F481791

General Info

Members Datasets Scaffolds Average Seq Length
809 539 602 413

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016595262|8016596943
Length 413
Sequence VIVSEETLTEPVVISDVTPAAKSAAGPAYVVLAGISFSHFLNDTMQSLIASVYPILKDTYALDFAQIGMITLAFQFTASLLQPVVGHYTDKKAQPYSLSIGMASTFFGLLLLSAAHQYLVILVAAALVGLGSAVFHPESARIARLASGGRYGFAQSVFQLGGSFGTSMGPVLAALIVVPFGQGSIAWFSSIAFLAILILWRIGRWYEPQIKAKKKTVAIETHPDAPSSRRVTVALLVLVALLFSKQLYVSSLSSYYIFYLIDRFGVSTQAAQMYLFVFLAANAVGAFLGGPLGDRYGRKIVIWISILGALPFTLALPYAGLYASAVLSVIIGLIISSTTSSIIVFAQELVPHRFGMISGVFFGVAFGIGGLGAAVLGKLADHTSIEFVYQVCAYLPAIGLLAVFLPKLPRHVR

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
24 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
25 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
26 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
27 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
31 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
32 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
33 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
34 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
35 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
36 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
37 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
38 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
39 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
40 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
41 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
42 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
43 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
44 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
45 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
46 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
47 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
48 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
49 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
50 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
51 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
52 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
53 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
54 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
55 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
56 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
57 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
58 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
59 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
60 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
61 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
62 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
63 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
64 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
67 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
68 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
69 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
70 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
71 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
72 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
73 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
74 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
75 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
76 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
77 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
78 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
79 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
80 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
81 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
82 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
83 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
84 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
85 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
86 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
87 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
88 2904699407
89 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
90 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
91 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
92 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
93 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
94 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
95 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
96 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
97 2922368715
98 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
99 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
100 2922425934
101 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
102 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
103 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
104 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
105 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
106 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
107 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
108 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
109 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
110 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
111 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
112 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
113 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
114 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
115 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
116 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
117 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
118 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
119 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
120 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
121 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
122 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
123 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
124 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
125 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
126 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
127 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
128 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
129 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
130 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
131 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
132 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
133 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
134 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
135 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
136 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
137 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
138 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
139 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
140 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
141 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
142 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
143 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
144 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
145 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
146 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
147 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
148 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
149 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
150 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
151 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
152 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
153 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
154 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
155 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
156 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
157 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
158 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
159 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
160 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
161 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
162 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
163 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
164 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
165 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
166 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
167 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
168 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
169 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
170 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
171 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
172 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
173 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
174 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
175 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
176 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
177 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
178 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
179 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
180 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
183 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
184 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
185 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
186 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
187 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
188 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
189 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
190 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
191 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
194 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
195 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
196 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
197 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
198 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
199 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
200 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
201 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
202 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
203 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
204 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
205 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
206 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
207 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
208 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
209 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
210 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
211 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
212 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
213 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
214 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
215 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
217 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
218 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
219 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
220 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
221 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
222 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
223 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
224 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
225 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
226 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
227 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
228 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
229 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
230 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
231 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
232 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
233 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
234 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
236 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
237 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
238 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
239 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
240 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
244 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
245 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
246 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
247 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
248 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
