F481874

General Info

Members Datasets Scaffolds Average Seq Length
812 281 1624 132

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100029458|Ga0068859_1000294583
Length 152
Sequence VIADFADIYGTPMKNRPDPEDRMWSQAVELIAEAGRLHRQFFRLAAVESAPAWEPPIDVFEDEREIVVVVAMPGVAAERVQVLHEAGVLVVRGTRPLPFEGARGRLRQLEIPYGAFERRIALPPGSFEVGRPELAQGCLMLRLRKPPPSGRP

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
93 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
184 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
187 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
219 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
237 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.26
Metatranscriptomes 0.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.46
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 15.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100029458 3300005617 Bacteria 5508
2 Ga0007416J51690_1035555 3300003577 Bacteria 1448
3 Ga0065712_10078956 3300005290 Bacteria 3266
4 Ga0065715_10044724 3300005293 Bacteria 1431
5 Ga0070658_10004609 3300005327 Bacteria 11199
6 Ga0070658_10088525 3300005327 Bacteria 2549
7 Ga0070658_10115175 3300005327 Bacteria 2230
8 Ga0070658_10365648 3300005327 Unclassified 1236
9 Ga0070676_10005107 3300005328 Bacteria 6962
10 Ga0070676_10024865 3300005328 Bacteria 3379
11 Ga0070676_10053822 3300005328 Bacteria 2371
12 Ga0070676_10266950 3300005328 Bacteria 1148
13 Ga0070683_100009825 3300005329 Bacteria 8198
14 Ga0070683_100117852 3300005329 Bacteria 2507
15 Ga0070683_100123904 3300005329 Bacteria 2442
16 Ga0070683_100409358 3300005329 Unclassified 1294
17 Ga0070690_100032882 3300005330 Bacteria 3243
18 Ga0070690_100079965 3300005330 Bacteria 2137
19 Ga0070690_100255302 3300005330 Bacteria 1241
20 Ga0070690_100305141 3300005330 Bacteria 1142
21 Ga0070670_100064985 3300005331 Bacteria 3130
22 Ga0070670_100089391 3300005331 Bacteria 2647
23 Ga0070670_100140818 3300005331 Bacteria 2086
24 Ga0070670_100163319 3300005331 Bacteria 1931
25 Ga0070670_100272694 3300005331 Bacteria 1476
26 Ga0070670_100442933 3300005331 Unclassified 1150
27 Ga0070670_100508681 3300005331 Unclassified 1072
28 Ga0070670_100620502 3300005331 Bacteria 968
29 Ga0070677_10041819 3300005333 Bacteria 1811
30 Ga0070677_10050742 3300005333 Bacteria 1677
31 Ga0070677_10108525 3300005333 Bacteria 1236
32 Ga0070677_10236665 3300005333 Bacteria 899
33 Ga0068869_100007233 3300005334 Bacteria 7076
34 Ga0068869_100313441 3300005334 Unclassified 1270
35 Ga0068869_100591334 3300005334 Unclassified 936
36 Ga0068869_100703992 3300005334 Bacteria 862
37 Ga0070666_10053224 3300005335 Bacteria 2730
38 Ga0070666_10059032 3300005335 Bacteria 2594
39 Ga0070666_10132313 3300005335 Unclassified 1734
40 Ga0070680_100044639 3300005336 Bacteria 3601
41 Ga0070680_100256348 3300005336 Bacteria 1479
42 Ga0070680_100721796 3300005336 Bacteria 858
43 Ga0070680_101779895 3300005336 Unclassified 534
44 Ga0070682_100757596 3300005337 Bacteria 784
45 Ga0068868_100051746 3300005338 Bacteria 3232
46 Ga0068868_100241872 3300005338 Unclassified 1517
47 Ga0068868_100451649 3300005338 Unclassified 1118
48 Ga0068868_100532478 3300005338 Bacteria 1033
49 Ga0068868_100654701 3300005338 Bacteria 936
50 Ga0070660_100036853 3300005339 Bacteria 3706
51 Ga0070660_100199086 3300005339 Bacteria 1624
52 Ga0070660_100444270 3300005339 Unclassified 1075
53 Ga0070689_100024756 3300005340 Bacteria 4504
54 Ga0070689_100099189 3300005340 Bacteria 2304
55 Ga0070689_100852563 3300005340 Bacteria 804
56 Ga0070687_100006852 3300005343 Bacteria 4701
57 Ga0070687_100040827 3300005343 Bacteria 2340
58 Ga0070687_100113130 3300005343 Bacteria 1540
59 Ga0070687_100460410 3300005343 Bacteria 848
60 Ga0070661_100010574 3300005344 Bacteria 6418
61 Ga0070661_100019976 3300005344 Bacteria 4774
62 Ga0070661_100038944 3300005344 Bacteria 3462
63 Ga0070661_100142268 3300005344 Bacteria 1808
64 Ga0070661_100511733 3300005344 Bacteria 962
65 Ga0070661_100514413 3300005344 Unclassified 959
66 Ga0070661_100607637 3300005344 Bacteria 885
67 Ga0070692_10078484 3300005345 Bacteria 1773
68 Ga0070692_10320667 3300005345 Bacteria 953
69 Ga0070692_10481149 3300005345 Bacteria 801
70 Ga0070668_100094170 3300005347 Unclassified 2364
71 Ga0070668_100114455 3300005347 Bacteria 2149
72 Ga0070668_100649104 3300005347 Bacteria 927
73 Ga0070668_101174744 3300005347 Bacteria 695
74 Ga0070669_100020852 3300005353 Bacteria 4682
75 Ga0070669_100179729 3300005353 Bacteria 1654
76 Ga0070669_100501903 3300005353 Unclassified 1006
77 Ga0070675_100033777 3300005354 Bacteria 4148
78 Ga0070675_100140299 3300005354 Bacteria 2065
79 Ga0070671_100006714 3300005355 Bacteria 9208
80 Ga0070671_100008516 3300005355 Bacteria 8222
81 Ga0070671_100156793 3300005355 Unclassified 1923
82 Ga0070671_100184425 3300005355 Unclassified 1767
83 Ga0070671_100251168 3300005355 Bacteria 1502
84 Ga0070671_100540369 3300005355 Bacteria 1004
85 Ga0070671_100640669 3300005355 Bacteria 920
86 Ga0070671_101644650 3300005355 Unclassified 569
87 Ga0070674_100042551 3300005356 Bacteria 3086
88 Ga0070674_100097073 3300005356 Unclassified 2139
89 Ga0070674_100352740 3300005356 Bacteria 1189
90 Ga0070674_100650580 3300005356 Unclassified 896
91 Ga0070673_100047152 3300005364 Bacteria 3351
92 Ga0070673_100145840 3300005364 Bacteria 2001
93 Ga0070673_100165881 3300005364 Bacteria 1882
94 Ga0070673_100209037 3300005364 Unclassified 1684
95 Ga0070673_101311390 3300005364 Bacteria 680
96 Ga0070688_100017658 3300005365 Bacteria 4098
97 Ga0070688_100043248 3300005365 Bacteria 2774
98 Ga0070688_100698093 3300005365 Bacteria 786
99 Ga0070688_101020681 3300005365 Unclassified 658
100 Ga0070659_100003789 3300005366 Bacteria 10789
101 Ga0070659_100017005 3300005366 Bacteria 5467
102 Ga0070659_100167873 3300005366 Bacteria 1796
103 Ga0070659_100378347 3300005366 Bacteria 1192
104 Ga0070667_100056032 3300005367 Bacteria 3329
105 Ga0070667_100065112 3300005367 Bacteria 3094
106 Ga0070667_100307825 3300005367 Bacteria 1427
107 Ga0070667_100569959 3300005367 Bacteria 1042
108 Ga0070667_100989678 3300005367 Bacteria 784
109 Ga0070709_10482191 3300005434 Bacteria 939
110 Ga0070714_100004746 3300005435 Bacteria 10289
111 Ga0070714_100035013 3300005435 Bacteria 4206
112 Ga0070714_100561938 3300005435 Bacteria 1093
113 Ga0070713_100000062 3300005436 Bacteria 68367
114 Ga0070713_100767708 3300005436 Bacteria 923
115 Ga0070710_10577954 3300005437 Bacteria 779
116 Ga0070701_10192137 3300005438 Bacteria 1202
117 Ga0070701_10382293 3300005438 Bacteria 887
118 Ga0070700_100085329 3300005441 Bacteria 2048
119 Ga0070700_100267298 3300005441 Unclassified 1234
120 Ga0070694_100947272 3300005444 Bacteria 713
121 Ga0070663_100002512 3300005455 Bacteria 10349
122 Ga0070663_100055783 3300005455 Bacteria 2829
123 Ga0070663_100075167 3300005455 Bacteria 2468
124 Ga0070663_100084504 3300005455 Bacteria 2340
125 Ga0070663_101047024 3300005455 Bacteria 711
126 Ga0070663_101264906 3300005455 Bacteria 650
127 Ga0070678_100050238 3300005456 Bacteria 3015
128 Ga0070678_100055967 3300005456 Bacteria 2882
129 Ga0070678_100072590 3300005456 Bacteria 2580
130 Ga0070678_100169740 3300005456 Bacteria 1776
131 Ga0070678_100208299 3300005456 Bacteria 1618
132 Ga0070662_100034304 3300005457 Bacteria 3577
133 Ga0070662_100049061 3300005457 Bacteria 3044
134 Ga0070662_100053215 3300005457 Bacteria 2929
135 Ga0070662_100133710 3300005457 Bacteria 1916
136 Ga0070662_100246285 3300005457 Bacteria 1435
137 Ga0070662_100615246 3300005457 Bacteria 914
138 Ga0070662_101348873 3300005457 Bacteria 614
139 Ga0070681_10079908 3300005458 Bacteria 3226
140 Ga0070681_10134636 3300005458 Bacteria 2402
