F481838

General Info

Members Datasets Scaffolds Average Seq Length
811 478 549 170

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10075304|Ga0105251_100753042
Length 170
Sequence MSAFHTVTPSQLDRAAFVAAFGGIYEHSAWVAERAFDEGQPLPDSVDALHQRLAAQVARASHAEQLALIQAHPDLAGRAALAGELTAASSGEQAGAGLDQCTPDELERFTRHNDAYRAKFGFPFIMAVKGSNRHLILAAFEERLPNSPEQEFQRALVEIDRIALFRLQTL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
4 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
5 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
6 2511231004 Pseudomonas sp. GM102 Isolate Nodule
7 2511231006 Pseudomonas sp. GM17 Isolate Nodule
8 2511231007 Pseudomonas sp. GM18 Isolate Nodule
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231010 Pseudomonas sp. GM25 Isolate Nodule
11 2511231011 Pseudomonas sp. GM30 Isolate Nodule
12 2511231012 Pseudomonas sp. GM33 Isolate Nodule
13 2511231014 Pseudomonas sp. GM48 Isolate Nodule
14 2511231015 Pseudomonas sp. GM49 Isolate Nodule
15 2511231016 Pseudomonas sp. GM50 Isolate Nodule
16 2511231017 Pseudomonas sp. GM55 Isolate Nodule
17 2511231018 Pseudomonas sp. GM60 Isolate Nodule
18 2511231019 Pseudomonas sp. GM67 Isolate Nodule
19 2511231020 Pseudomonas sp. GM74 Isolate Nodule
20 2511231021 Pseudomonas sp. GM78 Isolate Nodule
21 2511231022 Pseudomonas sp. GM79 Isolate Nodule
22 2511231023 Pseudomonas sp. GM80 Isolate Nodule
23 2511231024 Pseudomonas sp. GM84 Isolate Nodule
24 2511231031 Pseudomonas sp. GM16 Isolate Nodule
25 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
26 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
27 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
28 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
29 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
30 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
31 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
32 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
33 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
42 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
43 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
44 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
45 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
46 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
47 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
48 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
49 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
50 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
51 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
52 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
53 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
54 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
55 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
56 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
57 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
58 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
59 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
60 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
61 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
62 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
63 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
64 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
65 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
66 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
67 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
68 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
69 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
70 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
71 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
72 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
73 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
74 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
75 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
76 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
77 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
78 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
79 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
80 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
81 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
82 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
83 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
84 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
85 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
86 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
87 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
88 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
89 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
90 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
91 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
92 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
93 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
94 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
95 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
96 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
97 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
98 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
99 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
100 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
101 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
102 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
103 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
104 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
105 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
106 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
107 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
108 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
109 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
110 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
111 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
112 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
113 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
114 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
115 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
116 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
117 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
118 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
119 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
120 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
121 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
122 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
123 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
124 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
125 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
126 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
127 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
128 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
129 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
130 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
131 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
132 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
133 2765235841 Pseudomonas putida AA7 Isolate Unclassified
134 2773857670 Pseudomonas sp. 478 Isolate Unclassified
135 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
136 2773857673 Pseudomonas sp. 443 Isolate Unclassified
137 2784132063 Pseudomonas sp. 424 Isolate Unclassified
138 2784132072 Pseudomonas sp. 460 Isolate Unclassified
139 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
140 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
141 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
142 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
143 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
144 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
145 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
146 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
147 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
148 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
149 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
150 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
151 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
152 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
153 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
154 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
155 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
156 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
157 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
158 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
159 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
160 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
161 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
162 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
163 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
164 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
165 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
166 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
167 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
168 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
169 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
170 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
171 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
172 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
173 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
174 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
175 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
176 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
177 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
178 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
179 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
180 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
181 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
182 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
183 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
184 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
185 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
186 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
187 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
188 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
189 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
190 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
191 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
192 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
193 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
194 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
195 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
196 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
197 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
198 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
199 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
200 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
201 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
202 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
203 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
204 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
205 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
206 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
207 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
208 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
209 2952252522 Salinicola sp. DM10 Isolate Unclassified
210 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
211 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
212 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
213 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
214 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
215 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
216 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
217 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
218 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
219 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