249 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
250 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
251 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
252 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
253 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
254 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
255 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
256 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
259 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
261 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
262 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
307 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
308 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
309 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
310 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
314 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
315 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
316 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
317 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
318 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
319 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
320 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
321 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
322 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
323 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
324 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
325 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
326 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
327 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
328 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
329 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
330 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
331 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
332 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
333 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
334 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
335 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
336 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
337 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
338 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
339 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
340 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
341 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
342 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
343 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
344 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
345 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
346 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
347 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
348 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
349 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
350 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
351 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
352 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
353 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
354 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
355 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
356 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
357 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
358 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
359 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
360 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
363 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
364 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
365 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
366 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
367 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
368 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
369 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
370 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
371 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
372 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
373 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
374 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
375 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
376 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
377 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
378 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
379 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
380 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
381 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
382 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
383 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
386 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
387 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
388 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
389 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
390 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
393 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
394 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
395 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
396 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
397 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
398 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
401 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
404 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
405 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
406 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
407 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
408 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
409 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
410 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
411 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
414 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
415 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
416 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
417 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
418 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
419 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
420 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
424 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
425 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
426 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
429 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
430 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
431 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
432 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
433 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
449 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
456 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
457 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
460 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
461 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
462 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
463 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
464 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
465 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
466 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
467 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
468 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
469 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
470 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
471 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
472 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
473 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
474 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
475 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
476 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
477 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
478 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
479 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
480 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
481 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
482 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
483 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
484 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
487 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
488 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
489 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
490 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
491 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
492 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
493 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
494 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
495 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
496 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
497 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
498 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
499 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
500 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
501 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
502 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
503 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
504 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
505 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
506 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
507 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
508 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
509 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
510 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
511 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
512 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
513 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
514 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
515 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
516 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
517 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
518 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
519 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
520 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
521 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
522 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
523 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
524 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
525 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
526 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
527 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
528 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
529 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
530 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
531 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
532 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
533 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
534 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
535 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
536 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
537 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
538 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
539 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.66
Metatranscriptomes 0.12
Isolates 25.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.75
Nodule 19.78
Rhizoplane 5.07
Rhizosphere 53.77
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000064 3300003203 Bacteria 49110
2 JGI25406J46586_10011327 3300003203 Bacteria 3917
3 JGI25153J46596_10001826 3300003215 Bacteria 12622
4 JGI25160J50197_1012133 3300003354 Bacteria 3012
5 Ga0070658_10070036 3300005327 Bacteria 2870
6 Ga0070683_100014616 3300005329 Bacteria 6874
7 Ga0070683_100028855 3300005329 Bacteria 5018
8 Ga0070683_100030271 3300005329 Bacteria 4911
9 Ga0068869_100048784 3300005334 Bacteria 3063
10 Ga0068869_100118836 3300005334 Bacteria 2019
11 Ga0070680_100015059 3300005336 Bacteria 6054
12 Ga0070680_100265806 3300005336 Bacteria 1452
13 Ga0070682_100097116 3300005337 Bacteria 1938
14 Ga0070682_100204237 3300005337 Bacteria 1396
15 Ga0070660_100034673 3300005339 Bacteria 3814
16 Ga0070660_100065521 3300005339 Bacteria 2827
17 Ga0070691_10025478 3300005341 Bacteria 2754
18 Ga0070668_100031147 3300005347 Bacteria 4058
19 Ga0070668_100118162 3300005347 Bacteria 2116
20 Ga0070669_100033219 3300005353 Bacteria 3730
