metagRoot

F481843

General Info

Members	Datasets	Scaffolds	Average Seq Length
811	652	336	361

Family's Representative Sequence

Representative Sequence	3300009766\|Ga0123342_1029220\|Ga0123342_10292203
Length	412
Sequence	MSVPPAALAGGFFIDEKAHHASRACLLWYVAFFKHIFSVRRRSRLRGAAMNNSSLQKSALSYFTWAFIFTGLGLILGAALGWQATGTIGGMATVFFICTVLAVLEISLSFDNAIVNANKLKEMTPVWQHRFLTWGIVIAVFGMRIVFPLAIVAIAAKIGPWEALVLAAREPAEYARIMNDAYLPIAAFGGTFLMMVGLNYFFNHEKDVHWIAGLEKLMARSATIKGIEIAFVLALVLVFSSFLGEEEATTFVHCAIYGLLTFLAVEVIGGLLDASQQTMSAAAKGGLGAFIYLEVLDASFSFDGVIGAFALTQNLFVIAIGLGIGAMYVRSMTIMLVEKGTLAEYRYLEHGAFYAILILSVIMYVQTMFHIPEVITGLGGAALIGISLWSSIRYNRKEQAEERAQAHKELHA

Samples

	Sample ID	Description	Type	Environment
1	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
2	2509276019	Ensifer aridi TW10	Isolate	Nodule
3	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
4	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
5	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
6	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
7	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
8	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
9	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
10	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
11	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
12	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
13	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
14	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
15	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
16	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
17	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
18	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
19	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
20	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
21	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
22	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
23	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
24	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
25	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
26	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
27	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
28	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
29	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
30	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
31	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
32	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
33	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
34	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
35	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
36	2516143018	Ensifer sp. BR816	Isolate	Nodule
37	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
38	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
39	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
40	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
41	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
42	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
43	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
44	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
45	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
46	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
47	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
48	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
49	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
50	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
51	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
52	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
53	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
54	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
55	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
56	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
57	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
58	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
59	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
60	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
61	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
62	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
63	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
64	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
65	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
66	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
67	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
68	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
69	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
70	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
71	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
72	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
73	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
74	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
75	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
76	2643221557	Ensifer sp. Root558	Isolate	Unclassified
77	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
78	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
79	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
80	2643221610	Ensifer sp. Root74	Isolate	Unclassified
81	2643221618	Ensifer sp. Root231	Isolate	Unclassified
82	2643221626	Ensifer sp. Root31	Isolate	Unclassified
83	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
84	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
85	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
86	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
87	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
88	2643221659	Ensifer sp. Root127	Isolate	Unclassified
89	2643221668	Ensifer sp. Root423	Isolate	Unclassified
90	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
91	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
92	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
93	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
94	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
95	2643221698	Ensifer sp. Root142	Isolate	Unclassified
96	2643221712	Ensifer sp. Root258	Isolate	Unclassified
97	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
98	2643221723	Ensifer sp. Root278	Isolate	Unclassified
99	2643221726	Ensifer sp. Root954	Isolate	Unclassified
100	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
101	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
102	2718217882	Rhizobium sp. N741	Isolate	Nodule
103	2718217927	Rhizobium sp. N324	Isolate	Nodule
104	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
105	2718218009	Rhizobium sp. N561	Isolate	Nodule
106	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
107	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
108	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
109	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
110	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
111	2718218363	Rhizobium sp. N113	Isolate	Nodule
112	2718218365	Rhizobium sp. N731	Isolate	Nodule
113	2718218366	Rhizobium sp. N621	Isolate	Nodule
114	2718218423	Rhizobium sp. N941	Isolate	Nodule
115	2721755514	Rhizobium sp. N6212	Isolate	Nodule
116	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
117	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
118	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
119	2721755809	Rhizobium sp. N541	Isolate	Nodule
120	2721755810	Rhizobium sp. N871	Isolate	Nodule
121	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
122	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
123	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
124	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
125	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
126	2728369365	Rhizobium sp. N1341	Isolate	Nodule
127	2728369397	Rhizobium sp. N1314	Isolate	Nodule
128	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
129	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
130	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
131	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
132	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
133	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
134	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
135	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
136	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
137	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
138	2791355256	Rhizobium sp. M10	Isolate	Nodule
139	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
140	2791355260	Rhizobium sp. L9	Isolate	Nodule
141	2791355261	Rhizobium sp. J15	Isolate	Nodule
142	2791355262	Rhizobium sp. M1	Isolate	Nodule
143	2791355263	Rhizobium chutanense C5	Isolate	Nodule
144	2791355264	Rhizobium sp. S9	Isolate	Nodule
145	2791355265	Rhizobium sp. H4	Isolate	Nodule
146	2791355266	Rhizobium sp. L43	Isolate	Nodule
147	2791355267	Rhizobium sp. L18	Isolate	Nodule
148	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
149	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
150	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
151	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
152	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
153	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
154	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
155	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
156	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
157	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
158	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
159	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
160	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
161	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
162	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
163	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
164	2834578030	Paracoccus thiocyanatus SST	Isolate	Unclassified
165	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
166	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
167	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
168	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
169	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
170	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
171	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
172	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
173	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
174	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
175	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
176	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
177	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
178	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
179	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
180	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
181	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
182	2840878972	Albibacillus kandeliae J95	Isolate	Rhizosphere
183	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
184	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
185	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
186	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
187	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
188	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
189	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
190	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
191	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
192	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
193	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
194	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
195	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
196	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
197	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
198	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
199	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
200	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
201	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
202	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
203	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
204	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
205	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
206	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
207	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
208	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
209	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
210	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
211	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
212	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
213	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
214	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
215	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
216	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
217	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
218	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
219	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
220	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
221	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
222	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
223	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
224	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
225	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
226	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
227	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
228	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
229	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
230	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
231	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
232	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
233	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
234	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
235	2855020534	Paracoccus endophyticus SYSUP0003	Isolate	Stem Tuber
236	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
237	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
238	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
239	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
240	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
241	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
242	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
243	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
244	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
245	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
246	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
247	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
248	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
249	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
250	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
251	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
252	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
253	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
254	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
255	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
256	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
257	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
258	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
259	2919679072	Pseudotabrizicola sp. 4114	Isolate	Unclassified
260	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
261	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
262	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
263	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
264	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
265	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
266	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
267	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
268	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
269	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
270	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
271	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
272	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
273	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
274	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
275	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
276	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
277	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
278	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
279	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
280	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
281	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
282	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
283	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
284	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
285	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
286	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
287	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
288	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
289	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
290	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
291	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
292	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
293	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
294	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
295	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
296	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
297	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
298	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
299	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
300	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
301	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
302	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
303	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
304	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
305	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
306	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
307	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
308	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
309	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
310	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
311	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
312	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
313	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
314	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
315	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
316	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
317	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
318	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
319	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
320	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
321	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
322	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
323	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
324	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
325	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
326	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
327	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
328	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
329	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
330	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
331	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
332	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
333	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
334	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
335	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
336	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
337	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
338	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
339	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
340	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
341	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
342	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
343	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
344	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
345	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
346	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
347	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
348	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
349	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
350	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
351	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
352	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
353	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
354	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
355	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
356	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
357	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
358	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
359	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
360	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
361	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
362	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
363	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
364	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
365	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
366	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
367	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
368	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
369	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
370	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
371	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
372	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
373	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
374	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
375	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
376	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
377	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
378	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
379	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
380	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
381	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
382	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
383	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
384	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
385	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
386	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
387	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
388	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
389	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
390	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
391	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
392	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
393	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
394	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
395	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
396	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
397	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
398	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
399	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
400	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
401	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
402	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
403	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
404	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
405	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
406	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
407	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
408	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
409	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
410	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
411	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
412	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
413	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
414	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
415	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
416	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
417	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
418	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
419	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
420	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
421	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
422	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
423	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
424	2996887358	Rhizobium sp. R711	Isolate	Nodule
425	2996893221	Rhizobium sp. R635	Isolate	Nodule
426	3000017691	Rhodobacteraceae bacterium GH2-2	Isolate	Rhizosphere
427	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
428	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
429	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
430	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
431	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
432	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
433	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
434	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
435	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
436	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
437	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
438	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
439	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
440	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
441	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
442	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
443	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
444	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
445	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
446	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
447	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
448	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
449	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
450	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
451	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
452	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
453	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
454	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
455	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
456	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
457	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
458	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
459	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
460	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
461	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
462	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
463	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
464	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
465	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
466	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
467	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
468	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
469	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
470	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
471	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
472	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
473	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
474	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
475	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
476	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
477	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
478	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
479	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
480	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
481	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
482	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
483	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
484	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
485	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
486	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
487	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
488	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
489	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
490	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
491	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
492	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
493	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
494	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
495	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
496	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
497	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
498	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
499	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
500	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
501	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
502	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
503	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
504	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
505	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
506	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
507	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
508	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
509	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
510	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
511	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
512	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
513	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
514	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
515	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
516	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
517	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
518	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
519	3300041907	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run	Metatranscriptome	Unclassified
520	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
521	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
522	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
523	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
524	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
525	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
526	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
527	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
528	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
529	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
530	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
531	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
532	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
533	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
534	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
535	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
536	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
537	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
538	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
539	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
540	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
541	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
542	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
543	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
544	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
545	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
546	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
547	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
548	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
549	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
550	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
551	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
552	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
553	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
554	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
555	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
556	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
557	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
558	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
559	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
560	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
561	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
562	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
563	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
564	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
565	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
566	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
567	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
568	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
569	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
570	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
571	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
572	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
573	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
574	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
575	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
576	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
577	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
578	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
579	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
580	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
581	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
582	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
583	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
584	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
585	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
586	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
587	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
588	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
589	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
590	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
591	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
592	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
593	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
594	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
595	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
596	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
597	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
598	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
599	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
600	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
601	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
602	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
603	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
604	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
605	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
606	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
607	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
608	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
609	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
610	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
611	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
612	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
613	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
614	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
615	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
616	8005258706	Rhizobium sp. R693	Isolate	Nodule
617	8005275841	Rhizobium sp. N4311	Isolate	Nodule
618	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
619	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
620	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
621	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
622	8005321885	Rhizobium sp. R72	Isolate	Nodule
623	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
624	8005382845	Rhizobium sp. R634	Isolate	Nodule
625	8005395548	Rhizobium sp. R339	Isolate	Nodule
626	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
627	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
628	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
629	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
630	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
631	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
632	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
633	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
634	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
635	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
636	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
637	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
638	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
639	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
640	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
641	8018176218	Rhizobium sp. N122	Isolate	Nodule
642	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
643	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
644	8024501048	Rhizobium sp. H4	Isolate	Nodule
645	8045864390	Aurantimonas endophytica KCTC 52296	Isolate	Unclassified
646	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
647	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
648	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
649	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
650	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
651	8057132660	Paracoccus rhizosphaerae LMG 21293	Isolate	Rhizosphere
652	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	41.31
Metatranscriptomes	0.12
Isolates	58.57

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	18.5
Nodule	49.45
Rhizoplane	0.62
Rhizosphere	21.21
Stem	0
Stem Tuber	0.12
Unclassified	10.11

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25158J39367_1000234	3300002739	Bacteria	12906
2	JGI25152J39213_1003086	3300002773	Bacteria	5837
3	JGI25152J39213_1003781	3300002773	Bacteria	5031
4	JGI25152J39213_1005342	3300002773	Bacteria	3774
5	JGI25152J39213_1007069	3300002773	Bacteria	2950
6	JGI25152J39213_1009079	3300002773	Bacteria	2397
7	JGI25150J39212_1000230	3300002774	Bacteria	30285
8	JGI25150J39212_1000388	3300002774	Bacteria	20972
9	JGI25150J39212_1012312	3300002774	Bacteria	1519
10	JGI25159J45721_1000144	3300002987	Bacteria	32636
11	JGI25159J45721_1001732	3300002987	Bacteria	8804
12	JGI25151J46595_10000031	3300003187	Bacteria	197865
13	JGI25151J46595_10001231	3300003187	Bacteria	18298
14	JGI25151J46595_10003775	3300003187	Bacteria	8219
15	JGI25151J46595_10011661	3300003187	Bacteria	4031
16	JGI25153J46596_10000937	3300003215	Bacteria	17751
17	JGI25153J46596_10003317	3300003215	Bacteria	9048
18	JGI25153J46596_10006057	3300003215	Bacteria	6214
19	JGI25153J46596_10008193	3300003215	Bacteria	5031
20	JGI25153J46596_10009197	3300003215	Bacteria	4626
21	JGI25153J46596_10016498	3300003215	Bacteria	2954
22	JGI25160J50197_1000006	3300003354	Bacteria	316247
23	JGI25160J50197_1000299	3300003354	Bacteria	34962
24	JGI25160J50197_1000918	3300003354	Bacteria	15469
25	JGI25160J50197_1006153	3300003354	Bacteria	4887
26	JGI25161J50226_1000004	3300003374	Bacteria	316212
27	JGI25161J50226_1000477	3300003374	Bacteria	18148
28	JGI25161J50226_1000786	3300003374	Bacteria	11965
29	JGI25161J50226_1002462	3300003374	Bacteria	4733
30	Ga0055526_1001243	3300003771	Bacteria	18284
31	Ga0055526_1001302	3300003771	Bacteria	17888
32	Ga0055526_1002116	3300003771	Bacteria	13636
33	Ga0055526_1005050	3300003771	Bacteria	7705
34	Ga0055526_1010662	3300003771	Bacteria	4246
35	Ga0055526_1012057	3300003771	Bacteria	3817
36	Ga0055524_1003458	3300003775	Bacteria	7658
37	Ga0055524_1003538	3300003775	Bacteria	7551
38	Ga0055524_1004660	3300003775	Bacteria	6286
39	Ga0055524_1013917	3300003775	Bacteria	3007
40	Ga0055524_1014150	3300003775	Bacteria	2972
41	Ga0055524_1016666	3300003775	Bacteria	2623
42	Ga0055528_1000497	3300003790	Bacteria	31006
43	Ga0055528_1001073	3300003790	Bacteria	18018
44	Ga0055528_1001278	3300003790	Bacteria	15830
45	Ga0055528_1004959	3300003790	Bacteria	6286
46	Ga0055528_1008289	3300003790	Bacteria	4481
47	Ga0055528_1009902	3300003790	Bacteria	3935
48	Ga0055540_1000453	3300003792	Bacteria	31964
49	Ga0055540_1012926	3300003792	Bacteria	2584
50	Ga0055540_1014246	3300003792	Bacteria	2380
51	Ga0055543_1000002	3300004625	Bacteria	390020
52	Ga0055543_1000077	3300004625	Bacteria	86457
53	Ga0055543_1000327	3300004625	Bacteria	32674
54	Ga0055543_1000724	3300004625	Bacteria	16747
55	Ga0065165_1000391	3300005262	Bacteria	71184
56	Ga0065165_1001070	3300005262	Bacteria	32674
57	Ga0065165_1002901	3300005262	Bacteria	13155
58	Ga0065165_1007649	3300005262	Bacteria	5251
59	Ga0070667_100154458	3300005367	Bacteria	2018
60	Ga0070672_100190340	3300005543	Bacteria	1713
61	Ga0070686_100168657	3300005544	Bacteria	1547
62	Ga0068859_100079371	3300005617	Bacteria	3322
63	Ga0075365_10010430	3300006038	Bacteria	5412
64	Ga0075363_100017342	3300006048	Bacteria	3569
65	Ga0075363_100043457	3300006048	Bacteria	2377
66	Ga0075364_10001547	3300006051	Bacteria	12560
67	Ga0075362_10004788	3300006177	Bacteria	4886
68	Ga0075367_10001098	3300006178	Bacteria	11176
69	Ga0075367_10004828	3300006178	Bacteria	6641
70	Ga0075369_10001520	3300006186	Bacteria	7936
71	Ga0075369_10001769	3300006186	Bacteria	7506
72	Ga0075366_10013184	3300006195	Bacteria	4700
73	Ga0075370_10000872	3300006353	Bacteria	12280
74	Ga0075430_100174030	3300006846	Bacteria	1791
75	Ga0075431_100106022	3300006847	Bacteria	2899
76	Ga0097620_100079379	3300006931	Bacteria	3322
77	Ga0079104_1002416	3300006946	Bacteria	10116
78	Ga0105251_10008359	3300009011	Bacteria	6242
79	Ga0111539_10057483	3300009094	Bacteria	4619
80	Ga0105247_10120067	3300009101	Bacteria	1702
81	Ga0114129_10031725	3300009147	Bacteria	7469
82	Ga0105243_10174750	3300009148	Bacteria	1863
83	Ga0105248_10065699	3300009177	Bacteria	4073
84	Ga0105249_10020779	3300009553	Bacteria	5870
85	Ga0105249_10116548	3300009553	Bacteria	2532
86	Ga0123341_1000016	3300009765	Bacteria	85309
87	Ga0123342_1015171	3300009766	Bacteria	7106
88	Ga0123342_1029220	3300009766	Bacteria	2884
89	Ga0105246_10239240	3300011119	Bacteria	1434
90	Ga0163162_10196355	3300013306	Bacteria	2147
91	Ga0157375_10301383	3300013308	Bacteria	1766
92	Ga0183363_1066	3300015690	Bacteria	32430
93	Ga0214544_1000951	3300021320	Bacteria	57462
94	Ga0214542_1000082	3300021321	Bacteria	120825
95	Ga0214542_1015269	3300021321	Bacteria	8105
96	Ga0214543_1000005	3300021327	Bacteria	454523
97	Ga0214543_1000075	3300021327	Bacteria	120861
98	Ga0228710_1000036	3300022740	Bacteria	91904
99	Ga0209436_100072	3300025208	Bacteria	51104
100	Ga0209436_100151	3300025208	Bacteria	33281
101	Ga0207425_1000070	3300025245	Bacteria	116438
102	Ga0207425_1001166	3300025245	Bacteria	11746
103	Ga0207425_1004275	3300025245	Bacteria	4332
104	Ga0207425_1019047	3300025245	Bacteria	1483
105	Ga0209129_1000080	3300025258	Bacteria	186416
106	Ga0209129_1000172	3300025258	Bacteria	95144
107	Ga0209129_1000232	3300025258	Bacteria	61645
108	Ga0209129_1000681	3300025258	Bacteria	22426
109	Ga0209129_1000773	3300025258	Bacteria	20269
110	Ga0209129_1002313	3300025258	Bacteria	9462
111	Ga0209129_1010305	3300025258	Bacteria	2349
112	Ga0209673_1000037	3300025273	Bacteria	313804
113	Ga0209673_1000060	3300025273	Bacteria	263602
114	Ga0209673_1000312	3300025273	Bacteria	89594
115	Ga0209673_1000439	3300025273	Bacteria	71645
116	Ga0209673_1000649	3300025273	Bacteria	51399
117	Ga0209673_1001880	3300025273	Bacteria	16931
118	Ga0209673_1002838	3300025273	Bacteria	11114
119	Ga0209673_1003212	3300025273	Bacteria	9895
120	Ga0209130_1000030	3300025284	Bacteria	323323
121	Ga0209130_1000032	3300025284	Bacteria	316240
122	Ga0209130_1000054	3300025284	Bacteria	212299
123	Ga0209675_1022270	3300025291	Bacteria	1669
124	Ga0209025_1000042	3300025294	Bacteria	370577
125	Ga0209025_1000083	3300025294	Bacteria	265556
126	Ga0209025_1000389	3300025294	Bacteria	90997
127	Ga0209025_1000607	3300025294	Bacteria	64560
128	Ga0209025_1003801	3300025294	Bacteria	13805
129	Ga0209025_1004418	3300025294	Bacteria	12232
130	Ga0209025_1004571	3300025294	Bacteria	11892
131	Ga0209025_1007712	3300025294	Bacteria	7938
132	Ga0209025_1010917	3300025294	Bacteria	6076
133	Ga0209025_1013652	3300025294	Bacteria	5082
134	Ga0209564_1000116	3300025295	Bacteria	207889
135	Ga0209564_1000125	3300025295	Bacteria	201709
136	Ga0209564_1000281	3300025295	Bacteria	104019
137	Ga0209564_1000929	3300025295	Bacteria	38046
138	Ga0209564_1002913	3300025295	Bacteria	12449
139	Ga0209564_1016609	3300025295	Bacteria	2915
140	Ga0209758_1000090	3300025297	Bacteria	246564
141	Ga0209758_1000357	3300025297	Bacteria	82792
142	Ga0209758_1000892	3300025297	Bacteria	40679
143	Ga0209758_1001670	3300025297	Bacteria	25082
144	Ga0209758_1002917	3300025297	Bacteria	16481
145	Ga0209758_1002964	3300025297	Bacteria	16280
146	Ga0209758_1009382	3300025297	Bacteria	6092
147	Ga0209256_1000583	3300025299	Bacteria	51552
148	Ga0209256_1000854	3300025299	Bacteria	37992
149	Ga0209256_1000951	3300025299	Bacteria	35127
150	Ga0209256_1001251	3300025299	Bacteria	27992
151	Ga0209256_1002135	3300025299	Bacteria	17093
152	Ga0209256_1003037	3300025299	Bacteria	12384
153	Ga0209256_1003087	3300025299	Bacteria	12224
154	Ga0207426_1000047	3300025302	Bacteria	417011
155	Ga0207426_1000077	3300025302	Bacteria	316246
156	Ga0207426_1000127	3300025302	Bacteria	212942
157	Ga0207426_1000268	3300025302	Bacteria	109321
158	Ga0207426_1001666	3300025302	Bacteria	17230
159	Ga0209051_1000371	3300025303	Bacteria	64402
160	Ga0209051_1002253	3300025303	Bacteria	14170
161	Ga0209051_1009628	3300025303	Bacteria	4960
162	Ga0209051_1015370	3300025303	Bacteria	3524
163	Ga0209051_1018276	3300025303	Bacteria	3105
164	Ga0209257_1005871	3300025304	Bacteria	8295
165	Ga0209257_1021331	3300025304	Bacteria	2356
166	Ga0207713_1041760	3300025735	Bacteria	1910
167	Ga0207644_10262752	3300025931	Bacteria	1381
168	Ga0207712_10137221	3300025961	Bacteria	1872
169	Ga0207658_10173480	3300025986	Bacteria	1779
170	Ga0207675_100049478	3300026118	Bacteria	3923
171	Ga0209281_1000178	3300027111	Bacteria	148152
172	Ga0209281_1001139	3300027111	Bacteria	18837
173	Ga0209282_1000023	3300027666	Bacteria	173309
174	Ga0209813_10018269	3300027866	Bacteria	1935
175	Ga0209974_10000993	3300027876	Bacteria	9980
176	Ga0307515_10000136	3300028794	Bacteria	174265
177	Ga0307515_10001888	3300028794	Bacteria	46615
178	Ga0307515_10064178	3300028794	Bacteria	5138
179	Ga0307513_10000302	3300031456	Bacteria	70793
180	Ga0307408_100063444	3300031548	Bacteria	2703
181	Ga0307410_10296268	3300031852	Bacteria	1275
182	Ga0307406_10006556	3300031901	Bacteria	6432
183	Ga0307412_10008274	3300031911	Bacteria	5929
184	Ga0315914_1000016	3300031967	Bacteria	126814
185	Ga0307416_100233206	3300032002	Bacteria	1776
186	Ga0315913_1000027	3300033430	Bacteria	83484
187	Ga0315915_1000007	3300033464	Bacteria	319225
188	Ga0395905_0011751	3300037471	Bacteria	8453
189	Ga0439436_0001089	3300041404	Bacteria	7656
190	Ga0439465_0004670	3300041413	Bacteria	4419
191	Ga0439465_0010673	3300041413	Bacteria	2883
192	Ga0439465_0015411	3300041413	Bacteria	2385
193	Ga0451787_119152	3300041441	Bacteria	4950
194	Ga0451833_0216090	3300041491	Bacteria	2961
195	Ga0451835_0294140	3300041492	Bacteria	3980
196	Ga0451841_0840310	3300041498	Bacteria	3400
197	Ga0451851_0064447	3300041507	Bacteria	1372
198	Ga0451853_3464945	3300041512	Bacteria	2609
199	Ga0452268_09318	3300041907	Bacteria	1859
200	Ga0439449_0016541	3300042007	Bacteria	2772
201	Ga0439462_0010520	3300042015	Bacteria	2344
202	Ga0450920_003695	3300042122	Bacteria	2662
203	Ga0439460_0047138	3300042461	Bacteria	1282
204	Ga0450918_004966	3300042531	Bacteria	2398
205	Ga0451577_0028605	3300042876	Bacteria	5038
206	Ga0453683_0000337	3300044673	Bacteria	57114
207	Ga0453683_0000421	3300044673	Bacteria	49219
208	Ga0453684_0007909	3300044712	Bacteria	19290
209	Ga0453684_0032252	3300044712	Bacteria	7338
210	Ga0453684_0033321	3300044712	Bacteria	7186
211	Ga0453684_0069234	3300044712	Bacteria	4476
212	Ga0466968_0021959	3300044735	Bacteria	2589
213	Ga0451576_0000780	3300045051	Bacteria	62647
214	Ga0495638_0000037	3300046460	Bacteria	261778
215	Ga0495638_0002245	3300046460	Bacteria	16025
216	Ga0495662_0009245	3300046476	Bacteria	4834
217	Ga0495664_0121748	3300046477	Bacteria	1578
218	Ga0495585_0070339	3300046492	Bacteria	1909
219	Ga0495607_0004670	3300046501	Bacteria	10025
220	Ga0495583_0005065	3300046506	Bacteria	9098
221	Ga0495583_0057196	3300046506	Bacteria	1755
222	Ga0495606_0149288	3300046507	Bacteria	1373
223	Ga0495610_0056009	3300046512	Bacteria	1898
224	Ga0495618_0095430	3300046514	Bacteria	1902
225	Ga0495620_0014229	3300046515	Bacteria	4050
226	Ga0495631_0001536	3300046518	Bacteria	13881
227	Ga0495632_0007830	3300046519	Bacteria	6650
228	Ga0495643_0000040	3300046522	Bacteria	234837
229	Ga0495643_0018582	3300046522	Bacteria	4036
230	Ga0495648_0072281	3300046524	Bacteria	1997
231	Ga0495587_0017879	3300046536	Bacteria	4398
232	Ga0495609_0005732	3300046538	Bacteria	6462
233	Ga0495633_0002333	3300046558	Bacteria	13490
234	Ga0495625_0000269	3300046660	Bacteria	80953
235	Ga0495625_0000961	3300046660	Bacteria	38394
236	Ga0495625_0021707	3300046660	Bacteria	4937
237	Ga0495625_0081358	3300046660	Bacteria	2254
238	Ga0495657_0073593	3300046675	Bacteria	2225
239	Ga0495600_0007376	3300046809	Bacteria	6723
240	Ga0495660_0000261	3300046810	Bacteria	50041
241	Ga0495660_0010832	3300046810	Bacteria	5294
242	Ga0495604_0159428	3300047317	Bacteria	1595
243	Ga0495681_0000092	3300047470	Bacteria	78660
244	Ga0495686_0085655	3300047472	Bacteria	1918
245	Ga0496106_0000326	3300048909	Bacteria	33680
246	Ga0496110_0086536	3300048913	Bacteria	2798
247	Ga0496116_0002925	3300048919	Bacteria	17426
248	Ga0496116_0035077	3300048919	Bacteria	3528
249	Ga0496121_0005299	3300048924	Bacteria	16600
250	Ga0496121_0009417	3300048924	Bacteria	11230
251	Ga0496121_0018198	3300048924	Bacteria	7101
252	Ga0496122_0011964	3300048925	Bacteria	8705
253	Ga0496122_0045481	3300048925	Bacteria	3411
254	Ga0496124_0005217	3300048927	Bacteria	14743
255	Ga0496124_0017242	3300048927	Bacteria	6813
256	Ga0496124_0020986	3300048927	Bacteria	6024
257	Ga0496125_0048726	3300048928	Bacteria	3529
258	Ga0495682_0000181	3300049460	Bacteria	52401
259	Ga0501300_006842	3300049523	Bacteria	1674
260	Ga0501031_0019233	3300049568	Bacteria	4446
261	Ga0501033_0003885	3300049570	Bacteria	12145
262	Ga0501033_0075890	3300049570	Bacteria	2467
263	Ga0501034_0048895	3300049571	Bacteria	4268
264	Ga0501034_0180844	3300049571	Bacteria	2073
265	Ga0501036_0086303	3300049572	Bacteria	2653
266	Ga0501037_0001083	3300049573	Bacteria	20206
267	Ga0501038_0004820	3300049574	Bacteria	12531
268	Ga0501038_0022898	3300049574	Bacteria	5592
269	Ga0501039_0008014	3300049575	Bacteria	8049
270	Ga0501040_0001772	3300049576	Bacteria	13875
271	Ga0501040_0075871	3300049576	Bacteria	2324
272	Ga0501041_0000264	3300049577	Bacteria	24842
273	Ga0501041_0067714	3300049577	Bacteria	2188
274	Ga0501041_0096669	3300049577	Bacteria	1826
275	Ga0501042_0002240	3300049578	Bacteria	11793
276	Ga0501042_0270093	3300049578	Bacteria	1228
277	Ga0501043_0010479	3300049579	Bacteria	7259
278	Ga0501043_0177511	3300049579	Bacteria	1660
279	Ga0501046_0006165	3300049580	Bacteria	10647
280	Ga0501046_0020804	3300049580	Bacteria	5420
281	Ga0501047_0339053	3300049581	Bacteria	1341
282	Ga0501048_0016258	3300049582	Bacteria	5485
283	Ga0501048_0037356	3300049582	Bacteria	3487
284	Ga0501068_0002210	3300049584	Bacteria	10355
285	Ga0501068_0180315	3300049584	Bacteria	1335
286	Ga0501070_0021666	3300049586	Bacteria	5388
287	Ga0501071_0005303	3300049587	Bacteria	8268
288	Ga0501072_0002910	3300049588	Bacteria	12882
289	Ga0501072_0076419	3300049588	Bacteria	2649
290	Ga0501073_0008666	3300049589	Bacteria	7535
291	Ga0501074_0011777	3300049590	Bacteria	6357
292	Ga0501075_0006453	3300049591	Bacteria	8073
293	Ga0501075_0036342	3300049591	Bacteria	3676
294	Ga0501076_0007101	3300049592	Bacteria	8137
295	Ga0501076_0212894	3300049592	Bacteria	1579
296	Ga0501077_0008805	3300049593	Bacteria	6262
297	Ga0501079_0001546	3300049741	Bacteria	16305
298	Ga0501079_0047156	3300049741	Bacteria	3324
299	Ga0501079_0082885	3300049741	Bacteria	2480
300	Ga0501080_0006128	3300049742	Bacteria	10785
301	Ga0501081_0004236	3300049743	Bacteria	9187
302	Ga0501081_0025123	3300049743	Bacteria	4005
303	Ga0501081_0027908	3300049743	Bacteria	3805
304	Ga0501081_0085497	3300049743	Bacteria	2214
305	Ga0501083_0022675	3300049744	Bacteria	4356
306	Ga0501083_0129916	3300049744	Bacteria	1651
307	Ga0501035_0009717	3300049822	Bacteria	8948
308	Ga0501035_0020466	3300049822	Bacteria	6075
309	Ga0501044_0147967	3300049823	Bacteria	2332
310	Ga0501045_0001563	3300049824	Bacteria	15245
311	nmdc:mga03683_5879_c1	3300050489	Bacteria	3852
312	nmdc:mga0yw44_11450_c1	3300050492	Bacteria	4580
313	nmdc:mga0k408_48462_c1	3300050493	Bacteria	2458
314	nmdc:mga05p37_409888_c1	3300050507	Bacteria	1580
315	Ga0495601_0054246	3300053077	Bacteria	2536
316	Ga0495619_0064809	3300053085	Bacteria	2437
317	Ga0500569_008856	3300053109	Bacteria	2316
318	Ga0500658_0000868	3300053134	Bacteria	12408
319	Ga0500568_0006210	3300053139	Bacteria	6033
320	Ga0500573_0000214	3300053140	Bacteria	23741
321	Ga0500573_0000771	3300053140	Bacteria	14381
322	Ga0500590_083010	3300053148	Bacteria	1570
323	Ga0500616_0006118	3300053153	Bacteria	7963
324	Ga0500622_0000918	3300053156	Bacteria	25056
325	Ga0500633_0000709	3300053160	Bacteria	5636
326	Ga0500636_0046387	3300053177	Bacteria	2562
327	Ga0501084_0000249	3300054114	Bacteria	40750
328	Ga0501084_0172140	3300054114	Bacteria	1827
329	Ga0501082_0005764	3300060353	Bacteria	10749
330	Ga0501082_0007795	3300060353	Bacteria	9240
331	Ga0501082_0299931	3300060353	Bacteria	1399
332	Ga0530510_0005071	3300061734	Bacteria	9086
333	Ga0530510_0032115	3300061734	Bacteria	3775
334	Ga0530510_0044308	3300061734	Bacteria	3215
335	Ga0530510_0072831	3300061734	Bacteria	2493
336	Ga0530510_0099847	3300061734	Bacteria	2122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044673	Ga0453683_0000421	Ga0453683_0000421_24503_25561	327
2	3300061734	Ga0530510_0032115	Ga0530510_0032115_2645_3646	330
3	3300049574	Ga0501038_0004820	Ga0501038_0004820_1763_2827	335
4	3300044712	Ga0453684_0032252	Ga0453684_0032252_2334_3410	337
5	3300044712	Ga0453684_0069234	Ga0453684_0069234_614_1690	337
6	iso_pu_bacteria	3000017691	3000021229	337
7	3300005544	Ga0070686_100168657	Ga0070686_1001686571	339
8	3300005617	Ga0068859_100079371	Ga0068859_1000793714	339
9	3300006846	Ga0075430_100174030	Ga0075430_1001740302	339
10	3300006931	Ga0097620_100079379	Ga0097620_1000793792	339
11	3300009094	Ga0111539_10057483	Ga0111539_100574837	339
12	3300009101	Ga0105247_10120067	Ga0105247_101200672	339
13	3300009147	Ga0114129_10031725	Ga0114129_100317259	339
14	3300009553	Ga0105249_10116548	Ga0105249_101165482	339
15	3300011119	Ga0105246_10239240	Ga0105246_102392401	339
16	3300013306	Ga0163162_10196355	Ga0163162_101963552	339
17	3300026118	Ga0207675_100049478	Ga0207675_1000494782	339
18	3300037471	Ga0395905_0011751	Ga0395905_0011751_2303_3397	339
19	3300044712	Ga0453684_0033321	Ga0453684_0033321_2078_3124	339
20	3300049577	Ga0501041_0096669	Ga0501041_0096669_258_1286	339
21	3300049578	Ga0501042_0270093	Ga0501042_0270093_91_1119	339
22	3300049584	Ga0501068_0180315	Ga0501068_0180315_242_1270	339
23	3300049591	Ga0501075_0036342	Ga0501075_0036342_2608_3636	339
24	3300049592	Ga0501076_0212894	Ga0501076_0212894_82_1110	339
25	3300049741	Ga0501079_0047156	Ga0501079_0047156_1787_2815	339
26	3300049743	Ga0501081_0025123	Ga0501081_0025123_2710_3738	339
27	3300060353	Ga0501082_0299931	Ga0501082_0299931_180_1208	339
28	3300061734	Ga0530510_0099847	Ga0530510_0099847_977_2005	339
29	iso_pu_bacteria	2757320392	2757571130	341
30	iso_pu_bacteria	2834578030	2834579127	341
31	iso_pu_bacteria	2840878972	2840882557	342
32	3300005367	Ga0070667_100154458	Ga0070667_1001544582	343
33	3300005543	Ga0070672_100190340	Ga0070672_1001903402	343
34	3300013308	Ga0157375_10301383	Ga0157375_103013832	343
35	3300025931	Ga0207644_10262752	Ga0207644_102627521	343
36	3300025986	Ga0207658_10173480	Ga0207658_101734802	343
37	3300044673	Ga0453683_0000337	Ga0453683_0000337_46323_47372	343
38	3300044712	Ga0453684_0007909	Ga0453684_0007909_9842_10891	343
39	3300045051	Ga0451576_0000780	Ga0451576_0000780_9769_10818	343
40	3300050507	nmdc:mga05p37_409888_c1	nmdc:mga05p37_409888_c1_21_1061	343
41	3300032002	Ga0307416_100233206	Ga0307416_1002332062	344
42	3300049570	Ga0501033_0075890	Ga0501033_0075890_1006_2103	346
43	3300049572	Ga0501036_0086303	Ga0501036_0086303_570_1667	346
44	3300049575	Ga0501039_0008014	Ga0501039_0008014_3450_4547	346
45	3300049576	Ga0501040_0001772	Ga0501040_0001772_9847_10944	346
46	3300049576	Ga0501040_0075871	Ga0501040_0075871_457_1533	346
47	3300049577	Ga0501041_0000264	Ga0501041_0000264_13824_14921	346
48	3300049578	Ga0501042_0002240	Ga0501042_0002240_5976_7073	346
49	3300049579	Ga0501043_0177511	Ga0501043_0177511_302_1399	346
50	3300049580	Ga0501046_0020804	Ga0501046_0020804_1485_2582	346
51	3300049582	Ga0501048_0016258	Ga0501048_0016258_1756_2853	346
52	3300049587	Ga0501071_0005303	Ga0501071_0005303_4622_5719	346
53	3300049588	Ga0501072_0002910	Ga0501072_0002910_8438_9535	346
54	3300049591	Ga0501075_0006453	Ga0501075_0006453_5104_6201	346
55	3300049592	Ga0501076_0007101	Ga0501076_0007101_4899_5996	346
56	3300049593	Ga0501077_0008805	Ga0501077_0008805_4385_5482	346
57	3300049741	Ga0501079_0001546	Ga0501079_0001546_2009_3106	346
58	3300049742	Ga0501080_0006128	Ga0501080_0006128_4570_5667	346
59	3300049743	Ga0501081_0004236	Ga0501081_0004236_3309_4406	346
60	3300049743	Ga0501081_0085497	Ga0501081_0085497_924_2000	346
61	3300049744	Ga0501083_0129916	Ga0501083_0129916_335_1432	346
62	3300049822	Ga0501035_0009717	Ga0501035_0009717_2642_3739	346
63	3300049824	Ga0501045_0001563	Ga0501045_0001563_9547_10644	346
64	3300054114	Ga0501084_0000249	Ga0501084_0000249_19062_20159	346
65	3300060353	Ga0501082_0005764	Ga0501082_0005764_5181_6278	346
66	3300061734	Ga0530510_0005071	Ga0530510_0005071_4681_5778	346
67	3300061734	Ga0530510_0044308	Ga0530510_0044308_1606_2682	346
68	3300046512	Ga0495610_0056009	Ga0495610_0056009_12_1106	347
69	3300046810	Ga0495660_0010832	Ga0495660_0010832_3111_4205	347
70	3300046476	Ga0495662_0009245	Ga0495662_0009245_2746_3810	348
71	3300046514	Ga0495618_0095430	Ga0495618_0095430_524_1588	348
72	3300046522	Ga0495643_0000040	Ga0495643_0000040_57079_58143	348
73	3300046524	Ga0495648_0072281	Ga0495648_0072281_284_1348	348
74	3300046675	Ga0495657_0073593	Ga0495657_0073593_358_1422	348
75	3300046809	Ga0495600_0007376	Ga0495600_0007376_3319_4383	348
76	3300047317	Ga0495604_0159428	Ga0495604_0159428_312_1376	348
77	3300053085	Ga0495619_0064809	Ga0495619_0064809_492_1556	348
78	3300053148	Ga0500590_083010	Ga0500590_083010_93_1157	348
79	3300053177	Ga0500636_0046387	Ga0500636_0046387_311_1375	348
80	iso_pu_bacteria	2818991439	2819558362	348
81	iso_pu_bacteria	2821123053	2821125200	348
82	3300049571	Ga0501034_0180844	Ga0501034_0180844_192_1268	349
83	iso_pu_bacteria	2513237159	2513998397	349
84	iso_pu_bacteria	2582581283	2585166609	349
85	iso_pu_bacteria	2582581306	2585267052	349
86	iso_pu_bacteria	2582581865	2585388093	349
87	iso_pu_bacteria	2643221607	2644052335	349
88	iso_pu_bacteria	2643221636	2644201282	349
89	iso_pu_bacteria	2643221686	2644484613	349
90	iso_pu_bacteria	2643221689	2644499402	349
91	iso_pu_bacteria	2842521101	2842524575	349
92	3300003771	Ga0055526_1012057	Ga0055526_10120574	350
93	3300003775	Ga0055524_1003538	Ga0055524_10035385	350
94	3300003790	Ga0055528_1000497	Ga0055528_10004972	350
95	3300009148	Ga0105243_10174750	Ga0105243_101747502	350
96	3300025273	Ga0209673_1000037	Ga0209673_1000037166	350
97	3300025294	Ga0209025_1007712	Ga0209025_10077123	350
98	3300025295	Ga0209564_1002913	Ga0209564_10029136	350
99	3300025299	Ga0209256_1001251	Ga0209256_100125111	350
100	3300042876	Ga0451577_0028605	Ga0451577_0028605_3257_4330	350
101	3300048924	Ga0496121_0005299	Ga0496121_0005299_13056_14162	350
102	3300048925	Ga0496122_0045481	Ga0496122_0045481_1151_2248	350
103	iso_pu_bacteria	2582581866	2585396551	350
104	iso_pu_bacteria	2599185156	2599335783	350
105	iso_pu_bacteria	2842922631	2842926429	350
106	iso_pu_bacteria	2919679072	2919679733	350
107	3300031911	Ga0307412_10008274	Ga0307412_100082741	351
108	iso_pu_bacteria	2643221688	2644494981	351
109	3300002773	JGI25152J39213_1005342	JGI25152J39213_10053425	352
110	3300002774	JGI25150J39212_1000230	JGI25150J39212_100023029	352
111	3300002774	JGI25150J39212_1000388	JGI25150J39212_100038817	352
112	3300003187	JGI25151J46595_10000031	JGI25151J46595_10000031165	352
113	3300003215	JGI25153J46596_10000937	JGI25153J46596_1000093715	352
114	3300025245	Ga0207425_1000070	Ga0207425_100007055	352
115	3300025258	Ga0209129_1000172	Ga0209129_100017255	352
116	3300025258	Ga0209129_1000232	Ga0209129_100023214	352
117	3300025273	Ga0209673_1001880	Ga0209673_100188012	352
118	3300025294	Ga0209025_1000083	Ga0209025_1000083208	352
119	3300025297	Ga0209758_1000090	Ga0209758_100009055	352
120	3300048919	Ga0496116_0002925	Ga0496116_0002925_4393_5508	352
121	3300048925	Ga0496122_0011964	Ga0496122_0011964_5844_6959	352
122	iso_pu_bacteria	2643221558	2643812401	352
123	iso_pu_bacteria	2643221637	2644209560	352
124	iso_pu_bacteria	2643221718	2644653088	352
125	iso_pu_bacteria	2791355253	2793281778	352
126	3300027876	Ga0209974_10000993	Ga0209974_100009939	353
127	3300028794	Ga0307515_10000136	Ga0307515_1000013653	353
128	3300031456	Ga0307513_10000302	Ga0307513_1000030217	353
129	3300041404	Ga0439436_0001089	Ga0439436_0001089_962_2029	353
130	3300041413	Ga0439465_0015411	Ga0439465_0015411_547_1614	353
131	3300042015	Ga0439462_0010520	Ga0439462_0010520_496_1563	353
132	3300042122	Ga0450920_003695	Ga0450920_003695_266_1333	353
133	3300042531	Ga0450918_004966	Ga0450918_004966_929_1996	353
134	3300046660	Ga0495625_0021707	Ga0495625_0021707_3080_4144	353
135	iso_pu_bacteria	8057132660	8057133645	353
136	3300006847	Ga0075431_100106022	Ga0075431_1001060221	354
137	3300028794	Ga0307515_10001888	Ga0307515_100018883	354
138	3300031852	Ga0307410_10296268	Ga0307410_102962681	354
139	3300049568	Ga0501031_0019233	Ga0501031_0019233_2512_3666	354
140	3300049570	Ga0501033_0003885	Ga0501033_0003885_254_1408	354
141	3300049573	Ga0501037_0001083	Ga0501037_0001083_12768_13922	354
142	3300049574	Ga0501038_0022898	Ga0501038_0022898_1087_2241	354
143	3300049577	Ga0501041_0067714	Ga0501041_0067714_773_1927	354
144	3300049579	Ga0501043_0010479	Ga0501043_0010479_562_1716	354
145	3300049580	Ga0501046_0006165	Ga0501046_0006165_789_1943	354
146	3300049582	Ga0501048_0037356	Ga0501048_0037356_1899_3053	354
147	3300049584	Ga0501068_0002210	Ga0501068_0002210_8448_9602	354
148	3300049586	Ga0501070_0021666	Ga0501070_0021666_542_1696	354
149	3300049588	Ga0501072_0076419	Ga0501072_0076419_475_1629	354
150	3300049589	Ga0501073_0008666	Ga0501073_0008666_6259_7413	354
151	3300049590	Ga0501074_0011777	Ga0501074_0011777_435_1589	354
152	3300049741	Ga0501079_0082885	Ga0501079_0082885_1097_2251	354
153	3300049743	Ga0501081_0027908	Ga0501081_0027908_2240_3394	354
154	3300049744	Ga0501083_0022675	Ga0501083_0022675_769_1923	354
155	3300049822	Ga0501035_0020466	Ga0501035_0020466_284_1438	354
156	3300049823	Ga0501044_0147967	Ga0501044_0147967_1140_2294	354
157	3300053140	Ga0500573_0000214	Ga0500573_0000214_7132_8202	354
158	3300054114	Ga0501084_0172140	Ga0501084_0172140_274_1428	354
159	3300060353	Ga0501082_0007795	Ga0501082_0007795_839_1993	354
160	3300061734	Ga0530510_0072831	Ga0530510_0072831_475_1629	354
161	3300053140	Ga0500573_0000771	Ga0500573_0000771_12391_13464	355
162	iso_pu_bacteria	2690316117	2692319135	355
163	iso_pu_bacteria	2847417321	2847422359	355
164	iso_pu_bacteria	2848992105	2848998191	355
165	iso_pu_bacteria	2855020534	2855021537	355
166	iso_pu_bacteria	2855872281	2855875742	355
167	iso_pu_bacteria	643692032	643823716	355
168	iso_pu_bacteria	8018150411	8018151139	355
169	3300041413	Ga0439465_0004670	Ga0439465_0004670_136_1257	356
170	3300042007	Ga0439449_0016541	Ga0439449_0016541_417_1538	356
171	3300046810	Ga0495660_0000261	Ga0495660_0000261_31591_32697	356
172	iso_pu_bacteria	2920760137	2920764332	356
173	3300046460	Ga0495638_0000037	Ga0495638_0000037_118920_120029	357
174	3300046477	Ga0495664_0121748	Ga0495664_0121748_384_1475	357
175	3300046492	Ga0495585_0070339	Ga0495585_0070339_225_1334	357
176	3300046501	Ga0495607_0004670	Ga0495607_0004670_5055_6164	357
177	3300046506	Ga0495583_0057196	Ga0495583_0057196_99_1208	357
178	3300046522	Ga0495643_0018582	Ga0495643_0018582_716_1825	357
179	3300046536	Ga0495587_0017879	Ga0495587_0017879_2915_4006	357
180	3300046538	Ga0495609_0005732	Ga0495609_0005732_5028_6137	357
181	3300046558	Ga0495633_0002333	Ga0495633_0002333_8860_10008	357
182	3300046660	Ga0495625_0000269	Ga0495625_0000269_3655_4758	357
183	3300046660	Ga0495625_0000961	Ga0495625_0000961_3206_4315	357
184	3300047470	Ga0495681_0000092	Ga0495681_0000092_12077_13225	357
185	3300049460	Ga0495682_0000181	Ga0495682_0000181_47829_48932	357
186	3300053077	Ga0495601_0054246	Ga0495601_0054246_1036_2127	357
187	iso_pu_bacteria	2896384573	2896388223	357
188	iso_pu_bacteria	2936381700	2936382249	357
189	iso_pu_bacteria	3003930520	3003930936	357
190	iso_pu_bacteria	8056875544	8056878527	357
191	3300003354	JGI25160J50197_1006153	JGI25160J50197_10061535	358
192	iso_pu_bacteria	2508501122	2509110281	358
193	iso_pu_bacteria	2509276019	2509377247	358
194	iso_pu_bacteria	2510065057	2510302610	358
195	iso_pu_bacteria	2511231052	2511497642	358
196	iso_pu_bacteria	2512047086	2512530078	358
197	iso_pu_bacteria	2512875026	2512969682	358
198	iso_pu_bacteria	2513237086	2513581761	358
199	iso_pu_bacteria	2513237089	2513603163	358
200	iso_pu_bacteria	2513237091	2513618344	358
201	iso_pu_bacteria	2513237093	2513631335	358
202	iso_pu_bacteria	2513237140	2513883771	358
203	iso_pu_bacteria	2513237143	2513902124	358
204	iso_pu_bacteria	2513237146	2513926927	358
205	iso_pu_bacteria	2513237156	2513985233	358
206	iso_pu_bacteria	2513237160	2514004467	358
207	iso_pu_bacteria	2515154107	2515612761	358
208	iso_pu_bacteria	2516143018	2516206762	358
209	iso_pu_bacteria	2516653046	2516896693	358
210	iso_pu_bacteria	2516653077	2517037539	358
211	iso_pu_bacteria	2517487022	2517565440	358
212	iso_pu_bacteria	2524023207	2524451506	358
213	iso_pu_bacteria	2551306084	2551677160	358
214	iso_pu_bacteria	2551306085	2551682993	358
215	iso_pu_bacteria	2551306086	2551693890	358
216	iso_pu_bacteria	2551306087	2551702680	358
217	iso_pu_bacteria	2551306089	2551712962	358
218	iso_pu_bacteria	2551306090	2551721273	358
219	iso_pu_bacteria	2551306090	2551722773	358
220	iso_pu_bacteria	2551306091	2551725461	358
221	iso_pu_bacteria	2551306092	2551733704	358
222	iso_pu_bacteria	2551306093	2551745261	358
223	iso_pu_bacteria	2558860100	2558862228	358
224	iso_pu_bacteria	2599185170	2599420579	358
225	iso_pu_bacteria	2643221599	2644006433	358
226	iso_pu_bacteria	2718217882	2719182580	358
227	iso_pu_bacteria	2718217997	2719666892	358
228	iso_pu_bacteria	2718218009	2719733299	358
229	iso_pu_bacteria	2718218199	2720493312	358
230	iso_pu_bacteria	2718218232	2720614787	358
231	iso_pu_bacteria	2718218233	2720621559	358
232	iso_pu_bacteria	2718218235	2720632887	358
233	iso_pu_bacteria	2718218269	2720776611	358
234	iso_pu_bacteria	2718218363	2721148693	358
235	iso_pu_bacteria	2718218366	2721165507	358
236	iso_pu_bacteria	2721755514	2722841677	358
237	iso_pu_bacteria	2721755556	2723028199	358
238	iso_pu_bacteria	2721755684	2723561830	358
239	iso_pu_bacteria	2721755685	2723568459	358
240	iso_pu_bacteria	2721755810	2724046055	358
241	iso_pu_bacteria	2721755819	2724091218	358
242	iso_pu_bacteria	2721755822	2724105724	358
243	iso_pu_bacteria	2721755823	2724111553	358
244	iso_pu_bacteria	2724679232	2725945485	358
245	iso_pu_bacteria	2728369352	2730109135	358
246	iso_pu_bacteria	2728369365	2730165815	358
247	iso_pu_bacteria	2751185821	2753462886	358
248	iso_pu_bacteria	2791355091	2792621591	358
249	iso_pu_bacteria	2791355092	2792627722	358
250	iso_pu_bacteria	2791355094	2792640317	358
251	iso_pu_bacteria	2791355264	2793347354	358
252	iso_pu_bacteria	2791355266	2793359718	358
253	iso_pu_bacteria	2802428858	2802716108	358
254	iso_pu_bacteria	2802428859	2802722854	358
255	iso_pu_bacteria	2802428860	2802729001	358
256	iso_pu_bacteria	2802428861	2802735395	358
257	iso_pu_bacteria	2802428862	2802742029	358
258	iso_pu_bacteria	2802428863	2802748479	358
259	iso_pu_bacteria	2838016132	2838019088	358
260	iso_pu_bacteria	2838035591	2838040747	358
261	iso_pu_bacteria	2838048938	2838051194	358
262	iso_pu_bacteria	2838061910	2838063830	358
263	iso_pu_bacteria	2838068647	2838073313	358
264	iso_pu_bacteria	2838074704	2838075775	358
265	iso_pu_bacteria	2838661181	2838664865	358
266	iso_pu_bacteria	2838680041	2838684977	358
267	iso_pu_bacteria	2838694306	2838699186	358
268	iso_pu_bacteria	2838707686	2838712667	358
269	iso_pu_bacteria	2842077413	2842082144	358
270	iso_pu_bacteria	2842118031	2842123066	358
271	iso_pu_bacteria	2842217011	2842220097	358
272	iso_pu_bacteria	2842237096	2842242031	358
273	iso_pu_bacteria	2842264693	2842266593	358
274	iso_pu_bacteria	2842285085	2842288814	358
275	iso_pu_bacteria	2842291075	2842296144	358
276	iso_pu_bacteria	2842311132	2842315580	358
277	iso_pu_bacteria	2842370503	2842375655	358
278	iso_pu_bacteria	2842377471	2842382543	358
279	iso_pu_bacteria	2842384541	2842389944	358
280	iso_pu_bacteria	2842402390	2842406519	358
281	iso_pu_bacteria	2842409023	2842413054	358
282	iso_pu_bacteria	2842415677	2842419697	358
283	iso_pu_bacteria	2842422224	2842426948	358
284	iso_pu_bacteria	2842428310	2842429912	358
285	iso_pu_bacteria	2842434925	2842436428	358
286	iso_pu_bacteria	2842441272	2842444131	358
287	iso_pu_bacteria	2842447887	2842451011	358
288	iso_pu_bacteria	2842462802	2842464333	358
289	iso_pu_bacteria	2842469257	2842470757	358
290	iso_pu_bacteria	2842482326	2842483407	358
291	iso_pu_bacteria	2850079185	2850085385	358
292	iso_pu_bacteria	2855825444	2855828473	358
293	iso_pu_bacteria	2858800743	2858807151	358
294	iso_pu_bacteria	2915980308	2915983805	358
295	iso_pu_bacteria	2915986958	2915992152	358
296	iso_pu_bacteria	2915993759	2915996573	358
297	iso_pu_bacteria	2916000859	2916007415	358
298	iso_pu_bacteria	2916007675	2916009928	358
299	iso_pu_bacteria	2916014648	2916015330	358
300	iso_pu_bacteria	2916021584	2916025533	358
301	iso_pu_bacteria	2916028427	2916029849	358
302	iso_pu_bacteria	2916035215	2916037836	358
303	iso_pu_bacteria	2916041962	2916043590	358
304	iso_pu_bacteria	2916048683	2916051737	358
305	iso_pu_bacteria	2916055098	2916057873	358
306	iso_pu_bacteria	2916061851	2916068410	358
307	iso_pu_bacteria	2916068649	2916073221	358
308	iso_pu_bacteria	2916076590	2916076852	358
309	iso_pu_bacteria	2921201388	2921204943	358
310	iso_pu_bacteria	2921208531	2921209114	358
311	iso_pu_bacteria	2921237296	2921241227	358
312	iso_pu_bacteria	2921244191	2921247319	358
313	iso_pu_bacteria	2921250672	2921257013	358
314	iso_pu_bacteria	2921257292	2921259801	358
315	iso_pu_bacteria	2921263974	2921266644	358
316	iso_pu_bacteria	2921282425	2921285084	358
317	iso_pu_bacteria	2921289301	2921296095	358
318	iso_pu_bacteria	2921296804	2921298561	358
319	iso_pu_bacteria	2924144063	2924150202	358
320	iso_pu_bacteria	2924150972	2924154344	358
321	iso_pu_bacteria	2924158325	2924162263	358
322	iso_pu_bacteria	2924165586	2924172416	358
323	iso_pu_bacteria	2924172951	2924174748	358
324	iso_pu_bacteria	2924179722	2924181945	358
325	iso_pu_bacteria	2924186466	2924188029	358
326	iso_pu_bacteria	2924193448	2924195672	358
327	iso_pu_bacteria	2924200457	2924206124	358
328	iso_pu_bacteria	2924207177	2924210609	358
329	iso_pu_bacteria	2924214083	2924218568	358
330	iso_pu_bacteria	2924221636	2924225115	358
331	iso_pu_bacteria	2924228884	2924231144	358
332	iso_pu_bacteria	2933016740	2933020996	358
333	iso_pu_bacteria	2933599457	2933603557	358
334	iso_pu_bacteria	2935894831	2935899752	358
335	iso_pu_bacteria	2936367885	2936374890	358
336	iso_pu_bacteria	2936375103	2936380581	358
337	iso_pu_bacteria	2936996657	2937001634	358
338	iso_pu_bacteria	2937002841	2937005479	358
339	iso_pu_bacteria	2937009748	2937014191	358
340	iso_pu_bacteria	2937016420	2937019116	358
341	iso_pu_bacteria	2937023124	2937026216	358
342	iso_pu_bacteria	2937029754	2937035125	358
343	iso_pu_bacteria	2937036028	2937038232	358
344	iso_pu_bacteria	2937042894	2937046974	358
345	iso_pu_bacteria	2937049772	2937053538	358
346	iso_pu_bacteria	2937056579	2937061835	358
347	iso_pu_bacteria	2937063883	2937064956	358
348	iso_pu_bacteria	2937071275	2937076823	358
349	iso_pu_bacteria	2937078374	2937084218	358
350	iso_pu_bacteria	2937084907	2937089714	358
351	iso_pu_bacteria	2937091812	2937098334	358
352	iso_pu_bacteria	2937098957	2937102870	358
353	iso_pu_bacteria	2937106411	2937111400	358
354	iso_pu_bacteria	2937113482	2937116545	358
355	iso_pu_bacteria	2937119839	2937120622	358
356	iso_pu_bacteria	2937126314	2937128880	358
357	iso_pu_bacteria	2957375807	2957378514	358
358	iso_pu_bacteria	2957382221	2957388161	358
359	iso_pu_bacteria	2957388812	2957392695	358
360	iso_pu_bacteria	2957395598	2957399067	358
361	iso_pu_bacteria	2957402308	2957408228	358
362	iso_pu_bacteria	2957408893	2957411406	358
363	iso_pu_bacteria	2957415311	2957416044	358
364	iso_pu_bacteria	2957422303	2957429323	358
365	iso_pu_bacteria	2957430029	2957433190	358
366	iso_pu_bacteria	2957437181	2957440033	358
367	iso_pu_bacteria	2957443900	2957444005	358
368	iso_pu_bacteria	2957450854	2957454792	358
369	iso_pu_bacteria	2957457609	2957461286	358
370	iso_pu_bacteria	2957464669	2957467635	358
371	iso_pu_bacteria	2957471148	2957475820	358
372	iso_pu_bacteria	2957478035	2957480581	358
373	iso_pu_bacteria	2957484790	2957487150	358
374	iso_pu_bacteria	2957491536	2957494841	358
375	iso_pu_bacteria	2957498199	2957500454	358
376	iso_pu_bacteria	2957505466	2957506440	358
377	iso_pu_bacteria	2960584000	2960584989	358
378	iso_pu_bacteria	2960591022	2960596596	358
379	iso_pu_bacteria	2960597568	2960598300	358
380	iso_pu_bacteria	2960603979	2960604530	358
381	iso_pu_bacteria	2960610863	2960613559	358
382	iso_pu_bacteria	2960617483	2960619691	358
383	iso_pu_bacteria	2960624210	2960624997	358
384	iso_pu_bacteria	2960631154	2960634493	358
385	iso_pu_bacteria	2960637947	2960644059	358
386	iso_pu_bacteria	2960645483	2960646433	358
387	iso_pu_bacteria	2960652885	2960656043	358
388	iso_pu_bacteria	2960660292	2960662675	358
389	iso_pu_bacteria	2960667422	2960670831	358
390	iso_pu_bacteria	2960674078	2960680437	358
391	iso_pu_bacteria	2960680706	2960683142	358
392	iso_pu_bacteria	2960687367	2960690689	358
393	iso_pu_bacteria	2960693952	2960698622	358
394	iso_pu_bacteria	2964607997	2964612108	358
395	iso_pu_bacteria	2964615318	2964618017	358
396	iso_pu_bacteria	2964621998	2964625162	358
397	iso_pu_bacteria	2964628898	2964631842	358
398	iso_pu_bacteria	2964636051	2964637237	358
399	iso_pu_bacteria	2964643177	2964644460	358
400	iso_pu_bacteria	2964649959	2964654115	358
401	iso_pu_bacteria	2964656573	2964660344	358
402	iso_pu_bacteria	2964663802	2964666643	358
403	iso_pu_bacteria	2964670856	2964671428	358
404	iso_pu_bacteria	2964678106	2964679516	358
405	iso_pu_bacteria	2964685014	2964685698	358
406	iso_pu_bacteria	2964691889	2964694890	358
407	iso_pu_bacteria	2964698721	2964703336	358
408	iso_pu_bacteria	2964705432	2964708893	358
409	iso_pu_bacteria	2964712639	2964713217	358
410	iso_pu_bacteria	2964719344	2964725079	358
411	iso_pu_bacteria	2967664464	2967669535	358
412	iso_pu_bacteria	2967671571	2967675475	358
413	iso_pu_bacteria	2967678726	2967679812	358
414	iso_pu_bacteria	2967686174	2967687831	358
415	iso_pu_bacteria	2967693043	2967696850	358
416	iso_pu_bacteria	2967699805	2967706672	358
417	iso_pu_bacteria	2967706974	2967709405	358
418	iso_pu_bacteria	2967714385	2967717065	358
419	iso_pu_bacteria	2967721400	2967723622	358
420	iso_pu_bacteria	2967728569	2967728915	358
421	iso_pu_bacteria	2967735183	2967737797	358
422	iso_pu_bacteria	2967742019	2967745755	358
423	iso_pu_bacteria	2967748971	2967755142	358
424	iso_pu_bacteria	2967755722	2967759071	358
425	iso_pu_bacteria	2967762386	2967764997	358
426	iso_pu_bacteria	2967769361	2967774936	358
427	iso_pu_bacteria	2967775926	2967780577	358
428	iso_pu_bacteria	2970019648	2970020328	358
429	iso_pu_bacteria	2970026789	2970032063	358
430	iso_pu_bacteria	2970033650	2970034174	358
431	iso_pu_bacteria	2970040964	2970044429	358
432	iso_pu_bacteria	2970047711	2970053845	358
433	iso_pu_bacteria	2970054988	2970055338	358
434	iso_pu_bacteria	2970061556	2970064249	358
435	iso_pu_bacteria	2970068827	2970069360	358
436	iso_pu_bacteria	2970076120	2970078317	358
437	iso_pu_bacteria	2970082768	2970083875	358
438	iso_pu_bacteria	2970088815	2970090261	358
439	iso_pu_bacteria	2970095765	2970098335	358
440	iso_pu_bacteria	2970102677	2970105566	358
441	iso_pu_bacteria	2970109326	2970109709	358
442	iso_pu_bacteria	2970116247	2970120047	358
443	iso_pu_bacteria	2970122695	2970125054	358
444	iso_pu_bacteria	2970129317	2970132988	358
445	iso_pu_bacteria	2970136068	2970137257	358
446	iso_pu_bacteria	2970143518	2970143839	358
447	iso_pu_bacteria	2970149975	2970156143	358
448	iso_pu_bacteria	2970156795	2970160531	358
449	iso_pu_bacteria	2970164137	2970170300	358
450	iso_pu_bacteria	2970170962	2970177828	358
451	iso_pu_bacteria	2970177841	2970179588	358
452	iso_pu_bacteria	2970184632	2970185882	358
453	iso_pu_bacteria	2970191845	2970195616	358
454	iso_pu_bacteria	2977516862	2977518732	358
455	iso_pu_bacteria	2977523885	2977523935	358
456	iso_pu_bacteria	2977523885	2977524158	358
457	iso_pu_bacteria	2977530762	2977532766	358
458	iso_pu_bacteria	2977537788	2977540176	358
459	iso_pu_bacteria	2977544691	2977547864	358
460	iso_pu_bacteria	2977551784	2977555542	358
461	iso_pu_bacteria	2977558990	2977565432	358
462	iso_pu_bacteria	2977565890	2977569443	358
463	iso_pu_bacteria	2977572785	2977573020	358
464	iso_pu_bacteria	2977579622	2977583303	358
465	iso_pu_bacteria	639633055	639649979	358
466	iso_pu_bacteria	648276728	648740271	358
467	iso_pu_bacteria	8003992118	8003996164	358
468	iso_pu_bacteria	8003999396	8004003922	358
469	iso_pu_bacteria	8005282627	8005288969	358
470	iso_pu_bacteria	8005376324	8005382808	358
471	iso_pu_bacteria	8005430974	8005434139	358
472	iso_pu_bacteria	8005497431	8005501644	358
473	iso_pu_bacteria	8005563573	8005566755	358
474	iso_pu_bacteria	8005619151	8005623000	358
475	iso_pu_bacteria	8005626139	8005631697	358
476	iso_pu_bacteria	8005668836	8005673066	358
477	iso_pu_bacteria	8018163183	8018170199	358
478	iso_pu_bacteria	8024479707	8024481928	358
479	iso_pu_bacteria	8054558443	8054560191	358
480	iso_pu_bacteria	8057874678	8057876803	358
481	3300041507	Ga0451851_0064447	Ga0451851_0064447_225_1304	359
482	iso_pu_bacteria	2509276021	2509386464	359
483	iso_pu_bacteria	2509276021	2509389859	359
484	iso_pu_bacteria	2509276033	2509447890	359
485	iso_pu_bacteria	2510065019	2510134824	359
486	iso_pu_bacteria	2510461076	2510896232	359
487	iso_pu_bacteria	2510917028	2511185109	359
488	iso_pu_bacteria	2513237084	2513572589	359
489	iso_pu_bacteria	2513237085	2513580181	359
490	iso_pu_bacteria	2513237088	2513597157	359
491	iso_pu_bacteria	2513237103	2513710764	359
492	iso_pu_bacteria	2513237138	2513868119	359
493	iso_pu_bacteria	2513237162	2514022353	359
494	iso_pu_bacteria	2515075009	2515113909	359
495	iso_pu_bacteria	2515154113	2515637018	359
496	iso_pu_bacteria	2515154114	2515643048	359
497	iso_pu_bacteria	2515154116	2515656795	359
498	iso_pu_bacteria	2515154134	2515743735	359
499	iso_pu_bacteria	2516653085	2517077827	359
500	iso_pu_bacteria	2517093000	2517096624	359
501	iso_pu_bacteria	2517287029	2517410339	359
502	iso_pu_bacteria	2519899620	2520377920	359
503	iso_pu_bacteria	2529292951	2530646935	359
504	iso_pu_bacteria	2534681796	2535519453	359
505	iso_pu_bacteria	2582581294	2585202489	359
506	iso_pu_bacteria	2582581299	2585227811	359
507	iso_pu_bacteria	2582581867	2585402201	359
508	iso_pu_bacteria	2585427526	2585529096	359
509	iso_pu_bacteria	2585427528	2585541036	359
510	iso_pu_bacteria	2585427590	2585822499	359
511	iso_pu_bacteria	2585427593	2585839798	359
512	iso_pu_bacteria	2615840624	2616295539	359
513	iso_pu_bacteria	2643221634	2644195882	359
514	iso_pu_bacteria	2643221643	2644241845	359
515	iso_pu_bacteria	2643221668	2644376059	359
516	iso_pu_bacteria	2643221723	2644675313	359
517	iso_pu_bacteria	2718217927	2719387254	359
518	iso_pu_bacteria	2718218365	2721160079	359
519	iso_pu_bacteria	2718218423	2721400889	359
520	iso_pu_bacteria	2721755809	2724039702	359
521	iso_pu_bacteria	2728369397	2730299711	359
522	iso_pu_bacteria	2738541333	2739035590	359
523	iso_pu_bacteria	2765235942	2766065339	359
524	iso_pu_bacteria	2791355256	2793293661	359
525	iso_pu_bacteria	2791355259	2793313091	359
526	iso_pu_bacteria	2791355260	2793319737	359
527	iso_pu_bacteria	2791355261	2793327757	359
528	iso_pu_bacteria	2791355262	2793333355	359
529	iso_pu_bacteria	2791355263	2793342108	359
530	iso_pu_bacteria	2791355265	2793353677	359
531	iso_pu_bacteria	2791355267	2793369471	359
532	iso_pu_bacteria	2802429605	2805929382	359
533	iso_pu_bacteria	2802429606	2805935428	359
534	iso_pu_bacteria	2802429633	2806044578	359
535	iso_pu_bacteria	2802429634	2806052778	359
536	iso_pu_bacteria	2802429635	2806059078	359
537	iso_pu_bacteria	2802429636	2806068259	359
538	iso_pu_bacteria	2802429637	2806074379	359
539	iso_pu_bacteria	2838022645	2838024317	359
540	iso_pu_bacteria	2838042994	2838046244	359
541	iso_pu_bacteria	2838668709	2838671161	359
542	iso_pu_bacteria	2838686498	2838691339	359
543	iso_pu_bacteria	2838701080	2838703660	359
544	iso_pu_bacteria	2838729681	2838733298	359
545	iso_pu_bacteria	2838742623	2838746130	359
546	iso_pu_bacteria	2841851746	2841853842	359
547	iso_pu_bacteria	2841864319	2841868188	359
548	iso_pu_bacteria	2842110456	2842113453	359
549	iso_pu_bacteria	2842146304	2842149339	359
550	iso_pu_bacteria	2842156927	2842162151	359
551	iso_pu_bacteria	2842163707	2842169931	359
552	iso_pu_bacteria	2842180545	2842185077	359
553	iso_pu_bacteria	2842192696	2842198277	359
554	iso_pu_bacteria	2842198810	2842199860	359
555	iso_pu_bacteria	2842205361	2842208289	359
556	iso_pu_bacteria	2842229732	2842233515	359
557	iso_pu_bacteria	2842243621	2842247608	359
558	iso_pu_bacteria	2842250916	2842254024	359
559	iso_pu_bacteria	2842257432	2842262124	359
560	iso_pu_bacteria	2842271015	2842275813	359
561	iso_pu_bacteria	2842278818	2842281702	359
562	iso_pu_bacteria	2842304105	2842308203	359
563	iso_pu_bacteria	2842317721	2842321411	359
564	iso_pu_bacteria	2842341865	2842344986	359
565	iso_pu_bacteria	2842363717	2842370033	359
566	iso_pu_bacteria	2842395702	2842398527	359
567	iso_pu_bacteria	2842489311	2842493253	359
568	iso_pu_bacteria	2842495871	2842499177	359
569	iso_pu_bacteria	2844454524	2844457513	359
570	iso_pu_bacteria	2857516855	2857518921	359
571	iso_pu_bacteria	2899803654	2899804551	359
572	iso_pu_bacteria	2913295892	2913296669	359
573	iso_pu_bacteria	2923556063	2923562868	359
574	iso_pu_bacteria	2933570622	2933574652	359
575	iso_pu_bacteria	2933586486	2933589257	359
576	iso_pu_bacteria	2935901341	2935907574	359
577	iso_pu_bacteria	2989349275	2989354854	359
578	iso_pu_bacteria	2996887358	2996889182	359
579	iso_pu_bacteria	2996893221	2996896356	359
580	iso_pu_bacteria	3005452660	3005455546	359
581	iso_pu_bacteria	8005258706	8005264240	359
582	iso_pu_bacteria	8005275841	8005281999	359
583	iso_pu_bacteria	8005289223	8005294291	359
584	iso_pu_bacteria	8005307578	8005309367	359
585	iso_pu_bacteria	8005321885	8005323709	359
586	iso_pu_bacteria	8005382845	8005383860	359
587	iso_pu_bacteria	8005395548	8005401185	359
588	iso_pu_bacteria	8005460587	8005464596	359
589	iso_pu_bacteria	8005542996	8005547143	359
590	iso_pu_bacteria	8005556819	8005558401	359
591	iso_pu_bacteria	8005570704	8005574964	359
592	iso_pu_bacteria	8005695170	8005700848	359
593	iso_pu_bacteria	8018127388	8018133633	359
594	iso_pu_bacteria	8018176218	8018178481	359
595	iso_pu_bacteria	8023680758	8023687568	359
596	iso_pu_bacteria	8024501048	8024505964	359
597	iso_pu_bacteria	8056375014	8056381564	359
598	iso_pu_bacteria	8056382006	8056386996	359
599	3300002773	JGI25152J39213_1003086	JGI25152J39213_10030864	360
600	3300003187	JGI25151J46595_10003775	JGI25151J46595_100037753	360
601	3300025258	Ga0209129_1000080	Ga0209129_1000080158	360
602	3300025294	Ga0209025_1000607	Ga0209025_100060719	360
603	3300025303	Ga0209051_1009628	Ga0209051_10096285	360
604	3300046507	Ga0495606_0149288	Ga0495606_0149288_200_1297	360
605	3300047472	Ga0495686_0085655	Ga0495686_0085655_589_1686	360
606	iso_pu_bacteria	2510917030	2511198422	360
607	iso_pu_bacteria	2513237144	2513908205	360
608	iso_pu_bacteria	2582581298	2585224802	360
609	iso_pu_bacteria	2582581304	2585257810	360
610	iso_pu_bacteria	2585427529	2585547358	360
611	iso_pu_bacteria	2585427594	2585845348	360
612	iso_pu_bacteria	2599185352	2600195106	360
613	iso_pu_bacteria	2643221557	2643805467	360
614	iso_pu_bacteria	2643221610	2644068280	360
615	iso_pu_bacteria	2643221618	2644110339	360
616	iso_pu_bacteria	2643221626	2644144885	360
617	iso_pu_bacteria	2643221655	2644307091	360
618	iso_pu_bacteria	2643221659	2644336988	360
619	iso_pu_bacteria	2643221675	2644419206	360
620	iso_pu_bacteria	2643221680	2644452563	360
621	iso_pu_bacteria	2643221698	2644540692	360
622	iso_pu_bacteria	2643221712	2644613171	360
623	iso_pu_bacteria	2643221726	2644691337	360
624	iso_pu_bacteria	2657244999	2657683428	360
625	iso_pu_bacteria	2738541293	2738800457	360
626	iso_pu_bacteria	2791355082	2792580155	360
627	iso_pu_bacteria	2802429268	2804754626	360
628	iso_pu_bacteria	2844163670	2844165430	360
629	iso_pu_bacteria	2919100787	2919104544	360
630	iso_pu_bacteria	2920822456	2920828206	360
631	iso_pu_bacteria	2941499720	2941502962	360
632	iso_pu_bacteria	3005409236	3005415506	360
633	iso_pu_bacteria	3005445848	3005449256	360
634	iso_pu_bacteria	8045864390	8045865460	360
635	iso_pu_bacteria	8049293176	8049298558	360
636	3300003215	JGI25153J46596_10009197	JGI25153J46596_100091971	362
637	3300003354	JGI25160J50197_1000006	JGI25160J50197_100000663	362
638	3300003374	JGI25161J50226_1000004	JGI25161J50226_100000463	362
639	3300003790	Ga0055528_1001278	Ga0055528_10012782	362
640	3300003792	Ga0055540_1014246	Ga0055540_10142462	362
641	3300004625	Ga0055543_1000002	Ga0055543_1000002271	362
642	3300005262	Ga0065165_1000391	Ga0065165_100039139	362
643	3300006946	Ga0079104_1002416	Ga0079104_10024167	362
644	3300021321	Ga0214542_1015269	Ga0214542_10152692	362
645	3300021327	Ga0214543_1000005	Ga0214543_1000005235	362
646	3300022740	Ga0228710_1000036	Ga0228710_100003629	362
647	3300025258	Ga0209129_1000681	Ga0209129_100068119	362
648	3300025284	Ga0209130_1000032	Ga0209130_100003259	362
649	3300025297	Ga0209758_1000357	Ga0209758_100035749	362
650	3300025302	Ga0207426_1000077	Ga0207426_100007759	362
651	3300025303	Ga0209051_1002253	Ga0209051_100225310	362
652	3300027111	Ga0209281_1000178	Ga0209281_100017890	362
653	3300027111	Ga0209281_1001139	Ga0209281_100113914	362
654	3300027666	Ga0209282_1000023	Ga0209282_1000023116	362
655	3300031548	Ga0307408_100063444	Ga0307408_1000634444	362
656	3300031967	Ga0315914_1000016	Ga0315914_100001673	362
657	3300033430	Ga0315913_1000027	Ga0315913_100002721	362
658	3300033464	Ga0315915_1000007	Ga0315915_1000007151	362
659	3300042461	Ga0439460_0047138	Ga0439460_0047138_24_1226	362
660	3300048924	Ga0496121_0018198	Ga0496121_0018198_5137_6237	362
661	3300002773	JGI25152J39213_1009079	JGI25152J39213_10090793	363
662	3300002987	JGI25159J45721_1000144	JGI25159J45721_100014430	363
663	3300003187	JGI25151J46595_10001231	JGI25151J46595_100012317	363
664	3300003215	JGI25153J46596_10003317	JGI25153J46596_100033171	363
665	3300003215	JGI25153J46596_10006057	JGI25153J46596_100060576	363
666	3300003354	JGI25160J50197_1000299	JGI25160J50197_100029911	363
667	3300003354	JGI25160J50197_1000918	JGI25160J50197_100091810	363
668	3300003374	JGI25161J50226_1000786	JGI25161J50226_10007866	363
669	3300003374	JGI25161J50226_1002462	JGI25161J50226_10024627	363
670	3300003771	Ga0055526_1001243	Ga0055526_100124311	363
671	3300003771	Ga0055526_1002116	Ga0055526_10021162	363
672	3300003771	Ga0055526_1005050	Ga0055526_10050505	363
673	3300003771	Ga0055526_1010662	Ga0055526_10106624	363
674	3300003775	Ga0055524_1004660	Ga0055524_10046601	363
675	3300003775	Ga0055524_1013917	Ga0055524_10139172	363
676	3300003775	Ga0055524_1014150	Ga0055524_10141501	363
677	3300003775	Ga0055524_1016666	Ga0055524_10166662	363
678	3300003790	Ga0055528_1001073	Ga0055528_100107311	363
679	3300003790	Ga0055528_1004959	Ga0055528_10049596	363
680	3300003790	Ga0055528_1008289	Ga0055528_10082896	363
681	3300003790	Ga0055528_1009902	Ga0055528_10099025	363
682	3300003792	Ga0055540_1000453	Ga0055540_10004539	363
683	3300003792	Ga0055540_1012926	Ga0055540_10129264	363
684	3300004625	Ga0055543_1000327	Ga0055543_100032730	363
685	3300004625	Ga0055543_1000724	Ga0055543_10007243	363
686	3300005262	Ga0065165_1001070	Ga0065165_100107030	363
687	3300005262	Ga0065165_1007649	Ga0065165_10076493	363
688	3300006038	Ga0075365_10010430	Ga0075365_100104306	363
689	3300006048	Ga0075363_100017342	Ga0075363_1000173423	363
690	3300006048	Ga0075363_100043457	Ga0075363_1000434572	363
691	3300006051	Ga0075364_10001547	Ga0075364_1000154710	363
692	3300006177	Ga0075362_10004788	Ga0075362_100047886	363
693	3300006178	Ga0075367_10001098	Ga0075367_100010985	363
694	3300006178	Ga0075367_10004828	Ga0075367_100048288	363
695	3300006186	Ga0075369_10001520	Ga0075369_1000152011	363
696	3300006186	Ga0075369_10001769	Ga0075369_100017696	363
697	3300006195	Ga0075366_10013184	Ga0075366_100131843	363
698	3300006353	Ga0075370_10000872	Ga0075370_1000087210	363
699	3300009011	Ga0105251_10008359	Ga0105251_100083596	363
700	3300009177	Ga0105248_10065699	Ga0105248_100656994	363
701	3300009553	Ga0105249_10020779	Ga0105249_100207794	363
702	3300009765	Ga0123341_1000016	Ga0123341_100001631	363
703	3300009766	Ga0123342_1015171	Ga0123342_10151719	363
704	3300009766	Ga0123342_1029220	Ga0123342_10292203	363
705	3300021320	Ga0214544_1000951	Ga0214544_100095143	363
706	3300021321	Ga0214542_1000082	Ga0214542_100008259	363
707	3300021327	Ga0214543_1000075	Ga0214543_100007559	363
708	3300025208	Ga0209436_100151	Ga0209436_10015140	363
709	3300025245	Ga0207425_1004275	Ga0207425_10042754	363
710	3300025258	Ga0209129_1000773	Ga0209129_100077312	363
711	3300025258	Ga0209129_1010305	Ga0209129_10103053	363
712	3300025273	Ga0209673_1000060	Ga0209673_1000060192	363
713	3300025273	Ga0209673_1000312	Ga0209673_100031274	363
714	3300025273	Ga0209673_1000439	Ga0209673_100043960	363
715	3300025273	Ga0209673_1000649	Ga0209673_100064950	363
716	3300025273	Ga0209673_1003212	Ga0209673_10032129	363
717	3300025284	Ga0209130_1000054	Ga0209130_1000054183	363
718	3300025291	Ga0209675_1022270	Ga0209675_10222702	363
719	3300025294	Ga0209025_1000042	Ga0209025_1000042331	363
720	3300025294	Ga0209025_1000389	Ga0209025_100038927	363
721	3300025294	Ga0209025_1004571	Ga0209025_100457112	363
722	3300025294	Ga0209025_1010917	Ga0209025_10109178	363
723	3300025295	Ga0209564_1000116	Ga0209564_1000116192	363
724	3300025295	Ga0209564_1000125	Ga0209564_100012512	363
725	3300025295	Ga0209564_1000929	Ga0209564_100092911	363
726	3300025295	Ga0209564_1016609	Ga0209564_10166092	363
727	3300025297	Ga0209758_1000892	Ga0209758_100089221	363
728	3300025297	Ga0209758_1002917	Ga0209758_100291714	363
729	3300025297	Ga0209758_1009382	Ga0209758_10093824	363
730	3300025299	Ga0209256_1000854	Ga0209256_10008548	363
731	3300025299	Ga0209256_1000951	Ga0209256_100095114	363
732	3300025299	Ga0209256_1002135	Ga0209256_100213514	363
733	3300025299	Ga0209256_1003037	Ga0209256_10030379	363
734	3300025299	Ga0209256_1003087	Ga0209256_10030877	363
735	3300025302	Ga0207426_1000127	Ga0207426_1000127183	363
736	3300025302	Ga0207426_1000268	Ga0207426_100026857	363
737	3300025302	Ga0207426_1001666	Ga0207426_100166616	363
738	3300025303	Ga0209051_1000371	Ga0209051_100037125	363
739	3300025303	Ga0209051_1015370	Ga0209051_10153705	363
740	3300025303	Ga0209051_1018276	Ga0209051_10182761	363
741	3300025304	Ga0209257_1005871	Ga0209257_100587112	363
742	3300025735	Ga0207713_1041760	Ga0207713_10417602	363
743	3300025961	Ga0207712_10137221	Ga0207712_101372213	363
744	3300027866	Ga0209813_10018269	Ga0209813_100182693	363
745	3300028794	Ga0307515_10064178	Ga0307515_100641783	363
746	3300041441	Ga0451787_119152	Ga0451787_119152_837_1928	363
747	3300041491	Ga0451833_0216090	Ga0451833_0216090_918_2009	363
748	3300041492	Ga0451835_0294140	Ga0451835_0294140_1048_2139	363
749	3300041498	Ga0451841_0840310	Ga0451841_0840310_1666_2757	363
750	3300041512	Ga0451853_3464945	Ga0451853_3464945_1273_2364	363
751	3300041907	Ga0452268_09318	Ga0452268_09318_449_1540	363
752	3300044735	Ga0466968_0021959	Ga0466968_0021959_358_1491	363
753	3300046460	Ga0495638_0002245	Ga0495638_0002245_191_1282	363
754	3300046506	Ga0495583_0005065	Ga0495583_0005065_1159_2376	363
755	3300046515	Ga0495620_0014229	Ga0495620_0014229_1295_2386	363
756	3300046518	Ga0495631_0001536	Ga0495631_0001536_12122_13213	363
757	3300046519	Ga0495632_0007830	Ga0495632_0007830_499_1590	363
758	3300046660	Ga0495625_0081358	Ga0495625_0081358_718_1809	363
759	3300048913	Ga0496110_0086536	Ga0496110_0086536_1440_2531	363
760	3300048927	Ga0496124_0020986	Ga0496124_0020986_1472_2563	363
761	3300049523	Ga0501300_006842	Ga0501300_006842_221_1324	363
762	3300049571	Ga0501034_0048895	Ga0501034_0048895_2332_3450	363
763	3300050489	nmdc:mga03683_5879_c1	nmdc:mga03683_5879_c1_2105_3196	363
764	3300050492	nmdc:mga0yw44_11450_c1	nmdc:mga0yw44_11450_c1_2648_3739	363
765	3300050493	nmdc:mga0k408_48462_c1	nmdc:mga0k408_48462_c1_704_1795	363
766	3300053109	Ga0500569_008856	Ga0500569_008856_409_1500	363
767	3300053134	Ga0500658_0000868	Ga0500658_0000868_96_1187	363
768	3300053153	Ga0500616_0006118	Ga0500616_0006118_6663_7775	363
769	iso_pu_bacteria	8005301065	8005306693	363
770	iso_pu_bacteria	8005688590	8005693611	363
771	3300002739	JGI25158J39367_1000234	JGI25158J39367_10002347	364
772	3300002773	JGI25152J39213_1003781	JGI25152J39213_10037814	364
773	3300002773	JGI25152J39213_1007069	JGI25152J39213_10070691	364
774	3300002774	JGI25150J39212_1012312	JGI25150J39212_10123122	364
775	3300002987	JGI25159J45721_1001732	JGI25159J45721_10017323	364
776	3300003187	JGI25151J46595_10011661	JGI25151J46595_100116613	364
777	3300003215	JGI25153J46596_10008193	JGI25153J46596_100081931	364
778	3300003215	JGI25153J46596_10016498	JGI25153J46596_100164981	364
779	3300003374	JGI25161J50226_1000477	JGI25161J50226_100047713	364
780	3300003771	Ga0055526_1001302	Ga0055526_100130213	364
781	3300003775	Ga0055524_1003458	Ga0055524_10034588	364
782	3300004625	Ga0055543_1000077	Ga0055543_100007773	364
783	3300005262	Ga0065165_1002901	Ga0065165_100290110	364
784	3300015690	Ga0183363_1066	Ga0183363_106624	364
785	3300025208	Ga0209436_100072	Ga0209436_10007229	364
786	3300025245	Ga0207425_1001166	Ga0207425_100116610	364
787	3300025245	Ga0207425_1019047	Ga0207425_10190471	364
788	3300025258	Ga0209129_1002313	Ga0209129_10023131	364
789	3300025273	Ga0209673_1002838	Ga0209673_100283811	364
790	3300025284	Ga0209130_1000030	Ga0209130_1000030186	364
791	3300025294	Ga0209025_1003801	Ga0209025_100380110	364
792	3300025294	Ga0209025_1004418	Ga0209025_100441812	364
793	3300025294	Ga0209025_1013652	Ga0209025_10136521	364
794	3300025295	Ga0209564_1000281	Ga0209564_100028137	364
795	3300025297	Ga0209758_1001670	Ga0209758_100167017	364
796	3300025297	Ga0209758_1002964	Ga0209758_100296417	364
797	3300025299	Ga0209256_1000583	Ga0209256_100058318	364
798	3300025302	Ga0207426_1000047	Ga0207426_1000047214	364
799	3300025304	Ga0209257_1021331	Ga0209257_10213314	364
800	3300031901	Ga0307406_10006556	Ga0307406_100065564	364
801	3300041413	Ga0439465_0010673	Ga0439465_0010673_1779_2873	364
802	3300048909	Ga0496106_0000326	Ga0496106_0000326_13130_14224	364
803	3300048919	Ga0496116_0035077	Ga0496116_0035077_464_1624	364
804	3300048924	Ga0496121_0009417	Ga0496121_0009417_7660_8820	364
805	3300048927	Ga0496124_0005217	Ga0496124_0005217_13447_14562	364
806	3300048927	Ga0496124_0017242	Ga0496124_0017242_932_2092	364
807	3300048928	Ga0496125_0048726	Ga0496125_0048726_1660_2820	364
808	3300049581	Ga0501047_0339053	Ga0501047_0339053_218_1312	364
809	3300053139	Ga0500568_0006210	Ga0500568_0006210_2020_3114	364
810	3300053156	Ga0500622_0000918	Ga0500622_0000918_12276_13436	364
811	3300053160	Ga0500633_0000709	Ga0500633_0000709_2925_4019	364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04332

DUF475

Protein of unknown function (DUF475)

110

398

0.97 PF03741

TerC

Integral membrane protein TerC family

99

219

0.92 PF03741

TerC

Integral membrane protein TerC family

210

367

0.84 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3j9u-assembly1.cif.gz_R	yeast v-atpase state 2	0.2745	126	347
6ivw-assembly1.cif.gz_E	crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation d269a	0.2735	13	315
7d5p-assembly1.cif.gz_A	structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody	0.2707	7	323
6ivw-assembly1.cif.gz_E	crystal structure of a bacterial bestrophin homolog from klebsiella pneumoniae with a mutation d269a	0.2682	13	315
5jag-assembly1.cif.gz_A	leut t354h mutant in the outward-oriented, na+-free return state	0.2632	9	348

ID	Description	Score	Start	End	Superfamily
af_P67127_16_204_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.6409	51	317	1.20.1250.20
af_P67127_16_204_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.6333	51	317	1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.6094	51	317	1.20.1250.20
af_Q2FZP3_16_220_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.6024	51	317	1.20.1250.20
af_K7KLR7_219_465_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.4138	43	323	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-A0A285D3X1-F1-model_v4	DUF475 domain-containing protein	0.9892	6	351	GO:0016020
AF-A0A291M4F0-F1-model_v4	DUF475 domain-containing protein	0.9884	6	352	GO:0016020
AF-A0A2W5SD69-F1-model_v4	DUF475 domain-containing protein	0.9863	1	358	GO:0016020
AF-A0A7G6S184-F1-model_v4	deleted	0.9853	1	349
AF-A0A369Q9F4-F1-model_v4	DUF475 domain-containing protein	0.985	9	355	GO:0016020

Feature Viewer

pLDDT	pTM	Quality
81.67	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F481843

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04332

DUF475

Protein of unknown function (DUF475)

110

398

0.97

PF03741

TerC

Integral membrane protein TerC family

99

219

0.92

PF03741

TerC

Integral membrane protein TerC family

210

367

0.84

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map