220 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
221 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
222 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
223 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
224 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
225 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
226 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
227 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
228 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
229 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
230 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
231 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
232 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
233 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
234 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
235 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
236 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
237 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
238 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
239 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
240 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
241 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
242 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
243 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
244 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
245 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
246 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
247 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
248 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
249 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
250 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
251 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
252 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
253 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
254 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
255 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
256 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
257 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
258 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
259 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
260 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
261 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
262 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
263 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
264 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
265 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
266 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
267 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
268 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
269 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
270 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
271 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
272 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
273 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
276 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
281 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
282 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
283 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
284 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
285 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
286 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
287 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
288 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
289 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
290 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
294 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
295 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
296 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
297 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
298 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
299 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
301 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
302 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
303 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
325 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
327 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
335 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
336 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
338 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
340 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
341 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
342 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
343 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
344 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
345 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
346 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
347 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
348 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
349 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
350 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
351 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
352 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
353 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
354 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
355 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
356 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
357 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
358 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
359 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
360 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
361 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
362 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
363 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
364 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
365 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
366 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
367 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
368 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
369 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
370 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
371 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
372 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
373 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
374 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
375 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
376 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
377 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
378 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
379 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
380 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
381 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
382 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
383 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
384 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
385 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
386 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
387 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
388 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
389 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
392 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
393 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
394 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
395 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
396 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
397 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
398 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
399 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
400 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
401 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
402 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
403 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
404 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
405 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
406 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
407 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
408 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
409 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
410 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
411 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
412 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
413 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
414 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
415 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
416 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
420 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
421 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
422 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
423 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
424 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
425 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
426 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
427 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
428 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
429 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
430 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
431 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
434 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
435 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
436 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
437 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
438 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
439 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
440 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
441 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
442 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
443 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
445 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
446 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
447 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
448 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
449 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
450 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
451 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
452 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
453 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
454 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
455 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
456 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
457 8052494512 Pseudomonas putida LD6 Isolate Unclassified
458 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
459 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
460 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
461 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
462 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
463 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
464 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
465 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
466 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
467 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
468 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
469 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
470 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
471 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
472 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
473 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
474 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
475 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
476 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
477 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
478 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 67.69
Metatranscriptomes 0
Isolates 32.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 7.27