21 Ga0070671_100068590 3300005355 Bacteria 2958
22 Ga0070671_100075345 3300005355 Bacteria 2819
23 Ga0070674_100008657 3300005356 Bacteria 6066
24 Ga0070674_100065540 3300005356 Bacteria 2549
25 Ga0070659_100026378 3300005366 Bacteria 4471
26 Ga0070659_100127078 3300005366 Bacteria 2069
27 Ga0070667_100044424 3300005367 Bacteria 3731
28 Ga0070667_100171521 3300005367 Bacteria 1915
29 Ga0070709_10002262 3300005434 Bacteria 10432
30 Ga0070714_100011322 3300005435 Bacteria 7074
31 Ga0070713_100003057 3300005436 Bacteria 10992
32 Ga0070713_100013210 3300005436 Bacteria 6089
33 Ga0070713_100060660 3300005436 Bacteria 3162
34 Ga0070710_10023090 3300005437 Bacteria 3263
35 Ga0070711_100030272 3300005439 Bacteria 3582
36 Ga0070694_100098788 3300005444 Bacteria 2062
37 Ga0070663_100048939 3300005455 Bacteria 2999
38 Ga0070663_100163359 3300005455 Bacteria 1716
39 Ga0070678_100137012 3300005456 Bacteria 1953
40 Ga0070678_100169963 3300005456 Bacteria 1774
41 Ga0070662_100064814 3300005457 Bacteria 2676
42 Ga0070662_100073964 3300005457 Bacteria 2519
43 Ga0070681_10031485 3300005458 Bacteria 5326
44 Ga0070681_10067186 3300005458 Bacteria 3553
45 Ga0070681_10117395 3300005458 Bacteria 2597
46 Ga0068867_100200088 3300005459 Bacteria 1599
47 Ga0070698_100103345 3300005471 Bacteria 2819
48 Ga0070679_100009249 3300005530 Bacteria 9313
49 Ga0070684_100008556 3300005535 Bacteria 8010
50 Ga0070684_100013708 3300005535 Bacteria 6541
51 Ga0070697_100015893 3300005536 Bacteria 5914
52 Ga0068853_100002207 3300005539 Bacteria 14542
53 Ga0068853_100030556 3300005539 Bacteria 4551
54 Ga0070665_100030314 3300005548 Bacteria 5444
55 Ga0070665_100073740 3300005548 Bacteria 3418
56 Ga0070665_100089381 3300005548 Bacteria 3086
57 Ga0068855_100117585 3300005563 Bacteria 3045
58 Ga0068855_100192942 3300005563 Bacteria 2296
59 Ga0068855_100284371 3300005563 Bacteria 1835
60 Ga0068857_100034471 3300005577 Bacteria 4478
61 Ga0068857_100155307 3300005577 Bacteria 2075
62 Ga0068854_100203564 3300005578 Bacteria 1557
63 Ga0068856_100004436 3300005614 Bacteria 13974
64 Ga0068856_100202460 3300005614 Bacteria 2000
65 Ga0068852_100107521 3300005616 Bacteria 2530
66 Ga0068859_100062487 3300005617 Bacteria 3754
67 Ga0068864_100051077 3300005618 Bacteria 3560
68 Ga0068861_100107403 3300005719 Bacteria 2231
69 Ga0068851_10015046 3300005834 Bacteria 3682
70 Ga0068858_100100363 3300005842 Bacteria 2700
71 Ga0068860_100002033 3300005843 Bacteria 21319
72 Ga0081455_10004676 3300005937 Bacteria 15239
73 Ga0081455_10023105 3300005937 Bacteria 5792
74 Ga0081455_10042566 3300005937 Bacteria 3982
75 Ga0081455_10055334 3300005937 Bacteria 3375
76 Ga0081455_10105146 3300005937 Bacteria 2256
77 Ga0081540_1003809 3300005983 Bacteria 11796
78 Ga0081540_1005189 3300005983 Bacteria 9753
79 Ga0081540_1007118 3300005983 Bacteria 8028
80 Ga0081540_1008316 3300005983 Bacteria 7258
81 Ga0081540_1009524 3300005983 Bacteria 6687
82 Ga0081540_1033115 3300005983 Bacteria 2811
83 Ga0081539_10000099 3300005985 Bacteria 201018
84 Ga0081539_10000958 3300005985 Bacteria 54105
85 Ga0081539_10075359 3300005985 Bacteria 1793
86 Ga0070717_10205460 3300006028 Bacteria 1727
87 Ga0075365_10007229 3300006038 Bacteria 6203
88 Ga0075365_10017120 3300006038 Bacteria 4425
89 Ga0075365_10042647 3300006038 Bacteria 2967
90 Ga0075365_10046934 3300006038 Bacteria 2838
91 Ga0075365_10070828 3300006038 Bacteria 2346
92 Ga0075368_10010213 3300006042 Bacteria 3391
93 Ga0075363_100024415 3300006048 Bacteria 3073
94 Ga0075363_100029979 3300006048 Bacteria 2812
95 Ga0075363_100039740 3300006048 Bacteria 2477
96 Ga0070715_10003525 3300006163 Bacteria 4997
97 Ga0070716_100105346 3300006173 Bacteria 1737
98 Ga0070712_100010132 3300006175 Bacteria 5941
99 Ga0075362_10003381 3300006177 Bacteria 5564
100 Ga0075367_10008443 3300006178 Bacteria 5336
101 Ga0075367_10011965 3300006178 Bacteria 4610
102 Ga0075367_10016996 3300006178 Bacteria 3984
103 Ga0075367_10042754 3300006178 Bacteria 2652
104 Ga0075370_10048373 3300006353 Bacteria 2409
105 Ga0075370_10101950 3300006353 Bacteria 1662
106 Ga0075428_100107116 3300006844 Bacteria 3046
107 Ga0075434_100090790 3300006871 Bacteria 3056
108 Ga0068865_100024542 3300006881 Bacteria 3957
109 Ga0097620_100062488 3300006931 Bacteria 3754
110 Ga0099824_1008513 3300006942 Bacteria 13101
111 Ga0099795_10016452 3300007788 Bacteria 2339
112 Ga0105240_10028981 3300009093 Bacteria 7220
113 Ga0105240_10074144 3300009093 Bacteria 4201
114 Ga0105240_10076492 3300009093 Bacteria 4126
115 Ga0105240_10088824 3300009093 Bacteria 3781
116 Ga0105240_10108155 3300009093 Bacteria 3369
117 Ga0111539_10035547 3300009094 Bacteria 6031
118 Ga0111539_10038005 3300009094 Bacteria 5807
119 Ga0111539_10398983 3300009094 Bacteria 1602
120 Ga0105245_10016400 3300009098 Bacteria 6462
121 Ga0105247_10161614 3300009101 Bacteria 1483
122 Ga0105241_10134404 3300009174 Bacteria 2006
123 Ga0105237_10012102 3300009545 Bacteria 9107
124 Ga0105237_10022395 3300009545 Bacteria 6483
125 Ga0105237_10027380 3300009545 Bacteria 5819
126 Ga0105237_10045894 3300009545 Bacteria 4397
127 Ga0105237_10135130 3300009545 Bacteria 2461
128 Ga0105237_10184946 3300009545 Bacteria 2084
129 Ga0105237_10286844 3300009545 Bacteria 1649
130 Ga0105238_10003421 3300009551 Bacteria 15825
131 Ga0105238_10171357 3300009551 Bacteria 2147
132 Ga0105249_10259876 3300009553 Bacteria 1725
133 Ga0105239_10039377 3300010375 Bacteria 5180
134 Ga0105239_10062992 3300010375 Bacteria 4071
135 Ga0105239_10141081 3300010375 Bacteria 2685
136 Ga0105239_10354715 3300010375 Bacteria 1656
137 Ga0105246_10122556 3300011119 Bacteria 1929
138 Ga0157370_10124163 3300013104 Bacteria 2410
139 Ga0157370_10144768 3300013104 Bacteria 2213
140 Ga0157369_10008923 3300013105 Bacteria 11481
141 Ga0157369_10048074 3300013105 Bacteria 4630
142 Ga0157369_10053962 3300013105 Bacteria 4341
143 Ga0157369_10145823 3300013105 Bacteria 2503
144 Ga0157374_10003262 3300013296 Bacteria 13625
145 Ga0157374_10045188 3300013296 Bacteria 4076
146 Ga0157378_10004948 3300013297 Bacteria 11684
147 Ga0157378_10095220 3300013297 Bacteria 2712
148 Ga0163162_10140685 3300013306 Bacteria 2526
149 Ga0157372_10037760 3300013307 Bacteria 5328
150 Ga0157372_10265646 3300013307 Bacteria 1993
151 Ga0163163_10117367 3300014325 Bacteria 2693
152 Ga0163163_10153434 3300014325 Bacteria 2346
153 Ga0157380_10023470 3300014326 Bacteria 4652
154 Ga0157380_10093329 3300014326 Bacteria 2488
155 Ga0157379_10070458 3300014968 Bacteria 3128
156 Ga0214544_1000163 3300021320 Bacteria 101631
157 Ga0214542_1000156 3300021321 Bacteria 101631
158 Ga0214545_1000078 3300021324 Bacteria 101631
159 Ga0214543_1000136 3300021327 Bacteria 101629
160 Ga0209563_101512 3300025230 Bacteria 6093
161 Ga0209677_107843 3300025253 Bacteria 2179
162 Ga0209233_1009766 3300025261 Bacteria 2905
163 Ga0209564_1009894 3300025295 Bacteria 4465
164 Ga0209758_1000705 3300025297 Bacteria 49585
165 Ga0209758_1000932 3300025297 Bacteria 39573
166 Ga0209758_1000986 3300025297 Bacteria 38258
167 Ga0209758_1001737 3300025297 Bacteria 24275
168 Ga0209758_1003580 3300025297 Bacteria 13909
169 Ga0209758_1008219 3300025297 Bacteria 6835
170 Ga0207426_1000632 3300025302 Bacteria 44581
171 Ga0209257_1023187 3300025304 Bacteria 2189
172 Ga0207697_10020133 3300025315 Bacteria 2733
173 Ga0207656_10011027 3300025321 Bacteria 3403
174 Ga0207692_10003950 3300025898 Bacteria 5822
175 Ga0207692_10009404 3300025898 Bacteria 4082
176 Ga0207647_10012253 3300025904 Bacteria 5976
177 Ga0207699_10001069 3300025906 Bacteria 12945
178 Ga0207705_10055052 3300025909 Bacteria 2868
179 Ga0207654_10013829 3300025911 Bacteria 4158
180 Ga0207654_10041635 3300025911 Bacteria 2595
181 Ga0207707_10001541 3300025912 Bacteria 21226
182 Ga0207707_10022607 3300025912 Bacteria 5497
183 Ga0207707_10089328 3300025912 Bacteria 2692
184 Ga0207707_10178212 3300025912 Bacteria 1856
185 Ga0207695_10000123 3300025913 Bacteria 232059
186 Ga0207695_10065019 3300025913 Bacteria 3752
187 Ga0207695_10077656 3300025913 Bacteria 3371
188 Ga0207671_10014288 3300025914 Bacteria 6280
189 Ga0207671_10023986 3300025914 Bacteria 4592
190 Ga0207693_10000565 3300025915 Bacteria 33481
191 Ga0207693_10003555 3300025915 Bacteria 13315
192 Ga0207693_10008187 3300025915 Bacteria 8566
193 Ga0207693_10020827 3300025915 Bacteria 5214
194 Ga0207663_10000239 3300025916 Bacteria 24165
195 Ga0207663_10005579 3300025916 Bacteria 6352
196 Ga0207663_10082976 3300025916 Bacteria 2104
197 Ga0207660_10010184 3300025917 Bacteria 6093
198 Ga0207660_10033682 3300025917 Bacteria 3546
199 Ga0207657_10005246 3300025919 Bacteria 13576
200 Ga0207657_10055057 3300025919 Bacteria 3438
201 Ga0207657_10104597 3300025919 Bacteria 2344
202 Ga0207649_10028886 3300025920 Bacteria 3270
203 Ga0207652_10016519 3300025921 Bacteria 6028
204 Ga0207652_10024907 3300025921 Bacteria 4968
205 Ga0207652_10025737 3300025921 Bacteria 4895
206 Ga0207687_10002549 3300025927 Bacteria 12372
207 Ga0207687_10126782 3300025927 Bacteria 1918
208 Ga0207700_10005630 3300025928 Bacteria 7519
209 Ga0207700_10011952 3300025928 Bacteria 5568
210 Ga0207700_10021183 3300025928 Bacteria 4432
211 Ga0207664_10008257 3300025929 Bacteria 7252
212 Ga0207644_10076454 3300025931 Bacteria 2463
213 Ga0207690_10097110 3300025932 Bacteria 2096
214 Ga0207706_10028509 3300025933 Bacteria 4987
215 Ga0207706_10055808 3300025933 Bacteria 3483
216 Ga0207670_10072310 3300025936 Bacteria 2387
217 Ga0207669_10014357 3300025937 Bacteria 3967
218 Ga0207665_10000127 3300025939 Bacteria 50413
219 Ga0207665_10147606 3300025939 Bacteria 1681
220 Ga0207691_10050355 3300025940 Bacteria 3813
221 Ga0207711_10052652 3300025941 Bacteria 3489
222 Ga0207689_10014870 3300025942 Bacteria 6605
223 Ga0207661_10010620 3300025944 Bacteria 6635
224 Ga0207661_10011823 3300025944 Bacteria 6339
225 Ga0207667_10012980 3300025949 Bacteria 9561
226 Ga0207667_10128800 3300025949 Bacteria 2607
227 Ga0207667_10196100 3300025949 Bacteria 2072
228 Ga0207712_10016234 3300025961 Bacteria 4818
229 Ga0207712_10060450 3300025961 Bacteria 2686
230 Ga0207712_10176810 3300025961 Bacteria 1673
231 Ga0207668_10003544 3300025972 Bacteria 9176
232 Ga0207668_10134984 3300025972 Bacteria 1889
233 Ga0207677_10140768 3300026023 Bacteria 1846
234 Ga0207639_10016989 3300026041 Bacteria 5156
235 Ga0207678_10036953 3300026067 Bacteria 4251
236 Ga0207678_10130789 3300026067 Bacteria 2141
237 Ga0207708_10044384 3300026075 Bacteria 3387
238 Ga0207702_10000758 3300026078 Bacteria 34312
239 Ga0207641_10215815 3300026088 Bacteria 1776
240 Ga0207648_10046275 3300026089 Bacteria 3814
241 Ga0207648_10280973 3300026089 Bacteria 1489
242 Ga0207676_10027584 3300026095 Bacteria 4231
243 Ga0207674_10025987 3300026116 Bacteria 6231
244 Ga0207674_10026551 3300026116 Bacteria 6146
245 Ga0207675_100077746 3300026118 Bacteria 3109
246 Ga0207675_100125875 3300026118 Bacteria 2427
247 Ga0207698_10046695 3300026142 Bacteria 3273
248 Ga0207698_10230349 3300026142 Bacteria 1681
249 Ga0209389_1000248 3300027296 Bacteria 34726
250 Ga0209589_1001871 3300027357 Bacteria 35557
251 Ga0209489_102684 3300027361 Bacteria 35799
252 Ga0207428_10132076 3300027907 Bacteria 1910
253 Ga0268266_10022369 3300028379 Bacteria 5389
254 Ga0268266_10023902 3300028379 Bacteria 5200
255 Ga0268266_10048656 3300028379 Bacteria 3634
256 Ga0268266_10158379 3300028379 Bacteria 2047
257 Ga0268265_10023047 3300028380 Bacteria 4384
258 Ga0268265_10023969 3300028380 Bacteria 4310
259 Ga0268264_10000174 3300028381 Bacteria 137254
260 Ga0307517_10021811 3300028786 Bacteria 8062
261 Ga0307515_10221687 3300028794 Bacteria 1707
262 Ga0265338_10188674 3300028800 Bacteria 1565
263 Ga0265330_10035657 3300031235 Bacteria 2218
264 Ga0265332_10012460 3300031238 Bacteria 3774
265 Ga0265340_10003101 3300031247 Bacteria 9427
266 Ga0265339_10006267 3300031249 Bacteria 7828
267 Ga0265316_10070564 3300031344 Bacteria 2695
268 Ga0307509_10033214 3300031507 Bacteria 5679
269 Ga0307508_10000063 3300031616 Bacteria 122536
270 Ga0307508_10027504 3300031616 Bacteria 5146
271 Ga0265314_10008977 3300031711 Bacteria 8509
272 Ga0265342_10049875 3300031712 Bacteria 2503
273 Ga0265342_10094168 3300031712 Bacteria 1714
274 Ga0307516_10018150 3300031730 Bacteria 7316
275 Ga0307516_10059002 3300031730 Bacteria 3733
276 Ga0307516_10137777 3300031730 Bacteria 2213
277 Ga0307510_10010372 3300033180 Bacteria 11067
278 Ga0307510_10024996 3300033180 Bacteria 6896
279 Ga0307510_10041830 3300033180 Bacteria 5003
280 Ga0307510_10165981 3300033180 Bacteria 1796
281 Ga0316215_1002488 3300033544 Bacteria 1742
282 Ga0373934_0008383 3300035086 Bacteria 3852
283 Ga0373934_0023120 3300035086 Bacteria 2401
284 Ga0373923_0001005 3300035111 Bacteria 7635
