | 2961165016 | 298 |
| 390 | iso_pu_bacteria | 2965018300 | 2965019841 | 298 |
| 391 | iso_pu_bacteria | 2965062239 | 2965063856 | 298 |
| 392 | iso_pu_bacteria | 2968097103 | 2968103333 | 298 |
| 393 | iso_pu_bacteria | 2968128360 | 2968132330 | 298 |
| 394 | iso_pu_bacteria | 2968171901 | 2968173416 | 298 |
| 395 | iso_pu_bacteria | 2970554993 | 2970556505 | 298 |
| 396 | iso_pu_bacteria | 2977971508 | 2977977991 | 298 |
| 397 | iso_pu_bacteria | 2979779861 | 2979781620 | 298 |
| 398 | iso_pu_bacteria | 2987659509 | 2987661023 | 298 |
| 399 | iso_pu_bacteria | 2996341866 | 2996345874 | 298 |
| 400 | iso_pu_bacteria | 2996887358 | 2996890576 | 298 |
| 401 | iso_pu_bacteria | 3004188549 | 3004190073 | 298 |
| 402 | iso_pu_bacteria | 8004640170 | 8004645974 | 298 |
| 403 | iso_pu_bacteria | 8005258706 | 8005264305 | 298 |
| 404 | iso_pu_bacteria | 8005321885 | 8005325103 | 298 |
| 405 | iso_pu_bacteria | 8054002106 | 8054003667 | 298 |
| 406 | iso_pu_bacteria | 8057874678 | 8057876758 | 298 |
| 407 | 3300031730 | Ga0307516_10331684 | Ga0307516_103316842 | 299 |
| 408 | 3300039450 | Ga0436363_1503130 | Ga0436363_1503130_32_931 | 299 |
| 409 | 3300053151 | Ga0500604_0010952 | Ga0500604_0010952_155_1063 | 299 |
| 410 | iso_pu_bacteria | 2503198000 | 2503203741 | 299 |
| 411 | iso_pu_bacteria | 2508501123 | 2509113899 | 299 |
| 412 | iso_pu_bacteria | 2509276022 | 2509398103 | 299 |
| 413 | iso_pu_bacteria | 2510917028 | 2511187129 | 299 |
| 414 | iso_pu_bacteria | 2510917030 | 2511198471 | 299 |
| 415 | iso_pu_bacteria | 2513237084 | 2513572543 | 299 |
| 416 | iso_pu_bacteria | 2513237088 | 2513599150 | 299 |
| 417 | iso_pu_bacteria | 2513237090 | 2513608042 | 299 |
| 418 | iso_pu_bacteria | 2513237138 | 2513869738 | 299 |
| 419 | iso_pu_bacteria | 2513237144 | 2513908259 | 299 |
| 420 | iso_pu_bacteria | 2513237146 | 2513926879 | 299 |
| 421 | iso_pu_bacteria | 2513237305 | 2514423188 | 299 |
| 422 | iso_pu_bacteria | 2534681796 | 2535519516 | 299 |
| 423 | iso_pu_bacteria | 2582581294 | 2585202554 | 299 |
| 424 | iso_pu_bacteria | 2582581867 | 2585403313 | 299 |
| 425 | iso_pu_bacteria | 2585427590 | 2585823610 | 299 |
| 426 | iso_pu_bacteria | 2599185170 | 2599420627 | 299 |
| 427 | iso_pu_bacteria | 2599185301 | 2599938583 | 299 |
| 428 | iso_pu_bacteria | 2643221599 | 2644006330 | 299 |
| 429 | iso_pu_bacteria | 2643221634 | 2644191465 | 299 |
| 430 | iso_pu_bacteria | 2693429783 | 2694632683 | 299 |
| 431 | iso_pu_bacteria | 2693429784 | 2694639588 | 299 |
| 432 | iso_pu_bacteria | 2721755686 | 2723577778 | 299 |
| 433 | iso_pu_bacteria | 2838035591 | 2838040699 | 299 |
| 434 | iso_pu_bacteria | 2838661181 | 2838664914 | 299 |
| 435 | iso_pu_bacteria | 2856349417 | 2856352094 | 299 |
| 436 | iso_pu_bacteria | 2856356410 | 2856356493 | 299 |
| 437 | iso_pu_bacteria | 2856364286 | 2856365289 | 299 |
| 438 | iso_pu_bacteria | 2857349434 | 2857354718 | 299 |
| 439 | iso_pu_bacteria | 2869162929 | 2869163111 | 299 |
| 440 | iso_pu_bacteria | 2869285874 | 2869289200 | 299 |
| 441 | iso_pu_bacteria | 2871429161 | 2871431268 | 299 |
| 442 | iso_pu_bacteria | 2871488783 | 2871492710 | 299 |
| 443 | iso_pu_bacteria | 2874146452 | 2874148467 | 299 |
| 444 | iso_pu_bacteria | 2874155637 | 2874156211 | 299 |
| 445 | iso_pu_bacteria | 2876392853 | 2876398968 | 299 |
| 446 | iso_pu_bacteria | 2876413966 | 2876415246 | 299 |
| 447 | iso_pu_bacteria | 2878745973 | 2878747872 | 299 |
| 448 | iso_pu_bacteria | 2878753008 | 2878758590 | 299 |
| 449 | iso_pu_bacteria | 2881147464 | 2881154118 | 299 |
| 450 | iso_pu_bacteria | 2881155292 | 2881157853 | 299 |
| 451 | iso_pu_bacteria | 2881161766 | 2881163185 | 299 |
| 452 | iso_pu_bacteria | 2881845957 | 2881848107 | 299 |
| 453 | iso_pu_bacteria | 2881861095 | 2881861852 | 299 |
| 454 | iso_pu_bacteria | 2882632389 | 2882639956 | 299 |