141 Ga0070681_10192257 3300005458 Bacteria 1960
142 Ga0070681_10196101 3300005458 Bacteria 1938
143 Ga0070681_10213109 3300005458 Bacteria 1848
144 Ga0068867_100018985 3300005459 Bacteria 4894
145 Ga0068867_100037735 3300005459 Bacteria 3513
146 Ga0068867_100458235 3300005459 Bacteria 1088
147 Ga0068867_100879437 3300005459 Unclassified 805
148 Ga0070685_10073454 3300005466 Bacteria 2033
149 Ga0070685_10344571 3300005466 Bacteria 1017
150 Ga0070685_10398477 3300005466 Bacteria 953
151 Ga0070699_100856744 3300005518 Bacteria 832
152 Ga0070679_100049148 3300005530 Bacteria 4201
153 Ga0070679_100053635 3300005530 Bacteria 4013
154 Ga0070679_100133412 3300005530 Bacteria 2464
155 Ga0070679_100179875 3300005530 Bacteria 2087
156 Ga0070679_100310678 3300005530 Bacteria 1526
157 Ga0070679_100441095 3300005530 Unclassified 1247
158 Ga0070684_100024188 3300005535 Bacteria 5092
159 Ga0070684_100032031 3300005535 Bacteria 4478
160 Ga0070684_100384911 3300005535 Bacteria 1292
161 Ga0068853_100207626 3300005539 Bacteria 1784
162 Ga0068853_100249262 3300005539 Bacteria 1629
163 Ga0068853_100298143 3300005539 Bacteria 1489
164 Ga0068853_100308008 3300005539 Bacteria 1465
165 Ga0070672_100080211 3300005543 Bacteria 2614
166 Ga0070672_100119660 3300005543 Bacteria 2154
167 Ga0070672_100157913 3300005543 Bacteria 1879
168 Ga0070672_100235671 3300005543 Bacteria 1538
169 Ga0070672_100248575 3300005543 Unclassified 1497
170 Ga0070672_100339340 3300005543 Unclassified 1279
171 Ga0070672_100374177 3300005543 Unclassified 1217
172 Ga0070686_100030290 3300005544 Bacteria 3299
173 Ga0070686_100107651 3300005544 Bacteria 1894
174 Ga0070686_100228369 3300005544 Bacteria 1349
175 Ga0070686_100411269 3300005544 Bacteria 1031
176 Ga0070695_101263497 3300005545 Bacteria 609
177 Ga0070696_100641134 3300005546 Bacteria 860
178 Ga0070693_100063904 3300005547 Bacteria 2147
179 Ga0070693_100075711 3300005547 Bacteria 1994
180 Ga0070693_100106074 3300005547 Bacteria 1720
181 Ga0070693_100659768 3300005547 Unclassified 762
182 Ga0070665_100109657 3300005548 Bacteria 2762
183 Ga0070665_100339512 3300005548 Bacteria 1507
184 Ga0070665_101652500 3300005548 Bacteria 648
185 Ga0070704_100187175 3300005549 Bacteria 1661
186 Ga0068855_100011490 3300005563 Bacteria 10700
187 Ga0068855_100077784 3300005563 Bacteria 3849
188 Ga0068855_100078854 3300005563 Bacteria 3820
189 Ga0068855_100356818 3300005563 Bacteria 1609
190 Ga0068855_100824311 3300005563 Bacteria 985
191 Ga0070664_100048360 3300005564 Bacteria 3594
192 Ga0070664_100066225 3300005564 Bacteria 3084
193 Ga0070664_100091941 3300005564 Bacteria 2627
194 Ga0070664_100113236 3300005564 Bacteria 2369
195 Ga0070664_100151510 3300005564 Bacteria 2047
196 Ga0070664_100170710 3300005564 Bacteria 1929
197 Ga0070664_100190605 3300005564 Bacteria 1826
198 Ga0070664_100299319 3300005564 Bacteria 1453
199 Ga0070664_101226601 3300005564 Unclassified 708
200 Ga0068857_100124812 3300005577 Bacteria 2319
201 Ga0068857_100140622 3300005577 Bacteria 2182
202 Ga0068857_100260832 3300005577 Bacteria 1590
203 Ga0068857_101252397 3300005577 Bacteria 719
204 Ga0068857_101962563 3300005577 Bacteria 574
205 Ga0068854_100005022 3300005578 Bacteria 8340
206 Ga0068854_100121074 3300005578 Bacteria 1987
207 Ga0068854_100144174 3300005578 Bacteria 1831
208 Ga0068854_100366662 3300005578 Bacteria 1183
209 Ga0068854_100956309 3300005578 Bacteria 756
210 Ga0068856_100003779 3300005614 Bacteria 15167
211 Ga0068856_100074561 3300005614 Bacteria 3360
212 Ga0068856_100135357 3300005614 Bacteria 2469
213 Ga0068856_100689700 3300005614 Bacteria 1042
214 Ga0070702_100019349 3300005615 Bacteria 3549
215 Ga0070702_100956906 3300005615 Bacteria 675
216 Ga0068852_100048725 3300005616 Bacteria 3621
217 Ga0068852_100061448 3300005616 Bacteria 3265
218 Ga0068852_100090421 3300005616 Bacteria 2738
219 Ga0068852_100117213 3300005616 Bacteria 2431
220 Ga0068852_100452988 3300005616 Unclassified 1271
221 Ga0068852_100626477 3300005616 Bacteria 1082
222 Ga0068852_100701489 3300005616 Bacteria 1022
223 Ga0068852_100794601 3300005616 Bacteria 960
224 Ga0068859_100102118 3300005617 Bacteria 2925
225 Ga0068859_100154364 3300005617 Bacteria 2372
226 Ga0068859_101737250 3300005617 Bacteria 689
227 Ga0068859_102267801 3300005617 Bacteria 599
228 Ga0068859_102826812 3300005617 Bacteria 532
229 Ga0068864_100034582 3300005618 Bacteria 4299
230 Ga0068864_100073663 3300005618 Bacteria 2977
231 Ga0068864_100229406 3300005618 Unclassified 1717
232 Ga0068864_100241240 3300005618 Bacteria 1675
233 Ga0068864_100356834 3300005618 Bacteria 1381
234 Ga0068866_10446561 3300005718 Unclassified 845
235 Ga0068866_10888332 3300005718 Bacteria 626
236 Ga0068861_100008162 3300005719 Bacteria 7204
237 Ga0068861_100100768 3300005719 Bacteria 2296
238 Ga0068861_100288275 3300005719 Bacteria 1416
239 Ga0068861_100658358 3300005719 Bacteria 968
240 Ga0068851_10003502 3300005834 Bacteria 6987
241 Ga0068851_10004631 3300005834 Bacteria 6209
242 Ga0068870_10011393 3300005840 Bacteria 4122
243 Ga0068870_10022931 3300005840 Bacteria 3072
244 Ga0068870_10108540 3300005840 Unclassified 1580
245 Ga0068863_100093205 3300005841 Bacteria 2858
246 Ga0068863_100116575 3300005841 Unclassified 2545
247 Ga0068863_100177142 3300005841 Bacteria 2047
248 Ga0068863_101816697 3300005841 Bacteria 619
249 Ga0068858_100002040 3300005842 Bacteria 20578
250 Ga0068858_100019635 3300005842 Bacteria 6318
251 Ga0068858_100049555 3300005842 Bacteria 3889
252 Ga0068858_100074620 3300005842 Bacteria 3149
253 Ga0068860_100000216 3300005843 Bacteria 90423
254 Ga0068860_100019508 3300005843 Bacteria 6573
255 Ga0068860_100096355 3300005843 Bacteria 2820
256 Ga0068860_100250290 3300005843 Bacteria 1725
257 Ga0068862_100214471 3300005844 Bacteria 1740
258 Ga0068862_100521330 3300005844 Bacteria 1131
259 Ga0068862_100626237 3300005844 Unclassified 1035
260 Ga0068862_100758652 3300005844 Bacteria 944
261 Ga0081539_10348116 3300005985 Bacteria 623
262 Ga0070717_10354168 3300006028 Unclassified 1313
263 Ga0070717_10365750 3300006028 Bacteria 1292
264 Ga0075432_10123063 3300006058 Bacteria 976
265 Ga0070715_10213813 3300006163 Bacteria 987
266 Ga0070712_100159397 3300006175 Bacteria 1741
267 Ga0097621_100022168 3300006237 Bacteria 4926
268 Ga0097621_100062757 3300006237 Bacteria 3051
269 Ga0097621_100064697 3300006237 Bacteria 3008
270 Ga0097621_100302327 3300006237 Bacteria 1413
271 Ga0097621_101336291 3300006237 Bacteria 678
272 Ga0097621_101378667 3300006237 Bacteria 667
273 Ga0068871_100075352 3300006358 Bacteria 2785
274 Ga0068871_100112817 3300006358 Bacteria 2288
275 Ga0068871_100194422 3300006358 Bacteria 1749
276 Ga0075429_100672632 3300006880 Bacteria 907
277 Ga0068865_100041278 3300006881 Bacteria 3138
278 Ga0068865_100107113 3300006881 Bacteria 2055
279 Ga0068865_100177122 3300006881 Bacteria 1639
280 Ga0068865_100343817 3300006881 Bacteria 1206
281 Ga0068865_100377346 3300006881 Bacteria 1155
282 Ga0097620_100029458 3300006931 Bacteria 5508
283 Ga0097620_100102116 3300006931 Bacteria 2925
284 Ga0097620_100154357 3300006931 Bacteria 2372
285 Ga0097620_101737558 3300006931 Bacteria 689
286 Ga0097620_102267280 3300006931 Bacteria 599
287 Ga0097620_102826821 3300006931 Bacteria 532
288 Ga0105240_10045954 3300009093 Bacteria 5536
289 Ga0105240_10615151 3300009093 Bacteria 1195
290 Ga0111539_10225089 3300009094 Bacteria 2185
291 Ga0111539_10580957 3300009094 Bacteria 1305
292 Ga0111539_10591750 3300009094 Unclassified 1292
293 Ga0111539_12250262 3300009094 Unclassified 632
294 Ga0105245_10023776 3300009098 Bacteria 5379
295 Ga0105245_10053943 3300009098 Bacteria 3610