285 Ga0373936_0031660 3300035113 Bacteria 2089
286 Ga0373936_0035701 3300035113 Bacteria 1980
287 Ga0373945_0017685 3300035116 Bacteria 2417
288 Ga0373953_0000415 3300035117 Bacteria 11581
289 Ga0373954_0004190 3300035118 Bacteria 6181
290 Ga0373954_0012233 3300035118 Bacteria 3815
291 Ga0373954_0071911 3300035118 Bacteria 1644
292 Ga0373956_0001481 3300035119 Bacteria 9711
293 Ga0373956_0014888 3300035119 Bacteria 3252
294 Ga0373957_0008299 3300035120 Bacteria 3358
295 Ga0373943_0004735 3300035170 Bacteria 6149
296 Ga0373943_0005037 3300035170 Bacteria 5958
297 Ga0373955_0002049 3300035172 Bacteria 8671
298 Ga0373955_0019272 3300035172 Bacteria 3406
299 Ga0373955_0035628 3300035172 Bacteria 2636
300 Ga0373924_0027599 3300035410 Bacteria 2258
301 Ga0373931_0014884 3300035691 Bacteria 3810
302 Ga0373935_0036629 3300035692 Bacteria 3068
303 Ga0373935_0054232 3300035692 Bacteria 2552
304 Ga0373927_0023634 3300035695 Bacteria 4023
305 Ga0373933_0000204 3300035724 Bacteria 39417
306 Ga0373933_0004702 3300035724 Bacteria 7476
307 Ga0373947_0000455 3300035725 Bacteria 23308
308 Ga0373947_0013349 3300035725 Bacteria 4707
309 Ga0373937_0004613 3300036401 Bacteria 11701
310 Ga0373937_0008188 3300036401 Bacteria 9080
311 Ga0373937_0009140 3300036401 Bacteria 8599
312 Ga0373937_0019760 3300036401 Bacteria 6033
313 Ga0373937_0182159 3300036401 Bacteria 1973
314 Ga0372808_002623 3300036459 Bacteria 2102
315 Ga0373925_0006046 3300037068 Bacteria 8955
316 Ga0373925_0124477 3300037068 Bacteria 2004
317 Ga0395900_0012087 3300037418 Bacteria 8823
318 Ga0395900_0076163 3300037418 Bacteria 3449
319 Ga0395898_0008444 3300037466 Bacteria 10888
320 Ga0395898_0011301 3300037466 Bacteria 9283
321 Ga0395905_0146839 3300037471 Bacteria 2219
322 Ga0436364_0787494 3300037853 Bacteria 3229
323 Ga0395901_0015903 3300038443 Bacteria 7668
324 Ga0395901_0066938 3300038443 Bacteria 3741
325 Ga0436365_0488786 3300039437 Bacteria 4011
326 Ga0436365_1439813 3300039437 Bacteria 24357
327 Ga0436365_1552881 3300039437 Bacteria 2917
328 Ga0436363_0832891 3300039450 Bacteria 1721
329 Ga0436362_1202653 3300039453 Bacteria 2801
330 Ga0466966_0001614 3300044684 Bacteria 14525
331 Ga0466961_0000192 3300044693 Bacteria 40922
332 Ga0466959_0000934 3300045049 Bacteria 17340
333 Ga0495592_0008971 3300046454 Bacteria 7512
334 Ga0495592_0020497 3300046454 Bacteria 5029
335 Ga0495603_0000239 3300046455 Bacteria 28578
336 Ga0495603_0004059 3300046455 Bacteria 8712
337 Ga0495603_0042269 3300046455 Bacteria 2725
338 Ga0495629_0000457 3300046459 Bacteria 34088
339 Ga0495629_0004778 3300046459 Bacteria 10153
340 Ga0495629_0006402 3300046459 Bacteria 8733
341 Ga0495638_0015338 3300046460 Bacteria 5147
342 Ga0495641_0002157 3300046461 Bacteria 15774
343 Ga0495651_0001839 3300046462 Bacteria 16395
344 Ga0495651_0016963 3300046462 Bacteria 5640
345 Ga0495651_0045340 3300046462 Bacteria 3406
346 Ga0495651_0142626 3300046462 Bacteria 1735
347 Ga0495653_0009797 3300046463 Bacteria 7835
348 Ga0495653_0067979 3300046463 Bacteria 2673
349 Ga0495653_0107165 3300046463 Bacteria 2014
350 Ga0495650_0037007 3300046471 Bacteria 2129
351 Ga0495580_0004703 3300046472 Bacteria 11445
352 Ga0495580_0009906 3300046472 Bacteria 7462
353 Ga0495580_0062964 3300046472 Bacteria 2602
354 Ga0495582_0000077 3300046473 Bacteria 49112
355 Ga0495639_0000101 3300046475 Bacteria 42348
356 Ga0495639_0044668 3300046475 Bacteria 2003
357 Ga0495662_0010930 3300046476 Bacteria 4440
358 Ga0495664_0007665 3300046477 Bacteria 6003
359 Ga0495664_0022227 3300046477 Bacteria 3674
360 Ga0495594_0000083 3300046499 Bacteria 42703
361 Ga0495596_0050823 3300046500 Bacteria 1624
362 Ga0495606_0000357 3300046507 Bacteria 78015
363 Ga0495606_0013192 3300046507 Bacteria 6555
364 Ga0495608_0004649 3300046511 Bacteria 9811
365 Ga0495608_0038423 3300046511 Bacteria 3214
366 Ga0495618_0050333 3300046514 Bacteria 2631
367 Ga0495628_0009352 3300046516 Bacteria 8368
368 Ga0495628_0062610 3300046516 Bacteria 2916
369 Ga0495628_0074155 3300046516 Bacteria 2651
370 Ga0495666_0056332 3300046526 Bacteria 1883
371 Ga0495652_0027178 3300046529 Bacteria 5044
372 Ga0495652_0033108 3300046529 Bacteria 4516
373 Ga0495652_0088520 3300046529 Bacteria 2537
374 Ga0495652_0094059 3300046529 Bacteria 2445
375 Ga0495652_0095391 3300046529 Bacteria 2424
376 Ga0495665_0000055 3300046531 Bacteria 45208
377 Ga0495640_0004679 3300046533 Bacteria 10908
378 Ga0495640_0018966 3300046533 Bacteria 5088
379 Ga0495640_0040562 3300046533 Bacteria 3259
380 Ga0495586_0048634 3300046535 Bacteria 2292
381 Ga0495587_0004468 3300046536 Bacteria 9203
382 Ga0495587_0032943 3300046536 Bacteria 3129
383 Ga0495597_0027431 3300046542 Bacteria 2611
384 Ga0495645_0006792 3300046543 Bacteria 7952
385 Ga0495645_0027524 3300046543 Bacteria 4131
386 Ga0495645_0086668 3300046543 Bacteria 2240
387 Ga0495645_0154405 3300046543 Bacteria 1592
388 Ga0495667_0004352 3300046559 Bacteria 9561
389 Ga0495667_0034624 3300046559 Bacteria 3376
390 Ga0495667_0109928 3300046559 Bacteria 1781
391 Ga0495634_0000720 3300046642 Bacteria 32017
392 Ga0495634_0001493 3300046642 Bacteria 20702
393 Ga0495634_0027825 3300046642 Bacteria 3930
394 Ga0495634_0032036 3300046642 Bacteria 3617
395 Ga0495634_0112395 3300046642 Bacteria 1751
396 Ga0495625_0085379 3300046660 Bacteria 2191
397 Ga0495635_0004810 3300046663 Bacteria 9387
398 Ga0495635_0011274 3300046663 Bacteria 6269
399 Ga0495635_0012169 3300046663 Bacteria 6032
400 Ga0495635_0023852 3300046663 Bacteria 4263
401 Ga0495588_0032711 3300046674 Bacteria 2622
402 Ga0495657_0003079 3300046675 Bacteria 13781
403 Ga0495657_0004591 3300046675 Bacteria 11023
404 Ga0495657_0061694 3300046675 Bacteria 2479
405 Ga0495599_0001945 3300046678 Bacteria 11972
406 Ga0495599_0005172 3300046678 Bacteria 7778
407 Ga0495599_0067586 3300046678 Bacteria 2232
408 Ga0495599_0072228 3300046678 Bacteria 2154
409 Ga0495599_0107887 3300046678 Bacteria 1735
410 Ga0495623_0005899 3300046679 Bacteria 7979
411 Ga0495623_0012014 3300046679 Bacteria 5610
412 Ga0495623_0029120 3300046679 Bacteria 3555
413 Ga0495646_0001642 3300046680 Bacteria 13342
414 Ga0495646_0011553 3300046680 Bacteria 5607
415 Ga0495646_0037952 3300046680 Bacteria 2977
416 Ga0495646_0078288 3300046680 Bacteria 1932
417 Ga0495647_0010240 3300046681 Bacteria 3191
418 Ga0495658_0001572 3300046683 Bacteria 11910
419 Ga0495669_0002048 3300046684 Bacteria 8266
420 Ga0495613_0021735 3300046689 Bacteria 4780
421 Ga0495624_0000235 3300046690 Bacteria 43165
422 Ga0495624_0100052 3300046690 Bacteria 1785
423 Ga0495624_0117211 3300046690 Bacteria 1636
424 Ga0495600_0003270 3300046809 Bacteria 9492
425 Ga0495581_0000041 3300047315 Bacteria 46518
426 Ga0495581_0068564 3300047315 Bacteria 2051
427 Ga0495581_0083442 3300047315 Bacteria 1851
428 Ga0495604_0007215 3300047317 Bacteria 8805
429 Ga0495604_0007221 3300047317 Bacteria 8800
430 Ga0495604_0012818 3300047317 Bacteria 6675
431 Ga0495674_0010515 3300047319 Bacteria 8758
432 Ga0495674_0011929 3300047319 Bacteria 8194
433 Ga0495674_0119907 3300047319 Bacteria 2223
434 Ga0495672_0011925 3300047320 Bacteria 6096
435 Ga0495672_0067517 3300047320 Bacteria 2036
436 Ga0495676_0042790 3300047321 Bacteria 3714
437 Ga0495680_0001654 3300047322 Bacteria 23702
438 Ga0495680_0025270 3300047322 Bacteria 4918
439 Ga0495680_0056996 3300047322 Bacteria 3024
440 Ga0495687_015363 3300047443 Bacteria 3897
441 Ga0495675_0023366 3300047444 Bacteria 3938
442 Ga0495675_0041984 3300047444 Bacteria 2913
443 Ga0495684_0001399 3300047471 Bacteria 19329
444 Ga0495684_0131744 3300047471 Bacteria 1877
445 Ga0495686_0076338 3300047472 Bacteria 2053
446 Ga0495593_0000024 3300047673 Bacteria 65718
447 Ga0495593_0004938 3300047673 Bacteria 7905
448 Ga0495602_0009939 3300048088 Bacteria 9869
449 Ga0495602_0031141 3300048088 Bacteria 5047
450 Ga0495602_0075159 3300048088 Bacteria 2868
451 Ga0496101_0019807 3300048904 Bacteria 4600
452 Ga0496101_0053295 3300048904 Bacteria 2918
453 Ga0496102_0022602 3300048905 Bacteria 5573
454 Ga0496102_0026012 3300048905 Bacteria 5216
455 Ga0496102_0127619 3300048905 Bacteria 2378
456 Ga0496102_0162647 3300048905 Bacteria 2100
457 Ga0496103_0037403 3300048906 Bacteria 2974
458 Ga0496104_0006437 3300048907 Bacteria 10324
459 Ga0496104_0011552 3300048907 Bacteria 7912
460 Ga0496104_0023546 3300048907 Bacteria 5662
461 Ga0496104_0036831 3300048907 Bacteria 4574
462 Ga0496104_0182244 3300048907 Bacteria 2010
463 Ga0496105_0004780 3300048908 Bacteria 10225
464 Ga0496105_0014373 3300048908 Bacteria 6299
465 Ga0496105_0020055 3300048908 Bacteria 5396
466 Ga0496106_0006865 3300048909 Bacteria 8425
467 Ga0496106_0032587 3300048909 Bacteria 3886
468 Ga0496106_0069534 3300048909 Bacteria 2687
469 Ga0496107_0006673 3300048910 Bacteria 7945
470 Ga0496108_0026234 3300048911 Bacteria 4805
471 Ga0496108_0096093 3300048911 Bacteria 2523
472 Ga0496108_0104576 3300048911 Bacteria 2416
473 Ga0496109_0063433 3300048912 Bacteria 3380
474 Ga0496110_0014165 3300048913 Bacteria 6615
475 Ga0496110_0044935 3300048913 Bacteria 3858
476 Ga0496110_0079832 3300048913 Bacteria 2914
477 Ga0496111_0011527 3300048914 Bacteria 5961
478 Ga0496111_0039640 3300048914 Bacteria 3379
479 Ga0496111_0046795 3300048914 Bacteria 3115
480 Ga0496112_0000052 3300048915 Bacteria 81285
481 Ga0496112_0035596 3300048915 Bacteria 4851
482 Ga0496112_0100431 3300048915 Bacteria 2863
483 Ga0496112_0173505 3300048915 Bacteria 2121
484 Ga0496113_0032329 3300048916 Bacteria 3803
485 Ga0496113_0093176 3300048916 Bacteria 2325
486 Ga0496114_0265033 3300048917 Bacteria 1513
487 Ga0496115_0001250 3300048918 Bacteria 18240
488 Ga0496115_0058775 3300048918 Bacteria 3095
489 Ga0496115_0177837 3300048918 Bacteria 1760
490 Ga0496115_0238430 3300048918 Bacteria 1499
491 Ga0496116_0009198 3300048919 Bacteria 8457
492 Ga0496118_0014888 3300048921 Bacteria 7245
493 Ga0496118_0058206 3300048921 Bacteria 2890
494 Ga0496120_0044095 3300048923 Bacteria 2593
495 Ga0496121_0000406 3300048924 Bacteria 85761
496 Ga0496121_0038386 3300048924 Bacteria 4244
497 Ga0496121_0124517 3300048924 Bacteria 1940
498 Ga0496125_0000158 3300048928 Bacteria 151273
499 Ga0496126_0000849 3300048929 Bacteria 54058
500 Ga0496126_0009829 3300048929 Bacteria 10127
501 Ga0496126_0034696 3300048929 Bacteria 4735
502 Ga0496126_0060149 3300048929 Bacteria 3418
503 Ga0496126_0062869 3300048929 Bacteria 3329
504 Ga0496126_0116044 3300048929 Bacteria 2327
505 Ga0501031_0000398 3300049568 Bacteria 25392
506 Ga0501032_0000916 3300049569 Bacteria 23861
507 Ga0501033_0001463 3300049570 Bacteria 20932
508 Ga0501034_0000072 3300049571 Bacteria 179824
509 Ga0501036_0000250 3300049572 Bacteria 36419
510 Ga0501037_0000030 3300049573 Bacteria 136148
511 Ga0501038_0000039 3300049574 Bacteria 122904
512 Ga0501039_0000060 3300049575 Bacteria 85528
513 Ga0501039_0087726 3300049575 Bacteria 2424
514 Ga0501043_0003512 3300049579 Bacteria 12893
515 Ga0501043_0148437 3300049579 Bacteria 1835
516 Ga0501046_0000419 3300049580 Bacteria 42326
517 Ga0501047_0000174 3300049581 Bacteria 79021
518 Ga0501047_0071264 3300049581 Bacteria 3345
519 Ga0501047_0104480 3300049581 Bacteria 2713
520 Ga0501048_0000068 3300049582 Bacteria 53016
521 Ga0501067_0000068 3300049583 Bacteria 59338
522 Ga0501067_0083105 3300049583 Bacteria 1776
523 Ga0501068_0000949 3300049584 Bacteria 15209
524 Ga0501070_0007372 3300049586 Bacteria 9340
525 Ga0501070_0012988 3300049586 Bacteria 7020
526 Ga0501072_0003432 3300049588 Bacteria 11934
527 Ga0501073_0000009 3300049589 Bacteria 195649
528 Ga0501073_0065004 3300049589 Bacteria 2544
529 Ga0501074_0001057 3300049590 Bacteria 17986
530 Ga0501080_0002767 3300049742 Bacteria 15405
531 Ga0501083_0006137 3300049744 Bacteria 8522
532 Ga0501035_0000067 3300049822 Bacteria 129204
533 Ga0501035_0207447 3300049822 Bacteria 1678
534 Ga0501044_0246961 3300049823 Bacteria 1727
535 nmdc:mga03683_20124_c1 3300050489 Bacteria 2556
536 nmdc:mga03683_4811_c1 3300050489 Bacteria 4508
537 nmdc:mga03n38_36837_c1 3300050490 Bacteria 2106
538 nmdc:mga00v17_91210_c1 3300050491 Bacteria 1914
539 nmdc:mga0yw44_10099_c1 3300050492 Bacteria 4807
540 nmdc:mga0yw44_11198_c1 3300050492 Bacteria 4617
541 nmdc:mga0yw44_48604_c1 3300050492 Bacteria 2558
542 nmdc:mga0yw44_8041_c1 3300050492 Bacteria 5230
543 nmdc:mga0k408_50283_c1 3300050493 Bacteria 2413
544 nmdc:mga06z11_67292_c1 3300050494 Bacteria 1885
545 nmdc:mga06z11_714_c1 3300050494 Bacteria 12097
546 nmdc:mga04h51_20567_c1 3300050495 Bacteria 1973
547 nmdc:mga07m45_13095_c1 3300050496 Bacteria 4392
548 nmdc:mga07m45_18945_c1 3300050496 Bacteria 3724
549 nmdc:mga07m45_25456_c1 3300050496 Bacteria 3245
550 nmdc:mga07m45_9035_c1 3300050496 Bacteria 5149
551 nmdc:mga05p37_41080_c1 3300050507 Bacteria 5679