| 455 | iso_pu_bacteria | 2882912400 | 2882916390 | 299 |
| 456 | iso_pu_bacteria | 2885305155 | 2885312147 | 299 |
| 457 | iso_pu_bacteria | 2885318864 | 2885319759 | 299 |
| 458 | iso_pu_bacteria | 2885326080 | 2885326798 | 299 |
| 459 | iso_pu_bacteria | 2888350351 | 2888351117 | 299 |
| 460 | iso_pu_bacteria | 2889010040 | 2889013506 | 299 |
| 461 | iso_pu_bacteria | 2889016732 | 2889021776 | 299 |
| 462 | iso_pu_bacteria | 2903492973 | 2903496558 | 299 |
| 463 | iso_pu_bacteria | 2903492973 | 2903505872 | 299 |
| 464 | iso_pu_bacteria | 2904659560 | 2904665500 | 299 |
| 465 | iso_pu_bacteria | 2906308376 | 2906311490 | 299 |
| 466 | iso_pu_bacteria | 2906321335 | 2906323230 | 299 |
| 467 | iso_pu_bacteria | 2919100787 | 2919104496 | 299 |
| 468 | iso_pu_bacteria | 2922185730 | 2922187059 | 299 |
| 469 | iso_pu_bacteria | 2923556063 | 2923558855 | 299 |
| 470 | iso_pu_bacteria | 2924784321 | 2924785165 | 299 |
| 471 | iso_pu_bacteria | 2933016740 | 2933017462 | 299 |
| 472 | iso_pu_bacteria | 2937813078 | 2937818689 | 299 |
| 473 | iso_pu_bacteria | 2938014810 | 2938018581 | 299 |
| 474 | iso_pu_bacteria | 2958041894 | 2958048122 | 299 |
| 475 | iso_pu_bacteria | 2958064165 | 2958066292 | 299 |
| 476 | iso_pu_bacteria | 2958100919 | 2958103928 | 299 |
| 477 | iso_pu_bacteria | 2958130278 | 2958133576 | 299 |
| 478 | iso_pu_bacteria | 2958172287 | 2958174277 | 299 |
| 479 | iso_pu_bacteria | 2958179912 | 2958183220 | 299 |
| 480 | iso_pu_bacteria | 2961077736 | 2961081187 | 299 |
| 481 | iso_pu_bacteria | 2961114664 | 2961120500 | 299 |
| 482 | iso_pu_bacteria | 2961170736 | 2961173214 | 299 |
| 483 | iso_pu_bacteria | 2965119406 | 2965127225 | 299 |
| 484 | iso_pu_bacteria | 2967996073 | 2967998385 | 299 |
| 485 | iso_pu_bacteria | 2968003550 | 2968006189 | 299 |
| 486 | iso_pu_bacteria | 2968110612 | 2968116967 | 299 |
| 487 | iso_pu_bacteria | 2968117919 | 2968118693 | 299 |
| 488 | iso_pu_bacteria | 2970503327 | 2970505808 | 299 |
| 489 | iso_pu_bacteria | 2977821940 | 2977827124 | 299 |
| 490 | iso_pu_bacteria | 2977828996 | 2977830598 | 299 |
| 491 | iso_pu_bacteria | 2977843712 | 2977844514 | 299 |
| 492 | iso_pu_bacteria | 2977864932 | 2977870438 | 299 |
| 493 | iso_pu_bacteria | 2977942078 | 2977946498 | 299 |
| 494 | iso_pu_bacteria | 2979710463 | 2979716205 | 299 |
| 495 | iso_pu_bacteria | 2979808191 | 2979810529 | 299 |
| 496 | iso_pu_bacteria | 2987636660 | 2987643320 | 299 |
| 497 | iso_pu_bacteria | 3000135777 | 3000141232 | 299 |
| 498 | iso_pu_bacteria | 3004203850 | 3004206866 | 299 |
| 499 | iso_pu_bacteria | 3005445848 | 3005449211 | 299 |
| 500 | iso_pu_bacteria | 3005452660 | 3005455474 | 299 |
| 501 | iso_pu_bacteria | 8004374579 | 8004380107 | 299 |
| 502 | iso_pu_bacteria | 8004387939 | 8004391079 | 299 |
| 503 | iso_pu_bacteria | 8004714634 | 8004716450 | 299 |
| 504 | iso_pu_bacteria | 8005542996 | 8005547209 | 299 |
| 505 | 3300005548 | Ga0070665_100013795 | Ga0070665_1000137953 | 300 |
| 506 | 3300005548 | Ga0070665_100159477 | Ga0070665_1001594773 | 300 |
| 507 | 3300010375 | Ga0105239_10007580 | Ga0105239_100075808 | 300 |
| 508 | 3300025914 | Ga0207671_10000461 | Ga0207671_1000046144 | 300 |
| 509 | 3300028379 | Ga0268266_10000086 | Ga0268266_10000086114 | 300 |
| 510 | 3300028379 | Ga0268266_10201003 | Ga0268266_102010033 | 300 |
| 511 | 3300041413 | Ga0439465_0001676 | Ga0439465_0001676_5376_6284 | 300 |
| 512 | 3300046492 | Ga0495585_0004599 | Ga0495585_0004599_5613_6527 | 300 |
| 513 | 3300046507 | Ga0495606_0119161 | Ga0495606_0119161_604_1506 | 300 |
| 514 | 3300046660 | Ga0495625_0080571 | Ga0495625_0080571_1056_1970 | 300 |
| 515 | 3300046691 | Ga0495670_0135433 | Ga0495670_0135433_350_1258 | 300 |
| 516 | 3300047472 | Ga0495686_0228521 | Ga0495686_0228521_23_934 | 300 |