296 Ga0105245_10153927 3300009098 Bacteria 2176
297 Ga0105245_10487365 3300009098 Bacteria 1247
298 Ga0105245_11562490 3300009098 Unclassified 711
299 Ga0105245_12752158 3300009098 Bacteria 545
300 Ga0105247_10270176 3300009101 Unclassified 1169
301 Ga0105243_10088349 3300009148 Bacteria 2546
302 Ga0105243_10173229 3300009148 Unclassified 1871
303 Ga0105243_12600830 3300009148 Unclassified 546
304 Ga0105241_10005400 3300009174 Bacteria 9448
305 Ga0105241_10317898 3300009174 Bacteria 1341
306 Ga0105242_10037426 3300009176 Bacteria 3897
307 Ga0105242_10046377 3300009176 Bacteria 3526
308 Ga0105242_10071415 3300009176 Bacteria 2881
309 Ga0105242_10331316 3300009176 Unclassified 1400
310 Ga0105242_10475656 3300009176 Unclassified 1183
311 Ga0105242_10797870 3300009176 Bacteria 934
312 Ga0105242_10969255 3300009176 Bacteria 856
313 Ga0105248_10047973 3300009177 Bacteria 4790
314 Ga0105248_10061680 3300009177 Bacteria 4211
315 Ga0105248_10088139 3300009177 Bacteria 3493
316 Ga0105248_10111540 3300009177 Bacteria 3085
317 Ga0105248_10124629 3300009177 Bacteria 2906
318 Ga0105248_10195909 3300009177 Bacteria 2276
319 Ga0105248_10850203 3300009177 Unclassified 1030
320 Ga0105248_11605550 3300009177 Bacteria 737
321 Ga0105237_10164166 3300009545 Bacteria 2220
322 Ga0105237_10834172 3300009545 Bacteria 928
323 Ga0105238_10010886 3300009551 Bacteria 9141
324 Ga0105238_10083316 3300009551 Bacteria 3187
325 Ga0105238_10220455 3300009551 Bacteria 1873
326 Ga0105238_12306688 3300009551 Unclassified 573
327 Ga0105249_10032195 3300009553 Bacteria 4743
328 Ga0105249_10046248 3300009553 Bacteria 3961
329 Ga0105249_10365389 3300009553 Bacteria 1465
330 Ga0105239_10121158 3300010375 Bacteria 2905
331 Ga0105239_10668135 3300010375 Bacteria 1187
332 Ga0157324_1033112 3300012506 Bacteria 596
333 Ga0157327_1012899 3300012512 Bacteria 831
334 Ga0157373_10014786 3300013100 Bacteria 5718
335 Ga0157373_10085486 3300013100 Bacteria 2223
336 Ga0157371_10157193 3300013102 Bacteria 1623
337 Ga0157371_10969914 3300013102 Unclassified 647
338 Ga0157370_10021596 3300013104 Bacteria 6414
339 Ga0157370_10029321 3300013104 Bacteria 5402
340 Ga0157370_10038546 3300013104 Bacteria 4622
341 Ga0157370_10051163 3300013104 Bacteria 3947
342 Ga0157370_10902057 3300013104 Bacteria 802
343 Ga0157370_11746167 3300013104 Bacteria 558
344 Ga0157369_10015766 3300013105 Bacteria 8516
345 Ga0157369_10270402 3300013105 Unclassified 1771
346 Ga0157369_10444255 3300013105 Bacteria 1343
347 Ga0157369_10636833 3300013105 Bacteria 1100
348 Ga0157369_11172072 3300013105 Bacteria 784
349 Ga0157369_12251450 3300013105 Bacteria 552
350 Ga0157374_10037705 3300013296 Bacteria 4439
351 Ga0157374_10074510 3300013296 Bacteria 3206
352 Ga0157374_10166065 3300013296 Bacteria 2151
353 Ga0157374_10628046 3300013296 Bacteria 1085
354 Ga0157374_10826755 3300013296 Bacteria 943
355 Ga0157374_11539479 3300013296 Unclassified 689
356 Ga0157378_10020838 3300013297 Bacteria 5765
357 Ga0157378_10065445 3300013297 Bacteria 3254
358 Ga0157378_10240052 3300013297 Bacteria 1731
359 Ga0157378_11154540 3300013297 Unclassified 813
360 Ga0163162_10046601 3300013306 Bacteria 4345
361 Ga0163162_10138239 3300013306 Bacteria 2547
362 Ga0163162_10296653 3300013306 Unclassified 1748
363 Ga0163162_10405105 3300013306 Bacteria 1497
364 Ga0163162_10947798 3300013306 Unclassified 972
365 Ga0163162_10983043 3300013306 Unclassified 954
366 Ga0163162_11080162 3300013306 Bacteria 909
367 Ga0163162_11122514 3300013306 Bacteria 891
368 Ga0157372_10012754 3300013307 Bacteria 8953
369 Ga0157372_10076532 3300013307 Bacteria 3778
370 Ga0157372_10116808 3300013307 Bacteria 3059
371 Ga0157372_10124966 3300013307 Bacteria 2958
372 Ga0157372_10175996 3300013307 Bacteria 2476
373 Ga0157372_10220005 3300013307 Bacteria 2201
374 Ga0157372_10222939 3300013307 Bacteria 2186
375 Ga0157372_10333054 3300013307 Bacteria 1768
376 Ga0157372_10876176 3300013307 Bacteria 1042
377 Ga0157372_11708513 3300013307 Bacteria 724
378 Ga0157372_12476362 3300013307 Bacteria 596
379 Ga0157375_10017824 3300013308 Bacteria 6422
380 Ga0157375_10020056 3300013308 Bacteria 6099
381 Ga0157375_10064852 3300013308 Bacteria 3638
382 Ga0157375_10168212 3300013308 Bacteria 2338
383 Ga0157375_10185721 3300013308 Unclassified 2232
384 Ga0157375_10639565 3300013308 Unclassified 1221
385 Ga0157375_11847960 3300013308 Bacteria 717
386 Ga0163163_10411702 3300014325 Bacteria 1411
387 Ga0163163_10536433 3300014325 Unclassified 1232
388 Ga0163163_10555016 3300014325 Unclassified 1211
389 Ga0163163_11685681 3300014325 Bacteria 695
390 Ga0157380_10105337 3300014326 Unclassified 2357
391 Ga0157380_10118141 3300014326 Bacteria 2241
392 Ga0157380_11248041 3300014326 Unclassified 788
393 Ga0182008_10144196 3300014497 Bacteria 1193
394 Ga0182008_10379020 3300014497 Unclassified 756
395 Ga0182008_10523311 3300014497 Unclassified 655
396 Ga0157377_10035504 3300014745 Bacteria 2735
397 Ga0157377_10043403 3300014745 Bacteria 2502
398 Ga0157377_10206814 3300014745 Bacteria 1249
399 Ga0157377_10498124 3300014745 Bacteria 851
400 Ga0157377_10712305 3300014745 Bacteria 730
401 Ga0157379_10006049 3300014968 Bacteria 10425
402 Ga0157379_10124586 3300014968 Bacteria 2318
403 Ga0157379_10178377 3300014968 Bacteria 1919
404 Ga0157379_10603676 3300014968 Bacteria 1025
405 Ga0157379_10716963 3300014968 Bacteria 940
406 Ga0157376_10029741 3300014969 Bacteria 4354
407 Ga0157376_10225910 3300014969 Bacteria 1736
408 Ga0157376_10377394 3300014969 Bacteria 1365
409 Ga0157376_10426852 3300014969 Unclassified 1288
410 Ga0157376_10477114 3300014969 Bacteria 1221
411 Ga0163161_10059418 3300017792 Unclassified 2780
412 Ga0163161_10154875 3300017792 Bacteria 1744
413 Ga0163161_11276036 3300017792 Unclassified 638
414 Ga0197907_10261353 3300020069 Bacteria 1668
415 Ga0206356_11498925 3300020070 Bacteria 4932
416 Ga0206354_10985770 3300020081 Bacteria 920
417 Ga0206353_11201498 3300020082 Bacteria 1867
418 Ga0224712_10010480 3300022467 Bacteria 2838
419 Ga0207673_1025064 3300025290 Bacteria 815
420 Ga0207697_10000097 3300025315 Bacteria 39643
421 Ga0207697_10004415 3300025315 Bacteria 6725
422 Ga0207697_10064155 3300025315 Bacteria 1532
423 Ga0207656_10034062 3300025321 Bacteria 2124
424 Ga0207656_10050282 3300025321 Bacteria 1799
425 Ga0207682_10002851 3300025893 Bacteria 7626
426 Ga0207682_10004577 3300025893 Bacteria 5763
427 Ga0207682_10022305 3300025893 Bacteria 2494
428 Ga0207682_10051209 3300025893 Bacteria 1710
429 Ga0207642_10033111 3300025899 Bacteria 2183
430 Ga0207642_10046940 3300025899 Unclassified 1928
431 Ga0207688_10019430 3300025901 Bacteria 3702
432 Ga0207688_10020270 3300025901 Bacteria 3630
433 Ga0207688_10075260 3300025901 Bacteria 1921
434 Ga0207688_10078326 3300025901 Unclassified 1884
435 Ga0207680_10047095 3300025903 Bacteria 2553
436 Ga0207680_10070497 3300025903 Bacteria 2164
437 Ga0207680_10077844 3300025903 Bacteria 2075
438 Ga0207680_10245431 3300025903 Bacteria 1235
439 Ga0207680_10362915 3300025903 Bacteria 1019
440 Ga0207647_10042499 3300025904 Bacteria 2852
441 Ga0207685_10045682 3300025905 Bacteria 1662
442 Ga0207685_10109458 3300025905 Bacteria 1195
443 Ga0207699_10362627 3300025906 Bacteria 1025
444 Ga0207645_10001136 3300025907 Bacteria 22026
445 Ga0207645_10007824 3300025907 Bacteria 7516
446 Ga0207645_10049338 3300025907 Bacteria 2688
447 Ga0207643_10000178 3300025908 Bacteria 43423
448 Ga0207643_10035310 3300025908 Bacteria 2803
449 Ga0207643_10089527 3300025908 Bacteria 1792
450 Ga0207705_10052009 3300025909 Bacteria 2948
451 Ga0207705_10077019 3300025909 Bacteria 2425
452 Ga0207654_10052705 3300025911 Bacteria 2346
453 Ga0207654_10077983 3300025911 Bacteria 1987