Nodule 3.7
Rhizoplane 9.37
Rhizosphere 62.15
Stem 0
Stem Tuber 0
Unclassified 17.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1423 2124908027 Bacteria 8802
2 MRS1b_contig_4601869 2162886011 Bacteria 1014
3 JGI25163J39215_1001125 3300002771 Bacteria 5362
4 JGI25163J39215_1001411 3300002771 Bacteria 4016
5 JGI25164J39214_1000194 3300002772 Bacteria 52332
6 JGI25164J39214_1000411 3300002772 Bacteria 24391
7 JGI25165J46597_1000348 3300003214 Bacteria 52332
8 JGI25165J46597_1000430 3300003214 Bacteria 42934
9 Ga0055539_1000120 3300003752 Bacteria 85355
10 Ga0055533_1000128 3300003756 Bacteria 85355
11 Ga0055532_1000116 3300003758 Bacteria 85351
12 Ga0055525_1000165 3300003759 Bacteria 85355
13 Ga0055535_1003799 3300003761 Bacteria 4020
14 Ga0055536_1071782 3300003781 Bacteria 681
15 Ga0055530_10000268 3300003791 Bacteria 47280
16 Ga0055530_10001257 3300003791 Bacteria 19223
17 Ga0055540_1000253 3300003792 Bacteria 48323
18 Ga0055540_1000298 3300003792 Bacteria 43855
19 Ga0055540_1000430 3300003792 Bacteria 33405
20 Ga0055531_10000997 3300003794 Bacteria 22497
21 Ga0055541_1000080 3300003841 Bacteria 85355
22 Ga0065714_10001019 3300005288 Bacteria 1895
23 Ga0065714_10005969 3300005288 Bacteria 9133
24 Ga0065714_10076746 3300005288 Bacteria 2759
25 Ga0065704_10073003 3300005289 Bacteria 7692
26 Ga0065704_10114638 3300005289 Bacteria 1887
27 Ga0065704_10246281 3300005289 Bacteria 988
28 Ga0065704_10247097 3300005289 Bacteria 956
29 Ga0065704_10284496 3300005289 Bacteria 907
30 Ga0065704_10449446 3300005289 Bacteria 696
31 Ga0065712_10004972 3300005290 Bacteria 7065
32 Ga0065712_10068987 3300005290 Bacteria 8366
33 Ga0065712_10095097 3300005290 Bacteria 2230
34 Ga0070670_100001579 3300005331 Bacteria 18361
35 Ga0070670_100004362 3300005331 Bacteria 11838
36 Ga0070661_100000343 3300005344 Bacteria 36992
37 Ga0070669_100001097 3300005353 Bacteria 19798
38 Ga0070671_100859735 3300005355 Bacteria 791
39 Ga0070674_101137646 3300005356 Bacteria 691
40 Ga0070714_100185812 3300005435 Bacteria 1893
41 Ga0070705_100421132 3300005440 Bacteria 994
42 Ga0070662_100000181 3300005457 Bacteria 36916
43 Ga0070662_101191659 3300005457 Bacteria 655
44 Ga0068853_100145154 3300005539 Bacteria 2132
45 Ga0070665_100113264 3300005548 Bacteria 2715
46 Ga0070665_100184076 3300005548 Bacteria 2090
47 Ga0070664_100000276 3300005564 Bacteria 36992
48 Ga0070664_100361269 3300005564 Bacteria 1322
49 Ga0068854_100074742 3300005578 Bacteria 2486
50 Ga0070702_100481030 3300005615 Bacteria 907
51 Ga0068851_10000189 3300005834 Bacteria 30711
52 Ga0075364_10284233 3300006051 Bacteria 1125
53 Ga0075432_10008167 3300006058 Bacteria 3569
54 Ga0075432_10090666 3300006058 Bacteria 1118
55 Ga0075362_10197523 3300006177 Bacteria 978
56 Ga0075362_10213614 3300006177 Bacteria 941
57 Ga0075369_10009062 3300006186 Bacteria 3854
58 Ga0099823_1000090 3300006944 Bacteria 43898
59 Ga0099823_1090138 3300006944 Bacteria 1055
60 Ga0079104_1000438 3300006946 Bacteria 47426
61 Ga0079104_1003103 3300006946 Bacteria 8089
62 Ga0099826_10003959 3300006948 Bacteria 10255
63 Ga0105251_10000143 3300009011 Bacteria 72715
64 Ga0105251_10002273 3300009011 Bacteria 15245
65 Ga0105251_10005771 3300009011 Bacteria 8030
66 Ga0105251_10005887 3300009011 Bacteria 7929
67 Ga0105251_10011662 3300009011 Bacteria 5011
68 Ga0105251_10036204 3300009011 Bacteria 2430
69 Ga0105251_10075304 3300009011 Bacteria 1567
70 Ga0105251_10116736 3300009011 Bacteria 1213
71 Ga0105251_10139051 3300009011 Bacteria 1099
72 Ga0105244_10001813 3300009036 Bacteria 16711
73 Ga0105244_10002865 3300009036 Bacteria 12779
74 Ga0105244_10008847 3300009036 Bacteria 6248
75 Ga0105244_10013166 3300009036 Bacteria 4845
76 Ga0105244_10017435 3300009036 Bacteria 4057
77 Ga0105244_10056131 3300009036 Bacteria 1994
78 Ga0105244_10058225 3300009036 Bacteria 1951
79 Ga0105244_10067281 3300009036 Bacteria 1792
80 Ga0105244_10073318 3300009036 Bacteria 1704
81 Ga0105244_10134049 3300009036 Bacteria 1194
82 Ga0105244_10220600 3300009036 Bacteria 889
83 Ga0105244_10232158 3300009036 Bacteria 863
84 Ga0105250_10000135 3300009092 Bacteria 64046
85 Ga0105250_10019099 3300009092 Bacteria 2771
86 Ga0105250_10021665 3300009092 Bacteria 2594
87 Ga0105250_10030771 3300009092 Bacteria 2158
88 Ga0105250_10143073 3300009092 Bacteria 992
89 Ga0105243_10000594 3300009148 Bacteria 36205
90 Ga0105243_10000989 3300009148 Bacteria 26429
91 Ga0105243_10249508 3300009148 Bacteria 1584
92 Ga0105243_11400451 3300009148 Bacteria 720
93 Ga0105242_10027379 3300009176 Bacteria 4526
94 Ga0105248_10646018 3300009177 Bacteria 1194
95 Ga0105237_10020387 3300009545 Bacteria 6836
96 Ga0105249_10447994 3300009553 Bacteria 1329
97 Ga0105246_10036932 3300011119 Bacteria 3276
98 Ga0105246_10126077 3300011119 Bacteria 1905
99 Ga0105246_10299014 3300011119 Bacteria 1298
100 Ga0157345_1000962 3300012498 Bacteria 2122
101 Ga0157373_10003004 3300013100 Bacteria 12762
102 Ga0157373_10010628 3300013100 Bacteria 6773
103 Ga0157373_10040889 3300013100 Bacteria 3317
104 Ga0157373_10047837 3300013100 Bacteria 3050
105 Ga0157373_10085111 3300013100 Bacteria 2228
106 Ga0157373_10341887 3300013100 Bacteria 1067
107 Ga0157371_10000053 3300013102 Bacteria 176879
108 Ga0157371_10001115 3300013102 Bacteria 29118
109 Ga0157371_10018986 3300013102 Bacteria 5075
110 Ga0157371_10069499 3300013102 Bacteria 2494
111 Ga0157371_10075188 3300013102 Bacteria 2392
112 Ga0157371_10248869 3300013102 Bacteria 1279
113 Ga0157371_10306640 3300013102 Bacteria 1150
114 Ga0157371_10744935 3300013102 Bacteria 735
115 Ga0157370_10000450 3300013104 Bacteria 51371
116 Ga0157370_10005784 3300013104 Bacteria 13816
117 Ga0157370_10194940 3300013104 Bacteria 1880
118 Ga0157370_10237020 3300013104 Bacteria 1689
119 Ga0157370_10493951 3300013104 Bacteria 1124
120 Ga0157370_10847918 3300013104 Bacteria 830
121 Ga0157369_10001060 3300013105 Bacteria 34676
122 Ga0157369_10291576 3300013105 Bacteria 1698
123 Ga0157369_10571041 3300013105 Bacteria 1168
124 Ga0163162_10320389 3300013306 Bacteria 1683
125 Ga0157372_10012392 3300013307 Bacteria 9088
126 Ga0157372_10254720 3300013307 Bacteria 2038
127 Ga0157375_10938728 3300013308 Bacteria 1007
128 Ga0182008_10000847 3300014497 Bacteria 21271
129 Ga0182006_1001080 3300015261 Bacteria 17480
130 Ga0182006_1063195 3300015261 Bacteria 1391
131 Ga0182006_1129836 3300015261 Bacteria 868
132 Ga0182007_10084166 3300015262 Bacteria 1044
133 Ga0182007_10137188 3300015262 Bacteria 826
134 Ga0182005_1070800 3300015265 Bacteria 958
135 Ga0163161_10221268 3300017792 Bacteria 1466
136 Ga0163161_10447986 3300017792 Bacteria 1043
137 Ga0209435_100930 3300025206 Bacteria 4363
138 Ga0209760_100011 3300025207 Bacteria 197221
139 Ga0209760_100064 3300025207 Bacteria 91180
140 Ga0209784_100017 3300025224 Bacteria 472003
141 Ga0209566_100014 3300025225 Bacteria 472003
142 Ga0209674_100028 3300025226 Bacteria 472003
143 Ga0209147_100105 3300025229 Bacteria 157437
144 Ga0209563_100032 3300025230 Bacteria 472003
145 Ga0209563_100542 3300025230 Bacteria 12694
146 Ga0207427_100008 3300025231 Bacteria 740731
147 Ga0207427_100082 3300025231 Bacteria 142809
148 Ga0209437_100006 3300025233 Bacteria 1042724
149 Ga0209437_100014 3300025233 Bacteria 740714
150 Ga0209437_112169 3300025233 Bacteria 1264
151 Ga0209258_100194 3300025242 Bacteria 124587
152 Ga0209646_1000337 3300025246 Bacteria 34943
153 Ga0209677_100018 3300025253 Bacteria 472003
154 Ga0209759_1005950 3300025256 Bacteria 4167
155 Ga0209233_1000008 3300025261 Bacteria 1356712
156 Ga0209233_1000105 3300025261 Bacteria 272035
157 Ga0209675_1010587 3300025291 Bacteria 3135
158 Ga0209676_1000006 3300025292 Bacteria 1039588
159 Ga0209676_1000369 3300025292 Bacteria 83704
160 Ga0209676_1000707 3300025292 Bacteria 46539
161 Ga0209676_1001433 3300025292 Bacteria 22532
162 Ga0209676_1004478 3300025292 Bacteria 7759
163 Ga0209050_1000235 3300025298 Bacteria 121420
164 Ga0209050_1000260 3300025298 Bacteria 113066
165 Ga0209050_1000380 3300025298 Bacteria 83704
166 Ga0209050_1003293 3300025298 Bacteria 12118
167 Ga0209051_1000086 3300025303 Bacteria 183550
168 Ga0209051_1000123 3300025303 Bacteria 144298
169 Ga0209051_1000163 3300025303 Bacteria 124249
170 Ga0209257_1000421 3300025304 Bacteria 81748
171 Ga0209257_1013320 3300025304 Bacteria 3675
172 Ga0209257_1037245 3300025304 Bacteria 1485
173 Ga0207656_10000073 3300025321 Bacteria 37162
174 Ga0207696_1000010 3300025711 Bacteria 534681
175 Ga0207696_1000025 3300025711 Bacteria 418650
176 Ga0207696_1000043 3300025711 Bacteria 307112
177 Ga0207696_1000267 3300025711 Bacteria 65100
178 Ga0207696_1030025 3300025711 Bacteria 1655
179 Ga0207696_1054677 3300025711 Bacteria 1134
180 Ga0207696_1079517 3300025711 Bacteria 906
181 Ga0207655_1000019 3300025728 Bacteria 536324
182 Ga0207655_1000407 3300025728 Bacteria 59248
183 Ga0207655_1001123 3300025728 Bacteria 26140
184 Ga0207655_1003958 3300025728 Bacteria 10737
185 Ga0207655_1004447 3300025728 Bacteria 9936
186 Ga0207655_1005649 3300025728 Bacteria 8460
187 Ga0207655_1006919 3300025728 Bacteria 7439
188 Ga0207655_1008671 3300025728 Bacteria 6418
189 Ga0207655_1032224 3300025728 Bacteria 2399
190 Ga0207655_1041679 3300025728 Bacteria 1965
191 Ga0207655_1066070 3300025728 Bacteria 1369
192 Ga0207655_1113664 3300025728 Bacteria 910
193 Ga0207655_1134320 3300025728 Bacteria 802
194 Ga0207713_1000058 3300025735 Bacteria 216911
195 Ga0207713_1000156 3300025735 Bacteria 102640
196 Ga0207713_1000778 3300025735 Bacteria 29456
197 Ga0207713_1005473 3300025735 Bacteria 7933
198 Ga0207713_1005616 3300025735 Bacteria 7800
199 Ga0207713_1012354 3300025735 Bacteria 4573
200 Ga0207713_1013252 3300025735 Bacteria 4356
201 Ga0207713_1013300 3300025735 Bacteria 4344
202 Ga0207713_1027576 3300025735 Bacteria 2578
203 Ga0207713_1035190 3300025735 Bacteria 2164
204 Ga0207713_1079530 3300025735 Bacteria 1183
205 Ga0207713_1095423 3300025735 Bacteria 1036
206 Ga0207671_10000353 3300025914 Bacteria 66171
207 Ga0207649_10000237 3300025920 Bacteria 45073
208 Ga0207681_10000368 3300025923 Bacteria 31879
209 Ga0207681_10037659 3300025923 Bacteria 3198
210 Ga0207650_10000552 3300025925 Bacteria 30432
211 Ga0207650_10001026 3300025925 Bacteria 20960
212 Ga0207664_10137706 3300025929 Bacteria 2062
213 Ga0207706_10001188 3300025933 Bacteria 26290
214 Ga0207686_10069024 3300025934 Bacteria 2266
215 Ga0207709_10000223 3300025935 Bacteria 71537
216 Ga0207709_10001419 3300025935 Bacteria 16783
217 Ga0207711_10439928 3300025941 Bacteria 1213
218 Ga0207679_10000005 3300025945 Bacteria 525011
219 Ga0207679_11460822 3300025945 Bacteria 627
220 Ga0207640_10019149 3300025981 Bacteria 4039
221 Ga0207639_10121154 3300026041 Bacteria 2149
222 Ga0207678_10671757 3300026067 Bacteria 911
223 Ga0209281_1000010 3300027111 Bacteria 726106
224 Ga0209281_1001764 3300027111 Bacteria 11037
225 Ga0209281_1002274 3300027111 Bacteria 8103
226 Ga0209973_1015471 3300027252 Bacteria 964
227 Ga0209389_1000018 3300027296 Bacteria 179898
228 Ga0209371_1001804 3300027312 Bacteria 13369
229 Ga0209371_1015619 3300027312 Bacteria 2032
230 Ga0209969_1027758 3300027360 Bacteria 858
231 Ga0209981_1012925 3300027378 Bacteria 1159
232 Ga0209981_1036933 3300027378 Bacteria 725
233 Ga0209984_1000511 3300027424 Bacteria 4260
234 Ga0209995_1016047 3300027471 Bacteria 1229
235 Ga0209999_1014054 3300027543 Bacteria 1452
236 Ga0209999_1042123 3300027543 Bacteria 856
237 Ga0209982_1000468 3300027552 Bacteria 4985
238 Ga0209282_1025268 3300027666 Bacteria 3716
239 Ga0209971_1070400 3300027682 Bacteria 849
240 Ga0209974_10006519 3300027876 Bacteria 4072
241 Ga0209974_10028184 3300027876 Bacteria 1859
242 Ga0207428_10018746 3300027907 Bacteria 5905
243 Ga0207428_10759616 3300027907 Bacteria 691
244 Ga0268266_10107387 3300028379 Bacteria 2468
245 Ga0268256_1001548 3300030500 Bacteria 13551
246 Ga0268256_1017328 3300030500 Bacteria 2032
247 Ga0316177_1033879 3300030731 Bacteria 1866
248 Ga0316179_1080649 3300030734 Bacteria 3572
249 Ga0316178_1037599 3300030735 Bacteria 9150
250 Ga0307408_100136536 3300031548 Bacteria 1919
251 Ga0307408_100165101 3300031548 Bacteria 1762
252 Ga0307405_10000107 3300031731 Bacteria 34106
253 Ga0307405_10123242 3300031731 Bacteria 1777
254 Ga0307405_10482737 3300031731 Bacteria 989