| 517 | 3300053153 | Ga0500616_0101333 | Ga0500616_0101333_123_1031 | 300 |
| 518 | iso_pu_bacteria | 2876377896 | 2876385177 | 300 |
| 519 | 3300006048 | Ga0075363_100007136 | Ga0075363_1000071364 | 301 |
| 520 | 3300041507 | Ga0451851_0474418 | Ga0451851_0474418_200_1168 | 301 |
| 521 | iso_pu_bacteria | 2929199973 | 2929202327 | 301 |
| 522 | iso_pu_bacteria | 3005409236 | 3005415566 | 301 |
| 523 | iso_pu_bacteria | 8055909800 | 8055913786 | 301 |
| 524 | 3300005539 | Ga0068853_100036598 | Ga0068853_1000365981 | 302 |
| 525 | 3300005937 | Ga0081455_10205297 | Ga0081455_102052972 | 302 |
| 526 | 3300009545 | Ga0105237_10049273 | Ga0105237_100492732 | 302 |
| 527 | 3300009551 | Ga0105238_10002917 | Ga0105238_1000291717 | 302 |
| 528 | 3300025294 | Ga0209025_1032871 | Ga0209025_10328713 | 302 |
| 529 | 3300025297 | Ga0209758_1021472 | Ga0209758_10214724 | 302 |
| 530 | 3300025904 | Ga0207647_10039433 | Ga0207647_100394332 | 302 |
| 531 | 3300025924 | Ga0207694_10005520 | Ga0207694_100055202 | 302 |
| 532 | 3300026116 | Ga0207674_10153672 | Ga0207674_101536722 | 302 |
| 533 | 3300037312 | Ga0395899_0172777 | Ga0395899_0172777_117_1034 | 302 |
| 534 | 3300048921 | Ga0496118_0187605 | Ga0496118_0187605_19_930 | 302 |
| 535 | 3300048925 | Ga0496122_0101310 | Ga0496122_0101310_301_1215 | 302 |
| 536 | 3300048929 | Ga0496126_0051373 | Ga0496126_0051373_2687_3607 | 302 |
| 537 | 3300049822 | Ga0501035_0010471 | Ga0501035_0010471_2901_3824 | 302 |
| 538 | 3300049823 | Ga0501044_0050776 | Ga0501044_0050776_3137_4060 | 302 |
| 539 | 3300049823 | Ga0501044_0528375 | Ga0501044_0528375_16_939 | 302 |
| 540 | 3300002705 | JGI25156J39149_1005532 | JGI25156J39149_10055322 | 303 |
| 541 | 3300002739 | JGI25158J39367_1000180 | JGI25158J39367_100018010 | 303 |
| 542 | 3300002741 | JGI25157J39369_1001050 | JGI25157J39369_10010502 | 303 |
| 543 | 3300002773 | JGI25152J39213_1001981 | JGI25152J39213_100198110 | 303 |
| 544 | 3300002773 | JGI25152J39213_1005036 | JGI25152J39213_10050363 | 303 |
| 545 | 3300002987 | JGI25159J45721_1001406 | JGI25159J45721_10014067 | 303 |
| 546 | 3300003187 | JGI25151J46595_10002206 | JGI25151J46595_100022067 | 303 |
| 547 | 3300003187 | JGI25151J46595_10016424 | JGI25151J46595_100164241 | 303 |
| 548 | 3300003214 | JGI25165J46597_1000016 | JGI25165J46597_1000016278 | 303 |
| 549 | 3300003215 | JGI25153J46596_10003024 | JGI25153J46596_100030247 | 303 |
| 550 | 3300003354 | JGI25160J50197_1008267 | JGI25160J50197_10082672 | 303 |
| 551 | 3300003374 | JGI25161J50226_1000114 | JGI25161J50226_100011432 | 303 |
| 552 | 3300003771 | Ga0055526_1002600 | Ga0055526_10026005 | 303 |
| 553 | 3300003775 | Ga0055524_1011549 | Ga0055524_10115493 | 303 |
| 554 | 3300003775 | Ga0055524_1014713 | Ga0055524_10147131 | 303 |
| 555 | 3300003775 | Ga0055524_1018277 | Ga0055524_10182772 | 303 |
| 556 | 3300003790 | Ga0055528_1009892 | Ga0055528_10098922 | 303 |
| 557 | 3300003792 | Ga0055540_1001218 | Ga0055540_10012183 | 303 |
| 558 | 3300004625 | Ga0055543_1000077 | Ga0055543_100007727 | 303 |
| 559 | 3300005262 | Ga0065165_1010241 | Ga0065165_10102412 | 303 |
| 560 | 3300005331 | Ga0070670_100160644 | Ga0070670_1001606442 | 303 |
| 561 | 3300005355 | Ga0070671_100042321 | Ga0070671_1000423212 | 303 |
| 562 | 3300006038 | Ga0075365_10009275 | Ga0075365_100092756 | 303 |
| 563 | 3300006178 | Ga0075367_10004695 | Ga0075367_100046956 | 303 |
| 564 | 3300006186 | Ga0075369_10014442 | Ga0075369_100144422 | 303 |
| 565 | 3300009011 | Ga0105251_10012908 | Ga0105251_100129085 | 303 |
| 566 | 3300009177 | Ga0105248_10038064 | Ga0105248_100380644 | 303 |
| 567 | 3300025208 | Ga0209436_100050 | Ga0209436_10005032 | 303 |
| 568 | 3300025246 | Ga0209646_1005372 | Ga0209646_10053722 | 303 |
| 569 | 3300025250 | Ga0209026_1000005 | Ga0209026_1000005400 | 303 |