454 Ga0207654_10191950 3300025911 Bacteria 1339
455 Ga0207654_10313140 3300025911 Bacteria 1071
456 Ga0207707_10004039 3300025912 Bacteria 13008
457 Ga0207707_10021594 3300025912 Bacteria 5625
458 Ga0207707_10089355 3300025912 Bacteria 2692
459 Ga0207707_10124509 3300025912 Bacteria 2254
460 Ga0207707_10454405 3300025912 Bacteria 1096
461 Ga0207707_10752091 3300025912 Bacteria 815
462 Ga0207695_10049772 3300025913 Bacteria 4414
463 Ga0207695_10570871 3300025913 Unclassified 1013
464 Ga0207693_10138372 3300025915 Bacteria 1915
465 Ga0207693_10374134 3300025915 Bacteria 1114
466 Ga0207660_10034325 3300025917 Bacteria 3515
467 Ga0207660_10392755 3300025917 Unclassified 1116
468 Ga0207660_10433022 3300025917 Bacteria 1062
469 Ga0207660_10588911 3300025917 Unclassified 906
470 Ga0207660_11689725 3300025917 Unclassified 509
471 Ga0207662_10005166 3300025918 Bacteria 6926
472 Ga0207662_10031336 3300025918 Bacteria 3089
473 Ga0207662_10061628 3300025918 Bacteria 2253
474 Ga0207662_10479591 3300025918 Bacteria 854
475 Ga0207657_10005487 3300025919 Bacteria 13246
476 Ga0207657_10042979 3300025919 Bacteria 3984
477 Ga0207657_10258490 3300025919 Bacteria 1386
478 Ga0207649_10020776 3300025920 Bacteria 3770
479 Ga0207649_10088910 3300025920 Bacteria 2018
480 Ga0207649_10130357 3300025920 Bacteria 1707
481 Ga0207649_10172864 3300025920 Unclassified 1506
482 Ga0207649_10197660 3300025920 Bacteria 1418
483 Ga0207649_10308250 3300025920 Bacteria 1159
484 Ga0207652_10006535 3300025921 Bacteria 9394
485 Ga0207652_10011804 3300025921 Bacteria 7050
486 Ga0207652_10072463 3300025921 Bacteria 2996
487 Ga0207652_10237153 3300025921 Bacteria 1644
488 Ga0207652_10264943 3300025921 Bacteria 1550
489 Ga0207652_10362840 3300025921 Bacteria 1307
490 Ga0207652_11402200 3300025921 Bacteria 602
491 Ga0207681_10000413 3300025923 Bacteria 29801
492 Ga0207681_10199405 3300025923 Bacteria 1536
493 Ga0207694_10043983 3300025924 Bacteria 3448
494 Ga0207694_10127916 3300025924 Bacteria 2034
495 Ga0207650_10005398 3300025925 Bacteria 8722
496 Ga0207650_10042882 3300025925 Bacteria 3319
497 Ga0207650_10186502 3300025925 Bacteria 1655
498 Ga0207650_10396398 3300025925 Unclassified 1142
499 Ga0207659_10016488 3300025926 Bacteria 4809
500 Ga0207659_10081090 3300025926 Bacteria 2398
501 Ga0207659_10081137 3300025926 Bacteria 2397
502 Ga0207659_10102620 3300025926 Bacteria 2159
503 Ga0207659_10519232 3300025926 Bacteria 1010
504 Ga0207687_10085955 3300025927 Bacteria 2283
505 Ga0207687_10089279 3300025927 Unclassified 2244
506 Ga0207687_10124177 3300025927 Bacteria 1935
507 Ga0207687_10793072 3300025927 Bacteria 808
508 Ga0207700_10000143 3300025928 Bacteria 42682
509 Ga0207700_10723658 3300025928 Bacteria 889
510 Ga0207664_10176151 3300025929 Bacteria 1834
511 Ga0207664_10509166 3300025929 Bacteria 1078
512 Ga0207644_10000290 3300025931 Bacteria 33121
513 Ga0207644_10042774 3300025931 Bacteria 3212
514 Ga0207644_10076438 3300025931 Bacteria 2463
515 Ga0207644_10166384 3300025931 Unclassified 1718
516 Ga0207644_10169734 3300025931 Bacteria 1702
517 Ga0207644_10929064 3300025931 Bacteria 729
518 Ga0207690_10013817 3300025932 Bacteria 4864
519 Ga0207690_10114189 3300025932 Bacteria 1950
520 Ga0207690_10167800 3300025932 Unclassified 1642
521 Ga0207690_10321166 3300025932 Bacteria 1217
522 Ga0207690_11339952 3300025932 Bacteria 598
523 Ga0207706_10004967 3300025933 Bacteria 12430
524 Ga0207706_10030910 3300025933 Bacteria 4775
525 Ga0207706_10047902 3300025933 Bacteria 3781
526 Ga0207706_10049217 3300025933 Bacteria 3725
527 Ga0207706_10202973 3300025933 Bacteria 1739
528 Ga0207706_10958757 3300025933 Bacteria 720
529 Ga0207686_10019746 3300025934 Bacteria 3839
530 Ga0207686_10133358 3300025934 Bacteria 1706
531 Ga0207686_10591402 3300025934 Bacteria 872
532 Ga0207709_10020047 3300025935 Bacteria 3769
533 Ga0207709_10020819 3300025935 Bacteria 3704
534 Ga0207670_10021700 3300025936 Bacteria 3966
535 Ga0207670_10029892 3300025936 Bacteria 3475
536 Ga0207669_10003810 3300025937 Bacteria 6567
537 Ga0207669_10083074 3300025937 Bacteria 2058
538 Ga0207669_10114327 3300025937 Unclassified 1817
539 Ga0207669_10200070 3300025937 Bacteria 1449
540 Ga0207669_10261043 3300025937 Bacteria 1295
541 Ga0207669_10294729 3300025937 Bacteria 1230
542 Ga0207669_10651563 3300025937 Unclassified 861
543 Ga0207669_11638728 3300025937 Bacteria 549
544 Ga0207704_10010416 3300025938 Bacteria 4536
545 Ga0207704_10110163 3300025938 Bacteria 1859
546 Ga0207704_10659888 3300025938 Bacteria 862
547 Ga0207665_10159921 3300025939 Bacteria 1619
548 Ga0207691_10008160 3300025940 Bacteria 10052
549 Ga0207691_10013258 3300025940 Bacteria 7894
550 Ga0207691_10033044 3300025940 Bacteria 4819
551 Ga0207691_10115627 3300025940 Bacteria 2382
552 Ga0207691_10305381 3300025940 Unclassified 1366
553 Ga0207691_10899361 3300025940 Bacteria 741
554 Ga0207711_10037801 3300025941 Bacteria 4103
555 Ga0207711_10082081 3300025941 Bacteria 2817
556 Ga0207711_10126616 3300025941 Bacteria 2286
557 Ga0207711_10128658 3300025941 Bacteria 2268
558 Ga0207689_10011137 3300025942 Bacteria 7720
559 Ga0207689_10018323 3300025942 Bacteria 5909
560 Ga0207689_10068387 3300025942 Bacteria 2919
561 Ga0207689_10295307 3300025942 Unclassified 1343
562 Ga0207689_10376718 3300025942 Bacteria 1181
563 Ga0207689_10805877 3300025942 Bacteria 793
564 Ga0207661_10063297 3300025944 Bacteria 2995
565 Ga0207679_10138743 3300025945 Bacteria 1962
566 Ga0207679_10147056 3300025945 Bacteria 1913
567 Ga0207679_10269253 3300025945 Bacteria 1456
568 Ga0207679_10316578 3300025945 Unclassified 1350
569 Ga0207679_10475138 3300025945 Bacteria 1112
570 Ga0207679_10526559 3300025945 Bacteria 1058
571 Ga0207679_11156049 3300025945 Unclassified 710
572 Ga0207667_10006537 3300025949 Bacteria 14097
573 Ga0207667_10009356 3300025949 Bacteria 11554
574 Ga0207667_10380645 3300025949 Bacteria 1438
575 Ga0207667_10392204 3300025949 Bacteria 1414
576 Ga0207667_10515493 3300025949 Bacteria 1211
577 Ga0207651_10132362 3300025960 Bacteria 1911
578 Ga0207651_10151043 3300025960 Bacteria 1808
579 Ga0207651_10165031 3300025960 Bacteria 1740
580 Ga0207651_10207826 3300025960 Bacteria 1573
581 Ga0207651_10627848 3300025960 Unclassified 941
582 Ga0207651_11069637 3300025960 Bacteria 722
583 Ga0207712_10007238 3300025961 Bacteria 6998
584 Ga0207668_10031191 3300025972 Bacteria 3508
585 Ga0207640_10021406 3300025981 Bacteria 3853
586 Ga0207640_10053401 3300025981 Bacteria 2638
587 Ga0207640_10075036 3300025981 Bacteria 2290
588 Ga0207640_10118784 3300025981 Bacteria 1889
589 Ga0207640_10262957 3300025981 Bacteria 1346
590 Ga0207640_11444311 3300025981 Unclassified 617
591 Ga0207640_11452166 3300025981 Bacteria 615
592 Ga0207658_10010438 3300025986 Bacteria 6307
593 Ga0207658_10030384 3300025986 Bacteria 3824
594 Ga0207658_10078730 3300025986 Bacteria 2519
595 Ga0207658_10507860 3300025986 Bacteria 1074
596 Ga0207677_10032277 3300026023 Bacteria 3364
597 Ga0207677_10112056 3300026023 Bacteria 2034
598 Ga0207677_10201120 3300026023 Bacteria 1583
599 Ga0207677_10352126 3300026023 Bacteria 1234
600 Ga0207677_10629359 3300026023 Bacteria 945
601 Ga0207703_10001235 3300026035 Bacteria 23932
602 Ga0207703_10015327 3300026035 Bacteria 5979
603 Ga0207703_10083203 3300026035 Bacteria 2673
604 Ga0207703_10088863 3300026035 Bacteria 2594
605 Ga0207639_10007833 3300026041 Bacteria 7295
606 Ga0207639_10064325 3300026041 Bacteria 2843
607 Ga0207639_10197170 3300026041 Bacteria 1724
608 Ga0207639_10273984 3300026041 Unclassified 1481
609 Ga0207639_10470339 3300026041 Bacteria 1144
610 Ga0207639_11457030 3300026041 Bacteria 643
611 Ga0207678_10001247 3300026067 Bacteria 23481