552 nmdc:mga08y16_83157_c1 3300050511 Bacteria 3336
553 nmdc:mga0n895_345783_c1 3300050512 Bacteria 1506
554 nmdc:mga0sz30_4359_c1 3300050516 Bacteria 5109
555 Ga0495601_0037471 3300053077 Bacteria 3031
556 Ga0495601_0107617 3300053077 Bacteria 1804
557 Ga0500635_0002813 3300053080 Bacteria 4320
558 Ga0500635_0036346 3300053080 Bacteria 1623
559 Ga0495655_0003480 3300053083 Bacteria 2602
560 Ga0495595_0000637 3300053084 Bacteria 13319
561 Ga0495619_0001080 3300053085 Bacteria 17897
562 Ga0500643_000013 3300053087 Bacteria 324296
563 Ga0500646_0022926 3300053090 Bacteria 1672
564 Ga0500566_0001419 3300053094 Bacteria 14035
565 Ga0500566_0003306 3300053094 Bacteria 9643
566 Ga0500566_0021179 3300053094 Bacteria 3824
567 Ga0500640_000253 3300053095 Bacteria 11745
568 Ga0500641_0014230 3300053096 Bacteria 2934
569 Ga0500555_003315 3300053103 Bacteria 4589
570 Ga0500556_0034880 3300053104 Bacteria 1734
571 Ga0500557_000038 3300053105 Bacteria 69178
572 Ga0500572_000199 3300053111 Bacteria 21285
573 Ga0500595_000842 3300053119 Bacteria 17493
574 Ga0500595_003257 3300053119 Bacteria 7665
575 Ga0500595_025937 3300053119 Bacteria 2024
576 Ga0500607_017019 3300053121 Bacteria 4156
577 Ga0500608_047543 3300053122 Bacteria 2061
578 Ga0500614_004636 3300053123 Bacteria 2898
579 Ga0500642_0000381 3300053130 Bacteria 14828
580 Ga0500642_0013926 3300053130 Bacteria 2975
581 Ga0500658_0078263 3300053134 Bacteria 1409
582 Ga0500559_0004076 3300053136 Bacteria 7011
583 Ga0500559_0030442 3300053136 Bacteria 2313
584 Ga0500573_0103966 3300053140 Bacteria 1595
585 Ga0500603_000580 3300053150 Bacteria 9181
586 Ga0500603_000944 3300053150 Bacteria 6868
587 Ga0500630_000573 3300053159 Bacteria 16713
588 Ga0500638_001609 3300053162 Bacteria 7251
589 Ga0500638_002393 3300053162 Bacteria 6513
590 Ga0500639_000006 3300053163 Bacteria 165068
591 Ga0500636_0000762 3300053177 Bacteria 17368
592 Ga0500636_0042735 3300053177 Bacteria 2678
593 Ga0500637_0000251 3300053178 Bacteria 19903
594 Ga0500637_0052393 3300053178 Bacteria 2327
595 Ga0500625_008825 3300053729 Bacteria 4476
596 Ga0500596_001442 3300053735 Bacteria 4806
597 Ga0500599_000896 3300053736 Bacteria 3299
598 Ga0500601_000278 3300053737 Bacteria 9711
599 Ga0501084_0001174 3300054114 Bacteria 20442
600 Ga0500661_003392 3300055283 Bacteria 2986
601 Ga0501082_0001593 3300060353 Bacteria 20008
602 Ga0501082_0173716 3300060353 Bacteria 1874

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006942 Ga0099824_1008513 Ga0099824_100851311 363
2 3300048924 Ga0496121_0038386 Ga0496121_0038386_2783_4072 365
3 3300005327 Ga0070658_10070036 Ga0070658_100700362 367
4 3300005548 Ga0070665_100030314 Ga0070665_1000303145 367
5 3300025261 Ga0209233_1009766 Ga0209233_10097662 367
6 3300025297 Ga0209758_1000705 Ga0209758_100070533 367
7 3300053094 Ga0500566_0003306 Ga0500566_0003306_6052_7317 367
8 3300053130 Ga0500642_0000381 Ga0500642_0000381_8841_10091 367
9 3300053729 Ga0500625_008825 Ga0500625_008825_2055_3305 367
10 3300053737 Ga0500601_000278 Ga0500601_000278_5371_6621 367
11 3300025230 Ga0209563_101512 Ga0209563_1015122 368
12 3300025253 Ga0209677_107843 Ga0209677_1078432 368
13 3300005459 Ga0068867_100200088 Ga0068867_1002000881 369
14 3300005578 Ga0068854_100203564 Ga0068854_1002035641 369
15 3300005983 Ga0081540_1003809 Ga0081540_10038098 369
16 3300006038 Ga0075365_10046934 Ga0075365_100469342 369
17 3300006178 Ga0075367_10042754 Ga0075367_100427542 369
18 3300009093 Ga0105240_10074144 Ga0105240_100741443 369
19 3300010375 Ga0105239_10062992 Ga0105239_100629924 369
20 3300025913 Ga0207695_10000123 Ga0207695_1000012311 369
21 3300046674 Ga0495588_0032711 Ga0495588_0032711_591_1841 369
22 3300048907 Ga0496104_0006437 Ga0496104_0006437_2557_3807 369
23 3300048919 Ga0496116_0009198 Ga0496116_0009198_3054_4304 369
24 3300050491 nmdc:mga00v17_91210_c1 nmdc:mga00v17_91210_c1_124_1452 369
25 3300053087 Ga0500643_000013 Ga0500643_000013_188811_190073 369
26 3300053103 Ga0500555_003315 Ga0500555_003315_206_1459 369
27 3300053736 Ga0500599_000896 Ga0500599_000896_1728_2978 369
28 3300005367 Ga0070667_100044424 Ga0070667_1000444242 372
29 3300005842 Ga0068858_100100363 Ga0068858_1001003632 372
30 3300006038 Ga0075365_10042647 Ga0075365_100426472 372
31 3300006353 Ga0075370_10048373 Ga0075370_100483732 372
32 3300013296 Ga0157374_10045188 Ga0157374_100451882 372
33 3300025315 Ga0207697_10020133 Ga0207697_100201332 372
34 3300025904 Ga0207647_10012253 Ga0207647_100122532 372
35 3300025931 Ga0207644_10076454 Ga0207644_100764542 372
36 3300025941 Ga0207711_10052652 Ga0207711_100526523 372
37 3300026116 Ga0207674_10026551 Ga0207674_100265512 372
38 3300046542 Ga0495597_0027431 Ga0495597_0027431_805_2091 372
39 3300047443 Ga0495687_015363 Ga0495687_015363_204_1490 372
40 3300048905 Ga0496102_0127619 Ga0496102_0127619_74_1360 372
41 3300048907 Ga0496104_0011552 Ga0496104_0011552_3459_4745 372
42 3300048908 Ga0496105_0020055 Ga0496105_0020055_3333_4619 372
43 3300048911 Ga0496108_0026234 Ga0496108_0026234_114_1400 372
44 3300048912 Ga0496109_0063433 Ga0496109_0063433_473_1759 372
45 3300048914 Ga0496111_0046795 Ga0496111_0046795_825_2111 372
46 3300048915 Ga0496112_0173505 Ga0496112_0173505_295_1581 372
47 3300048921 Ga0496118_0058206 Ga0496118_0058206_1280_2566 372
48 3300050495 nmdc:mga04h51_20567_c1 nmdc:mga04h51_20567_c1_181_1467 372
49 3300050496 nmdc:mga07m45_9035_c1 nmdc:mga07m45_9035_c1_67_1353 372
50 3300027296 Ga0209389_1000248 Ga0209389_100024820 373
51 3300027357 Ga0209589_1001871 Ga0209589_100187120 373
52 3300027361 Ga0209489_102684 Ga0209489_10268414 373
53 3300053105 Ga0500557_000038 Ga0500557_000038_64922_66235 373
54 3300050492 nmdc:mga0yw44_11198_c1 nmdc:mga0yw44_11198_c1_2527_3813 375
55 3300005455 Ga0070663_100048939 Ga0070663_1000489392 376
56 3300033544 Ga0316215_1002488 Ga0316215_10024882 376
57 3300036401 Ga0373937_0004613 Ga0373937_0004613_1916_3169 376
58 3300036459 Ga0372808_002623 Ga0372808_002623_658_1911 376
59 3300047472 Ga0495686_0076338 Ga0495686_0076338_505_1755 376
60 3300053119 Ga0500595_003257 Ga0500595_003257_5370_6626 376
61 3300005843 Ga0068860_100002033 Ga0068860_1000020336 377
62 3300028381 Ga0268264_10000174 Ga0268264_1000017487 377
63 3300053104 Ga0500556_0034880 Ga0500556_0034880_363_1622 377
64 3300006028 Ga0070717_10205460 Ga0070717_102054601 378
65 3300049583 Ga0501067_0083105 Ga0501067_0083105_253_1566 379
66 iso_pu_bacteria 8006973647 8006974848 379
67 3300005436 Ga0070713_100003057 Ga0070713_1000030578 380
68 3300025928 Ga0207700_10011952 Ga0207700_100119524 380
69 3300005937 Ga0081455_10055334 Ga0081455_100553342 381
70 3300033180 Ga0307510_10165981 Ga0307510_101659811 381
71 3300046459 Ga0495629_0006402 Ga0495629_0006402_5884_7128 381
72 3300046462 Ga0495651_0142626 Ga0495651_0142626_404_1648 381
73 3300046559 Ga0495667_0109928 Ga0495667_0109928_31_1275 381
74 3300046642 Ga0495634_0112395 Ga0495634_0112395_273_1517 381
75 3300046663 Ga0495635_0011274 Ga0495635_0011274_968_2212 381
76 3300046690 Ga0495624_0100052 Ga0495624_0100052_225_1469 381
77 3300048907 Ga0496104_0023546 Ga0496104_0023546_415_1659 381
78 3300048908 Ga0496105_0014373 Ga0496105_0014373_3955_5199 381
79 3300048923 Ga0496120_0044095 Ga0496120_0044095_964_2208 381
80 3300048924 Ga0496121_0000406 Ga0496121_0000406_1036_2295 381
81 3300025297 Ga0209758_1008219 Ga0209758_10082192 382
82 3300031711 Ga0265314_10008977 Ga0265314_100089774 382
83 3300031712 Ga0265342_10049875 Ga0265342_100498752 382
84 3300044684 Ga0466966_0001614 Ga0466966_0001614_6175_7422 382
85 3300044693 Ga0466961_0000192 Ga0466961_0000192_6678_7925 382
86 3300045049 Ga0466959_0000934 Ga0466959_0000934_6749_7996 382
87 3300048918 Ga0496115_0238430 Ga0496115_0238430_187_1431 382
88 3300053090 Ga0500646_0022926 Ga0500646_0022926_116_1369 385
89 3300035724 Ga0373933_0000204 Ga0373933_0000204_8421_9677 386
90 3300036401 Ga0373937_0182159 Ga0373937_0182159_345_1598 386
91 3300046462 Ga0495651_0001839 Ga0495651_0001839_5328_6581 386
92 3300046477 Ga0495664_0022227 Ga0495664_0022227_1239_2492 386
93 3300046507 Ga0495606_0013192 Ga0495606_0013192_2831_4111 386
94 3300046516 Ga0495628_0062610 Ga0495628_0062610_503_1756 386
95 3300046529 Ga0495652_0033108 Ga0495652_0033108_1520_2773 386
96 3300046536 Ga0495587_0004468 Ga0495587_0004468_1826_3079 386
97 3300046559 Ga0495667_0004352 Ga0495667_0004352_6278_7531 386
98 3300046675 Ga0495657_0004591 Ga0495657_0004591_3324_4577 386
99 3300046678 Ga0495599_0005172 Ga0495599_0005172_2904_4157 386
100 3300046679 Ga0495623_0029120 Ga0495623_0029120_485_1738 386
101 3300046680 Ga0495646_0078288 Ga0495646_0078288_335_1588 386
102 3300047317 Ga0495604_0007215 Ga0495604_0007215_6230_7483 386
103 3300047319 Ga0495674_0011929 Ga0495674_0011929_5772_7025 386
104 3300047322 Ga0495680_0001654 Ga0495680_0001654_7246_8499 386
105 3300048088 Ga0495602_0009939 Ga0495602_0009939_1270_2523 386
106 3300050516 nmdc:mga0sz30_4359_c1 nmdc:mga0sz30_4359_c1_2297_3547 386
107 3300053121 Ga0500607_017019 Ga0500607_017019_243_1493 386
108 3300053136 Ga0500559_0030442 Ga0500559_0030442_227_1477 386
109 3300053177 Ga0500636_0000762 Ga0500636_0000762_4123_5376 386
110 3300003354 JGI25160J50197_1012133 JGI25160J50197_10121332 387
111 3300025295 Ga0209564_1009894 Ga0209564_10098944 387
112 3300025297 Ga0209758_1000986 Ga0209758_100098611 387
113 3300025302 Ga0207426_1000632 Ga0207426_100063213 387
114 3300025304 Ga0209257_1023187 Ga0209257_10231871 387
115 3300037068 Ga0373925_0124477 Ga0373925_0124477_14_1213 387
116 3300039437 Ga0436365_1439813 Ga0436365_1439813_21454_22671 387
117 3300039450 Ga0436363_0832891 Ga0436363_0832891_35_1285 387
118 3300047320 Ga0495672_0067517 Ga0495672_0067517_327_1553 387
119 3300048905 Ga0496102_0162647 Ga0496102_0162647_849_2078 387
120 3300048916 Ga0496113_0093176 Ga0496113_0093176_382_1611 387
121 3300048929 Ga0496126_0000849 Ga0496126_0000849_33973_35175 387
122 3300050490 nmdc:mga03n38_36837_c1 nmdc:mga03n38_36837_c1_276_1505 387
123 3300050494 nmdc:mga06z11_714_c1 nmdc:mga06z11_714_c1_4232_5461 387
124 3300053083 Ga0495655_0003480 Ga0495655_0003480_439_1725 387
125 iso_pu_bacteria 2935769743 2935776637 387
126 iso_pu_bacteria 2935777560 2935781530 387
127 iso_pu_bacteria 2935785616 2935789848 387
128 iso_pu_bacteria 2935793552 2935798386 387
129 iso_pu_bacteria 8016603502 8016607851 387
130 iso_pu_bacteria 8016613128 8016619634 387
131 iso_pu_bacteria 8019538911 8019541880 387
132 3300005614 Ga0068856_100004436 Ga0068856_10000443614 388
133 3300009094 Ga0111539_10035547 Ga0111539_100355472 388
134 3300009094 Ga0111539_10398983 Ga0111539_103989831 388
135 3300025914 Ga0207671_10014288 Ga0207671_100142885 388
136 3300026078 Ga0207702_10000758 Ga0207702_1000075814 388
137 3300035086 Ga0373934_0023120 Ga0373934_0023120_199_1455 388
138 3300035118 Ga0373954_0012233 Ga0373954_0012233_1572_2828 388
139 3300035119 Ga0373956_0014888 Ga0373956_0014888_1941_3197 388
140 3300035120 Ga0373957_0008299 Ga0373957_0008299_1858_3114 388
141 3300035172 Ga0373955_0019272 Ga0373955_0019272_908_2164 388
142 3300035410 Ga0373924_0027599 Ga0373924_0027599_282_1538 388
143 3300037466 Ga0395898_0008444 Ga0395898_0008444_4510_5751 388
144 3300039437 Ga0436365_0488786 Ga0436365_0488786_1543_2784 388
145 3300046454 Ga0495592_0020497 Ga0495592_0020497_1809_3065 388
146 3300046462 Ga0495651_0045340 Ga0495651_0045340_1908_3164 388
147 3300046463 Ga0495653_0067979 Ga0495653_0067979_1372_2628 388
148 3300046511 Ga0495608_0038423 Ga0495608_0038423_1324_2580 388
149 3300046516 Ga0495628_0009352 Ga0495628_0009352_3914_5170 388
150 3300046529 Ga0495652_0094059 Ga0495652_0094059_722_1978 388
151 3300046533 Ga0495640_0040562 Ga0495640_0040562_1949_3205 388
152 3300046535 Ga0495586_0048634 Ga0495586_0048634_146_1402 388
153 3300046543 Ga0495645_0027524 Ga0495645_0027524_1417_2673 388
154 3300046642 Ga0495634_0032036 Ga0495634_0032036_1104_2360 388
155 3300046675 Ga0495657_0061694 Ga0495657_0061694_954_2210 388
156 3300046678 Ga0495599_0107887 Ga0495599_0107887_282_1538 388
157 3300046679 Ga0495623_0012014 Ga0495623_0012014_4302_5558 388
158 3300046680 Ga0495646_0011553 Ga0495646_0011553_3499_4755 388
159 3300047317 Ga0495604_0012818 Ga0495604_0012818_23_1279 388
160 3300047322 Ga0495680_0056996 Ga0495680_0056996_1630_2886 388
161 3300047444 Ga0495675_0023366 Ga0495675_0023366_62_1318 388
162 3300047471 Ga0495684_0131744 Ga0495684_0131744_341_1597 388
163 3300048088 Ga0495602_0075159 Ga0495602_0075159_1250_2506 388
164 3300048909 Ga0496106_0006865 Ga0496106_0006865_405_1655 388
165 3300050511 nmdc:mga08y16_83157_c1 nmdc:mga08y16_83157_c1_1523_2728 388
166 3300050512 nmdc:mga0n895_345783_c1 nmdc:mga0n895_345783_c1_113_1318 388