| 570 | 3300025256 | Ga0209759_1000292 | Ga0209759_100029247 | 303 |
| 571 | 3300025258 | Ga0209129_1000080 | Ga0209129_100008083 | 303 |
| 572 | 3300025258 | Ga0209129_1001687 | Ga0209129_100168710 | 303 |
| 573 | 3300025258 | Ga0209129_1007430 | Ga0209129_10074306 | 303 |
| 574 | 3300025261 | Ga0209233_1000068 | Ga0209233_1000068280 | 303 |
| 575 | 3300025273 | Ga0209673_1003647 | Ga0209673_100364710 | 303 |
| 576 | 3300025273 | Ga0209673_1008335 | Ga0209673_10083352 | 303 |
| 577 | 3300025273 | Ga0209673_1008603 | Ga0209673_10086034 | 303 |
| 578 | 3300025284 | Ga0209130_1000030 | Ga0209130_1000030234 | 303 |
| 579 | 3300025294 | Ga0209025_1013719 | Ga0209025_10137192 | 303 |
| 580 | 3300025294 | Ga0209025_1019307 | Ga0209025_10193071 | 303 |
| 581 | 3300025294 | Ga0209025_1021393 | Ga0209025_10213933 | 303 |
| 582 | 3300025295 | Ga0209564_1000364 | Ga0209564_100036414 | 303 |
| 583 | 3300025295 | Ga0209564_1008211 | Ga0209564_10082116 | 303 |
| 584 | 3300025295 | Ga0209564_1013994 | Ga0209564_10139946 | 303 |
| 585 | 3300025297 | Ga0209758_1001342 | Ga0209758_100134216 | 303 |
| 586 | 3300025297 | Ga0209758_1001459 | Ga0209758_100145926 | 303 |
| 587 | 3300025297 | Ga0209758_1012315 | Ga0209758_10123152 | 303 |
| 588 | 3300025299 | Ga0209256_1002320 | Ga0209256_100232016 | 303 |
| 589 | 3300025299 | Ga0209256_1004718 | Ga0209256_100471812 | 303 |
| 590 | 3300025299 | Ga0209256_1010950 | Ga0209256_10109506 | 303 |
| 591 | 3300025299 | Ga0209256_1018180 | Ga0209256_10181802 | 303 |
| 592 | 3300025299 | Ga0209256_1023081 | Ga0209256_10230812 | 303 |
| 593 | 3300025302 | Ga0207426_1000047 | Ga0207426_1000047167 | 303 |
| 594 | 3300025302 | Ga0207426_1009672 | Ga0207426_10096724 | 303 |
| 595 | 3300025303 | Ga0209051_1001764 | Ga0209051_100176413 | 303 |
| 596 | 3300025304 | Ga0209257_1016732 | Ga0209257_10167322 | 303 |
| 597 | 3300026067 | Ga0207678_10028827 | Ga0207678_100288275 | 303 |
| 598 | 3300026121 | Ga0207683_10498084 | Ga0207683_104980842 | 303 |
| 599 | 3300037418 | Ga0395900_0216217 | Ga0395900_0216217_518_1438 | 303 |
| 600 | 3300038443 | Ga0395901_0134754 | Ga0395901_0134754_87_1040 | 303 |
| 601 | 3300041410 | Ga0439461_0035490 | Ga0439461_0035490_87_1007 | 303 |
| 602 | 3300044658 | Ga0466972_0080689 | Ga0466972_0080689_426_1346 | 303 |
| 603 | 3300046512 | Ga0495610_0019884 | Ga0495610_0019884_521_1567 | 303 |
| 604 | 3300046522 | Ga0495643_0009269 | Ga0495643_0009269_1870_2916 | 303 |
| 605 | 3300046694 | Ga0495649_0053272 | Ga0495649_0053272_862_1908 | 303 |
| 606 | 3300048091 | Ga0495626_0091177 | Ga0495626_0091177_13_933 | 303 |
| 607 | 3300048909 | Ga0496106_0000106 | Ga0496106_0000106_8450_9436 | 303 |
| 608 | 3300048909 | Ga0496106_0078865 | Ga0496106_0078865_965_1885 | 303 |
| 609 | 3300048913 | Ga0496110_0021717 | Ga0496110_0021717_2552_3481 | 303 |
| 610 | 3300048919 | Ga0496116_0022292 | Ga0496116_0022292_1959_2888 | 303 |
| 611 | 3300048919 | Ga0496116_0036053 | Ga0496116_0036053_445_1491 | 303 |
| 612 | 3300048920 | Ga0496117_0042063 | Ga0496117_0042063_668_1714 | 303 |
| 613 | 3300048921 | Ga0496118_0016317 | Ga0496118_0016317_2113_3159 | 303 |
| 614 | 3300048921 | Ga0496118_0091904 | Ga0496118_0091904_532_1461 | 303 |
| 615 | 3300048922 | Ga0496119_0012399 | Ga0496119_0012399_2558_3487 | 303 |
| 616 | 3300048922 | Ga0496119_0031096 | Ga0496119_0031096_2019_2969 | 303 |
| 617 | 3300048923 | Ga0496120_0002959 | Ga0496120_0002959_8389_9339 | 303 |
| 618 | 3300048924 | Ga0496121_0028161 | Ga0496121_0028161_3572_4540 | 303 |
| 619 | 3300048924 | Ga0496121_0033035 | Ga0496121_0033035_1973_3019 | 303 |
| 620 | 3300048924 | Ga0496121_0036220 | Ga0496121_0036220_1790_2710 | 303 |
| 621 | 3300048924 | Ga0496121_0107573 | Ga0496121_0107573_383_1312 | 303 |
| 622 | 3300048925 | Ga0496122_0018058 | Ga0496122_0018058_2327_3256 | 303 |