255 Ga0307405_10659627 3300031731 Bacteria 861
256 Ga0307413_10019906 3300031824 Bacteria 3558
257 Ga0307406_10232914 3300031901 Bacteria 1376
258 Ga0307407_10634779 3300031903 Bacteria 798
259 Ga0307412_10032963 3300031911 Bacteria 3287
260 Ga0307412_10070169 3300031911 Bacteria 2387
261 Ga0307412_10199713 3300031911 Bacteria 1517
262 Ga0307416_100332061 3300032002 Bacteria 1528
263 Ga0307414_10070250 3300032004 Bacteria 2521
264 Ga0307414_10402409 3300032004 Bacteria 1189
265 Ga0307411_10048226 3300032005 Bacteria 2759
266 Ga0307411_10356386 3300032005 Bacteria 1194
267 Ga0237819_00099 3300038705 Bacteria 31739
268 Ga0439436_0009362 3300041404 Bacteria 3003
269 Ga0439438_001978 3300041405 Bacteria 8955
270 Ga0439438_004427 3300041405 Bacteria 5392
271 Ga0439438_015714 3300041405 Bacteria 2217
272 Ga0439438_035665 3300041405 Bacteria 1306
273 Ga0439438_036601 3300041405 Bacteria 1286
274 Ga0439447_035471 3300041407 Bacteria 1236
275 Ga0439447_044289 3300041407 Bacteria 1076
276 Ga0439447_059995 3300041407 Bacteria 896
277 Ga0439466_0063129 3300041411 Bacteria 1189
278 Ga0439466_0065490 3300041411 Bacteria 1165
279 Ga0439466_0088225 3300041411 Bacteria 974
280 Ga0451791_0347004 3300041451 Bacteria 775
281 Ga0451797_1369733 3300041453 Bacteria 808
282 Ga0451841_0289499 3300041498 Bacteria 993
283 Ga0451853_1668893 3300041512 Bacteria 793
284 Ga0439431_0038190 3300041997 Bacteria 1214
285 Ga0439445_0027837 3300042004 Bacteria 1454
286 Ga0439432_000318 3300042006 Bacteria 17433
287 Ga0439432_037820 3300042006 Bacteria 1538
288 Ga0439432_050536 3300042006 Bacteria 1298
289 Ga0439432_073740 3300042006 Bacteria 1039
290 Ga0439451_048868 3300042009 Bacteria 846
291 Ga0439452_000884 3300042010 Bacteria 13802
292 Ga0439452_001254 3300042010 Bacteria 10764
293 Ga0439452_001351 3300042010 Bacteria 10189
294 Ga0439452_017974 3300042010 Bacteria 1890
295 Ga0439456_000351 3300042013 Bacteria 10372
296 Ga0439456_041043 3300042013 Bacteria 1002
297 Ga0439463_060482 3300042016 Bacteria 968
298 Ga0450911_000686 3300042115 Bacteria 10052
299 Ga0450900_010294 3300042136 Bacteria 1197
300 Ga0450902_002009 3300042137 Bacteria 2844
301 Ga0450905_004764 3300042142 Bacteria 1807
302 Ga0450907_031918 3300042146 Bacteria 896
303 Ga0439446_0091962 3300042156 Bacteria 950
304 Ga0450909_008435 3300042185 Bacteria 1499
305 Ga0439464_0001091 3300042439 Bacteria 6237
306 Ga0439460_0006234 3300042461 Bacteria 2952
307 Ga0450901_000610 3300042533 Bacteria 4197
308 Ga0495627_000013 3300046453 Bacteria 332765
309 Ga0495627_000455 3300046453 Bacteria 35556
310 Ga0495627_101350 3300046453 Bacteria 821
311 Ga0495603_0039940 3300046455 Bacteria 2810
312 Ga0495603_0461509 3300046455 Bacteria 727
313 Ga0495591_000020 3300046458 Bacteria 217845
314 Ga0495591_001165 3300046458 Bacteria 17173
315 Ga0495591_001196 3300046458 Bacteria 16933
316 Ga0495591_018551 3300046458 Bacteria 2357
317 Ga0495591_099844 3300046458 Bacteria 721
318 Ga0495638_0318628 3300046460 Bacteria 832
319 Ga0495653_0008758 3300046463 Bacteria 8286
320 Ga0495653_0100123 3300046463 Bacteria 2101
321 Ga0495653_0305777 3300046463 Bacteria 1035
322 Ga0495650_0002465 3300046471 Bacteria 14902
323 Ga0495650_0003101 3300046471 Bacteria 12466
324 Ga0495650_0004975 3300046471 Bacteria 8861
325 Ga0495650_0173029 3300046471 Bacteria 763
326 Ga0495605_0000047 3300046474 Bacteria 171270
327 Ga0495605_0000123 3300046474 Bacteria 101983
328 Ga0495605_0001519 3300046474 Bacteria 15069
329 Ga0495605_0022711 3300046474 Bacteria 3309
330 Ga0495605_0049876 3300046474 Bacteria 2043
331 Ga0495605_0120574 3300046474 Bacteria 1189
332 Ga0495584_0460021 3300046491 Bacteria 647
333 Ga0495585_0000979 3300046492 Bacteria 23943
334 Ga0495585_0019694 3300046492 Bacteria 3888
335 Ga0495585_0240647 3300046492 Bacteria 906
336 Ga0495594_0052767 3300046499 Bacteria 2238
337 Ga0495607_0000307 3300046501 Bacteria 51080
338 Ga0495607_0000518 3300046501 Bacteria 37977
339 Ga0495607_0002631 3300046501 Bacteria 14418
340 Ga0495607_0010671 3300046501 Bacteria 6159
341 Ga0495607_0014852 3300046501 Bacteria 5061
342 Ga0495607_0032526 3300046501 Bacteria 3182
343 Ga0495607_0057090 3300046501 Bacteria 2238
344 Ga0495607_0059120 3300046501 Bacteria 2187
345 Ga0495607_0098561 3300046501 Bacteria 1569
346 Ga0495607_0171529 3300046501 Bacteria 1095
347 Ga0495607_0181317 3300046501 Bacteria 1055
348 Ga0495607_0244248 3300046501 Bacteria 867
349 Ga0495607_0298370 3300046501 Bacteria 759
350 Ga0495583_0000036 3300046506 Bacteria 246077
351 Ga0495583_0001564 3300046506 Bacteria 22613
352 Ga0495583_0004122 3300046506 Bacteria 10649
353 Ga0495583_0004268 3300046506 Bacteria 10355
354 Ga0495583_0032434 3300046506 Bacteria 2521
355 Ga0495583_0092795 3300046506 Bacteria 1297
356 Ga0495606_0000698 3300046507 Bacteria 52041
357 Ga0495606_0000740 3300046507 Bacteria 50470
358 Ga0495606_0013614 3300046507 Bacteria 6414
359 Ga0495606_0018363 3300046507 Bacteria 5246
360 Ga0495606_0203214 3300046507 Bacteria 1127
361 Ga0495606_0358871 3300046507 Bacteria 771
362 Ga0495610_0003392 3300046512 Bacteria 12448
363 Ga0495610_0003846 3300046512 Bacteria 11409
364 Ga0495610_0070763 3300046512 Bacteria 1628
365 Ga0495610_0130970 3300046512 Bacteria 1089
366 Ga0495616_0045847 3300046513 Bacteria 2210
367 Ga0495620_0000001 3300046515 Bacteria 386508
368 Ga0495620_0000650 3300046515 Bacteria 21597
369 Ga0495620_0003198 3300046515 Bacteria 9401
370 Ga0495620_0128262 3300046515 Bacteria 996
371 Ga0495631_0119914 3300046518 Bacteria 1131
372 Ga0495631_0124473 3300046518 Bacteria 1108
373 Ga0495631_0151465 3300046518 Bacteria 995
374 Ga0495632_0002890 3300046519 Bacteria 12630
375 Ga0495632_0003671 3300046519 Bacteria 10771
376 Ga0495632_0005701 3300046519 Bacteria 8175
377 Ga0495632_0006623 3300046519 Bacteria 7411
378 Ga0495632_0026420 3300046519 Bacteria 3056
379 Ga0495632_0075177 3300046519 Bacteria 1617
380 Ga0495632_0170893 3300046519 Bacteria 998
381 Ga0495637_0000023 3300046520 Bacteria 172407
382 Ga0495637_0051872 3300046520 Bacteria 1714
383 Ga0495637_0071361 3300046520 Bacteria 1401
384 Ga0495637_0071735 3300046520 Bacteria 1396
385 Ga0495637_0079012 3300046520 Bacteria 1315
386 Ga0495637_0124207 3300046520 Bacteria 990
387 Ga0495643_0001188 3300046522 Bacteria 25383
388 Ga0495643_0001781 3300046522 Bacteria 18467
389 Ga0495643_0007124 3300046522 Bacteria 7255
390 Ga0495643_0169968 3300046522 Bacteria 1066
391 Ga0495643_0191408 3300046522 Bacteria 987
392 Ga0495644_0106095 3300046523 Bacteria 1064
393 Ga0495648_0008108 3300046524 Bacteria 8301
394 Ga0495648_0044900 3300046524 Bacteria 2754
395 Ga0495654_0002127 3300046530 Bacteria 12936
396 Ga0495654_0031555 3300046530 Bacteria 2689
397 Ga0495654_0111131 3300046530 Bacteria 1250
398 Ga0495654_0116616 3300046530 Bacteria 1212
399 Ga0495654_0123697 3300046530 Bacteria 1168
400 Ga0495654_0284959 3300046530 Bacteria 678
401 Ga0495586_0518371 3300046535 Bacteria 688
402 Ga0495587_0066385 3300046536 Bacteria 2105
403 Ga0495609_0000029 3300046538 Bacteria 217067
404 Ga0495609_0000382 3300046538 Bacteria 37599
405 Ga0495609_0001328 3300046538 Bacteria 16782
406 Ga0495597_0000004 3300046542 Bacteria 307496
407 Ga0495597_0003222 3300046542 Bacteria 9707
408 Ga0495597_0124438 3300046542 Bacteria 1073
409 Ga0495597_0187168 3300046542 Bacteria 834
410 Ga0495633_0000016 3300046558 Bacteria 250457
411 Ga0495633_0154797 3300046558 Bacteria 1058
412 Ga0495668_0229097 3300046616 Bacteria 1017
413 Ga0495611_0000623 3300046648 Bacteria 20413
414 Ga0495611_0001132 3300046648 Bacteria 13971
415 Ga0495625_0000010 3300046660 Bacteria 381775
416 Ga0495625_0015963 3300046660 Bacteria 5924
417 Ga0495661_0000004 3300046665 Bacteria 555340
418 Ga0495661_0000020 3300046665 Bacteria 196901
419 Ga0495661_0000095 3300046665 Bacteria 109100
420 Ga0495661_0000921 3300046665 Bacteria 26890
421 Ga0495661_0001217 3300046665 Bacteria 22327
422 Ga0495661_0128667 3300046665 Bacteria 1390
423 Ga0495661_0156929 3300046665 Bacteria 1224
424 Ga0495624_0241695 3300046690 Bacteria 1092
425 Ga0495671_0007562 3300046692 Bacteria 6182
426 Ga0495671_0055015 3300046692 Bacteria 1971
427 Ga0495671_0143898 3300046692 Bacteria 1161
428 Ga0495671_0163974 3300046692 Bacteria 1081
429 Ga0495671_0226650 3300046692 Bacteria 904
430 Ga0495649_0000534 3300046694 Bacteria 32323
431 Ga0495649_0009493 3300046694 Bacteria 5776
432 Ga0495649_0099173 3300046694 Bacteria 1549
433 Ga0495649_0236012 3300046694 Bacteria 942
434 Ga0495589_0037902 3300046794 Bacteria 2414
435 Ga0495589_0100947 3300046794 Bacteria 1396
436 Ga0495600_0307759 3300046809 Bacteria 998
437 Ga0495660_0000771 3300046810 Bacteria 24010
438 Ga0495660_0001796 3300046810 Bacteria 14165
439 Ga0495660_0018802 3300046810 Bacteria 3967
440 Ga0495660_0029340 3300046810 Bacteria 3104
441 Ga0495660_0112399 3300046810 Bacteria 1388
442 Ga0495672_0005847 3300047320 Bacteria 9648
443 Ga0495672_0007037 3300047320 Bacteria 8539
444 Ga0495672_0015126 3300047320 Bacteria 5251
445 Ga0495672_0057407 3300047320 Bacteria 2261
446 Ga0495672_0169591 3300047320 Bacteria 1114
447 Ga0495672_0389573 3300047320 Bacteria 639
448 Ga0495676_0000002 3300047321 Bacteria 373918
449 Ga0495676_0021042 3300047321 Bacteria 5708
450 Ga0495680_0577237 3300047322 Bacteria 755
451 Ga0495683_0000074 3300047323 Bacteria 100733
452 Ga0495683_0000191 3300047323 Bacteria 58418
453 Ga0495683_0017539 3300047323 Bacteria 3710
454 Ga0495675_0161477 3300047444 Bacteria 1379
455 Ga0495679_000126 3300047446 Bacteria 68027
456 Ga0495679_000127 3300047446 Bacteria 67885
457 Ga0495679_035266 3300047446 Bacteria 1587
458 Ga0495679_080596 3300047446 Bacteria 925
459 Ga0495673_0000563 3300047469 Bacteria 37758
460 Ga0495673_0002247 3300047469 Bacteria 13865
461 Ga0495673_0003301 3300047469 Bacteria 10701
462 Ga0495673_0035777 3300047469 Bacteria 2284
463 Ga0495673_0037890 3300047469 Bacteria 2198
464 Ga0495673_0063272 3300047469 Bacteria 1577
465 Ga0495681_0042894 3300047470 Bacteria 2186
466 Ga0495681_0077474 3300047470 Bacteria 1491
467 Ga0495681_0083510 3300047470 Bacteria 1422
468 Ga0495681_0250466 3300047470 Bacteria 699
469 Ga0495686_0271873 3300047472 Bacteria 945
470 Ga0495626_0000007 3300048091 Bacteria 276374
471 Ga0496102_0384246 3300048905 Bacteria 1321
472 Ga0496110_0447745 3300048913 Bacteria 1177
473 Ga0496110_0550802 3300048913 Bacteria 1048
474 Ga0496111_0597179 3300048914 Bacteria 808
475 Ga0496114_0016806 3300048917 Bacteria 5901
476 Ga0496116_0000444 3300048919 Bacteria 57719
477 Ga0496117_0000894 3300048920 Bacteria 45883
478 Ga0496117_0003730 3300048920 Bacteria 17472
479 Ga0496117_0003802 3300048920 Bacteria 17208
480 Ga0496117_0028714 3300048920 Bacteria 4303
481 Ga0496117_0073785 3300048920 Bacteria 2275
482 Ga0496117_0113673 3300048920 Bacteria 1680
483 Ga0496117_0347247 3300048920 Bacteria 767
484 Ga0496118_0007921 3300048921 Bacteria 11118
485 Ga0496118_0028492 3300048921 Bacteria 4702
486 Ga0496118_0030826 3300048921 Bacteria 4463
487 Ga0496118_0081412 3300048921 Bacteria 2273
488 Ga0496118_0244524 3300048921 Bacteria 1024
489 Ga0496118_0245655 3300048921 Bacteria 1021
490 Ga0496119_0000541 3300048922 Bacteria 51479
491 Ga0496119_0257814 3300048922 Bacteria 876
492 Ga0496120_0006452 3300048923 Bacteria 9006
493 Ga0496120_0180797 3300048923 Bacteria 1035
494 Ga0496120_0235741 3300048923 Bacteria 866
495 Ga0496121_0000815 3300048924 Bacteria 56865
496 Ga0496121_0005098 3300048924 Bacteria 17123
497 Ga0496121_0099488 3300048924 Bacteria 2247
498 Ga0496121_0258943 3300048924 Bacteria 1202
499 Ga0496121_0440490 3300048924 Bacteria 842
500 Ga0496121_0445885 3300048924 Bacteria 835
501 Ga0496122_0000156 3300048925 Bacteria 160178
502 Ga0496122_0009758 3300048925 Bacteria 10028
503 Ga0496122_0012018 3300048925 Bacteria 8680
504 Ga0496122_0087474 3300048925 Bacteria 2140
505 Ga0496122_0292903 3300048925 Bacteria 882
506 Ga0496122_0391170 3300048925 Bacteria 709
507 Ga0496123_0000087 3300048926 Bacteria 182994
508 Ga0496123_0002391 3300048926 Bacteria 23482
509 Ga0496123_0020828 3300048926 Bacteria 5115
510 Ga0496123_0068673 3300048926 Bacteria 2230
511 Ga0496123_0137169 3300048926 Bacteria 1344
512 Ga0496123_0165291 3300048926 Bacteria 1174
513 Ga0496123_0177731 3300048926 Bacteria 1115
514 Ga0496123_0213594 3300048926 Bacteria 978