167 3300053077 Ga0495601_0037471 Ga0495601_0037471_882_2138 388
168 3300003215 JGI25153J46596_10001826 JGI25153J46596_1000182610 389
169 3300005339 Ga0070660_100034673 Ga0070660_1000346732 389
170 3300005563 Ga0068855_100117585 Ga0068855_1001175852 389
171 3300005614 Ga0068856_100202460 Ga0068856_1002024602 389
172 3300025297 Ga0209758_1001737 Ga0209758_100173712 389
173 3300025919 Ga0207657_10055057 Ga0207657_100550573 389
174 3300025949 Ga0207667_10196100 Ga0207667_101961002 389
175 3300026142 Ga0207698_10230349 Ga0207698_102303492 389
176 3300037471 Ga0395905_0146839 Ga0395905_0146839_836_2095 389
177 3300037853 Ga0436364_0787494 Ga0436364_0787494_1326_2570 389
178 iso_pu_bacteria 2513237096 2513656139 389
179 iso_pu_bacteria 2513237137 2513859035 389
180 iso_pu_bacteria 2513237145 2513920852 389
181 iso_pu_bacteria 2517572143 2517895957 389
182 iso_pu_bacteria 2728368998 2728752348 389
183 iso_pu_bacteria 2791355197 2793069613 389
184 iso_pu_bacteria 2885374607 2885382984 389
185 iso_pu_bacteria 2904699407 2904707109 389
186 iso_pu_bacteria 2906635258 2906642021 389
187 iso_pu_bacteria 2906660503 2906665007 389
188 iso_pu_bacteria 2908739725 2908745606 389
189 iso_pu_bacteria 2922425934 2922432431 389
190 iso_pu_bacteria 2935630451 2935630754 389
191 iso_pu_bacteria 2941507105 2941507406 389
192 iso_pu_bacteria 2941515067 2941515833 389
193 iso_pu_bacteria 2941523033 2941523459 389
194 iso_pu_bacteria 8019555841 8019563779 389
195 iso_pu_bacteria 8019565922 8019573844 389
196 3300005329 Ga0070683_100014616 Ga0070683_1000146165 390
197 3300005336 Ga0070680_100015059 Ga0070680_1000150594 390
198 3300005337 Ga0070682_100097116 Ga0070682_1000971161 390
199 3300005458 Ga0070681_10031485 Ga0070681_100314852 390
200 3300005458 Ga0070681_10117395 Ga0070681_101173952 390
201 3300005530 Ga0070679_100009249 Ga0070679_1000092498 390
202 3300005535 Ga0070684_100008556 Ga0070684_1000085568 390
203 3300005577 Ga0068857_100155307 Ga0068857_1001553072 390
204 3300007788 Ga0099795_10016452 Ga0099795_100164522 390
205 3300009093 Ga0105240_10108155 Ga0105240_101081552 390
206 3300009174 Ga0105241_10134404 Ga0105241_101344042 390
207 3300025911 Ga0207654_10041635 Ga0207654_100416352 390
208 3300025912 Ga0207707_10001541 Ga0207707_1000154112 390
209 3300025912 Ga0207707_10089328 Ga0207707_100893282 390
210 3300025913 Ga0207695_10077656 Ga0207695_100776562 390
211 3300025917 Ga0207660_10033682 Ga0207660_100336822 390
212 3300025921 Ga0207652_10016519 Ga0207652_100165193 390
213 3300025921 Ga0207652_10024907 Ga0207652_100249073 390
214 3300025944 Ga0207661_10011823 Ga0207661_100118235 390
215 3300037418 Ga0395900_0076163 Ga0395900_0076163_286_1491 390
216 3300038443 Ga0395901_0066938 Ga0395901_0066938_1787_2992 390
217 iso_pu_bacteria 2507262055 2507511871 390
218 iso_pu_bacteria 2508501009 2508545535 390
219 iso_pu_bacteria 2508501042 2508694353 390
220 iso_pu_bacteria 2511231028 2511396664 390
221 iso_pu_bacteria 2513237095 2513651100 390
222 iso_pu_bacteria 2513237098 2513673492 390
223 iso_pu_bacteria 2513237101 2513696318 390
224 iso_pu_bacteria 2513237102 2513703536 390
225 iso_pu_bacteria 2513237104 2513717798 390
226 iso_pu_bacteria 2513237141 2513887720 390
227 iso_pu_bacteria 2517093001 2517108567 390
228 iso_pu_bacteria 2524023210 2524467513 390
229 iso_pu_bacteria 2528768022 2528854950 390
230 iso_pu_bacteria 2617270735 2617349624 390
231 iso_pu_bacteria 2617270741 2617376810 390
232 iso_pu_bacteria 2721755755 2723842815 390
233 iso_pu_bacteria 2791355199 2793080284 390
234 iso_pu_bacteria 2816332527 2818242184 390
235 iso_pu_bacteria 2824600985 2824608010 390
236 iso_pu_bacteria 2824609381 2824615050 390
237 iso_pu_bacteria 2824617872 2824624844 390
238 iso_pu_bacteria 2824626560 2824633750 390
239 iso_pu_bacteria 2824635225 2824642313 390
240 iso_pu_bacteria 2824644064 2824649641 390
241 iso_pu_bacteria 2824653114 2824659524 390
242 iso_pu_bacteria 2824661429 2824670052 390
243 iso_pu_bacteria 2824671348 2824676709 390
244 iso_pu_bacteria 2824679649 2824686164 390
245 iso_pu_bacteria 2824687955 2824692990 390
246 iso_pu_bacteria 2824696289 2824702585 390
247 iso_pu_bacteria 2824704595 2824711458 390
248 iso_pu_bacteria 2824714736 2824719743 390
249 iso_pu_bacteria 2824723954 2824730046 390
250 iso_pu_bacteria 2824732956 2824738287 390
251 iso_pu_bacteria 2824746037 2824751736 390
252 iso_pu_bacteria 2824753945 2824762968 390
253 iso_pu_bacteria 2824763712 2824772963 390
254 iso_pu_bacteria 2824773399 2824776996 390
255 iso_pu_bacteria 2838122688 2838128386 390
256 iso_pu_bacteria 2841941048 2841942246 390
257 iso_pu_bacteria 2841949485 2841955624 390
258 iso_pu_bacteria 2841957949 2841963521 390
259 iso_pu_bacteria 2841966195 2841971233 390
260 iso_pu_bacteria 2841974524 2841982353 390
261 iso_pu_bacteria 2841983080 2841984260 390
262 iso_pu_bacteria 2842038055 2842042008 390
263 iso_pu_bacteria 2842045827 2842050051 390
264 iso_pu_bacteria 2844315083 2844321088 390
265 iso_pu_bacteria 2847939898 2847943546 390
266 iso_pu_bacteria 2849076700 2849077268 390
267 iso_pu_bacteria 2874604998 2874606512 390
268 iso_pu_bacteria 2874620515 2874624004 390
269 iso_pu_bacteria 2874628541 2874630988 390
270 iso_pu_bacteria 2874645413 2874647367 390
271 iso_pu_bacteria 2876761206 2876767409 390
272 iso_pu_bacteria 2876771140 2876774778 390
273 iso_pu_bacteria 2876808645 2876809823 390
274 iso_pu_bacteria 2876818435 2876819731 390
275 iso_pu_bacteria 2879074833 2879079346 390
276 iso_pu_bacteria 2879099564 2879101404 390
277 iso_pu_bacteria 2879110137 2879113768 390
278 iso_pu_bacteria 2879127579 2879129080 390
279 iso_pu_bacteria 2879142872 2879144765 390
280 iso_pu_bacteria 2881364244 2881371135 390
281 iso_pu_bacteria 2881665667 2881673233 390
282 iso_pu_bacteria 2885366525 2885374065 390
283 iso_pu_bacteria 2885409591 2885412853 390
284 iso_pu_bacteria 2888378607 2888387381 390
285 iso_pu_bacteria 2888388044 2888391822 390
286 iso_pu_bacteria 2888419890 2888426602 390
287 iso_pu_bacteria 2889033259 2889033858 390
288 iso_pu_bacteria 2903727486 2903728511 390
289 iso_pu_bacteria 2904666416 2904670715 390
290 iso_pu_bacteria 2904711408 2904718957 390
291 iso_pu_bacteria 2906602504 2906607703 390
292 iso_pu_bacteria 2906626472 2906629322 390
293 iso_pu_bacteria 2908775508 2908782708 390
294 iso_pu_bacteria 2922361189 2922367281 390
295 iso_pu_bacteria 2922368715 2922370564 390
296 iso_pu_bacteria 2922386360 2922390015 390
297 iso_pu_bacteria 2922393267 2922396435 390
298 iso_pu_bacteria 2929615660 2929620140 390
299 iso_pu_bacteria 2929624759 2929629453 390
300 iso_pu_bacteria 2932784394 2932791495 390
301 iso_pu_bacteria 2932794094 2932796898 390
302 iso_pu_bacteria 2932801729 2932802324 390
303 iso_pu_bacteria 2932809354 2932816751 390
304 iso_pu_bacteria 2932818245 2932824067 390
305 iso_pu_bacteria 2932828146 2932835397 390
306 iso_pu_bacteria 2935616580 2935621140 390
307 iso_pu_bacteria 2935638405 2935643553 390
308 iso_pu_bacteria 2935648319 2935650482 390
309 iso_pu_bacteria 2935656913 2935662924 390
310 iso_pu_bacteria 2935665750 2935671137 390
311 iso_pu_bacteria 2935675223 2935681257 390
312 iso_pu_bacteria 2935684952 2935689400 390
313 iso_pu_bacteria 2935694250 2935699975 390
314 iso_pu_bacteria 2935703347 2935712094 390
315 iso_pu_bacteria 2935713505 2935720346 390
316 iso_pu_bacteria 2935722832 2935728037 390
317 iso_pu_bacteria 2935732158 2935737366 390
318 iso_pu_bacteria 2935741537 2935746573 390
319 iso_pu_bacteria 2935750917 2935757540 390
320 iso_pu_bacteria 2935760218 2935763917 390
321 iso_pu_bacteria 2935801545 2935807894 390
322 iso_pu_bacteria 2935810662 2935818772 390
323 iso_pu_bacteria 2935827899 2935833070 390
324 iso_pu_bacteria 2935837841 2935844274 390
325 iso_pu_bacteria 2935855204 2935859667 390
326 iso_pu_bacteria 2935864058 2935872065 390
327 iso_pu_bacteria 2935873716 2935879011 390
328 iso_pu_bacteria 2935883170 2935887236 390
329 iso_pu_bacteria 2935959822 2935965614 390
330 iso_pu_bacteria 2935975950 2935982045 390
331 iso_pu_bacteria 2935984226 2935990616 390
332 iso_pu_bacteria 2935992306 2936000358 390
333 iso_pu_bacteria 2936002035 2936008516 390
334 iso_pu_bacteria 2936011229 2936017162 390
335 iso_pu_bacteria 2936019824 2936026703 390
336 iso_pu_bacteria 2936028420 2936035446 390
337 iso_pu_bacteria 2936037263 2936045582 390
338 iso_pu_bacteria 2936046547 2936053595 390
339 iso_pu_bacteria 2936055302 2936062673 390
340 iso_pu_bacteria 2940556831 2940563638 390
341 iso_pu_bacteria 2941531003 2941537264 390
342 iso_pu_bacteria 2941538514 2941542606 390
343 iso_pu_bacteria 3005483717 3005490191 390
344 iso_pu_bacteria 3005506211 3005506911 390
345 iso_pu_bacteria 3005587118 3005591718 390
346 iso_pu_bacteria 3005594810 3005601427 390
347 iso_pu_bacteria 3005718088 3005724121 390
348 iso_pu_bacteria 8006964411 8006966131 390
349 iso_pu_bacteria 8006984368 8006989700 390
350 iso_pu_bacteria 8006994254 8006998093 390
351 iso_pu_bacteria 8016511872 8016519494 390
352 iso_pu_bacteria 8016522445 8016524861 390
353 iso_pu_bacteria 8016539877 8016542719 390
354 iso_pu_bacteria 8016548790 8016550562 390
355 iso_pu_bacteria 8016566248 8016568103 390
356 iso_pu_bacteria 8016575299 8016580779 390
357 iso_pu_bacteria 8016595262 8016596943 390
358 iso_pu_bacteria 8016622563 8016629974 390
359 iso_pu_bacteria 8016630954 8016637192 390
360 iso_pu_bacteria 8017057580 8017066028 390
361 iso_pu_bacteria 8019547302 8019548918 390
362 iso_pu_bacteria 8019576017 8019578604 390
363 iso_pu_bacteria 8019586578 8019596654 390
364 iso_pu_bacteria 8019597564 8019605049 390
365 iso_pu_bacteria 8019608314 8019613486 390
366 iso_pu_bacteria 8019619141 8019624156 390
367 iso_pu_bacteria 8019629233 8019637870 390
368 iso_pu_bacteria 8019638758 8019641753 390
369 iso_pu_bacteria 8019648815 8019653676 390
370 iso_pu_bacteria 8019659431 8019665800 390
371 iso_pu_bacteria 8019668869 8019675326 390
372 iso_pu_bacteria 8019678201 8019680779 390
373 iso_pu_bacteria 8056967851 8056975886 390
374 3300036401 Ga0373937_0019760 Ga0373937_0019760_1870_3114 391
375 3300046543 Ga0495645_0086668 Ga0495645_0086668_944_2194 391
376 3300049581 Ga0501047_0071264 Ga0501047_0071264_540_1790 391
377 3300049586 Ga0501070_0012988 Ga0501070_0012988_2624_3874 391
378 3300049589 Ga0501073_0065004 Ga0501073_0065004_1252_2502 391
379 3300049742 Ga0501080_0002767 Ga0501080_0002767_3959_5209 391
380 3300049823 Ga0501044_0246961 Ga0501044_0246961_50_1300 391
381 3300013104 Ga0157370_10144768 Ga0157370_101447682 392
382 3300013105 Ga0157369_10048074 Ga0157369_100480742 392
383 3300025898 Ga0207692_10009404 Ga0207692_100094044 392
384 3300025906 Ga0207699_10001069 Ga0207699_100010698 392
385 3300025915 Ga0207693_10008187 Ga0207693_100081877 392
386 3300025916 Ga0207663_10005579 Ga0207663_100055794 392
387 3300031235 Ga0265330_10035657 Ga0265330_100356572 392
388 3300031247 Ga0265340_10003101 Ga0265340_100031017 392
389 3300031712 Ga0265342_10094168 Ga0265342_100941681 392
390 3300035086 Ga0373934_0008383 Ga0373934_0008383_2529_3791 392
391 3300035111 Ga0373923_0001005 Ga0373923_0001005_775_2037 392
392 3300035117 Ga0373953_0000415 Ga0373953_0000415_2857_4119 392
393 3300035118 Ga0373954_0004190 Ga0373954_0004190_2322_3584 392
394 3300035119 Ga0373956_0001481 Ga0373956_0001481_1059_2321 392
395 3300035172 Ga0373955_0002049 Ga0373955_0002049_5747_7009 392
396 3300035724 Ga0373933_0004702 Ga0373933_0004702_1060_2322 392
397 3300036401 Ga0373937_0008188 Ga0373937_0008188_7602_8864 392
398 3300038443 Ga0395901_0015903 Ga0395901_0015903_877_2130 392
399 3300046454 Ga0495592_0008971 Ga0495592_0008971_1943_3205 392
400 3300046459 Ga0495629_0004778 Ga0495629_0004778_2722_3984 392
401 3300046462 Ga0495651_0016963 Ga0495651_0016963_1653_2915 392
402 3300046463 Ga0495653_0009797 Ga0495653_0009797_5766_7028 392
403 3300046511 Ga0495608_0004649 Ga0495608_0004649_5952_7214 392
404 3300046514 Ga0495618_0050333 Ga0495618_0050333_788_2050 392
405 3300046529 Ga0495652_0088520 Ga0495652_0088520_931_2193 392
406 3300046536 Ga0495587_0032943 Ga0495587_0032943_808_2070 392
407 3300046543 Ga0495645_0006792 Ga0495645_0006792_592_1854 392
408 3300046559 Ga0495667_0034624 Ga0495667_0034624_680_1942 392
409 3300046642 Ga0495634_0001493 Ga0495634_0001493_18519_19781 392
410 3300046663 Ga0495635_0004810 Ga0495635_0004810_2725_3987 392
411 3300046675 Ga0495657_0003079 Ga0495657_0003079_4680_5942 392
412 3300046678 Ga0495599_0001945 Ga0495599_0001945_6027_7289 392
413 3300046679 Ga0495623_0005899 Ga0495623_0005899_931_2193 392
414 3300046680 Ga0495646_0001642 Ga0495646_0001642_5269_6531 392
415 3300046809 Ga0495600_0003270 Ga0495600_0003270_931_2193 392
416 3300047317 Ga0495604_0007221 Ga0495604_0007221_680_1942 392
417 3300047319 Ga0495674_0119907 Ga0495674_0119907_734_1996 392
418 3300047322 Ga0495680_0025270 Ga0495680_0025270_931_2193 392
419 3300047444 Ga0495675_0041984 Ga0495675_0041984_1435_2697 392
420 3300047471 Ga0495684_0001399 Ga0495684_0001399_10397_11659 392
421 3300047673 Ga0495593_0004938 Ga0495593_0004938_6426_7688 392
422 3300048088 Ga0495602_0031141 Ga0495602_0031141_2726_3988 392
423 3300048928 Ga0496125_0000158 Ga0496125_0000158_111289_112569 392
424 3300049822 Ga0501035_0207447 Ga0501035_0207447_127_1374 392
425 3300053084 Ga0495595_0000637 Ga0495595_0000637_5915_7177 392
426 3300053085 Ga0495619_0001080 Ga0495619_0001080_808_2070 392
427 3300005329 Ga0070683_100030271 Ga0070683_1000302711 393
428 3300005355 Ga0070671_100068590 Ga0070671_1000685902 393
429 3300005577 Ga0068857_100034471 Ga0068857_1000344714 393
430 3300009545 Ga0105237_10286844 Ga0105237_102868442 393
431 3300049575 Ga0501039_0087726 Ga0501039_0087726_656_1903 393
432 3300053094 Ga0500566_0021179 Ga0500566_0021179_1305_2564 393
433 3300053119 Ga0500595_000842 Ga0500595_000842_15977_17236 393
434 3300053162 Ga0500638_001609 Ga0500638_001609_31_1290 393
435 3300053178 Ga0500637_0000251 Ga0500637_0000251_16001_17260 393
436 3300055283 Ga0500661_003392 Ga0500661_003392_472_1731 393
437 3300060353 Ga0501082_0173716 Ga0501082_0173716_193_1479 393
438 iso_pu_bacteria 2524023205 2524438313 393
439 iso_pu_bacteria 2744054633 2745078541 393
440 3300003203 JGI25406J46586_10011327 JGI25406J46586_100113273 394
441 3300005329 Ga0070683_100028855 Ga0070683_1000288552 394
442 3300005334 Ga0068869_100048784 Ga0068869_1000487842 394
443 3300005334 Ga0068869_100118836 Ga0068869_1001188362 394
444 3300005336 Ga0070680_100265806 Ga0070680_1002658061 394
445 3300005337 Ga0070682_100204237 Ga0070682_1002042371 394
446 3300005339 Ga0070660_100065521 Ga0070660_1000655212 394
447 3300005341 Ga0070691_10025478 Ga0070691_100254782 394
448 3300005347 Ga0070668_100031147 Ga0070668_1000311473 394
449 3300005347 Ga0070668_100118162 Ga0070668_1001181621 394
450 3300005353 Ga0070669_100033219 Ga0070669_1000332192 394
451 3300005355 Ga0070671_100075345 Ga0070671_1000753452 394
452 3300005356 Ga0070674_100008657 Ga0070674_1000086572 394
453 3300005356 Ga0070674_100065540 Ga0070674_1000655402 394
454 3300005366 Ga0070659_100026378 Ga0070659_1000263782 394
455 3300005366 Ga0070659_100127078 Ga0070659_1001270782 394
456 3300005367 Ga0070667_100171521 Ga0070667_1001715212 394
457 3300005434 Ga0070709_10002262 Ga0070709_100022628 394
458 3300005435 Ga0070714_100011322 Ga0070714_1000113224 394
459 3300005436 Ga0070713_100013210 Ga0070713_1000132104 394
460 3300005436 Ga0070713_100060660 Ga0070713_1000606602 394
461 3300005437 Ga0070710_10023090 Ga0070710_100230902 394
462 3300005439 Ga0070711_100030272 Ga0070711_1000302722 394
463 3300005444 Ga0070694_100098788 Ga0070694_1000987882 394
464 3300005455 Ga0070663_100163359 Ga0070663_1001633591 394
465 3300005456 Ga0070678_100137012 Ga0070678_1001370121 394
466 3300005456 Ga0070678_100169963 Ga0070678_1001699631 394
467 3300005457 Ga0070662_100064814 Ga0070662_1000648142 394
468 3300005457 Ga0070662_100073964 Ga0070662_1000739642 394
469 3300005458 Ga0070681_10067186 Ga0070681_100671862 394
470 3300005471 Ga0070698_100103345 Ga0070698_1001033452 394
471 3300005535 Ga0070684_100013708 Ga0070684_1000137084 394
472 3300005536 Ga0070697_100015893 Ga0070697_1000158934 394
473 3300005539 Ga0068853_100002207 Ga0068853_1000022073 394
474 3300005539 Ga0068853_100030556 Ga0068853_1000305565 394
475 3300005548 Ga0070665_100073740 Ga0070665_1000737403 394
476 3300005548 Ga0070665_100089381 Ga0070665_1000893812 394
477 3300005563 Ga0068855_100192942 Ga0068855_1001929422 394
478 3300005563 Ga0068855_100284371 Ga0068855_1002843712 394
479 3300005616 Ga0068852_100107521 Ga0068852_1001075212 394
480 3300005719 Ga0068861_100107403 Ga0068861_1001074032 394
481 3300005834 Ga0068851_10015046 Ga0068851_100150462 394
482 3300005937 Ga0081455_10004676 Ga0081455_100046765 394
483 3300005937 Ga0081455_10023105 Ga0081455_100231052 394
484 3300005937 Ga0081455_10042566 Ga0081455_100425662 394
485 3300005937 Ga0081455_10105146 Ga0081455_101051461 394
486 3300005983 Ga0081540_1005189 Ga0081540_10051897 394
487 3300005983 Ga0081540_1007118 Ga0081540_10071188 394
488 3300005983 Ga0081540_1008316 Ga0081540_10083168 394
489 3300005983 Ga0081540_1009524 Ga0081540_10095242 394
490 3300005983 Ga0081540_1033115 Ga0081540_10331152 394
491 3300005985 Ga0081539_10000958 Ga0081539_1000095852 394
492 3300005985 Ga0081539_10075359 Ga0081539_100753592 394
493 3300006038 Ga0075365_10007229 Ga0075365_100072297 394
494 3300006038 Ga0075365_10017120 Ga0075365_100171203 394
495 3300006038 Ga0075365_10070828 Ga0075365_100708281 394
496 3300006042 Ga0075368_10010213 Ga0075368_100102133 394
497 3300006048 Ga0075363_100024415 Ga0075363_1000244151 394
498 3300006048 Ga0075363_100029979 Ga0075363_1000299792 394
499 3300006048 Ga0075363_100039740 Ga0075363_1000397402 394
500 3300006163 Ga0070715_10003525 Ga0070715_100035255 394
501 3300006173 Ga0070716_100105346 Ga0070716_1001053462 394
502 3300006175 Ga0070712_100010132 Ga0070712_1000101323 394
503 3300006177 Ga0075362_10003381 Ga0075362_100033812 394
504 3300006178 Ga0075367_10008443 Ga0075367_100084435 394
505 3300006178 Ga0075367_10011965 Ga0075367_100119652 394
506 3300006178 Ga0075367_10016996 Ga0075367_100169962 394
507 3300006353 Ga0075370_10101950 Ga0075370_101019502 394
508 3300006844 Ga0075428_100107116 Ga0075428_1001071162 394
509 3300006871 Ga0075434_100090790 Ga0075434_1000907902 394
510 3300006881 Ga0068865_100024542 Ga0068865_1000245422 394
511 3300009093 Ga0105240_10088824 Ga0105240_100888243 394
512 3300009094 Ga0111539_10038005 Ga0111539_100380053 394
513 3300009098 Ga0105245_10016400 Ga0105245_100164003 394
514 3300009101 Ga0105247_10161614 Ga0105247_101616141 394
515 3300009545 Ga0105237_10012102 Ga0105237_100121028 394
516 3300009545 Ga0105237_10045894 Ga0105237_100458943 394
517 3300009545 Ga0105237_10184946 Ga0105237_101849462 394
518 3300009551 Ga0105238_10003421 Ga0105238_100034219 394
519 3300009553 Ga0105249_10259876 Ga0105249_102598761 394
520 3300010375 Ga0105239_10039377 Ga0105239_100393774 394
521 3300010375 Ga0105239_10141081 Ga0105239_101410812 394
522 3300011119 Ga0105246_10122556 Ga0105246_101225562 394
523 3300013104 Ga0157370_10124163 Ga0157370_101241632 394
524 3300013105 Ga0157369_10053962 Ga0157369_100539622 394
525 3300013105 Ga0157369_10145823 Ga0157369_101458232 394
526 3300013296 Ga0157374_10003262 Ga0157374_100032622 394
527 3300013297 Ga0157378_10004948 Ga0157378_100049489 394
528 3300013297 Ga0157378_10095220 Ga0157378_100952201 394
529 3300013306 Ga0163162_10140685 Ga0163162_101406852 394
530 3300014325 Ga0163163_10117367 Ga0163163_101173672 394
531 3300014325 Ga0163163_10153434 Ga0163163_101534342 394
532 3300014326 Ga0157380_10023470 Ga0157380_100234703 394
533 3300014326 Ga0157380_10093329 Ga0157380_100933292 394
534 3300014968 Ga0157379_10070458 Ga0157379_100704582 394
535 3300021320 Ga0214544_1000163 Ga0214544_100016374 394
536 3300021321 Ga0214542_1000156 Ga0214542_100015636 394
537 3300021324 Ga0214545_1000078 Ga0214545_100007874 394
538 3300021327 Ga0214543_1000136 Ga0214543_100013674 394
539 3300025297 Ga0209758_1000932 Ga0209758_100093234 394
540 3300025297 Ga0209758_1003580 Ga0209758_10035809 394
541 3300025321 Ga0207656_10011027 Ga0207656_100110272 394
542 3300025898 Ga0207692_10003950 Ga0207692_100039502 394
543 3300025909 Ga0207705_10055052 Ga0207705_100550522 394
544 3300025911 Ga0207654_10013829 Ga0207654_100138292 394
545 3300025912 Ga0207707_10022607 Ga0207707_100226072 394
546 3300025912 Ga0207707_10178212 Ga0207707_101782121 394
547 3300025913 Ga0207695_10065019 Ga0207695_100650192 394
548 3300025914 Ga0207671_10023986 Ga0207671_100239862 394
549 3300025915 Ga0207693_10000565 Ga0207693_100005658 394
550 3300025915 Ga0207693_10003555 Ga0207693_100035554 394
551 3300025915 Ga0207693_10020827 Ga0207693_100208272 394
552 3300025916 Ga0207663_10000239 Ga0207663_1000023910 394
553 3300025916 Ga0207663_10082976 Ga0207663_100829762 394
554 3300025917 Ga0207660_10010184 Ga0207660_100101842 394
555 3300025919 Ga0207657_10005246 Ga0207657_1000524612 394
556 3300025919 Ga0207657_10104597 Ga0207657_101045971 394
557 3300025920 Ga0207649_10028886 Ga0207649_100288862 394
558 3300025921 Ga0207652_10025737 Ga0207652_100257372 394
559 3300025927 Ga0207687_10002549 Ga0207687_100025494 394
560 3300025927 Ga0207687_10126782 Ga0207687_101267822 394
561 3300025928 Ga0207700_10005630 Ga0207700_100056304 394
562 3300025928 Ga0207700_10021183 Ga0207700_100211832 394
563 3300025929 Ga0207664_10008257 Ga0207664_100082576 394
564 3300025932 Ga0207690_10097110 Ga0207690_100971102 394
565 3300025933 Ga0207706_10028509 Ga0207706_100285093 394
566 3300025933 Ga0207706_10055808 Ga0207706_100558082 394
567 3300025936 Ga0207670_10072310 Ga0207670_100723102 394
568 3300025937 Ga0207669_10014357 Ga0207669_100143574 394
569 3300025939 Ga0207665_10000127 Ga0207665_1000012745 394
570 3300025939 Ga0207665_10147606 Ga0207665_101476062 394
571 3300025940 Ga0207691_10050355 Ga0207691_100503552 394
572 3300025942 Ga0207689_10014870 Ga0207689_100148707 394
573 3300025949 Ga0207667_10012980 Ga0207667_100129803 394
574 3300025949 Ga0207667_10128800 Ga0207667_101288002 394
575 3300025961 Ga0207712_10016234 Ga0207712_100162342 394
576 3300025961 Ga0207712_10060450 Ga0207712_100604502 394
577 3300025972 Ga0207668_10003544 Ga0207668_1000354411 394
578 3300025972 Ga0207668_10134984 Ga0207668_101349842 394
579 3300026023 Ga0207677_10140768 Ga0207677_101407682 394
580 3300026041 Ga0207639_10016989 Ga0207639_100169892 394
581 3300026067 Ga0207678_10036953 Ga0207678_100369532 394
582 3300026067 Ga0207678_10130789 Ga0207678_101307891 394
583 3300026075 Ga0207708_10044384 Ga0207708_100443842 394
584 3300026088 Ga0207641_10215815 Ga0207641_102158152 394
585 3300026089 Ga0207648_10046275 Ga0207648_100462753 394
586 3300026089 Ga0207648_10280973 Ga0207648_102809731 394
587 3300026095 Ga0207676_10027584 Ga0207676_100275842 394
588 3300026116 Ga0207674_10025987 Ga0207674_100259874 394
589 3300026118 Ga0207675_100077746 Ga0207675_1000777462 394
590 3300026118 Ga0207675_100125875 Ga0207675_1001258752 394
591 3300026142 Ga0207698_10046695 Ga0207698_100466952 394
592 3300027907 Ga0207428_10132076 Ga0207428_101320762 394
593 3300028379 Ga0268266_10022369 Ga0268266_100223692 394
594 3300028379 Ga0268266_10023902 Ga0268266_100239024 394
595 3300028379 Ga0268266_10048656 Ga0268266_100486562 394
596 3300028379 Ga0268266_10158379 Ga0268266_101583791 394
597 3300028380 Ga0268265_10023047 Ga0268265_100230474 394
598 3300028380 Ga0268265_10023969 Ga0268265_100239692 394
599 3300028800 Ga0265338_10188674 Ga0265338_101886741 394
600 3300031238 Ga0265332_10012460 Ga0265332_100124602 394
601 3300031249 Ga0265339_10006267 Ga0265339_100062677 394
602 3300031344 Ga0265316_10070564 Ga0265316_100705642 394
603 3300031507 Ga0307509_10033214 Ga0307509_100332142 394
604 3300031616 Ga0307508_10000063 Ga0307508_1000006345 394
605 3300031616 Ga0307508_10027504 Ga0307508_100275045 394
606 3300031730 Ga0307516_10018150 Ga0307516_100181508 394
607 3300031730 Ga0307516_10059002 Ga0307516_100590024 394
608 3300031730 Ga0307516_10137777 Ga0307516_101377772 394
609 3300033180 Ga0307510_10010372 Ga0307510_1001037210 394
610 3300033180 Ga0307510_10041830 Ga0307510_100418304 394
611 3300035113 Ga0373936_0031660 Ga0373936_0031660_267_1526 394
612 3300035113 Ga0373936_0035701 Ga0373936_0035701_447_1700 394
613 3300035172 Ga0373955_0035628 Ga0373955_0035628_828_2087 394
614 3300035691 Ga0373931_0014884 Ga0373931_0014884_669_1928 394
615 3300035692 Ga0373935_0054232 Ga0373935_0054232_935_2194 394
616 3300035695 Ga0373927_0023634 Ga0373927_0023634_356_1615 394
617 3300035725 Ga0373947_0000455 Ga0373947_0000455_11545_12798 394
618 3300035725 Ga0373947_0013349 Ga0373947_0013349_2293_3552 394
619 3300036401 Ga0373937_0009140 Ga0373937_0009140_3617_4876 394
620 3300037068 Ga0373925_0006046 Ga0373925_0006046_7603_8862 394
621 3300039453 Ga0436362_1202653 Ga0436362_1202653_1072_2322 394
622 3300046455 Ga0495603_0000239 Ga0495603_0000239_18390_19649 394
623 3300046455 Ga0495603_0004059 Ga0495603_0004059_4648_5907 394
624 3300046455 Ga0495603_0042269 Ga0495603_0042269_327_1586 394
625 3300046459 Ga0495629_0000457 Ga0495629_0000457_7453_8712 394
626 3300046460 Ga0495638_0015338 Ga0495638_0015338_2228_3487 394
627 3300046461 Ga0495641_0002157 Ga0495641_0002157_13582_14841 394
628 3300046463 Ga0495653_0107165 Ga0495653_0107165_512_1771 394
629 3300046471 Ga0495650_0037007 Ga0495650_0037007_693_1952 394
630 3300046472 Ga0495580_0004703 Ga0495580_0004703_3140_4399 394
631 3300046472 Ga0495580_0062964 Ga0495580_0062964_74_1333 394
632 3300046473 Ga0495582_0000077 Ga0495582_0000077_37318_38577 394
633 3300046475 Ga0495639_0000101 Ga0495639_0000101_20231_21490 394
634 3300046475 Ga0495639_0044668 Ga0495639_0044668_522_1781 394
635 3300046476 Ga0495662_0010930 Ga0495662_0010930_645_1904 394
636 3300046499 Ga0495594_0000083 Ga0495594_0000083_4980_6239 394
637 3300046500 Ga0495596_0050823 Ga0495596_0050823_129_1388 394
638 3300046529 Ga0495652_0095391 Ga0495652_0095391_478_1737 394
639 3300046531 Ga0495665_0000055 Ga0495665_0000055_23450_24709 394
640 3300046533 Ga0495640_0004679 Ga0495640_0004679_2627_3886 394
641 3300046543 Ga0495645_0154405 Ga0495645_0154405_315_1574 394
642 3300046642 Ga0495634_0000720 Ga0495634_0000720_2837_4096 394
643 3300046660 Ga0495625_0085379 Ga0495625_0085379_679_1938 394
644 3300046663 Ga0495635_0012169 Ga0495635_0012169_1860_3119 394
645 3300046680 Ga0495646_0037952 Ga0495646_0037952_884_2143 394
646 3300046683 Ga0495658_0001572 Ga0495658_0001572_5584_6843 394
647 3300046684 Ga0495669_0002048 Ga0495669_0002048_1710_2972 394
648 3300046689 Ga0495613_0021735 Ga0495613_0021735_1667_2926 394
649 3300046690 Ga0495624_0000235 Ga0495624_0000235_7988_9247 394
650 3300046690 Ga0495624_0117211 Ga0495624_0117211_324_1583 394
651 3300047315 Ga0495581_0000041 Ga0495581_0000041_24265_25524 394
652 3300047315 Ga0495581_0068564 Ga0495581_0068564_176_1435 394
653 3300047315 Ga0495581_0083442 Ga0495581_0083442_364_1623 394
654 3300047319 Ga0495674_0010515 Ga0495674_0010515_3469_4728 394
655 3300047320 Ga0495672_0011925 Ga0495672_0011925_2673_3923 394
656 3300047321 Ga0495676_0042790 Ga0495676_0042790_929_2188 394
657 3300047673 Ga0495593_0000024 Ga0495593_0000024_18253_19512 394
658 3300048904 Ga0496101_0019807 Ga0496101_0019807_990_2249 394
659 3300048904 Ga0496101_0053295 Ga0496101_0053295_722_1984 394
660 3300048905 Ga0496102_0022602 Ga0496102_0022602_1473_2732 394
661 3300048905 Ga0496102_0026012 Ga0496102_0026012_419_1678 394
662 3300048906 Ga0496103_0037403 Ga0496103_0037403_1265_2524 394
663 3300048907 Ga0496104_0036831 Ga0496104_0036831_2475_3734 394
664 3300048907 Ga0496104_0182244 Ga0496104_0182244_85_1344 394
665 3300048908 Ga0496105_0004780 Ga0496105_0004780_3442_4701 394
666 3300048909 Ga0496106_0032587 Ga0496106_0032587_744_2003 394
667 3300048909 Ga0496106_0069534 Ga0496106_0069534_72_1331 394
668 3300048910 Ga0496107_0006673 Ga0496107_0006673_567_1826 394
669 3300048911 Ga0496108_0096093 Ga0496108_0096093_249_1508 394
670 3300048911 Ga0496108_0104576 Ga0496108_0104576_289_1545 394
671 3300048913 Ga0496110_0014165 Ga0496110_0014165_3246_4505 394
672 3300048913 Ga0496110_0044935 Ga0496110_0044935_2199_3458 394
673 3300048913 Ga0496110_0079832 Ga0496110_0079832_1453_2709 394
674 3300048914 Ga0496111_0011527 Ga0496111_0011527_2756_4015 394
675 3300048914 Ga0496111_0039640 Ga0496111_0039640_1535_2791 394
676 3300048915 Ga0496112_0035596 Ga0496112_0035596_1253_2512 394
677 3300048915 Ga0496112_0100431 Ga0496112_0100431_872_2134 394
678 3300048916 Ga0496113_0032329 Ga0496113_0032329_1633_2889 394
679 3300048917 Ga0496114_0265033 Ga0496114_0265033_175_1434 394
680 3300048918 Ga0496115_0001250 Ga0496115_0001250_13102_14361 394
681 3300048918 Ga0496115_0058775 Ga0496115_0058775_587_1846 394
682 3300048921 Ga0496118_0014888 Ga0496118_0014888_3130_4383 394
683 3300048924 Ga0496121_0124517 Ga0496121_0124517_512_1765 394
684 3300048929 Ga0496126_0009829 Ga0496126_0009829_4823_6082 394
685 3300048929 Ga0496126_0060149 Ga0496126_0060149_894_2144 394
686 3300048929 Ga0496126_0062869 Ga0496126_0062869_268_1527 394
687 3300048929 Ga0496126_0116044 Ga0496126_0116044_289_1548 394
688 3300049579 Ga0501043_0148437 Ga0501043_0148437_331_1572 394
689 3300049581 Ga0501047_0104480 Ga0501047_0104480_461_1702 394
690 3300050489 nmdc:mga03683_20124_c1 nmdc:mga03683_20124_c1_1230_2489 394
691 3300050489 nmdc:mga03683_4811_c1 nmdc:mga03683_4811_c1_1093_2355 394
692 3300050492 nmdc:mga0yw44_10099_c1 nmdc:mga0yw44_10099_c1_718_1980 394
693 3300050492 nmdc:mga0yw44_48604_c1 nmdc:mga0yw44_48604_c1_295_1554 394
694 3300050492 nmdc:mga0yw44_8041_c1 nmdc:mga0yw44_8041_c1_3904_5163 394
695 3300050493 nmdc:mga0k408_50283_c1 nmdc:mga0k408_50283_c1_1078_2337 394
696 3300050494 nmdc:mga06z11_67292_c1 nmdc:mga06z11_67292_c1_217_1479 394
697 3300050496 nmdc:mga07m45_13095_c1 nmdc:mga07m45_13095_c1_26_1285 394
698 3300050496 nmdc:mga07m45_18945_c1 nmdc:mga07m45_18945_c1_1656_2915 394
699 3300050496 nmdc:mga07m45_25456_c1 nmdc:mga07m45_25456_c1_112_1374 394
700 3300050507 nmdc:mga05p37_41080_c1 nmdc:mga05p37_41080_c1_3090_4346 394
701 3300053077 Ga0495601_0107617 Ga0495601_0107617_339_1598 394
702 3300053080 Ga0500635_0002813 Ga0500635_0002813_828_2087 394
703 3300053094 Ga0500566_0001419 Ga0500566_0001419_5747_7000 394
704 3300053095 Ga0500640_000253 Ga0500640_000253_5732_6985 394
705 3300053096 Ga0500641_0014230 Ga0500641_0014230_624_1901 394
706 3300053111 Ga0500572_000199 Ga0500572_000199_852_2105 394
707 3300053119 Ga0500595_025937 Ga0500595_025937_751_2013 394
708 3300053122 Ga0500608_047543 Ga0500608_047543_39_1292 394
709 3300053123 Ga0500614_004636 Ga0500614_004636_115_1368 394
710 3300053130 Ga0500642_0013926 Ga0500642_0013926_1519_2775 394
711 3300053134 Ga0500658_0078263 Ga0500658_0078263_91_1350 394
712 3300053136 Ga0500559_0004076 Ga0500559_0004076_2864_4117 394
713 3300053140 Ga0500573_0103966 Ga0500573_0103966_157_1410 394
714 3300053150 Ga0500603_000580 Ga0500603_000580_5266_6519 394
715 3300053150 Ga0500603_000944 Ga0500603_000944_5347_6606 394
716 3300053159 Ga0500630_000573 Ga0500630_000573_10472_11725 394
717 3300053162 Ga0500638_002393 Ga0500638_002393_4208_5461 394
718 3300053163 Ga0500639_000006 Ga0500639_000006_156991_158244 394
719 3300053177 Ga0500636_0042735 Ga0500636_0042735_1207_2466 394
720 3300053178 Ga0500637_0052393 Ga0500637_0052393_577_1836 394
721 3300053735 Ga0500596_001442 Ga0500596_001442_1006_2259 394
722 3300005617 Ga0068859_100062487 Ga0068859_1000624873 396
723 3300006931 Ga0097620_100062488 Ga0097620_1000624883 396
724 3300025961 Ga0207712_10176810 Ga0207712_101768102 396
725 3300048929 Ga0496126_0034696 Ga0496126_0034696_2543_3796 396
726 iso_pu_bacteria 2524023228 2524534834 396
727 iso_pu_bacteria 8006933436 8006934880 396
728 3300010375 Ga0105239_10354715 Ga0105239_103547152 397
729 iso_pu_bacteria 2513237139 2513875293 397
730 iso_pu_bacteria 2802429603 2805921867 397
731 iso_pu_bacteria 2933577622 2933582057 397
732 iso_pu_bacteria 2935608549 2935613486 397
733 iso_pu_bacteria 2935819856 2935824661 397
734 iso_pu_bacteria 2935847175 2935851881 397
735 iso_pu_bacteria 2935908558 2935911231 397
736 iso_pu_bacteria 2935916978 2935920763 397
737 iso_pu_bacteria 2935926038 2935928260 397
738 iso_pu_bacteria 2935934488 2935937905 397
739 iso_pu_bacteria 2935942939 2935945187 397
740 iso_pu_bacteria 2935951376 2935954307 397
741 iso_pu_bacteria 2935967501 2935971425 397
742 iso_pu_bacteria 8016583857 8016588690 397
743 iso_pu_bacteria 8019687851 8019694989 397
744 iso_pu_bacteria 8055742211 8055750107 397
745 iso_pu_bacteria 8056673599 8056675117 397
746 3300046477 Ga0495664_0007665 Ga0495664_0007665_503_1855 398
747 3300046678 Ga0495599_0067586 Ga0495599_0067586_548_1900 398
748 iso_pu_bacteria 8006926726 8006929463 398
749 3300005618 Ga0068864_100051077 Ga0068864_1000510773 399
750 3300009093 Ga0105240_10028981 Ga0105240_100289817 399
751 3300009545 Ga0105237_10135130 Ga0105237_101351302 399
752 3300013105 Ga0157369_10008923 Ga0157369_100089238 399
753 3300013307 Ga0157372_10265646 Ga0157372_102656461 399
754 3300025944 Ga0207661_10010620 Ga0207661_100106202 399
755 3300033180 Ga0307510_10024996 Ga0307510_100249968 399
756 3300035118 Ga0373954_0071911 Ga0373954_0071911_181_1467 399
757 3300035170 Ga0373943_0004735 Ga0373943_0004735_4238_5524 399
758 3300035692 Ga0373935_0036629 Ga0373935_0036629_1394_2680 399
759 3300037418 Ga0395900_0012087 Ga0395900_0012087_4928_6223 399
760 3300037466 Ga0395898_0011301 Ga0395898_0011301_1337_2632 399
761 3300046472 Ga0495580_0009906 Ga0495580_0009906_2799_4085 399
762 3300046516 Ga0495628_0074155 Ga0495628_0074155_1284_2570 399
763 3300046526 Ga0495666_0056332 Ga0495666_0056332_551_1837 399
764 3300046529 Ga0495652_0027178 Ga0495652_0027178_1466_2752 399
765 3300046533 Ga0495640_0018966 Ga0495640_0018966_2986_4272 399
766 3300046642 Ga0495634_0027825 Ga0495634_0027825_1392_2678 399
767 3300046663 Ga0495635_0023852 Ga0495635_0023852_2949_4235 399
768 3300046678 Ga0495599_0072228 Ga0495599_0072228_276_1562 399
769 3300046681 Ga0495647_0010240 Ga0495647_0010240_761_2047 399
770 3300053080 Ga0500635_0036346 Ga0500635_0036346_296_1579 399
771 3300009545 Ga0105237_10022395 Ga0105237_100223952 400
772 3300009545 Ga0105237_10027380 Ga0105237_100273803 400
773 3300013307 Ga0157372_10037760 Ga0157372_100377605 400
774 3300049568 Ga0501031_0000398 Ga0501031_0000398_261_1541 400
775 3300049569 Ga0501032_0000916 Ga0501032_0000916_1889_3169 400
776 3300049570 Ga0501033_0001463 Ga0501033_0001463_5828_7108 400
777 3300049571 Ga0501034_0000072 Ga0501034_0000072_59959_61239 400
778 3300049572 Ga0501036_0000250 Ga0501036_0000250_1217_2497 400
779 3300049573 Ga0501037_0000030 Ga0501037_0000030_65442_66722 400
780 3300049574 Ga0501038_0000039 Ga0501038_0000039_116990_118270 400
781 3300049575 Ga0501039_0000060 Ga0501039_0000060_8435_9715 400
782 3300049579 Ga0501043_0003512 Ga0501043_0003512_5786_7066 400
783 3300049580 Ga0501046_0000419 Ga0501046_0000419_3093_4373 400
784 3300049581 Ga0501047_0000174 Ga0501047_0000174_52654_53934 400
785 3300049582 Ga0501048_0000068 Ga0501048_0000068_7078_8358 400
786 3300049583 Ga0501067_0000068 Ga0501067_0000068_42356_43636 400
787 3300049584 Ga0501068_0000949 Ga0501068_0000949_5460_6740 400
788 3300049586 Ga0501070_0007372 Ga0501070_0007372_5155_6435 400
789 3300049588 Ga0501072_0003432 Ga0501072_0003432_4967_6247 400
790 3300049589 Ga0501073_0000009 Ga0501073_0000009_75784_77064 400
791 3300049590 Ga0501074_0001057 Ga0501074_0001057_10751_12031 400
792 3300049744 Ga0501083_0006137 Ga0501083_0006137_3525_4805 400
793 3300049822 Ga0501035_0000067 Ga0501035_0000067_52084_53364 400
794 3300054114 Ga0501084_0001174 Ga0501084_0001174_3369_4649 400
795 3300060353 Ga0501082_0001593 Ga0501082_0001593_4307_5587 400
796 iso_pu_bacteria 2667528175 2671122751 400
797 3300028786 Ga0307517_10021811 Ga0307517_100218116 401
798 3300028794 Ga0307515_10221687 Ga0307515_102216871 401
799 3300035116 Ga0373945_0017685 Ga0373945_0017685_96_1391 401
800 3300035170 Ga0373943_0005037 Ga0373943_0005037_4166_5461 401
801 3300039437 Ga0436365_1552881 Ga0436365_1552881_777_2057 401
802 3300048918 Ga0496115_0177837 Ga0496115_0177837_275_1609 401
803 iso_pu_bacteria 2508501128 2509146628 401
804 3300009093 Ga0105240_10076492 Ga0105240_100764924 402
805 3300003203 JGI25406J46586_10000064 JGI25406J46586_1000006433 404
806 3300005985 Ga0081539_10000099 Ga0081539_10000099103 404
807 3300009551 Ga0105238_10171357 Ga0105238_101713572 404
808 3300046507 Ga0495606_0000357 Ga0495606_0000357_13539_14828 404
809 3300048915 Ga0496112_0000052 Ga0496112_0000052_40241_41530 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

250

413

0.88

PF07690

MFS_1

Major Facilitator Superfamily

35

371

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8509 20 395
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8457 21 396
6kkj-assembly1.cif.gz_B crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation 0.8327 21 396
6kki-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation 0.8315 20 396
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.8305 20 396
ID Description Score Start End Superfamily
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9734 220 403 1.20.1250.20
af_P52067_222_406_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9631 220 403 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9469 20 201 1.20.1250.20
af_O94607_344_515_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9069 225 372 1.20.1250.20
af_P52067_17_206_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9041 20 201 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3A9JEU6-F1-model_v4 MFS transporter 0.9701 21 397 GO:0005886
GO:0022857
AF-A0A1H5UN65-F1-model_v4 MFS transporter, FSR family, fosmidomycin resistance protein 0.967 21 401 GO:0005886
GO:0022857
AF-A0A7X1WME5-F1-model_v4 MFS transporter 0.9655 139 402 GO:0005886
GO:0022857
AF-A0A0M8MHA8-F1-model_v4 Fosmidomycin resistance protein 0.9653 21 404 GO:0005886
GO:0022857
AF-A0A7X1WME5-F1-model_v4 MFS transporter 0.9619 139 402 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map