| 623 | 3300048925 | Ga0496122_0029057 | Ga0496122_0029057_2073_3119 | 303 |
| 624 | 3300048926 | Ga0496123_0022351 | Ga0496123_0022351_1993_2922 | 303 |
| 625 | 3300048926 | Ga0496123_0030152 | Ga0496123_0030152_1299_2345 | 303 |
| 626 | 3300048927 | Ga0496124_0056962 | Ga0496124_0056962_1197_2126 | 303 |
| 627 | 3300048928 | Ga0496125_0013718 | Ga0496125_0013718_5029_6075 | 303 |
| 628 | 3300048928 | Ga0496125_0023218 | Ga0496125_0023218_2032_2961 | 303 |
| 629 | 3300048929 | Ga0496126_0041314 | Ga0496126_0041314_133_1101 | 303 |
| 630 | 3300048929 | Ga0496126_0270789 | Ga0496126_0270789_168_1097 | 303 |
| 631 | 3300049569 | Ga0501032_0044104 | Ga0501032_0044104_1504_2436 | 303 |
| 632 | 3300049571 | Ga0501034_0430599 | Ga0501034_0430599_52_984 | 303 |
| 633 | 3300049580 | Ga0501046_0127832 | Ga0501046_0127832_414_1346 | 303 |
| 634 | 3300050492 | nmdc:mga0yw44_6595_c1 | nmdc:mga0yw44_6595_c1_4095_5015 | 303 |
| 635 | 3300050516 | nmdc:mga0sz30_19380_c1 | nmdc:mga0sz30_19380_c1_858_1811 | 303 |
| 636 | 3300053079 | Ga0500610_0061674 | Ga0500610_0061674_233_1153 | 303 |
| 637 | 3300053134 | Ga0500658_0066098 | Ga0500658_0066098_411_1343 | 303 |
| 638 | 3300053139 | Ga0500568_0002618 | Ga0500568_0002618_7889_8821 | 303 |
| 639 | 3300053151 | Ga0500604_0006906 | Ga0500604_0006906_908_1840 | 303 |
| 640 | 3300053156 | Ga0500622_0000237 | Ga0500622_0000237_2947_3993 | 303 |
| 641 | 3300053160 | Ga0500633_0003057 | Ga0500633_0003057_1576_2562 | 303 |
| 642 | 3300060353 | Ga0501082_0072958 | Ga0501082_0072958_1878_2810 | 303 |
| 643 | iso_pu_bacteria | 2582581304 | 2585257738 | 303 |
| 644 | iso_pu_bacteria | 2585427594 | 2585845264 | 303 |
| 645 | 3300039450 | Ga0436363_0747323 | Ga0436363_0747323_426_1373 | 304 |
| 646 | 3300039447 | Ga0436361_0575458 | Ga0436361_0575458_362_1327 | 305 |
| 647 | 3300045049 | Ga0466959_0062249 | Ga0466959_0062249_1518_2462 | 305 |
| 648 | 3300048929 | Ga0496126_0306556 | Ga0496126_0306556_231_1172 | 305 |
| 649 | iso_pu_bacteria | 2582581308 | 2585280381 | 305 |
| 650 | iso_pu_bacteria | 2582581315 | 2585322658 | 305 |
| 651 | iso_pu_bacteria | 2585427527 | 2585532611 | 305 |
| 652 | iso_pu_bacteria | 2585427530 | 2585554373 | 305 |
| 653 | iso_pu_bacteria | 2615840626 | 2616307319 | 305 |
| 654 | iso_pu_bacteria | 2818991453 | 2819639780 | 305 |
| 655 | iso_pu_bacteria | 8024486573 | 8024489285 | 305 |
| 656 | 3300003187 | JGI25151J46595_10000031 | JGI25151J46595_1000003194 | 306 |
| 657 | 3300003215 | JGI25153J46596_10008684 | JGI25153J46596_100086843 | 306 |
| 658 | 3300025245 | Ga0207425_1000058 | Ga0207425_1000058138 | 306 |
| 659 | 3300025258 | Ga0209129_1000107 | Ga0209129_1000107138 | 306 |
| 660 | 3300025273 | Ga0209673_1002998 | Ga0209673_100299812 | 306 |
| 661 | 3300025294 | Ga0209025_1000083 | Ga0209025_1000083138 | 306 |
| 662 | 3300025297 | Ga0209758_1000090 | Ga0209758_1000090125 | 306 |
| 663 | 3300028794 | Ga0307515_10027093 | Ga0307515_100270938 | 306 |
| 664 | 3300046492 | Ga0495585_0016700 | Ga0495585_0016700_3002_3934 | 306 |
| 665 | 3300046507 | Ga0495606_0004192 | Ga0495606_0004192_7790_8716 | 306 |
| 666 | 3300046557 | Ga0495622_0070780 | Ga0495622_0070780_613_1545 | 306 |
| 667 | 3300046615 | Ga0495656_0078455 | Ga0495656_0078455_301_1233 | 306 |
| 668 | 3300046674 | Ga0495588_0125700 | Ga0495588_0125700_372_1304 | 306 |
| 669 | 3300047470 | Ga0495681_0008178 | Ga0495681_0008178_291_1229 | 306 |
| 670 | 3300047470 | Ga0495681_0014765 | Ga0495681_0014765_2843_3787 | 306 |
| 671 | 3300047472 | Ga0495686_0000685 | Ga0495686_0000685_6509_7432 | 306 |
| 672 | 3300047472 | Ga0495686_0013797 | Ga0495686_0013797_4487_5437 | 306 |
| 673 | 3300048919 | Ga0496116_0001128 | Ga0496116_0001128_28035_28973 | 306 |
| 674 | 3300048919 | Ga0496116_0006341 | Ga0496116_0006341_7048_7986 | 306 |