515 Ga0496124_0000292 3300048927 Bacteria 94018
516 Ga0496124_0007382 3300048927 Bacteria 11691
517 Ga0496124_0121785 3300048927 Bacteria 2083
518 Ga0496124_0148443 3300048927 Bacteria 1842
519 Ga0496124_0160976 3300048927 Bacteria 1749
520 Ga0496124_0252565 3300048927 Bacteria 1303
521 Ga0496124_0260209 3300048927 Bacteria 1277
522 Ga0496124_0267253 3300048927 Bacteria 1255
523 Ga0496124_0294299 3300048927 Bacteria 1176
524 Ga0496124_0387711 3300048927 Bacteria 974
525 Ga0496124_0492390 3300048927 Bacteria 824
526 Ga0496124_0588524 3300048927 Bacteria 726
527 Ga0496125_0007649 3300048928 Bacteria 11455
528 Ga0496125_0023326 3300048928 Bacteria 5713
529 Ga0496125_0074852 3300048928 Bacteria 2623
530 Ga0496125_0232781 3300048928 Bacteria 1176
531 Ga0496125_0253550 3300048928 Bacteria 1108
532 Ga0496125_0262907 3300048928 Bacteria 1080
533 Ga0496126_0038064 3300048929 Bacteria 4478
534 Ga0496126_0054264 3300048929 Bacteria 3631
535 Ga0496126_0110109 3300048929 Bacteria 2399
536 Ga0496126_0429248 3300048929 Bacteria 1067
537 Ga0495678_000037 3300049459 Bacteria 197851
538 Ga0495678_000815 3300049459 Bacteria 27907
539 Ga0495678_040723 3300049459 Bacteria 1864
540 Ga0495678_097103 3300049459 Bacteria 1027
541 Ga0495678_176424 3300049459 Bacteria 673
542 Ga0495682_0000050 3300049460 Bacteria 110280
543 Ga0495682_0001914 3300049460 Bacteria 10373
544 Ga0501032_0249105 3300049569 Bacteria 1153
545 Ga0501034_0000084 3300049571 Bacteria 168283
546 Ga0501034_0751848 3300049571 Bacteria 870
547 Ga0500618_038174 3300053125 Bacteria 1108
548 Ga0500659_0005870 3300053135 Bacteria 6849
549 Ga0500634_0134426 3300053161 Bacteria 1181

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_1668893 Ga0451853_1668893_160_606 148
2 3300042136 Ga0450900_010294 Ga0450900_010294_389_847 152
3 iso_pu_bacteria 2671180139 2671694588 156
4 3300015262 Ga0182007_10137188 Ga0182007_101371882 166
5 iso_pu_bacteria 2510065053 2510281692 166
6 iso_pu_bacteria 2510065055 2510292137 166
7 iso_pu_bacteria 2510065058 2510309840 166
8 iso_pu_bacteria 2773857672 2774130163 166
9 iso_pu_bacteria 2917832318 2917832537 166
10 iso_pu_bacteria 2919125081 2919125335 166
11 iso_pu_bacteria 2974298342 2974300533 166
12 iso_pu_bacteria 2984499530 2984502915 166
13 iso_pu_bacteria 2984504281 2984508542 166
14 iso_pu_bacteria 8016728285 8016729204 166
15 3300009011 Ga0105251_10036204 Ga0105251_100362042 167
16 3300046455 Ga0495603_0461509 Ga0495603_0461509_89_592 167
17 3300046471 Ga0495650_0003101 Ga0495650_0003101_367_870 167
18 3300046474 Ga0495605_0000123 Ga0495605_0000123_40326_40829 167
19 3300046499 Ga0495594_0052767 Ga0495594_0052767_1261_1764 167
20 3300046501 Ga0495607_0171529 Ga0495607_0171529_382_885 167
21 3300046506 Ga0495583_0000036 Ga0495583_0000036_49691_50194 167
22 3300046512 Ga0495610_0003392 Ga0495610_0003392_5946_6449 167
23 3300046515 Ga0495620_0000001 Ga0495620_0000001_324849_325352 167
24 3300046518 Ga0495631_0151465 Ga0495631_0151465_195_698 167
25 3300046520 Ga0495637_0124207 Ga0495637_0124207_310_813 167
26 3300046524 Ga0495648_0044900 Ga0495648_0044900_1468_1971 167
27 3300046530 Ga0495654_0002127 Ga0495654_0002127_3251_3754 167
28 3300046538 Ga0495609_0000029 Ga0495609_0000029_41579_42082 167
29 3300046542 Ga0495597_0003222 Ga0495597_0003222_7685_8188 167
30 3300046558 Ga0495633_0000016 Ga0495633_0000016_188869_189372 167
31 3300046648 Ga0495611_0001132 Ga0495611_0001132_3933_4436 167
32 3300046665 Ga0495661_0000004 Ga0495661_0000004_181497_182000 167
33 3300046794 Ga0495589_0037902 Ga0495589_0037902_466_969 167
34 3300046810 Ga0495660_0029340 Ga0495660_0029340_1471_1974 167
35 3300047323 Ga0495683_0000074 Ga0495683_0000074_39096_39599 167
36 3300047446 Ga0495679_000127 Ga0495679_000127_58185_58688 167
37 3300047469 Ga0495673_0003301 Ga0495673_0003301_3987_4490 167
38 3300047470 Ga0495681_0042894 Ga0495681_0042894_1486_1989 167
39 3300048925 Ga0496122_0012018 Ga0496122_0012018_7770_8273 167
40 3300048926 Ga0496123_0020828 Ga0496123_0020828_763_1266 167
41 3300049459 Ga0495678_000037 Ga0495678_000037_195723_196226 167
42 iso_pu_bacteria 2511231004 2511254557 167
43 iso_pu_bacteria 2511231006 2511263566 167
44 iso_pu_bacteria 2511231007 2511273782 167
45 iso_pu_bacteria 2511231008 2511276695 167
46 iso_pu_bacteria 2511231010 2511292980 167
47 iso_pu_bacteria 2511231011 2511293243 167
48 iso_pu_bacteria 2511231012 2511301870 167
49 iso_pu_bacteria 2511231014 2511314619 167
50 iso_pu_bacteria 2511231015 2511317200 167
51 iso_pu_bacteria 2511231016 2511323960 167
52 iso_pu_bacteria 2511231017 2511331549 167
53 iso_pu_bacteria 2511231018 2511339616 167
54 iso_pu_bacteria 2511231019 2511346301 167
55 iso_pu_bacteria 2511231020 2511349371 167
56 iso_pu_bacteria 2511231021 2511355233 167
57 iso_pu_bacteria 2511231022 2511366160 167
58 iso_pu_bacteria 2511231023 2511368718 167
59 iso_pu_bacteria 2511231024 2511373913 167
60 iso_pu_bacteria 2511231031 2511413536 167
61 iso_pu_bacteria 2511231156 2511826326 167
62 iso_pu_bacteria 2512047018 2512324122 167
63 iso_pu_bacteria 2554235132 2554816216 167
64 iso_pu_bacteria 2554235231 2555248888 167
65 iso_pu_bacteria 2582580891 2583793792 167
66 iso_pu_bacteria 2597489887 2597859466 167
67 iso_pu_bacteria 2597489888 2597865047 167
68 iso_pu_bacteria 2597489889 2597870903 167
69 iso_pu_bacteria 2599185155 2599326401 167
70 iso_pu_bacteria 2599185160 2599354461 167
71 iso_pu_bacteria 2599185161 2599359825 167
72 iso_pu_bacteria 2599185162 2599366147 167
73 iso_pu_bacteria 2599185163 2599372937 167
74 iso_pu_bacteria 2599185164 2599379569 167
75 iso_pu_bacteria 2599185165 2599385453 167
76 iso_pu_bacteria 2599185166 2599391796 167
77 iso_pu_bacteria 2599185167 2599400178 167
78 iso_pu_bacteria 2599185168 2599403562 167
79 iso_pu_bacteria 2599185179 2599451492 167
80 iso_pu_bacteria 2599185181 2599461295 167
81 iso_pu_bacteria 2599185182 2599469839 167
82 iso_pu_bacteria 2599185185 2599482296 167
83 iso_pu_bacteria 2599185186 2599490315 167
84 iso_pu_bacteria 2599185188 2599504174 167
85 iso_pu_bacteria 2599185189 2599509396 167
86 iso_pu_bacteria 2599185190 2599512664 167
87 iso_pu_bacteria 2599185191 2599520015 167
88 iso_pu_bacteria 2599185212 2599613459 167
89 iso_pu_bacteria 2599185248 2599772366 167
90 iso_pu_bacteria 2599185257 2599803986 167
91 iso_pu_bacteria 2599185288 2599878396 167
92 iso_pu_bacteria 2599185289 2599888913 167
93 iso_pu_bacteria 2599185290 2599891340 167
94 iso_pu_bacteria 2599185291 2599900542 167
95 iso_pu_bacteria 2599185300 2599933565 167
96 iso_pu_bacteria 2599185302 2599943984 167
97 iso_pu_bacteria 2599185303 2599947598 167
98 iso_pu_bacteria 2599185304 2599955804 167
99 iso_pu_bacteria 2599185305 2599961438 167
100 iso_pu_bacteria 2599185306 2599969710 167
101 iso_pu_bacteria 2599185307 2599971615 167
102 iso_pu_bacteria 2599185308 2599981184 167
103 iso_pu_bacteria 2599185309 2599985605 167
104 iso_pu_bacteria 2599185310 2599989529 167
105 iso_pu_bacteria 2599185311 2599994401 167
106 iso_pu_bacteria 2599185312 2600000126 167
107 iso_pu_bacteria 2599185313 2600009105 167
108 iso_pu_bacteria 2599185314 2600015029 167
109 iso_pu_bacteria 2599185315 2600019620 167
110 iso_pu_bacteria 2599185316 2600023695 167
111 iso_pu_bacteria 2599185317 2600032339 167
112 iso_pu_bacteria 2599185318 2600038783 167
113 iso_pu_bacteria 2599185319 2600044173 167
114 iso_pu_bacteria 2599185320 2600048381 167
115 iso_pu_bacteria 2599185321 2600054130 167
116 iso_pu_bacteria 2599185322 2600060348 167
117 iso_pu_bacteria 2599185323 2600066562 167
118 iso_pu_bacteria 2599185324 2600074343 167
119 iso_pu_bacteria 2599185325 2600078130 167
120 iso_pu_bacteria 2599185356 2600213911 167
121 iso_pu_bacteria 2600254930 2600361901 167
122 iso_pu_bacteria 2600254931 2600364371 167
123 iso_pu_bacteria 2600254954 2600446731 167
124 iso_pu_bacteria 2600255283 2601625147 167
125 iso_pu_bacteria 2600255296 2601689692 167
126 iso_pu_bacteria 2600255313 2601774077 167
127 iso_pu_bacteria 2600255318 2601795619 167
128 iso_pu_bacteria 2600255389 2602010731 167
129 iso_pu_bacteria 2603880185 2606075688 167
130 iso_pu_bacteria 2603880199 2606128399 167
131 iso_pu_bacteria 2606217733 2608382653 167
132 iso_pu_bacteria 2619619299 2621298390 167
133 iso_pu_bacteria 2623620443 2624479558 167
134 iso_pu_bacteria 2623620446 2624493434 167
135 iso_pu_bacteria 2643221565 2643842718 167
136 iso_pu_bacteria 2643221571 2643874350 167
137 iso_pu_bacteria 2643221589 2643952688 167
138 iso_pu_bacteria 2643221602 2644022450 167
139 iso_pu_bacteria 2643221633 2644185521 167
140 iso_pu_bacteria 2643221650 2644286880 167
141 iso_pu_bacteria 2643221713 2644621884 167
142 iso_pu_bacteria 2651869719 2652548307 167
143 iso_pu_bacteria 2667528170 2671093203 167
144 iso_pu_bacteria 2667528171 2671097042 167
145 iso_pu_bacteria 2667528176 2671128930 167
146 iso_pu_bacteria 2671180172 2671770446 167
147 iso_pu_bacteria 2675903420 2677899838 167
148 iso_pu_bacteria 2675903515 2678264674 167
149 iso_pu_bacteria 2713897148 2715753959 167
150 iso_pu_bacteria 2713897149 2715757823 167
151 iso_pu_bacteria 2718217725 2718633387 167
152 iso_pu_bacteria 2721755607 2723249798 167
153 iso_pu_bacteria 2728369097 2729146186 167
154 iso_pu_bacteria 2738541265 2738671227 167
155 iso_pu_bacteria 2738541271 2738688584 167
156 iso_pu_bacteria 2738541282 2738749621 167
157 iso_pu_bacteria 2738541294 2738808522 167
158 iso_pu_bacteria 2738541303 2738858661 167
159 iso_pu_bacteria 2738541309 2738895882 167
160 iso_pu_bacteria 2738543004 2739201210 167
161 iso_pu_bacteria 2738543015 2739262400 167
162 iso_pu_bacteria 2738543016 2739265104 167
163 iso_pu_bacteria 2738543020 2739287839 167
164 iso_pu_bacteria 2738543021 2739293151 167
165 iso_pu_bacteria 2738543025 2739316170 167
166 iso_pu_bacteria 2740892503 2743738996 167
167 iso_pu_bacteria 2744054620 2745005128 167
168 iso_pu_bacteria 2765235841 2765582864 167
169 iso_pu_bacteria 2773857670 2774119154 167
170 iso_pu_bacteria 2773857673 2774138448 167
171 iso_pu_bacteria 2784132063 2784265531 167
172 iso_pu_bacteria 2784132072 2784314804 167
173 iso_pu_bacteria 2791355520 2794595063 167
174 iso_pu_bacteria 2806310737 2807409404 167
175 iso_pu_bacteria 2806310745 2807457706 167
176 iso_pu_bacteria 2808606361 2808857074 167
177 iso_pu_bacteria 2808606361 2808858577 167
178 iso_pu_bacteria 2808606376 2808926700 167
179 iso_pu_bacteria 2808606377 2808927486 167
180 iso_pu_bacteria 2808606378 2808937146 167
181 iso_pu_bacteria 2808606378 2808938766 167
182 iso_pu_bacteria 2808606379 2808943148 167
183 iso_pu_bacteria 2808606380 2808948861 167
184 iso_pu_bacteria 2808606381 2808949974 167
185 iso_pu_bacteria 2808606382 2808959019 167
186 iso_pu_bacteria 2808606382 2808961960 167
187 iso_pu_bacteria 2808606383 2808965462 167
188 iso_pu_bacteria 2808606383 2808967038 167
189 iso_pu_bacteria 2808606385 2808977382 167
190 iso_pu_bacteria 2808606388 2808992537 167
191 iso_pu_bacteria 2808606389 2809000297 167
192 iso_pu_bacteria 2808606389 2809001892 167
193 iso_pu_bacteria 2808606445 2809216500 167
194 iso_pu_bacteria 2816332298 2817492461 167
195 iso_pu_bacteria 2818991456 2819654322 167
196 iso_pu_bacteria 2818991464 2819702136 167
197 iso_pu_bacteria 2823421272 2823423301 167
198 iso_pu_bacteria 2825651385 2825656438 167
199 iso_pu_bacteria 2834028612 2834031943 167
200 iso_pu_bacteria 2842805378 2842809626 167
201 iso_pu_bacteria 2842815866 2842820499 167
202 iso_pu_bacteria 2842826826 2842827724 167
203 iso_pu_bacteria 2842832357 2842832572 167
204 iso_pu_bacteria 2842837860 2842840975 167
205 iso_pu_bacteria 2842843487 2842848868 167
206 iso_pu_bacteria 2842849001 2842854273 167
207 iso_pu_bacteria 2842854478 2842856822 167
208 iso_pu_bacteria 2852612431 2852613170 167
209 iso_pu_bacteria 2852657418 2852659044 167
210 iso_pu_bacteria 2852667396 2852669095 167
211 iso_pu_bacteria 2860339153 2860339895 167
212 iso_pu_bacteria 2860867994 2860871561 167
213 iso_pu_bacteria 2878029506 2878031563 167
214 iso_pu_bacteria 2880230671 2880232434 167
215 iso_pu_bacteria 2904518522 2904523874 167
216 iso_pu_bacteria 2904550169 2904552853 167
217 iso_pu_bacteria 2908446538 2908450959 167
218 iso_pu_bacteria 2912963787 2912965405 167
219 iso_pu_bacteria 2913036834 2913041150 167
220 iso_pu_bacteria 2917070673 2917075248 167
221 iso_pu_bacteria 2919063839 2919063967 167
222 iso_pu_bacteria 2919155634 2919157784 167
223 iso_pu_bacteria 2919385768 2919386529 167
224 iso_pu_bacteria 2919456309 2919456991 167
225 iso_pu_bacteria 2919481497 2919486092 167
226 iso_pu_bacteria 2919487758 2919491190 167
227 iso_pu_bacteria 2919501602 2919505349 167
228 iso_pu_bacteria 2919697872 2919699301 167
229 iso_pu_bacteria 2923153595 2923158074 167
230 iso_pu_bacteria 2923519811 2923519961 167
231 iso_pu_bacteria 2923586266 2923590133 167
232 iso_pu_bacteria 2926063275 2926067026 167
233 iso_pu_bacteria 2929144301 2929148603 167
234 iso_pu_bacteria 2929189879 2929193596 167
235 iso_pu_bacteria 2931369376 2931373961 167
236 iso_pu_bacteria 2931390751 2931394910 167
237 iso_pu_bacteria 2931396565 2931400212 167
238 iso_pu_bacteria 2935353572 2935356236 167
239 iso_pu_bacteria 2939636861 2939639622 167
240 iso_pu_bacteria 2939651529 2939655239 167
241 iso_pu_bacteria 2945928738 2945932392 167
242 iso_pu_bacteria 2945961074 2945962308 167
243 iso_pu_bacteria 2946006987 2946008594 167
244 iso_pu_bacteria 2946027586 2946032058 167
245 iso_pu_bacteria 2947233263 2947238886 167
246 iso_pu_bacteria 2952252522 2952255094 167
247 iso_pu_bacteria 2969304461 2969306345 167
248 iso_pu_bacteria 2974289157 2974292000 167
249 iso_pu_bacteria 2984286254 2984288103 167
250 iso_pu_bacteria 2988728565 2988730192 167
251 iso_pu_bacteria 2998139840 2998141744 167
252 iso_pu_bacteria 3007395558 3007397380 167
253 iso_pu_bacteria 3007419365 3007421303 167
254 iso_pu_bacteria 3007511990 3007515247 167
255 iso_pu_bacteria 3007614139 3007616570 167
256 iso_pu_bacteria 3007619802 3007624122 167
257 iso_pu_bacteria 3007718800 3007719364 167
258 iso_pu_bacteria 3007803356 3007803639 167
259 iso_pu_bacteria 3007855910 3007856331 167
260 iso_pu_bacteria 3007861166 3007863022 167
261 iso_pu_bacteria 3007866637 3007870536 167
262 iso_pu_bacteria 3007872151 3007872710 167
263 iso_pu_bacteria 637000220 637321704 167
264 iso_pu_bacteria 640427133 640489036 167
265 iso_pu_bacteria 651053060 651177128 167
266 iso_pu_bacteria 8015687852 8015692171 167
267 iso_pu_bacteria 8019769354 8019773043 167
268 iso_pu_bacteria 8019775933 8019776429 167
269 iso_pu_bacteria 8029995093 8029999016 167
270 iso_pu_bacteria 8034962539 8034963787 167
271 iso_pu_bacteria 8052494512 8052498411 167
272 iso_pu_bacteria 8054285046 8054290791 167
273 iso_pu_bacteria 8054347763 8054350822 167
274 iso_pu_bacteria 8054503363 8054507419 167
275 iso_pu_bacteria 8054929484 8054930061 167
276 iso_pu_bacteria 8055770955 8055775380 167
277 iso_pu_bacteria 8055817908 8055822363 167
278 iso_pu_bacteria 8055878733 8055879754 167
279 iso_pu_bacteria 8056115690 8056119689 167
280 iso_pu_bacteria 8056120720 8056122424 167
281 iso_pu_bacteria 8056125926 8056130065 167
282 iso_pu_bacteria 8056131705 8056135825 167
283 iso_pu_bacteria 8056137416 8056141343 167
284 iso_pu_bacteria 8056143049 8056144779 167
285 iso_pu_bacteria 8056148874 8056153141 167
286 iso_pu_bacteria 8056155041 8056156110 167
287 iso_pu_bacteria 8056161164 8056162028 167
288 iso_pu_bacteria 8056166840 8056169251 167
289 iso_pu_bacteria 8056172158 8056175440 167
290 iso_pu_bacteria 8056177738 8056181264 167
291 iso_pu_bacteria 8056569372 8056571474 167
292 iso_pu_bacteria 8057798959 8057804197 167
293 3300041411 Ga0439466_0088225 Ga0439466_0088225_343_894 168
294 3300046455 Ga0495603_0039940 Ga0495603_0039940_1866_2375 169
295 3300046458 Ga0495591_099844 Ga0495591_099844_39_548 169
296 3300046463 Ga0495653_0008758 Ga0495653_0008758_5229_5738 169
297 3300046492 Ga0495585_0000979 Ga0495585_0000979_7732_8241 169
298 3300046492 Ga0495585_0240647 Ga0495585_0240647_113_622 169
299 3300046501 Ga0495607_0014852 Ga0495607_0014852_2158_2667 169
300 3300046501 Ga0495607_0298370 Ga0495607_0298370_59_568 169
301 3300046507 Ga0495606_0000698 Ga0495606_0000698_12290_12799 169
302 3300046507 Ga0495606_0358871 Ga0495606_0358871_141_650 169
303 3300046518 Ga0495631_0119914 Ga0495631_0119914_278_787 169
304 3300046665 Ga0495661_0000095 Ga0495661_0000095_44235_44744 169
305 3300046692 Ga0495671_0163974 Ga0495671_0163974_421_930 169
306 3300046694 Ga0495649_0000534 Ga0495649_0000534_20549_21058 169
307 3300047321 Ga0495676_0021042 Ga0495676_0021042_4046_4555 169
308 3300047323 Ga0495683_0000191 Ga0495683_0000191_49153_49662 169
309 3300049459 Ga0495678_176424 Ga0495678_176424_91_600 169
310 3300053125 Ga0500618_038174 Ga0500618_038174_337_846 169
311 3300009011 Ga0105251_10075304 Ga0105251_100753042 170
312 3300009036 Ga0105244_10013166 Ga0105244_100131664 170
313 3300013100 Ga0157373_10047837 Ga0157373_100478374 170
314 3300013102 Ga0157371_10001115 Ga0157371_100011152 170
315 3300013102 Ga0157371_10248869 Ga0157371_102488691 170
316 3300013105 Ga0157369_10001060 Ga0157369_100010609 170
317 3300013307 Ga0157372_10254720 Ga0157372_102547202 170
318 3300025728 Ga0207655_1066070 Ga0207655_10660702 170
319 3300027312 Ga0209371_1015619 Ga0209371_10156192 170
320 3300030500 Ga0268256_1017328 Ga0268256_10173282 170
321 2124908027 MRS2a_Contig_1423 MRS2a_00313110 171
322 2162886011 MRS1b_contig_4601869 MRS1b_0867.00001600 171
323 3300002771 JGI25163J39215_1001125 JGI25163J39215_10011254 171
324 3300002771 JGI25163J39215_1001411 JGI25163J39215_10014113 171
325 3300002772 JGI25164J39214_1000194 JGI25164J39214_100019439 171
326 3300002772 JGI25164J39214_1000411 JGI25164J39214_100041115 171
327 3300003214 JGI25165J46597_1000348 JGI25165J46597_100034839 171
328 3300003214 JGI25165J46597_1000430 JGI25165J46597_100043033 171
329 3300003752 Ga0055539_1000120 Ga0055539_100012029 171
330 3300003756 Ga0055533_1000128 Ga0055533_100012829 171
331 3300003758 Ga0055532_1000116 Ga0055532_100011629 171
332 3300003759 Ga0055525_1000165 Ga0055525_100016529 171
333 3300003761 Ga0055535_1003799 Ga0055535_10037994 171
334 3300003781 Ga0055536_1071782 Ga0055536_10717821 171
335 3300003791 Ga0055530_10000268 Ga0055530_1000026845 171
336 3300003791 Ga0055530_10001257 Ga0055530_100012573 171
337 3300003792 Ga0055540_1000253 Ga0055540_10002533 171
338 3300003792 Ga0055540_1000298 Ga0055540_100029846 171
339 3300003792 Ga0055540_1000430 Ga0055540_10004303 171
340 3300003794 Ga0055531_10000997 Ga0055531_1000099720 171
341 3300003841 Ga0055541_1000080 Ga0055541_100008029 171
342 3300005288 Ga0065714_10001019 Ga0065714_100010192 171
343 3300005288 Ga0065714_10005969 Ga0065714_100059692 171
344 3300005288 Ga0065714_10076746 Ga0065714_100767464 171
345 3300005289 Ga0065704_10073003 Ga0065704_100730037 171
346 3300005289 Ga0065704_10114638 Ga0065704_101146382 171
347 3300005289 Ga0065704_10246281 Ga0065704_102462812 171
348 3300005289 Ga0065704_10247097 Ga0065704_102470972 171
349 3300005289 Ga0065704_10284496 Ga0065704_102844961 171
350 3300005289 Ga0065704_10449446 Ga0065704_104494461 171
351 3300005290 Ga0065712_10004972 Ga0065712_100049727 171
352 3300005290 Ga0065712_10068987 Ga0065712_100689874 171
353 3300005290 Ga0065712_10095097 Ga0065712_100950972 171
354 3300005331 Ga0070670_100001579 Ga0070670_10000157922 171
355 3300005331 Ga0070670_100004362 Ga0070670_1000043622 171
356 3300005344 Ga0070661_100000343 Ga0070661_10000034336 171
357 3300005353 Ga0070669_100001097 Ga0070669_1000010978 171
358 3300005355 Ga0070671_100859735 Ga0070671_1008597352 171
359 3300005356 Ga0070674_101137646 Ga0070674_1011376461 171
360 3300005435 Ga0070714_100185812 Ga0070714_1001858121 171
361 3300005440 Ga0070705_100421132 Ga0070705_1004211322 171
362 3300005457 Ga0070662_100000181 Ga0070662_10000018119 171
363 3300005457 Ga0070662_101191659 Ga0070662_1011916591 171
364 3300005539 Ga0068853_100145154 Ga0068853_1001451543 171
365 3300005548 Ga0070665_100113264 Ga0070665_1001132642 171
366 3300005548 Ga0070665_100184076 Ga0070665_1001840762 171
367 3300005564 Ga0070664_100000276 Ga0070664_10000027636 171
368 3300005564 Ga0070664_100361269 Ga0070664_1003612692 171
369 3300005578 Ga0068854_100074742 Ga0068854_1000747422 171
370 3300005615 Ga0070702_100481030 Ga0070702_1004810302 171
371 3300005834 Ga0068851_10000189 Ga0068851_1000018918 171
372 3300006051 Ga0075364_10284233 Ga0075364_102842332 171
373 3300006058 Ga0075432_10008167 Ga0075432_100081674 171
374 3300006058 Ga0075432_10090666 Ga0075432_100906662 171
375 3300006177 Ga0075362_10197523 Ga0075362_101975232 171
376 3300006177 Ga0075362_10213614 Ga0075362_102136141 171
377 3300006186 Ga0075369_10009062 Ga0075369_100090623 171
378 3300006944 Ga0099823_1000090 Ga0099823_100009033 171
379 3300006944 Ga0099823_1090138 Ga0099823_10901382 171
380 3300006946 Ga0079104_1000438 Ga0079104_10004383 171
381 3300006946 Ga0079104_1003103 Ga0079104_10031033 171
382 3300006948 Ga0099826_10003959 Ga0099826_100039592 171
383 3300009011 Ga0105251_10000143 Ga0105251_1000014339 171
384 3300009011 Ga0105251_10002273 Ga0105251_1000227313 171
385 3300009011 Ga0105251_10005771 Ga0105251_100057713 171
386 3300009011 Ga0105251_10005887 Ga0105251_100058875 171
387 3300009011 Ga0105251_10011662 Ga0105251_100116624 171
388 3300009011 Ga0105251_10116736 Ga0105251_101167362 171
389 3300009011 Ga0105251_10139051 Ga0105251_101390512 171
390 3300009036 Ga0105244_10001813 Ga0105244_100018132 171
391 3300009036 Ga0105244_10002865 Ga0105244_1000286510 171
392 3300009036 Ga0105244_10008847 Ga0105244_100088472 171
393 3300009036 Ga0105244_10017435 Ga0105244_100174352 171
394 3300009036 Ga0105244_10056131 Ga0105244_100561312 171
395 3300009036 Ga0105244_10058225 Ga0105244_100582253 171
396 3300009036 Ga0105244_10067281 Ga0105244_100672812 171
397 3300009036 Ga0105244_10073318 Ga0105244_100733182 171
398 3300009036 Ga0105244_10134049 Ga0105244_101340492 171
399 3300009036 Ga0105244_10220600 Ga0105244_102206002 171
400 3300009036 Ga0105244_10232158 Ga0105244_102321582 171
401 3300009092 Ga0105250_10000135 Ga0105250_1000013517 171
402 3300009092 Ga0105250_10019099 Ga0105250_100190993 171
403 3300009092 Ga0105250_10021665 Ga0105250_100216652 171
404 3300009092 Ga0105250_10030771 Ga0105250_100307713 171
405 3300009092 Ga0105250_10143073 Ga0105250_101430731 171
406 3300009148 Ga0105243_10000594 Ga0105243_100005944 171
407 3300009148 Ga0105243_10000989 Ga0105243_1000098932 171
408 3300009148 Ga0105243_10249508 Ga0105243_102495081 171
409 3300009148 Ga0105243_11400451 Ga0105243_114004512 171
410 3300009176 Ga0105242_10027379 Ga0105242_100273795 171
411 3300009177 Ga0105248_10646018 Ga0105248_106460182 171
412 3300009545 Ga0105237_10020387 Ga0105237_100203873 171
413 3300009553 Ga0105249_10447994 Ga0105249_104479941 171
414 3300011119 Ga0105246_10036932 Ga0105246_100369322 171
415 3300011119 Ga0105246_10126077 Ga0105246_101260772 171
416 3300011119 Ga0105246_10299014 Ga0105246_102990142 171
417 3300012498 Ga0157345_1000962 Ga0157345_10009622 171
418 3300013100 Ga0157373_10003004 Ga0157373_100030043 171
419 3300013100 Ga0157373_10010628 Ga0157373_100106284 171
420 3300013100 Ga0157373_10040889 Ga0157373_100408894 171
421 3300013100 Ga0157373_10085111 Ga0157373_100851111 171
422 3300013100 Ga0157373_10341887 Ga0157373_103418872 171
423 3300013102 Ga0157371_10000053 Ga0157371_10000053132 171
424 3300013102 Ga0157371_10018986 Ga0157371_100189865 171
425 3300013102 Ga0157371_10069499 Ga0157371_100694993 171
426 3300013102 Ga0157371_10075188 Ga0157371_100751882 171
427 3300013102 Ga0157371_10306640 Ga0157371_103066402 171
428 3300013102 Ga0157371_10744935 Ga0157371_107449351 171
429 3300013104 Ga0157370_10000450 Ga0157370_1000045020 171
430 3300013104 Ga0157370_10005784 Ga0157370_1000578413 171
431 3300013104 Ga0157370_10194940 Ga0157370_101949402 171
432 3300013104 Ga0157370_10237020 Ga0157370_102370202 171
433 3300013104 Ga0157370_10493951 Ga0157370_104939512 171
434 3300013104 Ga0157370_10847918 Ga0157370_108479182 171
435 3300013105 Ga0157369_10291576 Ga0157369_102915762 171
436 3300013105 Ga0157369_10571041 Ga0157369_105710411 171
437 3300013306 Ga0163162_10320389 Ga0163162_103203892 171
438 3300013307 Ga0157372_10012392 Ga0157372_100123923 171
439 3300013308 Ga0157375_10938728 Ga0157375_109387282 171
440 3300014497 Ga0182008_10000847 Ga0182008_100008479 171
441 3300015261 Ga0182006_1001080 Ga0182006_10010803 171
442 3300015261 Ga0182006_1063195 Ga0182006_10631952 171
443 3300015261 Ga0182006_1129836 Ga0182006_11298362 171
444 3300015262 Ga0182007_10084166 Ga0182007_100841662 171
445 3300015265 Ga0182005_1070800 Ga0182005_10708002 171
446 3300017792 Ga0163161_10221268 Ga0163161_102212682 171
447 3300017792 Ga0163161_10447986 Ga0163161_104479862 171
448 3300025206 Ga0209435_100930 Ga0209435_1009304 171
449 3300025207 Ga0209760_100011 Ga0209760_10001127 171
450 3300025207 Ga0209760_100064 Ga0209760_10006437 171
451 3300025224 Ga0209784_100017 Ga0209784_100017117 171
452 3300025225 Ga0209566_100014 Ga0209566_100014117 171
453 3300025226 Ga0209674_100028 Ga0209674_100028117 171
454 3300025229 Ga0209147_100105 Ga0209147_100105117 171
455 3300025230 Ga0209563_100032 Ga0209563_100032117 171
456 3300025230 Ga0209563_100542 Ga0209563_1005423 171
457 3300025231 Ga0207427_100008 Ga0207427_100008208 171
458 3300025231 Ga0207427_100082 Ga0207427_10008296 171
459 3300025233 Ga0209437_100006 Ga0209437_100006228 171
460 3300025233 Ga0209437_100014 Ga0209437_100014503 171
461 3300025233 Ga0209437_112169 Ga0209437_1121692 171
462 3300025242 Ga0209258_100194 Ga0209258_10019482 171
463 3300025246 Ga0209646_1000337 Ga0209646_100033718 171
464 3300025253 Ga0209677_100018 Ga0209677_100018117 171
465 3300025256 Ga0209759_1005950 Ga0209759_10059502 171
466 3300025261 Ga0209233_1000008 Ga0209233_1000008503 171
467 3300025261 Ga0209233_1000105 Ga0209233_1000105209 171
468 3300025291 Ga0209675_1010587 Ga0209675_10105874 171
469 3300025292 Ga0209676_1000006 Ga0209676_1000006209 171
470 3300025292 Ga0209676_1000369 Ga0209676_100036953 171
471 3300025292 Ga0209676_1000707 Ga0209676_10007073 171
472 3300025292 Ga0209676_1001433 Ga0209676_100143311 171
473 3300025292 Ga0209676_1004478 Ga0209676_10044783 171
474 3300025298 Ga0209050_1000235 Ga0209050_100023586 171
475 3300025298 Ga0209050_1000260 Ga0209050_100026012 171
476 3300025298 Ga0209050_1000380 Ga0209050_100038053 171
477 3300025298 Ga0209050_1003293 Ga0209050_100329314 171
478 3300025303 Ga0209051_1000086 Ga0209051_1000086142 171
479 3300025303 Ga0209051_1000123 Ga0209051_100012330 171
480 3300025303 Ga0209051_1000163 Ga0209051_1000163110 171
481 3300025304 Ga0209257_1000421 Ga0209257_100042153 171
482 3300025304 Ga0209257_1013320 Ga0209257_10133202 171
483 3300025304 Ga0209257_1037245 Ga0209257_10372452 171
484 3300025321 Ga0207656_10000073 Ga0207656_100000737 171
485 3300025711 Ga0207696_1000010 Ga0207696_1000010388 171
486 3300025711 Ga0207696_1000025 Ga0207696_1000025269 171
487 3300025711 Ga0207696_1000043 Ga0207696_100004356 171
488 3300025711 Ga0207696_1000267 Ga0207696_100026737 171
489 3300025711 Ga0207696_1030025 Ga0207696_10300252 171
490 3300025711 Ga0207696_1054677 Ga0207696_10546772 171
491 3300025711 Ga0207696_1079517 Ga0207696_10795172 171
492 3300025728 Ga0207655_1000019 Ga0207655_1000019267 171
493 3300025728 Ga0207655_1000407 Ga0207655_100040716 171
494 3300025728 Ga0207655_1001123 Ga0207655_100112314 171
495 3300025728 Ga0207655_1003958 Ga0207655_10039583 171
496 3300025728 Ga0207655_1004447 Ga0207655_10044476 171
497 3300025728 Ga0207655_1005649 Ga0207655_10056492 171
498 3300025728 Ga0207655_1006919 Ga0207655_10069194 171
499 3300025728 Ga0207655_1008671 Ga0207655_10086712 171
500 3300025728 Ga0207655_1032224 Ga0207655_10322243 171
501 3300025728 Ga0207655_1041679 Ga0207655_10416792 171
502 3300025728 Ga0207655_1113664 Ga0207655_11136642 171
503 3300025728 Ga0207655_1134320 Ga0207655_11343202 171
504 3300025735 Ga0207713_1000058 Ga0207713_100005879 171
505 3300025735 Ga0207713_1000156 Ga0207713_100015652 171
506 3300025735 Ga0207713_1000778 Ga0207713_100077812 171
507 3300025735 Ga0207713_1005473 Ga0207713_10054735 171
508 3300025735 Ga0207713_1005616 Ga0207713_10056167 171
509 3300025735 Ga0207713_1012354 Ga0207713_10123545 171
510 3300025735 Ga0207713_1013252 Ga0207713_10132524 171
511 3300025735 Ga0207713_1013300 Ga0207713_10133004 171
512 3300025735 Ga0207713_1027576 Ga0207713_10275763 171
513 3300025735 Ga0207713_1035190 Ga0207713_10351902 171
514 3300025735 Ga0207713_1079530 Ga0207713_10795302 171
515 3300025735 Ga0207713_1095423 Ga0207713_10954232 171
516 3300025914 Ga0207671_10000353 Ga0207671_1000035333 171
517 3300025920 Ga0207649_10000237 Ga0207649_100002372 171
518 3300025923 Ga0207681_10000368 Ga0207681_1000036829 171
519 3300025923 Ga0207681_10037659 Ga0207681_100376592 171
520 3300025925 Ga0207650_10000552 Ga0207650_100005522 171
521 3300025925 Ga0207650_10001026 Ga0207650_1000102612 171
522 3300025929 Ga0207664_10137706 Ga0207664_101377061 171
523 3300025933 Ga0207706_10001188 Ga0207706_100011883 171
524 3300025934 Ga0207686_10069024 Ga0207686_100690242 171
525 3300025935 Ga0207709_10000223 Ga0207709_1000022331 171
526 3300025935 Ga0207709_10001419 Ga0207709_100014194 171
527 3300025941 Ga0207711_10439928 Ga0207711_104399282 171
528 3300025945 Ga0207679_10000005 Ga0207679_1000000542 171
529 3300025945 Ga0207679_11460822 Ga0207679_114608221 171
530 3300025981 Ga0207640_10019149 Ga0207640_100191494 171
531 3300026041 Ga0207639_10121154 Ga0207639_101211543 171
532 3300026067 Ga0207678_10671757 Ga0207678_106717572 171
533 3300027111 Ga0209281_1000010 Ga0209281_1000010582 171
534 3300027111 Ga0209281_1001764 Ga0209281_10017648 171
535 3300027111 Ga0209281_1002274 Ga0209281_10022748 171
536 3300027252 Ga0209973_1015471 Ga0209973_10154711 171
537 3300027296 Ga0209389_1000018 Ga0209389_1000018147 171
538 3300027312 Ga0209371_1001804 Ga0209371_10018043 171
539 3300027360 Ga0209969_1027758 Ga0209969_10277582 171
540 3300027378 Ga0209981_1012925 Ga0209981_10129252 171
541 3300027378 Ga0209981_1036933 Ga0209981_10369331 171
542 3300027424 Ga0209984_1000511 Ga0209984_10005112 171
543 3300027471 Ga0209995_1016047 Ga0209995_10160471 171
544 3300027543 Ga0209999_1014054 Ga0209999_10140542 171
545 3300027543 Ga0209999_1042123 Ga0209999_10421231 171
546 3300027552 Ga0209982_1000468 Ga0209982_10004686 171
547 3300027666 Ga0209282_1025268 Ga0209282_10252682 171
548 3300027682 Ga0209971_1070400 Ga0209971_10704001 171
549 3300027876 Ga0209974_10006519 Ga0209974_100065194 171
550 3300027876 Ga0209974_10028184 Ga0209974_100281843 171
551 3300027907 Ga0207428_10018746 Ga0207428_100187465 171
552 3300027907 Ga0207428_10759616 Ga0207428_107596161 171
553 3300028379 Ga0268266_10107387 Ga0268266_101073872 171
554 3300030500 Ga0268256_1001548 Ga0268256_10015483 171
555 3300030731 Ga0316177_1033879 Ga0316177_10338792 171
556 3300030734 Ga0316179_1080649 Ga0316179_10806492 171
557 3300030735 Ga0316178_1037599 Ga0316178_10375996 171
558 3300031548 Ga0307408_100136536 Ga0307408_1001365363 171
559 3300031548 Ga0307408_100165101 Ga0307408_1001651012 171
560 3300031731 Ga0307405_10000107 Ga0307405_1000010734 171
561 3300031731 Ga0307405_10123242 Ga0307405_101232422 171
562 3300031731 Ga0307405_10482737 Ga0307405_104827372 171
563 3300031731 Ga0307405_10659627 Ga0307405_106596272 171
564 3300031824 Ga0307413_10019906 Ga0307413_100199062 171
565 3300031901 Ga0307406_10232914 Ga0307406_102329142 171
566 3300031903 Ga0307407_10634779 Ga0307407_106347792 171
567 3300031911 Ga0307412_10032963 Ga0307412_100329632 171
568 3300031911 Ga0307412_10070169 Ga0307412_100701692 171
569 3300031911 Ga0307412_10199713 Ga0307412_101997132 171
570 3300032002 Ga0307416_100332061 Ga0307416_1003320612 171
571 3300032004 Ga0307414_10070250 Ga0307414_100702503 171
572 3300032004 Ga0307414_10402409 Ga0307414_104024092 171
573 3300032005 Ga0307411_10048226 Ga0307411_100482262 171
574 3300032005 Ga0307411_10356386 Ga0307411_103563861 171
575 3300038705 Ga0237819_00099 Ga0237819_00099_2458_2973 171
576 3300041404 Ga0439436_0009362 Ga0439436_0009362_1474_1989 171
577 3300041405 Ga0439438_001978 Ga0439438_001978_6971_7486 171
578 3300041405 Ga0439438_004427 Ga0439438_004427_397_912 171
579 3300041405 Ga0439438_015714 Ga0439438_015714_1130_1645 171
580 3300041405 Ga0439438_035665 Ga0439438_035665_579_1094 171
581 3300041405 Ga0439438_036601 Ga0439438_036601_177_692 171
582 3300041407 Ga0439447_035471 Ga0439447_035471_498_1013 171
583 3300041407 Ga0439447_044289 Ga0439447_044289_278_793 171
584 3300041407 Ga0439447_059995 Ga0439447_059995_201_716 171
585 3300041411 Ga0439466_0063129 Ga0439466_0063129_170_685 171
586 3300041411 Ga0439466_0065490 Ga0439466_0065490_353_868 171
587 3300041451 Ga0451791_0347004 Ga0451791_0347004_235_750 171
588 3300041453 Ga0451797_1369733 Ga0451797_1369733_245_760 171
589 3300041498 Ga0451841_0289499 Ga0451841_0289499_239_754 171
590 3300041997 Ga0439431_0038190 Ga0439431_0038190_173_688 171
591 3300042004 Ga0439445_0027837 Ga0439445_0027837_453_968 171
592 3300042006 Ga0439432_000318 Ga0439432_000318_353_868 171
593 3300042006 Ga0439432_037820 Ga0439432_037820_705_1220 171
594 3300042006 Ga0439432_050536 Ga0439432_050536_599_1114 171
595 3300042006 Ga0439432_073740 Ga0439432_073740_198_713 171
596 3300042009 Ga0439451_048868 Ga0439451_048868_114_629 171
597 3300042010 Ga0439452_000884 Ga0439452_000884_699_1214 171
598 3300042010 Ga0439452_001254 Ga0439452_001254_8506_9021 171
599 3300042010 Ga0439452_001351 Ga0439452_001351_146_661 171
600 3300042010 Ga0439452_017974 Ga0439452_017974_573_1088 171
601 3300042013 Ga0439456_000351 Ga0439456_000351_8798_9316 171
602 3300042013 Ga0439456_041043 Ga0439456_041043_258_773 171
603 3300042016 Ga0439463_060482 Ga0439463_060482_303_818 171
604 3300042115 Ga0450911_000686 Ga0450911_000686_8939_9454 171
605 3300042137 Ga0450902_002009 Ga0450902_002009_2054_2569 171
606 3300042142 Ga0450905_004764 Ga0450905_004764_1133_1648 171
607 3300042146 Ga0450907_031918 Ga0450907_031918_297_812 171
608 3300042156 Ga0439446_0091962 Ga0439446_0091962_341_856 171
609 3300042185 Ga0450909_008435 Ga0450909_008435_409_924 171
610 3300042439 Ga0439464_0001091 Ga0439464_0001091_302_817 171
611 3300042461 Ga0439460_0006234 Ga0439460_0006234_198_713 171
612 3300042533 Ga0450901_000610 Ga0450901_000610_2603_3118 171
613 3300046453 Ga0495627_000013 Ga0495627_000013_200046_200561 171
614 3300046453 Ga0495627_000455 Ga0495627_000455_1527_2042 171
615 3300046453 Ga0495627_101350 Ga0495627_101350_115_630 171
616 3300046458 Ga0495591_000020 Ga0495591_000020_171067_171582 171
617 3300046458 Ga0495591_001165 Ga0495591_001165_16470_16985 171
618 3300046458 Ga0495591_001196 Ga0495591_001196_318_833 171
619 3300046458 Ga0495591_018551 Ga0495591_018551_448_963 171
620 3300046460 Ga0495638_0318628 Ga0495638_0318628_223_738 171
621 3300046463 Ga0495653_0100123 Ga0495653_0100123_281_796 171
622 3300046463 Ga0495653_0305777 Ga0495653_0305777_129_644 171
623 3300046471 Ga0495650_0002465 Ga0495650_0002465_5014_5529 171
624 3300046471 Ga0495650_0004975 Ga0495650_0004975_2358_2873 171
625 3300046471 Ga0495650_0173029 Ga0495650_0173029_173_688 171
626 3300046474 Ga0495605_0000047 Ga0495605_0000047_60687_61202 171
627 3300046474 Ga0495605_0001519 Ga0495605_0001519_10168_10683 171
628 3300046474 Ga0495605_0022711 Ga0495605_0022711_1323_1838 171
629 3300046474 Ga0495605_0049876 Ga0495605_0049876_289_804 171
630 3300046474 Ga0495605_0120574 Ga0495605_0120574_310_825 171
631 3300046491 Ga0495584_0460021 Ga0495584_0460021_117_632 171
632 3300046492 Ga0495585_0019694 Ga0495585_0019694_458_973 171
633 3300046501 Ga0495607_0000307 Ga0495607_0000307_23028_23543 171
634 3300046501 Ga0495607_0000518 Ga0495607_0000518_18402_18917 171
635 3300046501 Ga0495607_0002631 Ga0495607_0002631_5655_6170 171
636 3300046501 Ga0495607_0010671 Ga0495607_0010671_2258_2773 171
637 3300046501 Ga0495607_0032526 Ga0495607_0032526_183_698 171
638 3300046501 Ga0495607_0057090 Ga0495607_0057090_56_571 171
639 3300046501 Ga0495607_0059120 Ga0495607_0059120_539_1054 171
640 3300046501 Ga0495607_0098561 Ga0495607_0098561_651_1166 171
641 3300046501 Ga0495607_0181317 Ga0495607_0181317_284_799 171
642 3300046501 Ga0495607_0244248 Ga0495607_0244248_208_723 171
643 3300046506 Ga0495583_0001564 Ga0495583_0001564_21669_22184 171
644 3300046506 Ga0495583_0004122 Ga0495583_0004122_5943_6458 171
645 3300046506 Ga0495583_0004268 Ga0495583_0004268_8731_9246 171
646 3300046506 Ga0495583_0032434 Ga0495583_0032434_1710_2225 171
647 3300046506 Ga0495583_0092795 Ga0495583_0092795_284_799 171
648 3300046507 Ga0495606_0000740 Ga0495606_0000740_48845_49360 171
649 3300046507 Ga0495606_0013614 Ga0495606_0013614_5668_6183 171
650 3300046507 Ga0495606_0018363 Ga0495606_0018363_258_773 171
651 3300046507 Ga0495606_0203214 Ga0495606_0203214_369_884 171
652 3300046512 Ga0495610_0003846 Ga0495610_0003846_97_612 171
653 3300046512 Ga0495610_0070763 Ga0495610_0070763_779_1294 171
654 3300046512 Ga0495610_0130970 Ga0495610_0130970_130_645 171
655 3300046513 Ga0495616_0045847 Ga0495616_0045847_198_713 171
656 3300046515 Ga0495620_0000650 Ga0495620_0000650_963_1478 171
657 3300046515 Ga0495620_0003198 Ga0495620_0003198_5799_6314 171
658 3300046515 Ga0495620_0128262 Ga0495620_0128262_286_801 171
659 3300046518 Ga0495631_0124473 Ga0495631_0124473_422_937 171
660 3300046519 Ga0495632_0002890 Ga0495632_0002890_5256_5771 171
661 3300046519 Ga0495632_0003671 Ga0495632_0003671_9181_9696 171
662 3300046519 Ga0495632_0005701 Ga0495632_0005701_5808_6323 171
663 3300046519 Ga0495632_0006623 Ga0495632_0006623_92_607 171
664 3300046519 Ga0495632_0026420 Ga0495632_0026420_2329_2844 171
665 3300046519 Ga0495632_0075177 Ga0495632_0075177_880_1395 171
666 3300046519 Ga0495632_0170893 Ga0495632_0170893_285_800 171
667 3300046520 Ga0495637_0000023 Ga0495637_0000023_27052_27567 171
668 3300046520 Ga0495637_0051872 Ga0495637_0051872_664_1179 171
669 3300046520 Ga0495637_0071361 Ga0495637_0071361_207_722 171
670 3300046520 Ga0495637_0071735 Ga0495637_0071735_277_792 171
671 3300046520 Ga0495637_0079012 Ga0495637_0079012_228_743 171
672 3300046522 Ga0495643_0001188 Ga0495643_0001188_4481_4996 171
673 3300046522 Ga0495643_0001781 Ga0495643_0001781_10604_11119 171
674 3300046522 Ga0495643_0007124 Ga0495643_0007124_708_1223 171
675 3300046522 Ga0495643_0169968 Ga0495643_0169968_355_870 171
676 3300046522 Ga0495643_0191408 Ga0495643_0191408_257_772 171
677 3300046523 Ga0495644_0106095 Ga0495644_0106095_379_894 171
678 3300046524 Ga0495648_0008108 Ga0495648_0008108_950_1465 171
679 3300046530 Ga0495654_0031555 Ga0495654_0031555_345_860 171
680 3300046530 Ga0495654_0111131 Ga0495654_0111131_637_1152 171
681 3300046530 Ga0495654_0116616 Ga0495654_0116616_517_1032 171
682 3300046530 Ga0495654_0123697 Ga0495654_0123697_284_799 171
683 3300046530 Ga0495654_0284959 Ga0495654_0284959_79_594 171
684 3300046535 Ga0495586_0518371 Ga0495586_0518371_134_649 171
685 3300046536 Ga0495587_0066385 Ga0495587_0066385_78_593 171
686 3300046538 Ga0495609_0000382 Ga0495609_0000382_443_958 171
687 3300046538 Ga0495609_0001328 Ga0495609_0001328_10981_11496 171
688 3300046542 Ga0495597_0000004 Ga0495597_0000004_196649_197164 171
689 3300046542 Ga0495597_0124438 Ga0495597_0124438_250_765 171
690 3300046542 Ga0495597_0187168 Ga0495597_0187168_244_759 171
691 3300046558 Ga0495633_0154797 Ga0495633_0154797_244_759 171
692 3300046616 Ga0495668_0229097 Ga0495668_0229097_198_713 171
693 3300046648 Ga0495611_0000623 Ga0495611_0000623_667_1182 171
694 3300046660 Ga0495625_0000010 Ga0495625_0000010_247974_248489 171
695 3300046660 Ga0495625_0015963 Ga0495625_0015963_807_1322 171
696 3300046665 Ga0495661_0000020 Ga0495661_0000020_35104_35619 171
697 3300046665 Ga0495661_0000921 Ga0495661_0000921_14261_14776 171
698 3300046665 Ga0495661_0001217 Ga0495661_0001217_200_715 171
699 3300046665 Ga0495661_0128667 Ga0495661_0128667_311_826 171
700 3300046665 Ga0495661_0156929 Ga0495661_0156929_191_706 171
701 3300046690 Ga0495624_0241695 Ga0495624_0241695_405_920 171
702 3300046692 Ga0495671_0007562 Ga0495671_0007562_2470_2985 171
703 3300046692 Ga0495671_0055015 Ga0495671_0055015_1316_1831 171
704 3300046692 Ga0495671_0143898 Ga0495671_0143898_198_713 171
705 3300046692 Ga0495671_0226650 Ga0495671_0226650_71_586 171
706 3300046694 Ga0495649_0009493 Ga0495649_0009493_255_770 171
707 3300046694 Ga0495649_0099173 Ga0495649_0099173_886_1401 171
708 3300046694 Ga0495649_0236012 Ga0495649_0236012_208_723 171
709 3300046794 Ga0495589_0100947 Ga0495589_0100947_187_702 171
710 3300046809 Ga0495600_0307759 Ga0495600_0307759_39_554 171
711 3300046810 Ga0495660_0000771 Ga0495660_0000771_20752_21267 171
712 3300046810 Ga0495660_0001796 Ga0495660_0001796_9407_9922 171
713 3300046810 Ga0495660_0018802 Ga0495660_0018802_869_1384 171
714 3300046810 Ga0495660_0112399 Ga0495660_0112399_355_879 171
715 3300047320 Ga0495672_0005847 Ga0495672_0005847_6439_6954 171
716 3300047320 Ga0495672_0007037 Ga0495672_0007037_7706_8221 171
717 3300047320 Ga0495672_0015126 Ga0495672_0015126_543_1058 171
718 3300047320 Ga0495672_0057407 Ga0495672_0057407_827_1342 171
719 3300047320 Ga0495672_0169591 Ga0495672_0169591_375_890 171
720 3300047320 Ga0495672_0389573 Ga0495672_0389573_34_549 171
721 3300047321 Ga0495676_0000002 Ga0495676_0000002_131265_131780 171
722 3300047322 Ga0495680_0577237 Ga0495680_0577237_167_682 171
723 3300047323 Ga0495683_0017539 Ga0495683_0017539_363_878 171
724 3300047444 Ga0495675_0161477 Ga0495675_0161477_566_1081 171
725 3300047446 Ga0495679_000126 Ga0495679_000126_24170_24685 171
726 3300047446 Ga0495679_035266 Ga0495679_035266_779_1294 171
727 3300047446 Ga0495679_080596 Ga0495679_080596_277_792 171
728 3300047469 Ga0495673_0000563 Ga0495673_0000563_36750_37265 171
729 3300047469 Ga0495673_0002247 Ga0495673_0002247_12438_12953 171
730 3300047469 Ga0495673_0035777 Ga0495673_0035777_169_684 171
731 3300047469 Ga0495673_0037890 Ga0495673_0037890_370_885 171
732 3300047469 Ga0495673_0063272 Ga0495673_0063272_102_617 171
733 3300047470 Ga0495681_0077474 Ga0495681_0077474_332_847 171
734 3300047470 Ga0495681_0083510 Ga0495681_0083510_631_1146 171
735 3300047470 Ga0495681_0250466 Ga0495681_0250466_47_562 171
736 3300047472 Ga0495686_0271873 Ga0495686_0271873_112_627 171
737 3300048091 Ga0495626_0000007 Ga0495626_0000007_134725_135240 171
738 3300048905 Ga0496102_0384246 Ga0496102_0384246_302_817 171
739 3300048913 Ga0496110_0447745 Ga0496110_0447745_337_852 171
740 3300048913 Ga0496110_0550802 Ga0496110_0550802_40_555 171
741 3300048914 Ga0496111_0597179 Ga0496111_0597179_262_777 171
742 3300048917 Ga0496114_0016806 Ga0496114_0016806_5155_5670 171
743 3300048919 Ga0496116_0000444 Ga0496116_0000444_54825_55340 171
744 3300048920 Ga0496117_0000894 Ga0496117_0000894_1570_2085 171
745 3300048920 Ga0496117_0003730 Ga0496117_0003730_16642_17157 171
746 3300048920 Ga0496117_0003802 Ga0496117_0003802_16484_16999 171
747 3300048920 Ga0496117_0028714 Ga0496117_0028714_3416_3931 171
748 3300048920 Ga0496117_0073785 Ga0496117_0073785_1419_1934 171
749 3300048920 Ga0496117_0113673 Ga0496117_0113673_140_655 171
750 3300048920 Ga0496117_0347247 Ga0496117_0347247_105_620 171
751 3300048921 Ga0496118_0007921 Ga0496118_0007921_167_682 171
752 3300048921 Ga0496118_0028492 Ga0496118_0028492_501_1016 171
753 3300048921 Ga0496118_0030826 Ga0496118_0030826_1175_1690 171
754 3300048921 Ga0496118_0081412 Ga0496118_0081412_216_731 171
755 3300048921 Ga0496118_0244524 Ga0496118_0244524_334_849 171
756 3300048921 Ga0496118_0245655 Ga0496118_0245655_141_656 171
757 3300048922 Ga0496119_0000541 Ga0496119_0000541_22582_23097 171
758 3300048922 Ga0496119_0257814 Ga0496119_0257814_288_803 171
759 3300048923 Ga0496120_0006452 Ga0496120_0006452_389_904 171
760 3300048923 Ga0496120_0180797 Ga0496120_0180797_182_697 171
761 3300048923 Ga0496120_0235741 Ga0496120_0235741_63_578 171
762 3300048924 Ga0496121_0000815 Ga0496121_0000815_54801_55316 171
763 3300048924 Ga0496121_0005098 Ga0496121_0005098_1882_2397 171
764 3300048924 Ga0496121_0099488 Ga0496121_0099488_1349_1864 171
765 3300048924 Ga0496121_0258943 Ga0496121_0258943_125_640 171
766 3300048924 Ga0496121_0440490 Ga0496121_0440490_71_586 171
767 3300048924 Ga0496121_0445885 Ga0496121_0445885_224_739 171
768 3300048925 Ga0496122_0000156 Ga0496122_0000156_158909_159424 171
769 3300048925 Ga0496122_0009758 Ga0496122_0009758_6329_6844 171
770 3300048925 Ga0496122_0087474 Ga0496122_0087474_78_593 171
771 3300048925 Ga0496122_0292903 Ga0496122_0292903_137_652 171
772 3300048925 Ga0496122_0391170 Ga0496122_0391170_148_663 171
773 3300048926 Ga0496123_0000087 Ga0496123_0000087_23369_23884 171
774 3300048926 Ga0496123_0002391 Ga0496123_0002391_18304_18819 171
775 3300048926 Ga0496123_0068673 Ga0496123_0068673_201_716 171
776 3300048926 Ga0496123_0137169 Ga0496123_0137169_488_1003 171
777 3300048926 Ga0496123_0165291 Ga0496123_0165291_146_661 171
778 3300048926 Ga0496123_0177731 Ga0496123_0177731_226_741 171
779 3300048926 Ga0496123_0213594 Ga0496123_0213594_273_788 171
780 3300048927 Ga0496124_0000292 Ga0496124_0000292_91271_91786 171
781 3300048927 Ga0496124_0007382 Ga0496124_0007382_177_692 171
782 3300048927 Ga0496124_0121785 Ga0496124_0121785_873_1388 171
783 3300048927 Ga0496124_0148443 Ga0496124_0148443_927_1442 171
784 3300048927 Ga0496124_0160976 Ga0496124_0160976_890_1405 171
785 3300048927 Ga0496124_0252565 Ga0496124_0252565_414_929 171
786 3300048927 Ga0496124_0260209 Ga0496124_0260209_180_695 171
787 3300048927 Ga0496124_0267253 Ga0496124_0267253_461_976 171
788 3300048927 Ga0496124_0294299 Ga0496124_0294299_648_1163 171
789 3300048927 Ga0496124_0387711 Ga0496124_0387711_148_663 171
790 3300048927 Ga0496124_0492390 Ga0496124_0492390_283_798 171
791 3300048927 Ga0496124_0588524 Ga0496124_0588524_140_655 171
792 3300048928 Ga0496125_0007649 Ga0496125_0007649_248_763 171
793 3300048928 Ga0496125_0023326 Ga0496125_0023326_651_1166 171
794 3300048928 Ga0496125_0074852 Ga0496125_0074852_723_1238 171
795 3300048928 Ga0496125_0232781 Ga0496125_0232781_475_990 171
796 3300048928 Ga0496125_0253550 Ga0496125_0253550_284_799 171
797 3300048928 Ga0496125_0262907 Ga0496125_0262907_165_680 171
798 3300048929 Ga0496126_0038064 Ga0496126_0038064_746_1261 171
799 3300048929 Ga0496126_0054264 Ga0496126_0054264_1075_1590 171
800 3300048929 Ga0496126_0110109 Ga0496126_0110109_158_673 171
801 3300048929 Ga0496126_0429248 Ga0496126_0429248_191_706 171
802 3300049459 Ga0495678_000815 Ga0495678_000815_1689_2204 171
803 3300049459 Ga0495678_040723 Ga0495678_040723_378_893 171
804 3300049459 Ga0495678_097103 Ga0495678_097103_253_768 171
805 3300049460 Ga0495682_0000050 Ga0495682_0000050_100073_100588 171
806 3300049460 Ga0495682_0001914 Ga0495682_0001914_1099_1614 171
807 3300049569 Ga0501032_0249105 Ga0501032_0249105_507_1022 171
808 3300049571 Ga0501034_0000084 Ga0501034_0000084_29507_30022 171
809 3300049571 Ga0501034_0751848 Ga0501034_0751848_81_596 171
810 3300053135 Ga0500659_0005870 Ga0500659_0005870_678_1193 171
811 3300053161 Ga0500634_0134426 Ga0500634_0134426_170_685 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09349

OHCU_decarbox

OHCU decarboxylase

10

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z5m-assembly1.cif.gz_B crystal structure of (s)-allantoin synthase 0.9049 9 169
5z5m-assembly1.cif.gz_D crystal structure of (s)-allantoin synthase 0.9031 9 169
5z5m-assembly1.cif.gz_A crystal structure of (s)-allantoin synthase 0.9006 9 169
2o74-assembly3.cif.gz_F structure of ohcu decarboxylase in complex with guanine 0.8818 10 169
2o8i-assembly1.cif.gz_A-2 crystal structure of protein atu2327 from agrobacterium tumefaciens str. c58 0.859 11 169
ID Description Score Start End Superfamily
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8824 9 169 1.10.3330.10
2o8iA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8594 12 170 1.10.3330.10
2o8iA00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.839 12 170 1.10.3330.10
2q37A00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8342 22 166 1.10.3330.10
2o70F00 Mainly Alpha;Orthogonal Bundle;UraD-like;Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase 0.8332 9 169 1.10.3330.10
ID Description Score Start End GO Terms
AF-A0A2N1URU2-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9786 101 169 GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A3M3DZL8-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9702 1 170 GO:0000255
GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A653XL81-F1-model_v4 deleted 0.9688 1 170
AF-A0A069DAK5-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) 0.9653 47 169 GO:0000255
GO:0005777
GO:0006144
GO:0019628
GO:0051997
AF-A0A8B6HQ93-F1-model_v4 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase (EC 4.1.1.97) (Parahox neighbor) (Ureidoimidazoline (2-oxo-4-hydroxy-4-carboxy-5-) decarboxylase) 0.9647 85 169 GO:0000255
GO:0005777
GO:0006144
GO:0019628
GO:0051997

Feature Viewer

pLDDT pTM Quality
89.19 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map