612 Ga0207678_10003036 3300026067 Bacteria 15180
613 Ga0207678_10008198 3300026067 Bacteria 9212
614 Ga0207678_10411871 3300026067 Bacteria 1171
615 Ga0207678_10635644 3300026067 Bacteria 937
616 Ga0207678_11326545 3300026067 Bacteria 636
617 Ga0207708_10000668 3300026075 Bacteria 26303
618 Ga0207708_10005673 3300026075 Bacteria 9220
619 Ga0207708_10125596 3300026075 Unclassified 2002
620 Ga0207708_10951439 3300026075 Bacteria 745
621 Ga0207702_10102150 3300026078 Bacteria 2533
622 Ga0207702_10105069 3300026078 Bacteria 2500
623 Ga0207702_10115559 3300026078 Bacteria 2393
624 Ga0207702_10594606 3300026078 Bacteria 1085
625 Ga0207702_11775497 3300026078 Unclassified 609
626 Ga0207641_10012345 3300026088 Bacteria 7007
627 Ga0207641_10051971 3300026088 Bacteria 3469
628 Ga0207641_10072178 3300026088 Bacteria 2972
629 Ga0207641_10107792 3300026088 Unclassified 2464
630 Ga0207641_11628067 3300026088 Bacteria 647
631 Ga0207648_10011626 3300026089 Bacteria 8286
632 Ga0207648_10045848 3300026089 Bacteria 3834
633 Ga0207648_10055675 3300026089 Bacteria 3452
634 Ga0207648_10097512 3300026089 Bacteria 2573
635 Ga0207648_10253744 3300026089 Unclassified 1568
636 Ga0207648_10569413 3300026089 Unclassified 1042
637 Ga0207676_10113957 3300026095 Bacteria 2267
638 Ga0207676_10211575 3300026095 Bacteria 1720
639 Ga0207676_10224999 3300026095 Bacteria 1673
640 Ga0207676_10234546 3300026095 Bacteria 1642
641 Ga0207676_10260215 3300026095 Unclassified 1566
642 Ga0207676_10552469 3300026095 Unclassified 1100
643 Ga0207676_11378637 3300026095 Bacteria 701
644 Ga0207676_12059182 3300026095 Unclassified 569
645 Ga0207674_10003456 3300026116 Bacteria 19320
646 Ga0207674_10026694 3300026116 Bacteria 6127
647 Ga0207674_10049516 3300026116 Bacteria 4296
648 Ga0207674_10391006 3300026116 Bacteria 1344
649 Ga0207674_10480588 3300026116 Bacteria 1201
650 Ga0207674_10573002 3300026116 Bacteria 1090
651 Ga0207674_11745859 3300026116 Bacteria 590
652 Ga0207675_100007725 3300026118 Bacteria 10148
653 Ga0207675_100008887 3300026118 Bacteria 9424
654 Ga0207675_100009544 3300026118 Bacteria 9075
655 Ga0207675_100067811 3300026118 Bacteria 3335
656 Ga0207683_10009735 3300026121 Bacteria 8194
657 Ga0207683_10034137 3300026121 Bacteria 4420
658 Ga0207683_10084919 3300026121 Bacteria 2814
659 Ga0207683_10090075 3300026121 Bacteria 2731
660 Ga0207683_10167772 3300026121 Bacteria 1987
661 Ga0207683_10306447 3300026121 Bacteria 1453
662 Ga0207683_10481076 3300026121 Unclassified 1146
663 Ga0207683_10500724 3300026121 Bacteria 1122
664 Ga0207698_10039635 3300026142 Bacteria 3492
665 Ga0207698_10172494 3300026142 Bacteria 1906
666 Ga0207698_10295928 3300026142 Unclassified 1504
667 Ga0207698_10399595 3300026142 Bacteria 1313
668 Ga0207698_10489176 3300026142 Unclassified 1195
669 Ga0207698_10668712 3300026142 Bacteria 1030
670 Ga0207698_11329530 3300026142 Bacteria 733
671 Ga0207698_12638648 3300026142 Unclassified 512
672 Ga0207428_10226752 3300027907 Unclassified 1399
673 Ga0207428_10656141 3300027907 Bacteria 753
674 Ga0268266_10080687 3300028379 Bacteria 2835
675 Ga0268266_10999223 3300028379 Bacteria 810
676 Ga0268265_10008122 3300028380 Bacteria 7092
677 Ga0268265_10264175 3300028380 Bacteria 1532
678 Ga0268264_10010827 3300028381 Bacteria 7535
679 Ga0268264_10222417 3300028381 Unclassified 1738
680 Ga0268264_10659209 3300028381 Bacteria 1036
681 Ga0268264_10729137 3300028381 Bacteria 986
682 Ga0268264_12056921 3300028381 Bacteria 580
683 Ga0265318_10038370 3300028577 Bacteria 1831
684 Ga0265338_10246260 3300028800 Bacteria 1321
685 Ga0265330_10044474 3300031235 Bacteria 1960
686 Ga0265332_10022483 3300031238 Bacteria 2782
687 Ga0265328_10002961 3300031239 Bacteria 7583
688 Ga0265320_10064738 3300031240 Bacteria 1736
689 Ga0265325_10291913 3300031241 Unclassified 729
690 Ga0265329_10012135 3300031242 Bacteria 3108
691 Ga0265331_10001175 3300031250 Bacteria 19969
692 Ga0307408_100760585 3300031548 Bacteria 876
693 Ga0265314_10000442 3300031711 Bacteria 55420
694 Ga0265342_10014636 3300031712 Bacteria 5201
695 Ga0307405_10073669 3300031731 Bacteria 2206
696 Ga0307413_10351162 3300031824 Bacteria 1138
697 Ga0307406_10518080 3300031901 Bacteria 970
698 Ga0307406_10717897 3300031901 Bacteria 836
699 Ga0307407_10112254 3300031903 Bacteria 1713
700 Ga0307412_10406663 3300031911 Bacteria 1110
701 Ga0307412_11107811 3300031911 Unclassified 705
702 Ga0307409_100421176 3300031995 Bacteria 1281
703 Ga0307416_100324022 3300032002 Bacteria 1545
704 Ga0307416_100394171 3300032002 Unclassified 1420
705 Ga0307416_101948183 3300032002 Unclassified 691
706 Ga0307414_10542686 3300032004 Bacteria 1035
707 Ga0307411_10088169 3300032005 Bacteria 2157
708 Ga0307415_102453579 3300032126 Bacteria 513
709 Ga0373956_0636644 3300035119 Bacteria 509
710 Ga0373957_0114555 3300035120 Bacteria 1088
711 Ga0373946_0129476 3300035171 Unclassified 1160
712 Ga0373955_0006662 3300035172 Bacteria 5270
713 Ga0373924_0020207 3300035410 Bacteria 2587
714 Ga0373935_0150943 3300035692 Unclassified 1577
715 Ga0373935_0313884 3300035692 Bacteria 1111
716 Ga0373927_0657324 3300035695 Unclassified 693
717 Ga0373947_0039356 3300035725 Bacteria 2813
718 Ga0373947_0144906 3300035725 Bacteria 1526
719 Ga0373937_0084025 3300036401 Bacteria 2945
720 Ga0373925_0154949 3300037068 Bacteria 1801
721 Ga0373925_0602483 3300037068 Bacteria 905
722 Ga0373925_0900322 3300037068 Bacteria 729
723 Ga0395900_0859414 3300037418 Bacteria 832
724 Ga0395905_0064819 3300037471 Bacteria 3420
725 Ga0395901_0662778 3300038443 Bacteria 1045
726 Ga0451804_1162064 3300041463 Bacteria 507
727 Ga0451807_0603668 3300041486 Bacteria 1545
728 Ga0451839_0578504 3300041496 Unclassified 699
729 Ga0451845_0538943 3300041501 Bacteria 602
730 Ga0451849_0839170 3300041505 Bacteria 746
731 Ga0451853_1911501 3300041512 Bacteria 1508
732 Ga0451853_2484905 3300041512 Bacteria 607
733 Ga0439435_0123374 3300042436 Bacteria 813
734 Ga0451576_1502049 3300045051 Bacteria 700
735 Ga0495592_0054819 3300046454 Bacteria 2952
736 Ga0495629_0713868 3300046459 Unclassified 665
737 Ga0495580_0047374 3300046472 Bacteria 3047
738 Ga0495584_0000021 3300046491 Bacteria 130377
739 Ga0495585_0000608 3300046492 Bacteria 33524
740 Ga0495606_0032366 3300046507 Bacteria 3623
741 Ga0495608_0724158 3300046511 Unclassified 591
742 Ga0495616_0000646 3300046513 Bacteria 25901
743 Ga0495620_0043243 3300046515 Bacteria 1964
744 Ga0495628_0554057 3300046516 Bacteria 825
745 Ga0495628_1032123 3300046516 Unclassified 564
746 Ga0495642_0075646 3300046528 Bacteria 1413
747 Ga0495642_0156926 3300046528 Bacteria 986
748 Ga0495652_0370393 3300046529 Bacteria 1021
749 Ga0495587_0165237 3300046536 Bacteria 1258
750 Ga0495598_0014949 3300046537 Bacteria 1949
751 Ga0495621_0002750 3300046539 Bacteria 4775
752 Ga0495621_0042963 3300046539 Bacteria 1593
753 Ga0495621_0407816 3300046539 Unclassified 577
754 Ga0495645_0001821 3300046543 Bacteria 14495
755 Ga0495645_0167176 3300046543 Bacteria 1516
756 Ga0495645_0579686 3300046543 Bacteria 692
757 Ga0495667_0132486 3300046559 Bacteria 1608
758 Ga0495588_0388501 3300046674 Unclassified 733
759 Ga0495657_0031654 3300046675 Bacteria 3696
760 Ga0495599_0023709 3300046678 Bacteria 3836
761 Ga0495599_0214947 3300046678 Bacteria 1178
762 Ga0495623_0106214 3300046679 Bacteria 1706
763 Ga0495647_0072282 3300046681 Unclassified 1383
764 Ga0495647_0198945 3300046681 Bacteria 878
765 Ga0495647_0284171 3300046681 Unclassified 743
766 Ga0495658_0050615 3300046683 Unclassified 2351
767 Ga0495658_0642747 3300046683 Unclassified 680
768 Ga0495669_0098889 3300046684 Unclassified 1354
769 Ga0495613_0893123 3300046689 Unclassified 575
770 Ga0495674_0670854 3300047319 Bacteria 816
771 Ga0495674_0992478 3300047319 Unclassified 644
772 Ga0495680_0543233 3300047322 Bacteria 784
773 Ga0495684_0018668 3300047471 Bacteria 5343
774 Ga0495614_0094628 3300048089 Bacteria 1302
775 Ga0496101_0199699 3300048904 Bacteria 1545
776 Ga0496102_0131344 3300048905 Bacteria 2344
777 Ga0496103_0070934 3300048906 Bacteria 2180
778 Ga0496104_0733648 3300048907 Bacteria 895
779 Ga0496105_0034590 3300048908 Bacteria 4157
780 Ga0496106_0021551 3300048909 Bacteria 4785
781 Ga0496107_0528707 3300048910 Bacteria 874
782 Ga0496108_0072047 3300048911 Bacteria 2916
783 Ga0496108_0951974 3300048911 Unclassified 735
784 Ga0496109_0029023 3300048912 Bacteria 4952
785 Ga0496109_0832397 3300048912 Bacteria 861
786 Ga0496109_1479489 3300048912 Unclassified 614
787 Ga0496110_0022164 3300048913 Bacteria 5389
788 Ga0496111_0081515 3300048914 Bacteria 2362
789 Ga0496114_0008463 3300048917 Bacteria 8151
790 Ga0496114_0060288 3300048917 Bacteria 3171
791 Ga0496114_0550180 3300048917 Unclassified 1020
792 Ga0496114_0574862 3300048917 Bacteria 995
793 Ga0501032_0034545 3300049569 Bacteria 3461
794 Ga0501036_0099707 3300049572 Bacteria 2457
795 Ga0501043_0000756 3300049579 Bacteria 28764
796 Ga0501046_0000051 3300049580 Bacteria 133545
797 Ga0501047_0000003 3300049581 Bacteria 508375
798 Ga0501048_0000579 3300049582 Bacteria 26035
799 Ga0501071_0827467 3300049587 Bacteria 714
800 Ga0501072_1245145 3300049588 Unclassified 577
801 Ga0501074_0690474 3300049590 Bacteria 721
802 Ga0501075_0312361 3300049591 Bacteria 1198
803 Ga0501045_0022184 3300049824 Bacteria 4543
804 Ga0501045_0513976 3300049824 Unclassified 889
805 nmdc:mga09592_762421_c1 3300050508 Bacteria 820
806 nmdc:mga08y16_1701267_c1 3300050511 Bacteria 586
807 nmdc:mga08y16_234383_c1 3300050511 Bacteria 1898
808 nmdc:mga0rr50_528850_c1 3300050513 Unclassified 1003
809 Ga0495601_0008302 3300053077 Bacteria 6130
810 Ga0495595_0192790 3300053084 Bacteria 1013
811 Ga0495595_0210962 3300053084 Bacteria 968
812 Ga0495619_0018240 3300053085 Bacteria 4452
813 Ga0068859_100029458
814 Ga0007416J51690_1035555
815 Ga0065712_10078956
816 Ga0065715_10044724
817 Ga0070658_10004609
818 Ga0070658_10088525
819 Ga0070658_10115175
820 Ga0070658_10365648
821 Ga0070676_10005107
822 Ga0070676_10024865
823 Ga0070676_10053822
824 Ga0070676_10266950
825 Ga0070683_100009825
826 Ga0070683_100117852
827 Ga0070683_100123904
828 Ga0070683_100409358
829 Ga0070690_100032882
830 Ga0070690_100079965
831 Ga0070690_100255302
832 Ga0070690_100305141
833 Ga0070670_100064985
834 Ga0070670_100089391
835 Ga0070670_100140818
836 Ga0070670_100163319
837 Ga0070670_100272694
838 Ga0070670_100442933
839 Ga0070670_100508681
840 Ga0070670_100620502
841 Ga0070677_10041819
842 Ga0070677_10050742
843 Ga0070677_10108525
844 Ga0070677_10236665
845 Ga0068869_100007233
846 Ga0068869_100313441
847 Ga0068869_100591334
848 Ga0068869_100703992
849 Ga0070666_10053224
850 Ga0070666_10059032
851 Ga0070666_10132313
852 Ga0070680_100044639
853 Ga0070680_100256348
854 Ga0070680_100721796
855 Ga0070680_101779895
856 Ga0070682_100757596
857 Ga0068868_100051746
858 Ga0068868_100241872
859 Ga0068868_100451649
860 Ga0068868_100532478
861 Ga0068868_100654701
862 Ga0070660_100036853
863 Ga0070660_100199086
864 Ga0070660_100444270
865 Ga0070689_100024756
866 Ga0070689_100099189
867 Ga0070689_100852563
868 Ga0070687_100006852
869 Ga0070687_100040827
870 Ga0070687_100113130
871 Ga0070687_100460410
872 Ga0070661_100010574
873 Ga0070661_100019976
874 Ga0070661_100038944
875 Ga0070661_100142268
876 Ga0070661_100511733
877 Ga0070661_100514413
878 Ga0070661_100607637
879 Ga0070692_10078484
880 Ga0070692_10320667
881 Ga0070692_10481149
882 Ga0070668_100094170
883 Ga0070668_100114455
884 Ga0070668_100649104
885 Ga0070668_101174744
886 Ga0070669_100020852
887 Ga0070669_100179729
888 Ga0070669_100501903
889 Ga0070675_100033777
890 Ga0070675_100140299
891 Ga0070671_100006714
892 Ga0070671_100008516
893 Ga0070671_100156793
894 Ga0070671_100184425
895 Ga0070671_100251168
896 Ga0070671_100540369
897 Ga0070671_100640669
898 Ga0070671_101644650
899 Ga0070674_100042551
900 Ga0070674_100097073
901 Ga0070674_100352740
902 Ga0070674_100650580
903 Ga0070673_100047152
904 Ga0070673_100145840
905 Ga0070673_100165881
906 Ga0070673_100209037
907 Ga0070673_101311390
908 Ga0070688_100017658
909 Ga0070688_100043248
910 Ga0070688_100698093
911 Ga0070688_101020681
912 Ga0070659_100003789
913 Ga0070659_100017005
914 Ga0070659_100167873
915 Ga0070659_100378347
916 Ga0070667_100056032
917 Ga0070667_100065112
918 Ga0070667_100307825
919 Ga0070667_100569959
920 Ga0070667_100989678
921 Ga0070709_10482191
922 Ga0070714_100004746
923 Ga0070714_100035013
924 Ga0070714_100561938
925 Ga0070713_100000062
926 Ga0070713_100767708
927 Ga0070710_10577954
928 Ga0070701_10192137
929 Ga0070701_10382293
930 Ga0070700_100085329
931 Ga0070700_100267298
932 Ga0070694_100947272
933 Ga0070663_100002512
934 Ga0070663_100055783
935 Ga0070663_100075167
936 Ga0070663_100084504
937 Ga0070663_101047024
938 Ga0070663_101264906
939 Ga0070678_100050238
940 Ga0070678_100055967
941 Ga0070678_100072590
942 Ga0070678_100169740
943 Ga0070678_100208299
944 Ga0070662_100034304
945 Ga0070662_100049061
946 Ga0070662_100053215
947 Ga0070662_100133710
948 Ga0070662_100246285
949 Ga0070662_100615246
950 Ga0070662_101348873
951 Ga0070681_10079908
952 Ga0070681_10134636
953 Ga0070681_10192257
954 Ga0070681_10196101
955 Ga0070681_10213109
956 Ga0068867_100018985
957 Ga0068867_100037735
958 Ga0068867_100458235
959 Ga0068867_100879437
960 Ga0070685_10073454
961 Ga0070685_10344571
962 Ga0070685_10398477
963 Ga0070699_100856744
964 Ga0070679_100049148
965 Ga0070679_100053635
966 Ga0070679_100133412
967 Ga0070679_100179875
968 Ga0070679_100310678
969 Ga0070679_100441095
970 Ga0070684_100024188
971 Ga0070684_100032031
972 Ga0070684_100384911
973 Ga0068853_100207626
974 Ga0068853_100249262
975 Ga0068853_100298143
976 Ga0068853_100308008
977 Ga0070672_100080211
978 Ga0070672_100119660
979 Ga0070672_100157913
980 Ga0070672_100235671
981 Ga0070672_100248575
982 Ga0070672_100339340
983 Ga0070672_100374177
984 Ga0070686_100030290
985 Ga0070686_100107651
986 Ga0070686_100228369
987 Ga0070686_100411269
988 Ga0070695_101263497
989 Ga0070696_100641134
990 Ga0070693_100063904
991 Ga0070693_100075711
992 Ga0070693_100106074
993 Ga0070693_100659768
994 Ga0070665_100109657
995 Ga0070665_100339512
996 Ga0070665_101652500
997 Ga0070704_100187175
998 Ga0068855_100011490
999 Ga0068855_100077784
1000 Ga0068855_100078854
1001 Ga0068855_100356818
1002 Ga0068855_100824311
1003 Ga0070664_100048360
1004 Ga0070664_100066225
1005 Ga0070664_100091941
1006 Ga0070664_100113236
1007 Ga0070664_100151510
1008 Ga0070664_100170710
1009 Ga0070664_100190605
1010 Ga0070664_100299319
1011 Ga0070664_101226601
1012 Ga0068857_100124812
1013 Ga0068857_100140622
1014 Ga0068857_100260832
1015 Ga0068857_101252397
1016 Ga0068857_101962563
1017 Ga0068854_100005022
1018 Ga0068854_100121074
1019 Ga0068854_100144174
1020 Ga0068854_100366662
1021 Ga0068854_100956309
1022 Ga0068856_100003779
1023 Ga0068856_100074561
1024 Ga0068856_100135357
1025 Ga0068856_100689700
1026 Ga0070702_100019349
1027 Ga0070702_100956906
1028 Ga0068852_100048725
1029 Ga0068852_100061448
1030 Ga0068852_100090421
1031 Ga0068852_100117213
1032 Ga0068852_100452988
1033 Ga0068852_100626477
1034 Ga0068852_100701489
1035 Ga0068852_100794601
1036 Ga0068859_100102118
1037 Ga0068859_100154364
1038 Ga0068859_101737250
1039 Ga0068859_102267801
1040 Ga0068859_102826812
1041 Ga0068864_100034582
1042 Ga0068864_100073663
1043 Ga0068864_100229406
1044 Ga0068864_100241240
1045 Ga0068864_100356834
1046 Ga0068866_10446561
1047 Ga0068866_10888332
1048 Ga0068861_100008162
1049 Ga0068861_100100768
1050 Ga0068861_100288275
1051 Ga0068861_100658358
1052 Ga0068851_10003502
1053 Ga0068851_10004631
1054 Ga0068870_10011393
1055 Ga0068870_10022931
1056 Ga0068870_10108540
1057 Ga0068863_100093205
1058 Ga0068863_100116575
1059 Ga0068863_100177142
1060 Ga0068863_101816697
1061 Ga0068858_100002040
1062 Ga0068858_100019635
1063 Ga0068858_100049555
1064 Ga0068858_100074620
1065 Ga0068860_100000216
1066 Ga0068860_100019508
1067 Ga0068860_100096355
1068 Ga0068860_100250290
1069 Ga0068862_100214471
1070 Ga0068862_100521330
1071 Ga0068862_100626237
1072 Ga0068862_100758652
1073 Ga0081539_10348116
1074 Ga0070717_10354168
1075 Ga0070717_10365750
1076 Ga0075432_10123063
1077 Ga0070715_10213813
1078 Ga0070712_100159397
1079 Ga0097621_100022168
1080 Ga0097621_100062757
1081 Ga0097621_100064697
1082 Ga0097621_100302327
1083 Ga0097621_101336291
1084 Ga0097621_101378667
1085 Ga0068871_100075352
1086 Ga0068871_100112817
1087 Ga0068871_100194422
1088 Ga0075429_100672632
1089 Ga0068865_100041278
1090 Ga0068865_100107113
1091 Ga0068865_100177122
1092 Ga0068865_100343817
1093 Ga0068865_100377346
1094 Ga0097620_100029458
1095 Ga0097620_100102116
1096 Ga0097620_100154357
1097 Ga0097620_101737558
1098 Ga0097620_102267280
1099 Ga0097620_102826821
1100 Ga0105240_10045954
1101 Ga0105240_10615151
1102 Ga0111539_10225089
1103 Ga0111539_10580957
1104 Ga0111539_10591750
1105 Ga0111539_12250262
1106 Ga0105245_10023776
1107 Ga0105245_10053943
1108 Ga0105245_10153927
1109 Ga0105245_10487365
1110 Ga0105245_11562490
1111 Ga0105245_12752158
1112 Ga0105247_10270176
1113 Ga0105243_10088349
1114 Ga0105243_10173229
1115 Ga0105243_12600830
1116 Ga0105241_10005400
1117 Ga0105241_10317898
1118 Ga0105242_10037426
1119 Ga0105242_10046377
1120 Ga0105242_10071415
1121 Ga0105242_10331316
1122 Ga0105242_10475656
1123 Ga0105242_10797870
1124 Ga0105242_10969255
1125 Ga0105248_10047973
1126 Ga0105248_10061680
1127 Ga0105248_10088139
1128 Ga0105248_10111540
1129 Ga0105248_10124629
1130 Ga0105248_10195909
1131 Ga0105248_10850203
1132 Ga0105248_11605550
1133 Ga0105237_10164166
1134 Ga0105237_10834172
1135 Ga0105238_10010886
1136 Ga0105238_10083316
1137 Ga0105238_10220455
1138 Ga0105238_12306688
1139 Ga0105249_10032195
1140 Ga0105249_10046248
1141 Ga0105249_10365389
1142 Ga0105239_10121158
1143 Ga0105239_10668135
1144 Ga0157324_1033112
1145 Ga0157327_1012899
1146 Ga0157373_10014786
1147 Ga0157373_10085486
1148 Ga0157371_10157193
1149 Ga0157371_10969914
1150 Ga0157370_10021596
1151 Ga0157370_10029321
1152 Ga0157370_10038546
1153 Ga0157370_10051163
1154 Ga0157370_10902057
1155 Ga0157370_11746167
1156 Ga0157369_10015766
1157 Ga0157369_10270402
1158 Ga0157369_10444255
1159 Ga0157369_10636833
1160 Ga0157369_11172072
1161 Ga0157369_12251450
1162 Ga0157374_10037705
1163 Ga0157374_10074510
1164 Ga0157374_10166065
1165 Ga0157374_10628046
1166 Ga0157374_10826755
1167 Ga0157374_11539479
1168 Ga0157378_10020838
1169 Ga0157378_10065445
1170 Ga0157378_10240052
1171 Ga0157378_11154540
1172 Ga0163162_10046601
1173 Ga0163162_10138239
1174 Ga0163162_10296653
1175 Ga0163162_10405105
1176 Ga0163162_10947798
1177 Ga0163162_10983043
1178 Ga0163162_11080162
1179 Ga0163162_11122514
1180 Ga0157372_10012754
1181 Ga0157372_10076532
1182 Ga0157372_10116808
1183 Ga0157372_10124966
1184 Ga0157372_10175996
1185 Ga0157372_10220005
1186 Ga0157372_10222939
1187 Ga0157372_10333054
1188 Ga0157372_10876176
1189 Ga0157372_11708513
1190 Ga0157372_12476362
1191 Ga0157375_10017824
1192 Ga0157375_10020056
1193 Ga0157375_10064852
1194 Ga0157375_10168212
1195 Ga0157375_10185721
1196 Ga0157375_10639565
1197 Ga0157375_11847960
1198 Ga0163163_10411702
1199 Ga0163163_10536433
1200 Ga0163163_10555016
1201 Ga0163163_11685681
1202 Ga0157380_10105337
1203 Ga0157380_10118141
1204 Ga0157380_11248041
1205 Ga0182008_10144196
1206 Ga0182008_10379020
1207 Ga0182008_10523311
1208 Ga0157377_10035504
1209 Ga0157377_10043403
1210 Ga0157377_10206814
1211 Ga0157377_10498124
1212 Ga0157377_10712305
1213 Ga0157379_10006049
1214 Ga0157379_10124586
1215 Ga0157379_10178377
1216 Ga0157379_10603676
1217 Ga0157379_10716963
1218 Ga0157376_10029741
1219 Ga0157376_10225910
1220 Ga0157376_10377394
1221 Ga0157376_10426852
1222 Ga0157376_10477114
1223 Ga0163161_10059418
1224 Ga0163161_10154875
1225 Ga0163161_11276036
1226 Ga0197907_10261353
1227 Ga0206356_11498925
1228 Ga0206354_10985770
1229 Ga0206353_11201498
1230 Ga0224712_10010480
1231 Ga0207673_1025064
1232 Ga0207697_10000097
1233 Ga0207697_10004415
1234 Ga0207697_10064155
1235 Ga0207656_10034062
1236 Ga0207656_10050282
1237 Ga0207682_10002851
1238 Ga0207682_10004577
1239 Ga0207682_10022305
1240 Ga0207682_10051209
1241 Ga0207642_10033111
1242 Ga0207642_10046940
1243 Ga0207688_10019430
1244 Ga0207688_10020270
1245 Ga0207688_10075260
1246 Ga0207688_10078326
1247 Ga0207680_10047095
1248 Ga0207680_10070497
1249 Ga0207680_10077844
1250 Ga0207680_10245431
1251 Ga0207680_10362915
1252 Ga0207647_10042499
1253 Ga0207685_10045682
1254 Ga0207685_10109458
1255 Ga0207699_10362627
1256 Ga0207645_10001136
1257 Ga0207645_10007824
1258 Ga0207645_10049338
1259 Ga0207643_10000178
1260 Ga0207643_10035310
1261 Ga0207643_10089527
1262 Ga0207705_10052009
1263 Ga0207705_10077019
1264 Ga0207654_10052705
1265 Ga0207654_10077983
1266 Ga0207654_10191950
1267 Ga0207654_10313140
1268 Ga0207707_10004039
1269 Ga0207707_10021594
1270 Ga0207707_10089355
1271 Ga0207707_10124509
1272 Ga0207707_10454405
1273 Ga0207707_10752091
1274 Ga0207695_10049772
1275 Ga0207695_10570871
1276 Ga0207693_10138372
1277 Ga0207693_10374134
1278 Ga0207660_10034325
1279 Ga0207660_10392755
1280 Ga0207660_10433022
1281 Ga0207660_10588911
1282 Ga0207660_11689725
1283 Ga0207662_10005166
1284 Ga0207662_10031336
1285 Ga0207662_10061628
1286 Ga0207662_10479591
1287 Ga0207657_10005487
1288 Ga0207657_10042979
1289 Ga0207657_10258490
1290 Ga0207649_10020776
1291 Ga0207649_10088910
1292 Ga0207649_10130357
1293 Ga0207649_10172864
1294 Ga0207649_10197660
1295 Ga0207649_10308250
1296 Ga0207652_10006535
1297 Ga0207652_10011804
1298 Ga0207652_10072463
1299 Ga0207652_10237153
1300 Ga0207652_10264943
1301 Ga0207652_10362840
1302 Ga0207652_11402200
1303 Ga0207681_10000413
1304 Ga0207681_10199405
1305 Ga0207694_10043983
1306 Ga0207694_10127916
1307 Ga0207650_10005398
1308 Ga0207650_10042882
1309 Ga0207650_10186502
1310 Ga0207650_10396398
1311 Ga0207659_10016488
1312 Ga0207659_10081090
1313 Ga0207659_10081137
1314 Ga0207659_10102620
1315 Ga0207659_10519232
1316 Ga0207687_10085955
1317 Ga0207687_10089279
1318 Ga0207687_10124177
1319 Ga0207687_10793072
1320 Ga0207700_10000143
1321 Ga0207700_10723658
1322 Ga0207664_10176151
1323 Ga0207664_10509166
1324 Ga0207644_10000290
1325 Ga0207644_10042774
1326 Ga0207644_10076438
1327 Ga0207644_10166384
1328 Ga0207644_10169734
1329 Ga0207644_10929064
1330 Ga0207690_10013817
1331 Ga0207690_10114189
1332 Ga0207690_10167800
1333 Ga0207690_10321166
1334 Ga0207690_11339952
1335 Ga0207706_10004967
1336 Ga0207706_10030910
1337 Ga0207706_10047902
1338 Ga0207706_10049217
1339 Ga0207706_10202973
1340 Ga0207706_10958757
1341 Ga0207686_10019746
1342 Ga0207686_10133358
1343 Ga0207686_10591402
1344 Ga0207709_10020047
1345 Ga0207709_10020819
1346 Ga0207670_10021700
1347 Ga0207670_10029892
1348 Ga0207669_10003810
1349 Ga0207669_10083074
1350 Ga0207669_10114327
1351 Ga0207669_10200070
1352 Ga0207669_10261043
1353 Ga0207669_10294729
1354 Ga0207669_10651563
1355 Ga0207669_11638728
1356 Ga0207704_10010416
1357 Ga0207704_10110163
1358 Ga0207704_10659888
1359 Ga0207665_10159921
1360 Ga0207691_10008160
1361 Ga0207691_10013258
1362 Ga0207691_10033044
1363 Ga0207691_10115627
1364 Ga0207691_10305381
1365 Ga0207691_10899361
1366 Ga0207711_10037801
1367 Ga0207711_10082081
1368 Ga0207711_10126616
1369 Ga0207711_10128658
1370 Ga0207689_10011137
1371 Ga0207689_10018323
1372 Ga0207689_10068387
1373 Ga0207689_10295307
1374 Ga0207689_10376718
1375 Ga0207689_10805877
1376 Ga0207661_10063297
1377 Ga0207679_10138743
1378 Ga0207679_10147056
1379 Ga0207679_10269253
1380 Ga0207679_10316578
1381 Ga0207679_10475138
1382 Ga0207679_10526559
1383 Ga0207679_11156049
1384 Ga0207667_10006537
1385 Ga0207667_10009356
1386 Ga0207667_10380645
1387 Ga0207667_10392204
1388 Ga0207667_10515493
1389 Ga0207651_10132362
1390 Ga0207651_10151043
1391 Ga0207651_10165031
1392 Ga0207651_10207826
1393 Ga0207651_10627848
1394 Ga0207651_11069637
1395 Ga0207712_10007238
1396 Ga0207668_10031191
1397 Ga0207640_10021406
1398 Ga0207640_10053401
1399 Ga0207640_10075036
1400 Ga0207640_10118784
1401 Ga0207640_10262957
1402 Ga0207640_11444311
1403 Ga0207640_11452166
1404 Ga0207658_10010438
1405 Ga0207658_10030384
1406 Ga0207658_10078730
1407 Ga0207658_10507860
1408 Ga0207677_10032277
1409 Ga0207677_10112056
1410 Ga0207677_10201120
1411 Ga0207677_10352126
1412 Ga0207677_10629359
1413 Ga0207703_10001235
1414 Ga0207703_10015327
1415 Ga0207703_10083203
1416 Ga0207703_10088863
1417 Ga0207639_10007833
1418 Ga0207639_10064325
1419 Ga0207639_10197170
1420 Ga0207639_10273984
1421 Ga0207639_10470339
1422 Ga0207639_11457030
1423 Ga0207678_10001247
1424 Ga0207678_10003036
1425 Ga0207678_10008198
1426 Ga0207678_10411871
1427 Ga0207678_10635644
1428 Ga0207678_11326545
1429 Ga0207708_10000668
1430 Ga0207708_10005673
1431 Ga0207708_10125596
1432 Ga0207708_10951439
1433 Ga0207702_10102150
1434 Ga0207702_10105069
1435 Ga0207702_10115559
1436 Ga0207702_10594606
1437 Ga0207702_11775497
1438 Ga0207641_10012345
1439 Ga0207641_10051971
1440 Ga0207641_10072178
1441 Ga0207641_10107792
1442 Ga0207641_11628067
1443 Ga0207648_10011626
1444 Ga0207648_10045848
1445 Ga0207648_10055675
1446 Ga0207648_10097512
1447 Ga0207648_10253744
1448 Ga0207648_10569413
1449 Ga0207676_10113957
1450 Ga0207676_10211575
1451 Ga0207676_10224999
1452 Ga0207676_10234546
1453 Ga0207676_10260215
1454 Ga0207676_10552469
1455 Ga0207676_11378637
1456 Ga0207676_12059182
1457 Ga0207674_10003456
1458 Ga0207674_10026694
1459 Ga0207674_10049516
1460 Ga0207674_10391006
1461 Ga0207674_10480588
1462 Ga0207674_10573002
1463 Ga0207674_11745859
1464 Ga0207675_100007725
1465 Ga0207675_100008887
1466 Ga0207675_100009544
1467 Ga0207675_100067811
1468 Ga0207683_10009735
1469 Ga0207683_10034137
1470 Ga0207683_10084919
1471 Ga0207683_10090075
1472 Ga0207683_10167772
1473 Ga0207683_10306447
1474 Ga0207683_10481076
1475 Ga0207683_10500724
1476 Ga0207698_10039635
1477 Ga0207698_10172494
1478 Ga0207698_10295928
1479 Ga0207698_10399595
1480 Ga0207698_10489176
1481 Ga0207698_10668712
1482 Ga0207698_11329530
1483 Ga0207698_12638648
1484 Ga0207428_10226752
1485 Ga0207428_10656141
1486 Ga0268266_10080687
1487 Ga0268266_10999223
1488 Ga0268265_10008122
1489 Ga0268265_10264175
1490 Ga0268264_10010827
1491 Ga0268264_10222417
1492 Ga0268264_10659209
1493 Ga0268264_10729137
1494 Ga0268264_12056921
1495 Ga0265318_10038370
1496 Ga0265338_10246260
1497 Ga0265330_10044474
1498 Ga0265332_10022483
1499 Ga0265328_10002961
1500 Ga0265320_10064738
1501 Ga0265325_10291913
1502 Ga0265329_10012135
1503 Ga0265331_10001175
1504 Ga0307408_100760585
1505 Ga0265314_10000442
1506 Ga0265342_10014636
1507 Ga0307405_10073669
1508 Ga0307413_10351162
1509 Ga0307406_10518080
1510 Ga0307406_10717897
1511 Ga0307407_10112254
1512 Ga0307412_10406663
1513 Ga0307412_11107811
1514 Ga0307409_100421176
1515 Ga0307416_100324022
1516 Ga0307416_100394171
1517 Ga0307416_101948183
1518 Ga0307414_10542686
1519 Ga0307411_10088169
1520 Ga0307415_102453579
1521 Ga0373956_0636644
1522 Ga0373957_0114555
1523 Ga0373946_0129476
1524 Ga0373955_0006662
1525 Ga0373924_0020207
1526 Ga0373935_0150943
1527 Ga0373935_0313884
1528 Ga0373927_0657324
1529 Ga0373947_0039356
1530 Ga0373947_0144906
1531 Ga0373937_0084025
1532 Ga0373925_0154949
1533 Ga0373925_0602483
1534 Ga0373925_0900322
1535 Ga0395900_0859414
1536 Ga0395905_0064819
1537 Ga0395901_0662778
1538 Ga0451804_1162064
1539 Ga0451807_0603668
1540 Ga0451839_0578504
1541 Ga0451845_0538943
1542 Ga0451849_0839170
1543 Ga0451853_1911501
1544 Ga0451853_2484905
1545 Ga0439435_0123374
1546 Ga0451576_1502049
1547 Ga0495592_0054819
1548 Ga0495629_0713868
1549 Ga0495580_0047374
1550 Ga0495584_0000021
1551 Ga0495585_0000608
1552 Ga0495606_0032366
1553 Ga0495608_0724158
1554 Ga0495616_0000646
1555 Ga0495620_0043243
1556 Ga0495628_0554057
1557 Ga0495628_1032123
1558 Ga0495642_0075646
1559 Ga0495642_0156926
1560 Ga0495652_0370393
1561 Ga0495587_0165237
1562 Ga0495598_0014949
1563 Ga0495621_0002750
1564 Ga0495621_0042963
1565 Ga0495621_0407816
1566 Ga0495645_0001821
1567 Ga0495645_0167176
1568 Ga0495645_0579686
1569 Ga0495667_0132486
1570 Ga0495588_0388501
1571 Ga0495657_0031654
1572 Ga0495599_0023709
1573 Ga0495599_0214947
1574 Ga0495623_0106214
1575 Ga0495647_0072282
1576 Ga0495647_0198945
1577 Ga0495647_0284171
1578 Ga0495658_0050615
1579 Ga0495658_0642747
1580 Ga0495669_0098889
1581 Ga0495613_0893123
1582 Ga0495674_0670854
1583 Ga0495674_0992478
1584 Ga0495680_0543233
1585 Ga0495684_0018668
1586 Ga0495614_0094628
1587 Ga0496101_0199699
1588 Ga0496102_0131344
1589 Ga0496103_0070934
1590 Ga0496104_0733648
1591 Ga0496105_0034590
1592 Ga0496106_0021551
1593 Ga0496107_0528707
1594 Ga0496108_0072047
1595 Ga0496108_0951974
1596 Ga0496109_0029023
1597 Ga0496109_0832397
1598 Ga0496109_1479489
1599 Ga0496110_0022164
1600 Ga0496111_0081515
1601 Ga0496114_0008463
1602 Ga0496114_0060288
1603 Ga0496114_0550180
1604 Ga0496114_0574862
1605 Ga0501032_0034545
1606 Ga0501036_0099707
1607 Ga0501043_0000756
1608 Ga0501046_0000051
1609 Ga0501047_0000003
1610 Ga0501048_0000579
1611 Ga0501071_0827467
1612 Ga0501072_1245145
1613 Ga0501074_0690474
1614 Ga0501075_0312361
1615 Ga0501045_0022184
1616 Ga0501045_0513976
1617 nmdc:mga09592_762421_c1
1618 nmdc:mga08y16_1701267_c1
1619 nmdc:mga08y16_234383_c1
1620 nmdc:mga0rr50_528850_c1
1621 Ga0495601_0008302
1622 Ga0495595_0192790
1623 Ga0495595_0210962
1624 Ga0495619_0018240

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

58

151

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w1z-assembly1.cif.gz_D heat shock protein 16.0 from schizosaccharomyces pombe 0.9042 42 134
6l6m-assembly1.cif.gz_A hsp18.5 from e. histolytica 0.8938 40 137
4eld-assembly1.cif.gz_A crystal structure of an activated variant of small heat shock protein hsp16.5 0.8598 43 134
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.8535 43 133
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8534 44 133
ID Description Score Start End Superfamily
3w1zD00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9042 42 134 2.60.40.790
af_Q8IB02_36_170_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8665 39 138 2.60.40.790
4eldA00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8598 43 134 2.60.40.790
af_Q0E4A8_70_176_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8595 44 133 2.60.40.790
af_Q208N7_181_285_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8566 41 134 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A1V6F271-F1-model_v4 Spore protein SP21 0.8937 41 138
AF-A0A1E5Q5B2-F1-model_v4 SHSP domain-containing protein 0.8735 36 133
AF-A0A1F3A2G1-F1-model_v4 Heat-shock protein Hsp20 0.8659 30 136
AF-A0A2M7URH3-F1-model_v4 SHSP domain-containing protein 0.8654 33 137
AF-A0A3D3HVB9-F1-model_v4 Uncharacterized protein 0.8649 42 137

Map