| 675 | 3300048920 | Ga0496117_0009481 | Ga0496117_0009481_6934_7872 | 306 |
| 676 | 3300048921 | Ga0496118_0059136 | Ga0496118_0059136_364_1314 | 306 |
| 677 | 3300048924 | Ga0496121_0010544 | Ga0496121_0010544_8970_9908 | 306 |
| 678 | 3300048924 | Ga0496121_0014862 | Ga0496121_0014862_6396_7322 | 306 |
| 679 | 3300048925 | Ga0496122_0007183 | Ga0496122_0007183_5154_6092 | 306 |
| 680 | 3300048926 | Ga0496123_0005151 | Ga0496123_0005151_5176_6114 | 306 |
| 681 | 3300048927 | Ga0496124_0003535 | Ga0496124_0003535_2929_3867 | 306 |
| 682 | 3300048928 | Ga0496125_0009740 | Ga0496125_0009740_1785_2723 | 306 |
| 683 | 3300053107 | Ga0500560_000510 | Ga0500560_000510_2041_2979 | 306 |
| 684 | 3300031911 | Ga0307412_10067639 | Ga0307412_100676393 | 307 |
| 685 | 3300046459 | Ga0495629_0092130 | Ga0495629_0092130_733_1656 | 307 |
| 686 | 3300046557 | Ga0495622_0035953 | Ga0495622_0035953_35_958 | 307 |
| 687 | 3300046675 | Ga0495657_0042631 | Ga0495657_0042631_1592_2515 | 307 |
| 688 | 3300047321 | Ga0495676_0070218 | Ga0495676_0070218_988_1911 | 307 |
| 689 | 3300048919 | Ga0496116_0073111 | Ga0496116_0073111_1177_2118 | 307 |
| 690 | 3300048924 | Ga0496121_0034768 | Ga0496121_0034768_344_1285 | 307 |
| 691 | 3300048925 | Ga0496122_0075034 | Ga0496122_0075034_1236_2177 | 307 |
| 692 | 3300048926 | Ga0496123_0125665 | Ga0496123_0125665_474_1415 | 307 |
| 693 | 3300048927 | Ga0496124_0084150 | Ga0496124_0084150_463_1404 | 307 |
| 694 | 3300048927 | Ga0496124_0111043 | Ga0496124_0111043_1198_2139 | 307 |
| 695 | 3300053121 | Ga0500607_060903 | Ga0500607_060903_162_1085 | 307 |
| 696 | 3300053148 | Ga0500590_000103 | Ga0500590_000103_3192_4115 | 307 |
| 697 | iso_pu_bacteria | 2582581299 | 2585227727 | 307 |
| 698 | 3300003322 | rootL2_10226176 | rootL2_102261761 | 308 |
| 699 | 3300003214 | JGI25165J46597_1008042 | JGI25165J46597_10080422 | 309 |
| 700 | 3300005548 | Ga0070665_100259226 | Ga0070665_1002592261 | 309 |
| 701 | 3300005563 | Ga0068855_100179404 | Ga0068855_1001794042 | 309 |
| 702 | 3300009093 | Ga0105240_10000019 | Ga0105240_10000019262 | 309 |
| 703 | 3300009148 | Ga0105243_10052786 | Ga0105243_100527861 | 309 |
| 704 | 3300009545 | Ga0105237_10014402 | Ga0105237_100144022 | 309 |
| 705 | 3300013104 | Ga0157370_10008723 | Ga0157370_1000872312 | 309 |
| 706 | 3300013105 | Ga0157369_10173794 | Ga0157369_101737942 | 309 |
| 707 | 3300015262 | Ga0182007_10003955 | Ga0182007_100039556 | 309 |
| 708 | 3300025253 | Ga0209677_102053 | Ga0209677_1020539 | 309 |
| 709 | 3300025261 | Ga0209233_1000194 | Ga0209233_100019499 | 309 |
| 710 | 3300025913 | Ga0207695_10000049 | Ga0207695_10000049264 | 309 |
| 711 | 3300025914 | Ga0207671_10000591 | Ga0207671_1000059118 | 309 |
| 712 | 3300025949 | Ga0207667_10154770 | Ga0207667_101547702 | 309 |
| 713 | 3300028379 | Ga0268266_10024552 | Ga0268266_100245528 | 309 |
| 714 | 3300031456 | Ga0307513_10235046 | Ga0307513_102350462 | 309 |
| 715 | 3300046506 | Ga0495583_0071333 | Ga0495583_0071333_416_1351 | 309 |
| 716 | 3300046513 | Ga0495616_0017890 | Ga0495616_0017890_2209_3144 | 309 |
| 717 | 3300046518 | Ga0495631_0000815 | Ga0495631_0000815_2805_3740 | 309 |
| 718 | 3300046519 | Ga0495632_0025506 | Ga0495632_0025506_289_1224 | 309 |
| 719 | 3300046616 | Ga0495668_0005275 | Ga0495668_0005275_4945_5880 | 309 |
| 720 | 3300046660 | Ga0495625_0057398 | Ga0495625_0057398_1391_2326 | 309 |
| 721 | 3300047320 | Ga0495672_0004852 | Ga0495672_0004852_4528_5490 | 309 |
| 722 | 3300048905 | Ga0496102_0012405 | Ga0496102_0012405_1930_2883 | 309 |
| 723 | 3300048906 | Ga0496103_0020699 | Ga0496103_0020699_1634_2587 | 309 |
| 724 | 3300048920 | Ga0496117_0001714 | Ga0496117_0001714_27421_28374 | 309 |
| 725 | 3300048921 | Ga0496118_0000991 | Ga0496118_0000991_27422_28375 | 309 |
| 726 | 3300048922 | Ga0496119_0019736 | Ga0496119_0019736_3482_4435 | 309 |
| 727 | 3300048923 | Ga0496120_0006425 | Ga0496120_0006425_493_1446 | 309 |
| 728 | 3300048924 | Ga0496121_0003374 | Ga0496121_0003374_2351_3304 | 309 |
| 729 | 3300048925 | Ga0496122_0018232 | Ga0496122_0018232_4485_5438 | 309 |
| 730 | 3300048926 | Ga0496123_0010370 | Ga0496123_0010370_2812_3765 | 309 |
| 731 | 3300048928 | Ga0496125_0015447 | Ga0496125_0015447_4481_5434 | 309 |
| 732 | 3300049459 | Ga0495678_006144 | Ga0495678_006144_4090_5025 | 309 |
| 733 | 3300053079 | Ga0500610_0002770 | Ga0500610_0002770_4619_5554 | 309 |
| 734 | 3300053108 | Ga0500562_025884 | Ga0500562_025884_251_1213 | 309 |
| 735 | 3300053109 | Ga0500569_001114 | Ga0500569_001114_3959_4894 | 309 |
| 736 | 3300053139 | Ga0500568_0000185 | Ga0500568_0000185_41736_42698 | 309 |
| 737 | 3300053153 | Ga0500616_0000526 | Ga0500616_0000526_30030_30992 | 309 |
| 738 | 3300053727 | Ga0500611_005194 | Ga0500611_005194_550_1512 | 309 |
| 739 | iso_pu_bacteria | 2510917022 | 2511136636 | 309 |
| 740 | iso_pu_bacteria | 2524023209 | 2524460148 | 309 |
| 741 | iso_pu_bacteria | 2582581307 | 2585274208 | 309 |
| 742 | iso_pu_bacteria | 2582581316 | 2585330772 | 309 |
| 743 | iso_pu_bacteria | 2585427531 | 2585560657 | 309 |
| 744 | iso_pu_bacteria | 2585427608 | 2585898865 | 309 |
| 745 | iso_pu_bacteria | 2585427609 | 2585903545 | 309 |
| 746 | iso_pu_bacteria | 2585428125 | 2587981336 | 309 |
| 747 | iso_pu_bacteria | 2615840698 | 2616554863 | 309 |
| 748 | iso_pu_bacteria | 2617270742 | 2617383532 | 309 |
| 749 | iso_pu_bacteria | 2667528174 | 2671112113 | 309 |
| 750 | iso_pu_bacteria | 2775507266 | 2778175928 | 309 |
| 751 | iso_pu_bacteria | 2818991448 | 2819609680 | 309 |
| 752 | iso_pu_bacteria | 2838029111 | 2838033054 | 309 |
| 753 | iso_pu_bacteria | 2842298080 | 2842298626 | 309 |
| 754 | iso_pu_bacteria | 2842357229 | 2842359507 | 309 |
| 755 | iso_pu_bacteria | 2842475841 | 2842479787 | 309 |
| 756 | iso_pu_bacteria | 2842482326 | 2842483473 | 309 |
| 757 | iso_pu_bacteria | 2842502639 | 2842506963 | 309 |
| 758 | iso_pu_bacteria | 2842509118 | 2842510654 | 309 |
| 759 | iso_pu_bacteria | 2852387548 | 2852391119 | 309 |
| 760 | iso_pu_bacteria | 2919408235 | 2919410598 | 309 |
| 761 | iso_pu_bacteria | 3005416602 | 3005418564 | 309 |
| 762 | iso_pu_bacteria | 8005314921 | 8005318544 | 309 |
| 763 | iso_pu_bacteria | 8005484373 | 8005488574 | 309 |
| 764 | iso_pu_bacteria | 8005645114 | 8005649041 | 309 |
| 765 | iso_pu_bacteria | 8005682033 | 8005682280 | 309 |
| 766 | iso_pu_bacteria | 8046767195 | 8046773298 | 309 |
| 767 | iso_pu_bacteria | 8057575449 | 8057580969 | 309 |
| 768 | 3300005366 | Ga0070659_100003983 | Ga0070659_1000039839 | 312 |
| 769 | 3300005458 | Ga0070681_10021500 | Ga0070681_100215004 | 312 |
| 770 | 3300005530 | Ga0070679_100148422 | Ga0070679_1001484222 | 312 |
| 771 | 3300025912 | Ga0207707_10288164 | Ga0207707_102881642 | 312 |
| 772 | 3300025921 | Ga0207652_10117883 | Ga0207652_101178832 | 312 |
| 773 | 3300025932 | Ga0207690_10006097 | Ga0207690_100060972 | 312 |
| 774 | 3300001979 | JGI24740J21852_10012667 | JGI24740J21852_100126673 | 313 |
| 775 | 3300002704 | JGI25155J39150_1000007 | JGI25155J39150_100000782 | 313 |
| 776 | 3300002705 | JGI25156J39149_1000066 | JGI25156J39149_100006683 | 313 |
| 777 | 3300002737 | JGI25162J39368_1000875 | JGI25162J39368_100087514 | 313 |
| 778 | 3300002738 | JGI25154J39366_1000169 | JGI25154J39366_10001694 | 313 |
| 779 | 3300002741 | JGI25157J39369_1000197 | JGI25157J39369_10001976 | 313 |
| 780 | 3300003214 | JGI25165J46597_1000402 | JGI25165J46597_100040223 | 313 |
| 781 | 3300003214 | JGI25165J46597_1000734 | JGI25165J46597_10007344 | 313 |
| 782 | 3300003320 | rootH2_10039535 | rootH2_100395353 | 313 |
| 783 | 3300003354 | JGI25160J50197_1000114 | JGI25160J50197_100011418 | 313 |
| 784 | 3300003374 | JGI25161J50226_1000089 | JGI25161J50226_100008965 | 313 |
| 785 | 3300004625 | Ga0055543_1000002 | Ga0055543_1000002395 | 313 |
| 786 | 3300005262 | Ga0065165_1001020 | Ga0065165_100102022 | 313 |
| 787 | 3300005614 | Ga0068856_100009870 | Ga0068856_10000987010 | 313 |
| 788 | 3300006353 | Ga0075370_10023223 | Ga0075370_100232235 | 313 |
| 789 | 3300025206 | Ga0209435_100005 | Ga0209435_100005233 | 313 |
| 790 | 3300025228 | Ga0209672_103804 | Ga0209672_1038045 | 313 |
| 791 | 3300025233 | Ga0209437_100058 | Ga0209437_100058339 | 313 |
| 792 | 3300025233 | Ga0209437_100078 | Ga0209437_100078258 | 313 |
| 793 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011233 | 313 |
| 794 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008233 | 313 |
| 795 | 3300025254 | Ga0209148_1020332 | Ga0209148_10203322 | 313 |
| 796 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004233 | 313 |
| 797 | 3300025261 | Ga0209233_1000157 | Ga0209233_100015782 | 313 |
| 798 | 3300025261 | Ga0209233_1000192 | Ga0209233_1000192104 | 313 |
| 799 | 3300025284 | Ga0209130_1000083 | Ga0209130_1000083104 | 313 |
| 800 | 3300025302 | Ga0207426_1000173 | Ga0207426_1000173104 | 313 |
| 801 | 3300026078 | Ga0207702_10033500 | Ga0207702_100335001 | 313 |
| 802 | 3300027312 | Ga0209371_1005394 | Ga0209371_10053946 | 313 |
| 803 | 3300030500 | Ga0268256_1019197 | Ga0268256_10191972 | 313 |
| 804 | 3300044765 | Ga0466970_0004245 | Ga0466970_0004245_1596_2537 | 313 |
| 805 | 3300044842 | Ga0466957_0032121 | Ga0466957_0032121_51_992 | 313 |
| 806 | 3300045049 | Ga0466959_0054439 | Ga0466959_0054439_1829_2770 | 313 |
| 807 | 3300045976 | Ga0466967_0416201 | Ga0466967_0416201_47_988 | 313 |
| 808 | 3300047470 | Ga0495681_0067053 | Ga0495681_0067053_203_1144 | 313 |
| 809 | 3300048922 | Ga0496119_0024824 | Ga0496119_0024824_1526_2467 | 313 |
| 810 | 3300048923 | Ga0496120_0043832 | Ga0496120_0043832_1115_2056 | 313 |
| 811 | 3300048924 | Ga0496121_0079147 | Ga0496121_0079147_1448_2389 | 313 |
| 812 | 3300048925 | Ga0496122_0014363 | Ga0496122_0014363_1766_2707 | 313 |
| 813 | 3300048927 | Ga0496124_0015621 | Ga0496124_0015621_4006_4947 | 313 |
| 814 | 3300048928 | Ga0496125_0155438 | Ga0496125_0155438_121_1062 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5z4y-assembly1.cif.gz_B | crystal structure of pacysb ntd domain with space group p4 | 0.9041 | 5 | 87 |
| 4ihs-assembly1.cif.gz_A | crystal structure of benm_dbd/catb site 1 dna complex | 0.901 | 7 | 87 |
| 5xxp-assembly1.cif.gz_B | crystal structure of cbnr_dbd-dna complex | 0.8984 | 7 | 84 |
| 4ihs-assembly1.cif.gz_B | crystal structure of benm_dbd/catb site 1 dna complex | 0.8974 | 7 | 87 |
| 4ihs-assembly3.cif.gz_C | crystal structure of benm_dbd/catb site 1 dna complex | 0.8958 | 7 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33634_1_88_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9549 | 7 | 88 | 1.10.10.10 |
| 3fzvC01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9446 | 6 | 77 | 1.10.10.10 |
| af_P36771_5_92_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9433 | 1 | 86 | 1.10.10.10 |
| 4gwoA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9398 | 92 | 149 | 3.40.190.10 |
| af_Q2FZS7_1_83_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9392 | 7 | 88 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658JMP9-F1-model_v4 | deleted | 0.9288 | 7 | 84 |
|
| AF-U1BSD3-F1-model_v4 | deleted | 0.9142 | 7 | 202 |
|
| AF-A0A258CPL3-F1-model_v4 | LysR family transcriptional regulator | 0.9109 | 8 | 87 |
GO:0003700
GO:0006351 GO:0043565 |
| AF-U1BSD3-F1-model_v4 | deleted | 0.8966 | 7 | 202 |
|
| AF-A0A2G6K8T7-F1-model_v4 | LysR family transcriptional regulator | 0.8965 | 5 | 77 |
GO:0003700
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar