F481791
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 809 | 539 | 602 | 413 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016595262|8016596943 |
| Length | 413 |
| Sequence | VIVSEETLTEPVVISDVTPAAKSAAGPAYVVLAGISFSHFLNDTMQSLIASVYPILKDTYALDFAQIGMITLAFQFTASLLQPVVGHYTDKKAQPYSLSIGMASTFFGLLLLSAAHQYLVILVAAALVGLGSAVFHPESARIARLASGGRYGFAQSVFQLGGSFGTSMGPVLAALIVVPFGQGSIAWFSSIAFLAILILWRIGRWYEPQIKAKKKTVAIETHPDAPSSRRVTVALLVLVALLFSKQLYVSSLSSYYIFYLIDRFGVSTQAAQMYLFVFLAANAVGAFLGGPLGDRYGRKIVIWISILGALPFTLALPYAGLYASAVLSVIIGLIISSTTSSIIVFAQELVPHRFGMISGVFFGVAFGIGGLGAAVLGKLADHTSIEFVYQVCAYLPAIGLLAVFLPKLPRHVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 20 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 24 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 25 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 26 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 27 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 31 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 32 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 33 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 34 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 35 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 36 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 37 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 38 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 39 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 40 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 41 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 42 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 43 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 44 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 45 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 46 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 47 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 48 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 49 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 50 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 51 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 52 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 53 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 54 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 55 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 56 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 57 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 58 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 59 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 60 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 61 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 62 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 63 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 64 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 65 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 66 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 67 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 68 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 69 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 70 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 71 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 72 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 73 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 74 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 75 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 76 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 77 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 78 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 79 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 80 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 81 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 82 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 83 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 84 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 85 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 86 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 87 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 88 | 2904699407 | |||
| 89 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 90 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 91 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 92 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 93 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 94 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 95 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 96 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 97 | 2922368715 | |||
| 98 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 99 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 100 | 2922425934 | |||
| 101 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 102 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 103 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 104 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 105 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 106 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 107 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 108 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 109 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 110 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 111 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 112 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 113 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 114 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 115 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 116 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 117 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 118 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 119 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 120 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 121 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 122 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 123 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 124 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 125 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 126 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 127 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 128 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 129 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 130 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 131 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 132 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 133 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 134 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 135 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 136 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 137 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 138 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 139 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 140 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 141 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 142 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 143 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 144 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 145 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 146 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 147 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 148 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 149 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 150 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 151 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 152 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 153 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 154 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 155 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 156 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 157 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 158 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 159 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 160 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 161 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 162 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 163 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 164 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 165 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 166 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 167 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 168 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 169 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 170 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 171 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 172 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 173 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 176 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 177 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 180 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 187 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 188 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 190 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 192 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 196 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 197 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 198 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 199 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 200 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 201 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 202 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 203 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 204 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 205 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 206 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 207 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 208 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 209 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 210 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 211 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 212 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 213 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 214 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 215 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 216 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 217 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 219 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 220 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 221 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 222 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 223 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 224 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 225 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 226 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 227 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 228 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 229 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 230 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 232 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 233 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 234 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 236 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 237 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 238 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 239 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 240 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 241 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 242 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 243 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 244 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 245 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 246 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 247 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 248 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 249 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 250 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 251 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 252 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 253 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 254 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 255 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 256 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 259 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 260 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 307 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 308 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 309 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 310 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 314 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 315 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 316 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 317 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 318 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 319 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 320 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 321 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 322 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 323 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 324 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 325 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 326 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 327 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 328 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 329 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 330 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 331 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 332 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 333 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 334 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 335 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 336 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 337 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 338 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 339 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 340 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 341 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 342 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 343 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 344 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 345 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 346 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 347 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 348 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 349 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 350 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 351 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 352 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 353 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 354 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 355 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 356 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 357 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 358 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 414 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 415 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 416 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 417 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 418 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 419 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 420 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 422 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 423 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 424 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 425 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 426 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 429 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 430 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 431 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 432 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 433 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 437 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 439 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 440 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 444 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 449 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 450 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 456 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 457 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 460 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 461 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 462 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 463 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 469 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 473 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 474 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 475 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 477 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 478 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 479 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 480 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 481 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 482 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 483 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 484 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 485 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 487 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 488 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 489 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 490 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 491 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 492 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 493 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 495 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 496 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 497 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 498 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 499 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 500 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 501 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 502 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 503 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 504 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 505 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 506 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 507 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 508 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 509 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 510 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 511 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 512 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 513 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 514 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 515 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 516 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 517 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 518 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 519 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 520 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 521 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 522 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 523 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 524 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 525 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 526 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 527 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 528 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 529 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 530 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 531 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 532 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 533 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 534 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 535 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 536 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 537 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 538 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 539 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.66 |
| Metatranscriptomes | 0.12 |
| Isolates | 25.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.75 |
| Nodule | 19.78 |
| Rhizoplane | 5.07 |
| Rhizosphere | 53.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000064 | 3300003203 | Bacteria | 49110 |
| 2 | JGI25406J46586_10011327 | 3300003203 | Bacteria | 3917 |
| 3 | JGI25153J46596_10001826 | 3300003215 | Bacteria | 12622 |
| 4 | JGI25160J50197_1012133 | 3300003354 | Bacteria | 3012 |
| 5 | Ga0070658_10070036 | 3300005327 | Bacteria | 2870 |
| 6 | Ga0070683_100014616 | 3300005329 | Bacteria | 6874 |
| 7 | Ga0070683_100028855 | 3300005329 | Bacteria | 5018 |
| 8 | Ga0070683_100030271 | 3300005329 | Bacteria | 4911 |
| 9 | Ga0068869_100048784 | 3300005334 | Bacteria | 3063 |
| 10 | Ga0068869_100118836 | 3300005334 | Bacteria | 2019 |
| 11 | Ga0070680_100015059 | 3300005336 | Bacteria | 6054 |
| 12 | Ga0070680_100265806 | 3300005336 | Bacteria | 1452 |
| 13 | Ga0070682_100097116 | 3300005337 | Bacteria | 1938 |
| 14 | Ga0070682_100204237 | 3300005337 | Bacteria | 1396 |
| 15 | Ga0070660_100034673 | 3300005339 | Bacteria | 3814 |
| 16 | Ga0070660_100065521 | 3300005339 | Bacteria | 2827 |
| 17 | Ga0070691_10025478 | 3300005341 | Bacteria | 2754 |
| 18 | Ga0070668_100031147 | 3300005347 | Bacteria | 4058 |
| 19 | Ga0070668_100118162 | 3300005347 | Bacteria | 2116 |
| 20 | Ga0070669_100033219 | 3300005353 | Bacteria | 3730 |
| 21 | Ga0070671_100068590 | 3300005355 | Bacteria | 2958 |
| 22 | Ga0070671_100075345 | 3300005355 | Bacteria | 2819 |
| 23 | Ga0070674_100008657 | 3300005356 | Bacteria | 6066 |
| 24 | Ga0070674_100065540 | 3300005356 | Bacteria | 2549 |
| 25 | Ga0070659_100026378 | 3300005366 | Bacteria | 4471 |
| 26 | Ga0070659_100127078 | 3300005366 | Bacteria | 2069 |
| 27 | Ga0070667_100044424 | 3300005367 | Bacteria | 3731 |
| 28 | Ga0070667_100171521 | 3300005367 | Bacteria | 1915 |
| 29 | Ga0070709_10002262 | 3300005434 | Bacteria | 10432 |
| 30 | Ga0070714_100011322 | 3300005435 | Bacteria | 7074 |
| 31 | Ga0070713_100003057 | 3300005436 | Bacteria | 10992 |
| 32 | Ga0070713_100013210 | 3300005436 | Bacteria | 6089 |
| 33 | Ga0070713_100060660 | 3300005436 | Bacteria | 3162 |
| 34 | Ga0070710_10023090 | 3300005437 | Bacteria | 3263 |
| 35 | Ga0070711_100030272 | 3300005439 | Bacteria | 3582 |
| 36 | Ga0070694_100098788 | 3300005444 | Bacteria | 2062 |
| 37 | Ga0070663_100048939 | 3300005455 | Bacteria | 2999 |
| 38 | Ga0070663_100163359 | 3300005455 | Bacteria | 1716 |
| 39 | Ga0070678_100137012 | 3300005456 | Bacteria | 1953 |
| 40 | Ga0070678_100169963 | 3300005456 | Bacteria | 1774 |
| 41 | Ga0070662_100064814 | 3300005457 | Bacteria | 2676 |
| 42 | Ga0070662_100073964 | 3300005457 | Bacteria | 2519 |
| 43 | Ga0070681_10031485 | 3300005458 | Bacteria | 5326 |
| 44 | Ga0070681_10067186 | 3300005458 | Bacteria | 3553 |
| 45 | Ga0070681_10117395 | 3300005458 | Bacteria | 2597 |
| 46 | Ga0068867_100200088 | 3300005459 | Bacteria | 1599 |
| 47 | Ga0070698_100103345 | 3300005471 | Bacteria | 2819 |
| 48 | Ga0070679_100009249 | 3300005530 | Bacteria | 9313 |
| 49 | Ga0070684_100008556 | 3300005535 | Bacteria | 8010 |
| 50 | Ga0070684_100013708 | 3300005535 | Bacteria | 6541 |
| 51 | Ga0070697_100015893 | 3300005536 | Bacteria | 5914 |
| 52 | Ga0068853_100002207 | 3300005539 | Bacteria | 14542 |
| 53 | Ga0068853_100030556 | 3300005539 | Bacteria | 4551 |
| 54 | Ga0070665_100030314 | 3300005548 | Bacteria | 5444 |
| 55 | Ga0070665_100073740 | 3300005548 | Bacteria | 3418 |
| 56 | Ga0070665_100089381 | 3300005548 | Bacteria | 3086 |
| 57 | Ga0068855_100117585 | 3300005563 | Bacteria | 3045 |
| 58 | Ga0068855_100192942 | 3300005563 | Bacteria | 2296 |
| 59 | Ga0068855_100284371 | 3300005563 | Bacteria | 1835 |
| 60 | Ga0068857_100034471 | 3300005577 | Bacteria | 4478 |
| 61 | Ga0068857_100155307 | 3300005577 | Bacteria | 2075 |
| 62 | Ga0068854_100203564 | 3300005578 | Bacteria | 1557 |
| 63 | Ga0068856_100004436 | 3300005614 | Bacteria | 13974 |
| 64 | Ga0068856_100202460 | 3300005614 | Bacteria | 2000 |
| 65 | Ga0068852_100107521 | 3300005616 | Bacteria | 2530 |
| 66 | Ga0068859_100062487 | 3300005617 | Bacteria | 3754 |
| 67 | Ga0068864_100051077 | 3300005618 | Bacteria | 3560 |
| 68 | Ga0068861_100107403 | 3300005719 | Bacteria | 2231 |
| 69 | Ga0068851_10015046 | 3300005834 | Bacteria | 3682 |
| 70 | Ga0068858_100100363 | 3300005842 | Bacteria | 2700 |
| 71 | Ga0068860_100002033 | 3300005843 | Bacteria | 21319 |
| 72 | Ga0081455_10004676 | 3300005937 | Bacteria | 15239 |
| 73 | Ga0081455_10023105 | 3300005937 | Bacteria | 5792 |
| 74 | Ga0081455_10042566 | 3300005937 | Bacteria | 3982 |
| 75 | Ga0081455_10055334 | 3300005937 | Bacteria | 3375 |
| 76 | Ga0081455_10105146 | 3300005937 | Bacteria | 2256 |
| 77 | Ga0081540_1003809 | 3300005983 | Bacteria | 11796 |
| 78 | Ga0081540_1005189 | 3300005983 | Bacteria | 9753 |
| 79 | Ga0081540_1007118 | 3300005983 | Bacteria | 8028 |
| 80 | Ga0081540_1008316 | 3300005983 | Bacteria | 7258 |
| 81 | Ga0081540_1009524 | 3300005983 | Bacteria | 6687 |
| 82 | Ga0081540_1033115 | 3300005983 | Bacteria | 2811 |
| 83 | Ga0081539_10000099 | 3300005985 | Bacteria | 201018 |
| 84 | Ga0081539_10000958 | 3300005985 | Bacteria | 54105 |
| 85 | Ga0081539_10075359 | 3300005985 | Bacteria | 1793 |
| 86 | Ga0070717_10205460 | 3300006028 | Bacteria | 1727 |
| 87 | Ga0075365_10007229 | 3300006038 | Bacteria | 6203 |
| 88 | Ga0075365_10017120 | 3300006038 | Bacteria | 4425 |
| 89 | Ga0075365_10042647 | 3300006038 | Bacteria | 2967 |
| 90 | Ga0075365_10046934 | 3300006038 | Bacteria | 2838 |
| 91 | Ga0075365_10070828 | 3300006038 | Bacteria | 2346 |
| 92 | Ga0075368_10010213 | 3300006042 | Bacteria | 3391 |
| 93 | Ga0075363_100024415 | 3300006048 | Bacteria | 3073 |
| 94 | Ga0075363_100029979 | 3300006048 | Bacteria | 2812 |
| 95 | Ga0075363_100039740 | 3300006048 | Bacteria | 2477 |
| 96 | Ga0070715_10003525 | 3300006163 | Bacteria | 4997 |
| 97 | Ga0070716_100105346 | 3300006173 | Bacteria | 1737 |
| 98 | Ga0070712_100010132 | 3300006175 | Bacteria | 5941 |
| 99 | Ga0075362_10003381 | 3300006177 | Bacteria | 5564 |
| 100 | Ga0075367_10008443 | 3300006178 | Bacteria | 5336 |
| 101 | Ga0075367_10011965 | 3300006178 | Bacteria | 4610 |
| 102 | Ga0075367_10016996 | 3300006178 | Bacteria | 3984 |
| 103 | Ga0075367_10042754 | 3300006178 | Bacteria | 2652 |
| 104 | Ga0075370_10048373 | 3300006353 | Bacteria | 2409 |
| 105 | Ga0075370_10101950 | 3300006353 | Bacteria | 1662 |
| 106 | Ga0075428_100107116 | 3300006844 | Bacteria | 3046 |
| 107 | Ga0075434_100090790 | 3300006871 | Bacteria | 3056 |
| 108 | Ga0068865_100024542 | 3300006881 | Bacteria | 3957 |
| 109 | Ga0097620_100062488 | 3300006931 | Bacteria | 3754 |
| 110 | Ga0099824_1008513 | 3300006942 | Bacteria | 13101 |
| 111 | Ga0099795_10016452 | 3300007788 | Bacteria | 2339 |
| 112 | Ga0105240_10028981 | 3300009093 | Bacteria | 7220 |
| 113 | Ga0105240_10074144 | 3300009093 | Bacteria | 4201 |
| 114 | Ga0105240_10076492 | 3300009093 | Bacteria | 4126 |
| 115 | Ga0105240_10088824 | 3300009093 | Bacteria | 3781 |
| 116 | Ga0105240_10108155 | 3300009093 | Bacteria | 3369 |
| 117 | Ga0111539_10035547 | 3300009094 | Bacteria | 6031 |
| 118 | Ga0111539_10038005 | 3300009094 | Bacteria | 5807 |
| 119 | Ga0111539_10398983 | 3300009094 | Bacteria | 1602 |
| 120 | Ga0105245_10016400 | 3300009098 | Bacteria | 6462 |
| 121 | Ga0105247_10161614 | 3300009101 | Bacteria | 1483 |
| 122 | Ga0105241_10134404 | 3300009174 | Bacteria | 2006 |
| 123 | Ga0105237_10012102 | 3300009545 | Bacteria | 9107 |
| 124 | Ga0105237_10022395 | 3300009545 | Bacteria | 6483 |
| 125 | Ga0105237_10027380 | 3300009545 | Bacteria | 5819 |
| 126 | Ga0105237_10045894 | 3300009545 | Bacteria | 4397 |
| 127 | Ga0105237_10135130 | 3300009545 | Bacteria | 2461 |
| 128 | Ga0105237_10184946 | 3300009545 | Bacteria | 2084 |
| 129 | Ga0105237_10286844 | 3300009545 | Bacteria | 1649 |
| 130 | Ga0105238_10003421 | 3300009551 | Bacteria | 15825 |
| 131 | Ga0105238_10171357 | 3300009551 | Bacteria | 2147 |
| 132 | Ga0105249_10259876 | 3300009553 | Bacteria | 1725 |
| 133 | Ga0105239_10039377 | 3300010375 | Bacteria | 5180 |
| 134 | Ga0105239_10062992 | 3300010375 | Bacteria | 4071 |
| 135 | Ga0105239_10141081 | 3300010375 | Bacteria | 2685 |
| 136 | Ga0105239_10354715 | 3300010375 | Bacteria | 1656 |
| 137 | Ga0105246_10122556 | 3300011119 | Bacteria | 1929 |
| 138 | Ga0157370_10124163 | 3300013104 | Bacteria | 2410 |
| 139 | Ga0157370_10144768 | 3300013104 | Bacteria | 2213 |
| 140 | Ga0157369_10008923 | 3300013105 | Bacteria | 11481 |
| 141 | Ga0157369_10048074 | 3300013105 | Bacteria | 4630 |
| 142 | Ga0157369_10053962 | 3300013105 | Bacteria | 4341 |
| 143 | Ga0157369_10145823 | 3300013105 | Bacteria | 2503 |
| 144 | Ga0157374_10003262 | 3300013296 | Bacteria | 13625 |
| 145 | Ga0157374_10045188 | 3300013296 | Bacteria | 4076 |
| 146 | Ga0157378_10004948 | 3300013297 | Bacteria | 11684 |
| 147 | Ga0157378_10095220 | 3300013297 | Bacteria | 2712 |
| 148 | Ga0163162_10140685 | 3300013306 | Bacteria | 2526 |
| 149 | Ga0157372_10037760 | 3300013307 | Bacteria | 5328 |
| 150 | Ga0157372_10265646 | 3300013307 | Bacteria | 1993 |
| 151 | Ga0163163_10117367 | 3300014325 | Bacteria | 2693 |
| 152 | Ga0163163_10153434 | 3300014325 | Bacteria | 2346 |
| 153 | Ga0157380_10023470 | 3300014326 | Bacteria | 4652 |
| 154 | Ga0157380_10093329 | 3300014326 | Bacteria | 2488 |
| 155 | Ga0157379_10070458 | 3300014968 | Bacteria | 3128 |
| 156 | Ga0214544_1000163 | 3300021320 | Bacteria | 101631 |
| 157 | Ga0214542_1000156 | 3300021321 | Bacteria | 101631 |
| 158 | Ga0214545_1000078 | 3300021324 | Bacteria | 101631 |
| 159 | Ga0214543_1000136 | 3300021327 | Bacteria | 101629 |
| 160 | Ga0209563_101512 | 3300025230 | Bacteria | 6093 |
| 161 | Ga0209677_107843 | 3300025253 | Bacteria | 2179 |
| 162 | Ga0209233_1009766 | 3300025261 | Bacteria | 2905 |
| 163 | Ga0209564_1009894 | 3300025295 | Bacteria | 4465 |
| 164 | Ga0209758_1000705 | 3300025297 | Bacteria | 49585 |
| 165 | Ga0209758_1000932 | 3300025297 | Bacteria | 39573 |
| 166 | Ga0209758_1000986 | 3300025297 | Bacteria | 38258 |
| 167 | Ga0209758_1001737 | 3300025297 | Bacteria | 24275 |
| 168 | Ga0209758_1003580 | 3300025297 | Bacteria | 13909 |
| 169 | Ga0209758_1008219 | 3300025297 | Bacteria | 6835 |
| 170 | Ga0207426_1000632 | 3300025302 | Bacteria | 44581 |
| 171 | Ga0209257_1023187 | 3300025304 | Bacteria | 2189 |
| 172 | Ga0207697_10020133 | 3300025315 | Bacteria | 2733 |
| 173 | Ga0207656_10011027 | 3300025321 | Bacteria | 3403 |
| 174 | Ga0207692_10003950 | 3300025898 | Bacteria | 5822 |
| 175 | Ga0207692_10009404 | 3300025898 | Bacteria | 4082 |
| 176 | Ga0207647_10012253 | 3300025904 | Bacteria | 5976 |
| 177 | Ga0207699_10001069 | 3300025906 | Bacteria | 12945 |
| 178 | Ga0207705_10055052 | 3300025909 | Bacteria | 2868 |
| 179 | Ga0207654_10013829 | 3300025911 | Bacteria | 4158 |
| 180 | Ga0207654_10041635 | 3300025911 | Bacteria | 2595 |
| 181 | Ga0207707_10001541 | 3300025912 | Bacteria | 21226 |
| 182 | Ga0207707_10022607 | 3300025912 | Bacteria | 5497 |
| 183 | Ga0207707_10089328 | 3300025912 | Bacteria | 2692 |
| 184 | Ga0207707_10178212 | 3300025912 | Bacteria | 1856 |
| 185 | Ga0207695_10000123 | 3300025913 | Bacteria | 232059 |
| 186 | Ga0207695_10065019 | 3300025913 | Bacteria | 3752 |
| 187 | Ga0207695_10077656 | 3300025913 | Bacteria | 3371 |
| 188 | Ga0207671_10014288 | 3300025914 | Bacteria | 6280 |
| 189 | Ga0207671_10023986 | 3300025914 | Bacteria | 4592 |
| 190 | Ga0207693_10000565 | 3300025915 | Bacteria | 33481 |
| 191 | Ga0207693_10003555 | 3300025915 | Bacteria | 13315 |
| 192 | Ga0207693_10008187 | 3300025915 | Bacteria | 8566 |
| 193 | Ga0207693_10020827 | 3300025915 | Bacteria | 5214 |
| 194 | Ga0207663_10000239 | 3300025916 | Bacteria | 24165 |
| 195 | Ga0207663_10005579 | 3300025916 | Bacteria | 6352 |
| 196 | Ga0207663_10082976 | 3300025916 | Bacteria | 2104 |
| 197 | Ga0207660_10010184 | 3300025917 | Bacteria | 6093 |
| 198 | Ga0207660_10033682 | 3300025917 | Bacteria | 3546 |
| 199 | Ga0207657_10005246 | 3300025919 | Bacteria | 13576 |
| 200 | Ga0207657_10055057 | 3300025919 | Bacteria | 3438 |
| 201 | Ga0207657_10104597 | 3300025919 | Bacteria | 2344 |
| 202 | Ga0207649_10028886 | 3300025920 | Bacteria | 3270 |
| 203 | Ga0207652_10016519 | 3300025921 | Bacteria | 6028 |
| 204 | Ga0207652_10024907 | 3300025921 | Bacteria | 4968 |
| 205 | Ga0207652_10025737 | 3300025921 | Bacteria | 4895 |
| 206 | Ga0207687_10002549 | 3300025927 | Bacteria | 12372 |
| 207 | Ga0207687_10126782 | 3300025927 | Bacteria | 1918 |
| 208 | Ga0207700_10005630 | 3300025928 | Bacteria | 7519 |
| 209 | Ga0207700_10011952 | 3300025928 | Bacteria | 5568 |
| 210 | Ga0207700_10021183 | 3300025928 | Bacteria | 4432 |
| 211 | Ga0207664_10008257 | 3300025929 | Bacteria | 7252 |
| 212 | Ga0207644_10076454 | 3300025931 | Bacteria | 2463 |
| 213 | Ga0207690_10097110 | 3300025932 | Bacteria | 2096 |
| 214 | Ga0207706_10028509 | 3300025933 | Bacteria | 4987 |
| 215 | Ga0207706_10055808 | 3300025933 | Bacteria | 3483 |
| 216 | Ga0207670_10072310 | 3300025936 | Bacteria | 2387 |
| 217 | Ga0207669_10014357 | 3300025937 | Bacteria | 3967 |
| 218 | Ga0207665_10000127 | 3300025939 | Bacteria | 50413 |
| 219 | Ga0207665_10147606 | 3300025939 | Bacteria | 1681 |
| 220 | Ga0207691_10050355 | 3300025940 | Bacteria | 3813 |
| 221 | Ga0207711_10052652 | 3300025941 | Bacteria | 3489 |
| 222 | Ga0207689_10014870 | 3300025942 | Bacteria | 6605 |
| 223 | Ga0207661_10010620 | 3300025944 | Bacteria | 6635 |
| 224 | Ga0207661_10011823 | 3300025944 | Bacteria | 6339 |
| 225 | Ga0207667_10012980 | 3300025949 | Bacteria | 9561 |
| 226 | Ga0207667_10128800 | 3300025949 | Bacteria | 2607 |
| 227 | Ga0207667_10196100 | 3300025949 | Bacteria | 2072 |
| 228 | Ga0207712_10016234 | 3300025961 | Bacteria | 4818 |
| 229 | Ga0207712_10060450 | 3300025961 | Bacteria | 2686 |
| 230 | Ga0207712_10176810 | 3300025961 | Bacteria | 1673 |
| 231 | Ga0207668_10003544 | 3300025972 | Bacteria | 9176 |
| 232 | Ga0207668_10134984 | 3300025972 | Bacteria | 1889 |
| 233 | Ga0207677_10140768 | 3300026023 | Bacteria | 1846 |
| 234 | Ga0207639_10016989 | 3300026041 | Bacteria | 5156 |
| 235 | Ga0207678_10036953 | 3300026067 | Bacteria | 4251 |
| 236 | Ga0207678_10130789 | 3300026067 | Bacteria | 2141 |
| 237 | Ga0207708_10044384 | 3300026075 | Bacteria | 3387 |
| 238 | Ga0207702_10000758 | 3300026078 | Bacteria | 34312 |
| 239 | Ga0207641_10215815 | 3300026088 | Bacteria | 1776 |
| 240 | Ga0207648_10046275 | 3300026089 | Bacteria | 3814 |
| 241 | Ga0207648_10280973 | 3300026089 | Bacteria | 1489 |
| 242 | Ga0207676_10027584 | 3300026095 | Bacteria | 4231 |
| 243 | Ga0207674_10025987 | 3300026116 | Bacteria | 6231 |
| 244 | Ga0207674_10026551 | 3300026116 | Bacteria | 6146 |
| 245 | Ga0207675_100077746 | 3300026118 | Bacteria | 3109 |
| 246 | Ga0207675_100125875 | 3300026118 | Bacteria | 2427 |
| 247 | Ga0207698_10046695 | 3300026142 | Bacteria | 3273 |
| 248 | Ga0207698_10230349 | 3300026142 | Bacteria | 1681 |
| 249 | Ga0209389_1000248 | 3300027296 | Bacteria | 34726 |
| 250 | Ga0209589_1001871 | 3300027357 | Bacteria | 35557 |
| 251 | Ga0209489_102684 | 3300027361 | Bacteria | 35799 |
| 252 | Ga0207428_10132076 | 3300027907 | Bacteria | 1910 |
| 253 | Ga0268266_10022369 | 3300028379 | Bacteria | 5389 |
| 254 | Ga0268266_10023902 | 3300028379 | Bacteria | 5200 |
| 255 | Ga0268266_10048656 | 3300028379 | Bacteria | 3634 |
| 256 | Ga0268266_10158379 | 3300028379 | Bacteria | 2047 |
| 257 | Ga0268265_10023047 | 3300028380 | Bacteria | 4384 |
| 258 | Ga0268265_10023969 | 3300028380 | Bacteria | 4310 |
| 259 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 260 | Ga0307517_10021811 | 3300028786 | Bacteria | 8062 |
| 261 | Ga0307515_10221687 | 3300028794 | Bacteria | 1707 |
| 262 | Ga0265338_10188674 | 3300028800 | Bacteria | 1565 |
| 263 | Ga0265330_10035657 | 3300031235 | Bacteria | 2218 |
| 264 | Ga0265332_10012460 | 3300031238 | Bacteria | 3774 |
| 265 | Ga0265340_10003101 | 3300031247 | Bacteria | 9427 |
| 266 | Ga0265339_10006267 | 3300031249 | Bacteria | 7828 |
| 267 | Ga0265316_10070564 | 3300031344 | Bacteria | 2695 |
| 268 | Ga0307509_10033214 | 3300031507 | Bacteria | 5679 |
| 269 | Ga0307508_10000063 | 3300031616 | Bacteria | 122536 |
| 270 | Ga0307508_10027504 | 3300031616 | Bacteria | 5146 |
| 271 | Ga0265314_10008977 | 3300031711 | Bacteria | 8509 |
| 272 | Ga0265342_10049875 | 3300031712 | Bacteria | 2503 |
| 273 | Ga0265342_10094168 | 3300031712 | Bacteria | 1714 |
| 274 | Ga0307516_10018150 | 3300031730 | Bacteria | 7316 |
| 275 | Ga0307516_10059002 | 3300031730 | Bacteria | 3733 |
| 276 | Ga0307516_10137777 | 3300031730 | Bacteria | 2213 |
| 277 | Ga0307510_10010372 | 3300033180 | Bacteria | 11067 |
| 278 | Ga0307510_10024996 | 3300033180 | Bacteria | 6896 |
| 279 | Ga0307510_10041830 | 3300033180 | Bacteria | 5003 |
| 280 | Ga0307510_10165981 | 3300033180 | Bacteria | 1796 |
| 281 | Ga0316215_1002488 | 3300033544 | Bacteria | 1742 |
| 282 | Ga0373934_0008383 | 3300035086 | Bacteria | 3852 |
| 283 | Ga0373934_0023120 | 3300035086 | Bacteria | 2401 |
| 284 | Ga0373923_0001005 | 3300035111 | Bacteria | 7635 |
| 285 | Ga0373936_0031660 | 3300035113 | Bacteria | 2089 |
| 286 | Ga0373936_0035701 | 3300035113 | Bacteria | 1980 |
| 287 | Ga0373945_0017685 | 3300035116 | Bacteria | 2417 |
| 288 | Ga0373953_0000415 | 3300035117 | Bacteria | 11581 |
| 289 | Ga0373954_0004190 | 3300035118 | Bacteria | 6181 |
| 290 | Ga0373954_0012233 | 3300035118 | Bacteria | 3815 |
| 291 | Ga0373954_0071911 | 3300035118 | Bacteria | 1644 |
| 292 | Ga0373956_0001481 | 3300035119 | Bacteria | 9711 |
| 293 | Ga0373956_0014888 | 3300035119 | Bacteria | 3252 |
| 294 | Ga0373957_0008299 | 3300035120 | Bacteria | 3358 |
| 295 | Ga0373943_0004735 | 3300035170 | Bacteria | 6149 |
| 296 | Ga0373943_0005037 | 3300035170 | Bacteria | 5958 |
| 297 | Ga0373955_0002049 | 3300035172 | Bacteria | 8671 |
| 298 | Ga0373955_0019272 | 3300035172 | Bacteria | 3406 |
| 299 | Ga0373955_0035628 | 3300035172 | Bacteria | 2636 |
| 300 | Ga0373924_0027599 | 3300035410 | Bacteria | 2258 |
| 301 | Ga0373931_0014884 | 3300035691 | Bacteria | 3810 |
| 302 | Ga0373935_0036629 | 3300035692 | Bacteria | 3068 |
| 303 | Ga0373935_0054232 | 3300035692 | Bacteria | 2552 |
| 304 | Ga0373927_0023634 | 3300035695 | Bacteria | 4023 |
| 305 | Ga0373933_0000204 | 3300035724 | Bacteria | 39417 |
| 306 | Ga0373933_0004702 | 3300035724 | Bacteria | 7476 |
| 307 | Ga0373947_0000455 | 3300035725 | Bacteria | 23308 |
| 308 | Ga0373947_0013349 | 3300035725 | Bacteria | 4707 |
| 309 | Ga0373937_0004613 | 3300036401 | Bacteria | 11701 |
| 310 | Ga0373937_0008188 | 3300036401 | Bacteria | 9080 |
| 311 | Ga0373937_0009140 | 3300036401 | Bacteria | 8599 |
| 312 | Ga0373937_0019760 | 3300036401 | Bacteria | 6033 |
| 313 | Ga0373937_0182159 | 3300036401 | Bacteria | 1973 |
| 314 | Ga0372808_002623 | 3300036459 | Bacteria | 2102 |
| 315 | Ga0373925_0006046 | 3300037068 | Bacteria | 8955 |
| 316 | Ga0373925_0124477 | 3300037068 | Bacteria | 2004 |
| 317 | Ga0395900_0012087 | 3300037418 | Bacteria | 8823 |
| 318 | Ga0395900_0076163 | 3300037418 | Bacteria | 3449 |
| 319 | Ga0395898_0008444 | 3300037466 | Bacteria | 10888 |
| 320 | Ga0395898_0011301 | 3300037466 | Bacteria | 9283 |
| 321 | Ga0395905_0146839 | 3300037471 | Bacteria | 2219 |
| 322 | Ga0436364_0787494 | 3300037853 | Bacteria | 3229 |
| 323 | Ga0395901_0015903 | 3300038443 | Bacteria | 7668 |
| 324 | Ga0395901_0066938 | 3300038443 | Bacteria | 3741 |
| 325 | Ga0436365_0488786 | 3300039437 | Bacteria | 4011 |
| 326 | Ga0436365_1439813 | 3300039437 | Bacteria | 24357 |
| 327 | Ga0436365_1552881 | 3300039437 | Bacteria | 2917 |
| 328 | Ga0436363_0832891 | 3300039450 | Bacteria | 1721 |
| 329 | Ga0436362_1202653 | 3300039453 | Bacteria | 2801 |
| 330 | Ga0466966_0001614 | 3300044684 | Bacteria | 14525 |
| 331 | Ga0466961_0000192 | 3300044693 | Bacteria | 40922 |
| 332 | Ga0466959_0000934 | 3300045049 | Bacteria | 17340 |
| 333 | Ga0495592_0008971 | 3300046454 | Bacteria | 7512 |
| 334 | Ga0495592_0020497 | 3300046454 | Bacteria | 5029 |
| 335 | Ga0495603_0000239 | 3300046455 | Bacteria | 28578 |
| 336 | Ga0495603_0004059 | 3300046455 | Bacteria | 8712 |
| 337 | Ga0495603_0042269 | 3300046455 | Bacteria | 2725 |
| 338 | Ga0495629_0000457 | 3300046459 | Bacteria | 34088 |
| 339 | Ga0495629_0004778 | 3300046459 | Bacteria | 10153 |
| 340 | Ga0495629_0006402 | 3300046459 | Bacteria | 8733 |
| 341 | Ga0495638_0015338 | 3300046460 | Bacteria | 5147 |
| 342 | Ga0495641_0002157 | 3300046461 | Bacteria | 15774 |
| 343 | Ga0495651_0001839 | 3300046462 | Bacteria | 16395 |
| 344 | Ga0495651_0016963 | 3300046462 | Bacteria | 5640 |
| 345 | Ga0495651_0045340 | 3300046462 | Bacteria | 3406 |
| 346 | Ga0495651_0142626 | 3300046462 | Bacteria | 1735 |
| 347 | Ga0495653_0009797 | 3300046463 | Bacteria | 7835 |
| 348 | Ga0495653_0067979 | 3300046463 | Bacteria | 2673 |
| 349 | Ga0495653_0107165 | 3300046463 | Bacteria | 2014 |
| 350 | Ga0495650_0037007 | 3300046471 | Bacteria | 2129 |
| 351 | Ga0495580_0004703 | 3300046472 | Bacteria | 11445 |
| 352 | Ga0495580_0009906 | 3300046472 | Bacteria | 7462 |
| 353 | Ga0495580_0062964 | 3300046472 | Bacteria | 2602 |
| 354 | Ga0495582_0000077 | 3300046473 | Bacteria | 49112 |
| 355 | Ga0495639_0000101 | 3300046475 | Bacteria | 42348 |
| 356 | Ga0495639_0044668 | 3300046475 | Bacteria | 2003 |
| 357 | Ga0495662_0010930 | 3300046476 | Bacteria | 4440 |
| 358 | Ga0495664_0007665 | 3300046477 | Bacteria | 6003 |
| 359 | Ga0495664_0022227 | 3300046477 | Bacteria | 3674 |
| 360 | Ga0495594_0000083 | 3300046499 | Bacteria | 42703 |
| 361 | Ga0495596_0050823 | 3300046500 | Bacteria | 1624 |
| 362 | Ga0495606_0000357 | 3300046507 | Bacteria | 78015 |
| 363 | Ga0495606_0013192 | 3300046507 | Bacteria | 6555 |
| 364 | Ga0495608_0004649 | 3300046511 | Bacteria | 9811 |
| 365 | Ga0495608_0038423 | 3300046511 | Bacteria | 3214 |
| 366 | Ga0495618_0050333 | 3300046514 | Bacteria | 2631 |
| 367 | Ga0495628_0009352 | 3300046516 | Bacteria | 8368 |
| 368 | Ga0495628_0062610 | 3300046516 | Bacteria | 2916 |
| 369 | Ga0495628_0074155 | 3300046516 | Bacteria | 2651 |
| 370 | Ga0495666_0056332 | 3300046526 | Bacteria | 1883 |
| 371 | Ga0495652_0027178 | 3300046529 | Bacteria | 5044 |
| 372 | Ga0495652_0033108 | 3300046529 | Bacteria | 4516 |
| 373 | Ga0495652_0088520 | 3300046529 | Bacteria | 2537 |
| 374 | Ga0495652_0094059 | 3300046529 | Bacteria | 2445 |
| 375 | Ga0495652_0095391 | 3300046529 | Bacteria | 2424 |
| 376 | Ga0495665_0000055 | 3300046531 | Bacteria | 45208 |
| 377 | Ga0495640_0004679 | 3300046533 | Bacteria | 10908 |
| 378 | Ga0495640_0018966 | 3300046533 | Bacteria | 5088 |
| 379 | Ga0495640_0040562 | 3300046533 | Bacteria | 3259 |
| 380 | Ga0495586_0048634 | 3300046535 | Bacteria | 2292 |
| 381 | Ga0495587_0004468 | 3300046536 | Bacteria | 9203 |
| 382 | Ga0495587_0032943 | 3300046536 | Bacteria | 3129 |
| 383 | Ga0495597_0027431 | 3300046542 | Bacteria | 2611 |
| 384 | Ga0495645_0006792 | 3300046543 | Bacteria | 7952 |
| 385 | Ga0495645_0027524 | 3300046543 | Bacteria | 4131 |
| 386 | Ga0495645_0086668 | 3300046543 | Bacteria | 2240 |
| 387 | Ga0495645_0154405 | 3300046543 | Bacteria | 1592 |
| 388 | Ga0495667_0004352 | 3300046559 | Bacteria | 9561 |
| 389 | Ga0495667_0034624 | 3300046559 | Bacteria | 3376 |
| 390 | Ga0495667_0109928 | 3300046559 | Bacteria | 1781 |
| 391 | Ga0495634_0000720 | 3300046642 | Bacteria | 32017 |
| 392 | Ga0495634_0001493 | 3300046642 | Bacteria | 20702 |
| 393 | Ga0495634_0027825 | 3300046642 | Bacteria | 3930 |
| 394 | Ga0495634_0032036 | 3300046642 | Bacteria | 3617 |
| 395 | Ga0495634_0112395 | 3300046642 | Bacteria | 1751 |
| 396 | Ga0495625_0085379 | 3300046660 | Bacteria | 2191 |
| 397 | Ga0495635_0004810 | 3300046663 | Bacteria | 9387 |
| 398 | Ga0495635_0011274 | 3300046663 | Bacteria | 6269 |
| 399 | Ga0495635_0012169 | 3300046663 | Bacteria | 6032 |
| 400 | Ga0495635_0023852 | 3300046663 | Bacteria | 4263 |
| 401 | Ga0495588_0032711 | 3300046674 | Bacteria | 2622 |
| 402 | Ga0495657_0003079 | 3300046675 | Bacteria | 13781 |
| 403 | Ga0495657_0004591 | 3300046675 | Bacteria | 11023 |
| 404 | Ga0495657_0061694 | 3300046675 | Bacteria | 2479 |
| 405 | Ga0495599_0001945 | 3300046678 | Bacteria | 11972 |
| 406 | Ga0495599_0005172 | 3300046678 | Bacteria | 7778 |
| 407 | Ga0495599_0067586 | 3300046678 | Bacteria | 2232 |
| 408 | Ga0495599_0072228 | 3300046678 | Bacteria | 2154 |
| 409 | Ga0495599_0107887 | 3300046678 | Bacteria | 1735 |
| 410 | Ga0495623_0005899 | 3300046679 | Bacteria | 7979 |
| 411 | Ga0495623_0012014 | 3300046679 | Bacteria | 5610 |
| 412 | Ga0495623_0029120 | 3300046679 | Bacteria | 3555 |
| 413 | Ga0495646_0001642 | 3300046680 | Bacteria | 13342 |
| 414 | Ga0495646_0011553 | 3300046680 | Bacteria | 5607 |
| 415 | Ga0495646_0037952 | 3300046680 | Bacteria | 2977 |
| 416 | Ga0495646_0078288 | 3300046680 | Bacteria | 1932 |
| 417 | Ga0495647_0010240 | 3300046681 | Bacteria | 3191 |
| 418 | Ga0495658_0001572 | 3300046683 | Bacteria | 11910 |
| 419 | Ga0495669_0002048 | 3300046684 | Bacteria | 8266 |
| 420 | Ga0495613_0021735 | 3300046689 | Bacteria | 4780 |
| 421 | Ga0495624_0000235 | 3300046690 | Bacteria | 43165 |
| 422 | Ga0495624_0100052 | 3300046690 | Bacteria | 1785 |
| 423 | Ga0495624_0117211 | 3300046690 | Bacteria | 1636 |
| 424 | Ga0495600_0003270 | 3300046809 | Bacteria | 9492 |
| 425 | Ga0495581_0000041 | 3300047315 | Bacteria | 46518 |
| 426 | Ga0495581_0068564 | 3300047315 | Bacteria | 2051 |
| 427 | Ga0495581_0083442 | 3300047315 | Bacteria | 1851 |
| 428 | Ga0495604_0007215 | 3300047317 | Bacteria | 8805 |
| 429 | Ga0495604_0007221 | 3300047317 | Bacteria | 8800 |
| 430 | Ga0495604_0012818 | 3300047317 | Bacteria | 6675 |
| 431 | Ga0495674_0010515 | 3300047319 | Bacteria | 8758 |
| 432 | Ga0495674_0011929 | 3300047319 | Bacteria | 8194 |
| 433 | Ga0495674_0119907 | 3300047319 | Bacteria | 2223 |
| 434 | Ga0495672_0011925 | 3300047320 | Bacteria | 6096 |
| 435 | Ga0495672_0067517 | 3300047320 | Bacteria | 2036 |
| 436 | Ga0495676_0042790 | 3300047321 | Bacteria | 3714 |
| 437 | Ga0495680_0001654 | 3300047322 | Bacteria | 23702 |
| 438 | Ga0495680_0025270 | 3300047322 | Bacteria | 4918 |
| 439 | Ga0495680_0056996 | 3300047322 | Bacteria | 3024 |
| 440 | Ga0495687_015363 | 3300047443 | Bacteria | 3897 |
| 441 | Ga0495675_0023366 | 3300047444 | Bacteria | 3938 |
| 442 | Ga0495675_0041984 | 3300047444 | Bacteria | 2913 |
| 443 | Ga0495684_0001399 | 3300047471 | Bacteria | 19329 |
| 444 | Ga0495684_0131744 | 3300047471 | Bacteria | 1877 |
| 445 | Ga0495686_0076338 | 3300047472 | Bacteria | 2053 |
| 446 | Ga0495593_0000024 | 3300047673 | Bacteria | 65718 |
| 447 | Ga0495593_0004938 | 3300047673 | Bacteria | 7905 |
| 448 | Ga0495602_0009939 | 3300048088 | Bacteria | 9869 |
| 449 | Ga0495602_0031141 | 3300048088 | Bacteria | 5047 |
| 450 | Ga0495602_0075159 | 3300048088 | Bacteria | 2868 |
| 451 | Ga0496101_0019807 | 3300048904 | Bacteria | 4600 |
| 452 | Ga0496101_0053295 | 3300048904 | Bacteria | 2918 |
| 453 | Ga0496102_0022602 | 3300048905 | Bacteria | 5573 |
| 454 | Ga0496102_0026012 | 3300048905 | Bacteria | 5216 |
| 455 | Ga0496102_0127619 | 3300048905 | Bacteria | 2378 |
| 456 | Ga0496102_0162647 | 3300048905 | Bacteria | 2100 |
| 457 | Ga0496103_0037403 | 3300048906 | Bacteria | 2974 |
| 458 | Ga0496104_0006437 | 3300048907 | Bacteria | 10324 |
| 459 | Ga0496104_0011552 | 3300048907 | Bacteria | 7912 |
| 460 | Ga0496104_0023546 | 3300048907 | Bacteria | 5662 |
| 461 | Ga0496104_0036831 | 3300048907 | Bacteria | 4574 |
| 462 | Ga0496104_0182244 | 3300048907 | Bacteria | 2010 |
| 463 | Ga0496105_0004780 | 3300048908 | Bacteria | 10225 |
| 464 | Ga0496105_0014373 | 3300048908 | Bacteria | 6299 |
| 465 | Ga0496105_0020055 | 3300048908 | Bacteria | 5396 |
| 466 | Ga0496106_0006865 | 3300048909 | Bacteria | 8425 |
| 467 | Ga0496106_0032587 | 3300048909 | Bacteria | 3886 |
| 468 | Ga0496106_0069534 | 3300048909 | Bacteria | 2687 |
| 469 | Ga0496107_0006673 | 3300048910 | Bacteria | 7945 |
| 470 | Ga0496108_0026234 | 3300048911 | Bacteria | 4805 |
| 471 | Ga0496108_0096093 | 3300048911 | Bacteria | 2523 |
| 472 | Ga0496108_0104576 | 3300048911 | Bacteria | 2416 |
| 473 | Ga0496109_0063433 | 3300048912 | Bacteria | 3380 |
| 474 | Ga0496110_0014165 | 3300048913 | Bacteria | 6615 |
| 475 | Ga0496110_0044935 | 3300048913 | Bacteria | 3858 |
| 476 | Ga0496110_0079832 | 3300048913 | Bacteria | 2914 |
| 477 | Ga0496111_0011527 | 3300048914 | Bacteria | 5961 |
| 478 | Ga0496111_0039640 | 3300048914 | Bacteria | 3379 |
| 479 | Ga0496111_0046795 | 3300048914 | Bacteria | 3115 |
| 480 | Ga0496112_0000052 | 3300048915 | Bacteria | 81285 |
| 481 | Ga0496112_0035596 | 3300048915 | Bacteria | 4851 |
| 482 | Ga0496112_0100431 | 3300048915 | Bacteria | 2863 |
| 483 | Ga0496112_0173505 | 3300048915 | Bacteria | 2121 |
| 484 | Ga0496113_0032329 | 3300048916 | Bacteria | 3803 |
| 485 | Ga0496113_0093176 | 3300048916 | Bacteria | 2325 |
| 486 | Ga0496114_0265033 | 3300048917 | Bacteria | 1513 |
| 487 | Ga0496115_0001250 | 3300048918 | Bacteria | 18240 |
| 488 | Ga0496115_0058775 | 3300048918 | Bacteria | 3095 |
| 489 | Ga0496115_0177837 | 3300048918 | Bacteria | 1760 |
| 490 | Ga0496115_0238430 | 3300048918 | Bacteria | 1499 |
| 491 | Ga0496116_0009198 | 3300048919 | Bacteria | 8457 |
| 492 | Ga0496118_0014888 | 3300048921 | Bacteria | 7245 |
| 493 | Ga0496118_0058206 | 3300048921 | Bacteria | 2890 |
| 494 | Ga0496120_0044095 | 3300048923 | Bacteria | 2593 |
| 495 | Ga0496121_0000406 | 3300048924 | Bacteria | 85761 |
| 496 | Ga0496121_0038386 | 3300048924 | Bacteria | 4244 |
| 497 | Ga0496121_0124517 | 3300048924 | Bacteria | 1940 |
| 498 | Ga0496125_0000158 | 3300048928 | Bacteria | 151273 |
| 499 | Ga0496126_0000849 | 3300048929 | Bacteria | 54058 |
| 500 | Ga0496126_0009829 | 3300048929 | Bacteria | 10127 |
| 501 | Ga0496126_0034696 | 3300048929 | Bacteria | 4735 |
| 502 | Ga0496126_0060149 | 3300048929 | Bacteria | 3418 |
| 503 | Ga0496126_0062869 | 3300048929 | Bacteria | 3329 |
| 504 | Ga0496126_0116044 | 3300048929 | Bacteria | 2327 |
| 505 | Ga0501031_0000398 | 3300049568 | Bacteria | 25392 |
| 506 | Ga0501032_0000916 | 3300049569 | Bacteria | 23861 |
| 507 | Ga0501033_0001463 | 3300049570 | Bacteria | 20932 |
| 508 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 509 | Ga0501036_0000250 | 3300049572 | Bacteria | 36419 |
| 510 | Ga0501037_0000030 | 3300049573 | Bacteria | 136148 |
| 511 | Ga0501038_0000039 | 3300049574 | Bacteria | 122904 |
| 512 | Ga0501039_0000060 | 3300049575 | Bacteria | 85528 |
| 513 | Ga0501039_0087726 | 3300049575 | Bacteria | 2424 |
| 514 | Ga0501043_0003512 | 3300049579 | Bacteria | 12893 |
| 515 | Ga0501043_0148437 | 3300049579 | Bacteria | 1835 |
| 516 | Ga0501046_0000419 | 3300049580 | Bacteria | 42326 |
| 517 | Ga0501047_0000174 | 3300049581 | Bacteria | 79021 |
| 518 | Ga0501047_0071264 | 3300049581 | Bacteria | 3345 |
| 519 | Ga0501047_0104480 | 3300049581 | Bacteria | 2713 |
| 520 | Ga0501048_0000068 | 3300049582 | Bacteria | 53016 |
| 521 | Ga0501067_0000068 | 3300049583 | Bacteria | 59338 |
| 522 | Ga0501067_0083105 | 3300049583 | Bacteria | 1776 |
| 523 | Ga0501068_0000949 | 3300049584 | Bacteria | 15209 |
| 524 | Ga0501070_0007372 | 3300049586 | Bacteria | 9340 |
| 525 | Ga0501070_0012988 | 3300049586 | Bacteria | 7020 |
| 526 | Ga0501072_0003432 | 3300049588 | Bacteria | 11934 |
| 527 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 528 | Ga0501073_0065004 | 3300049589 | Bacteria | 2544 |
| 529 | Ga0501074_0001057 | 3300049590 | Bacteria | 17986 |
| 530 | Ga0501080_0002767 | 3300049742 | Bacteria | 15405 |
| 531 | Ga0501083_0006137 | 3300049744 | Bacteria | 8522 |
| 532 | Ga0501035_0000067 | 3300049822 | Bacteria | 129204 |
| 533 | Ga0501035_0207447 | 3300049822 | Bacteria | 1678 |
| 534 | Ga0501044_0246961 | 3300049823 | Bacteria | 1727 |
| 535 | nmdc:mga03683_20124_c1 | 3300050489 | Bacteria | 2556 |
| 536 | nmdc:mga03683_4811_c1 | 3300050489 | Bacteria | 4508 |
| 537 | nmdc:mga03n38_36837_c1 | 3300050490 | Bacteria | 2106 |
| 538 | nmdc:mga00v17_91210_c1 | 3300050491 | Bacteria | 1914 |
| 539 | nmdc:mga0yw44_10099_c1 | 3300050492 | Bacteria | 4807 |
| 540 | nmdc:mga0yw44_11198_c1 | 3300050492 | Bacteria | 4617 |
| 541 | nmdc:mga0yw44_48604_c1 | 3300050492 | Bacteria | 2558 |
| 542 | nmdc:mga0yw44_8041_c1 | 3300050492 | Bacteria | 5230 |
| 543 | nmdc:mga0k408_50283_c1 | 3300050493 | Bacteria | 2413 |
| 544 | nmdc:mga06z11_67292_c1 | 3300050494 | Bacteria | 1885 |
| 545 | nmdc:mga06z11_714_c1 | 3300050494 | Bacteria | 12097 |
| 546 | nmdc:mga04h51_20567_c1 | 3300050495 | Bacteria | 1973 |
| 547 | nmdc:mga07m45_13095_c1 | 3300050496 | Bacteria | 4392 |
| 548 | nmdc:mga07m45_18945_c1 | 3300050496 | Bacteria | 3724 |
| 549 | nmdc:mga07m45_25456_c1 | 3300050496 | Bacteria | 3245 |
| 550 | nmdc:mga07m45_9035_c1 | 3300050496 | Bacteria | 5149 |
| 551 | nmdc:mga05p37_41080_c1 | 3300050507 | Bacteria | 5679 |
| 552 | nmdc:mga08y16_83157_c1 | 3300050511 | Bacteria | 3336 |
| 553 | nmdc:mga0n895_345783_c1 | 3300050512 | Bacteria | 1506 |
| 554 | nmdc:mga0sz30_4359_c1 | 3300050516 | Bacteria | 5109 |
| 555 | Ga0495601_0037471 | 3300053077 | Bacteria | 3031 |
| 556 | Ga0495601_0107617 | 3300053077 | Bacteria | 1804 |
| 557 | Ga0500635_0002813 | 3300053080 | Bacteria | 4320 |
| 558 | Ga0500635_0036346 | 3300053080 | Bacteria | 1623 |
| 559 | Ga0495655_0003480 | 3300053083 | Bacteria | 2602 |
| 560 | Ga0495595_0000637 | 3300053084 | Bacteria | 13319 |
| 561 | Ga0495619_0001080 | 3300053085 | Bacteria | 17897 |
| 562 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 563 | Ga0500646_0022926 | 3300053090 | Bacteria | 1672 |
| 564 | Ga0500566_0001419 | 3300053094 | Bacteria | 14035 |
| 565 | Ga0500566_0003306 | 3300053094 | Bacteria | 9643 |
| 566 | Ga0500566_0021179 | 3300053094 | Bacteria | 3824 |
| 567 | Ga0500640_000253 | 3300053095 | Bacteria | 11745 |
| 568 | Ga0500641_0014230 | 3300053096 | Bacteria | 2934 |
| 569 | Ga0500555_003315 | 3300053103 | Bacteria | 4589 |
| 570 | Ga0500556_0034880 | 3300053104 | Bacteria | 1734 |
| 571 | Ga0500557_000038 | 3300053105 | Bacteria | 69178 |
| 572 | Ga0500572_000199 | 3300053111 | Bacteria | 21285 |
| 573 | Ga0500595_000842 | 3300053119 | Bacteria | 17493 |
| 574 | Ga0500595_003257 | 3300053119 | Bacteria | 7665 |
| 575 | Ga0500595_025937 | 3300053119 | Bacteria | 2024 |
| 576 | Ga0500607_017019 | 3300053121 | Bacteria | 4156 |
| 577 | Ga0500608_047543 | 3300053122 | Bacteria | 2061 |
| 578 | Ga0500614_004636 | 3300053123 | Bacteria | 2898 |
| 579 | Ga0500642_0000381 | 3300053130 | Bacteria | 14828 |
| 580 | Ga0500642_0013926 | 3300053130 | Bacteria | 2975 |
| 581 | Ga0500658_0078263 | 3300053134 | Bacteria | 1409 |
| 582 | Ga0500559_0004076 | 3300053136 | Bacteria | 7011 |
| 583 | Ga0500559_0030442 | 3300053136 | Bacteria | 2313 |
| 584 | Ga0500573_0103966 | 3300053140 | Bacteria | 1595 |
| 585 | Ga0500603_000580 | 3300053150 | Bacteria | 9181 |
| 586 | Ga0500603_000944 | 3300053150 | Bacteria | 6868 |
| 587 | Ga0500630_000573 | 3300053159 | Bacteria | 16713 |
| 588 | Ga0500638_001609 | 3300053162 | Bacteria | 7251 |
| 589 | Ga0500638_002393 | 3300053162 | Bacteria | 6513 |
| 590 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 591 | Ga0500636_0000762 | 3300053177 | Bacteria | 17368 |
| 592 | Ga0500636_0042735 | 3300053177 | Bacteria | 2678 |
| 593 | Ga0500637_0000251 | 3300053178 | Bacteria | 19903 |
| 594 | Ga0500637_0052393 | 3300053178 | Bacteria | 2327 |
| 595 | Ga0500625_008825 | 3300053729 | Bacteria | 4476 |
| 596 | Ga0500596_001442 | 3300053735 | Bacteria | 4806 |
| 597 | Ga0500599_000896 | 3300053736 | Bacteria | 3299 |
| 598 | Ga0500601_000278 | 3300053737 | Bacteria | 9711 |
| 599 | Ga0501084_0001174 | 3300054114 | Bacteria | 20442 |
| 600 | Ga0500661_003392 | 3300055283 | Bacteria | 2986 |
| 601 | Ga0501082_0001593 | 3300060353 | Bacteria | 20008 |
| 602 | Ga0501082_0173716 | 3300060353 | Bacteria | 1874 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006942 | Ga0099824_1008513 | Ga0099824_100851311 | 363 |
| 2 | 3300048924 | Ga0496121_0038386 | Ga0496121_0038386_2783_4072 | 365 |
| 3 | 3300005327 | Ga0070658_10070036 | Ga0070658_100700362 | 367 |
| 4 | 3300005548 | Ga0070665_100030314 | Ga0070665_1000303145 | 367 |
| 5 | 3300025261 | Ga0209233_1009766 | Ga0209233_10097662 | 367 |
| 6 | 3300025297 | Ga0209758_1000705 | Ga0209758_100070533 | 367 |
| 7 | 3300053094 | Ga0500566_0003306 | Ga0500566_0003306_6052_7317 | 367 |
| 8 | 3300053130 | Ga0500642_0000381 | Ga0500642_0000381_8841_10091 | 367 |
| 9 | 3300053729 | Ga0500625_008825 | Ga0500625_008825_2055_3305 | 367 |
| 10 | 3300053737 | Ga0500601_000278 | Ga0500601_000278_5371_6621 | 367 |
| 11 | 3300025230 | Ga0209563_101512 | Ga0209563_1015122 | 368 |
| 12 | 3300025253 | Ga0209677_107843 | Ga0209677_1078432 | 368 |
| 13 | 3300005459 | Ga0068867_100200088 | Ga0068867_1002000881 | 369 |
| 14 | 3300005578 | Ga0068854_100203564 | Ga0068854_1002035641 | 369 |
| 15 | 3300005983 | Ga0081540_1003809 | Ga0081540_10038098 | 369 |
| 16 | 3300006038 | Ga0075365_10046934 | Ga0075365_100469342 | 369 |
| 17 | 3300006178 | Ga0075367_10042754 | Ga0075367_100427542 | 369 |
| 18 | 3300009093 | Ga0105240_10074144 | Ga0105240_100741443 | 369 |
| 19 | 3300010375 | Ga0105239_10062992 | Ga0105239_100629924 | 369 |
| 20 | 3300025913 | Ga0207695_10000123 | Ga0207695_1000012311 | 369 |
| 21 | 3300046674 | Ga0495588_0032711 | Ga0495588_0032711_591_1841 | 369 |
| 22 | 3300048907 | Ga0496104_0006437 | Ga0496104_0006437_2557_3807 | 369 |
| 23 | 3300048919 | Ga0496116_0009198 | Ga0496116_0009198_3054_4304 | 369 |
| 24 | 3300050491 | nmdc:mga00v17_91210_c1 | nmdc:mga00v17_91210_c1_124_1452 | 369 |
| 25 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_188811_190073 | 369 |
| 26 | 3300053103 | Ga0500555_003315 | Ga0500555_003315_206_1459 | 369 |
| 27 | 3300053736 | Ga0500599_000896 | Ga0500599_000896_1728_2978 | 369 |
| 28 | 3300005367 | Ga0070667_100044424 | Ga0070667_1000444242 | 372 |
| 29 | 3300005842 | Ga0068858_100100363 | Ga0068858_1001003632 | 372 |
| 30 | 3300006038 | Ga0075365_10042647 | Ga0075365_100426472 | 372 |
| 31 | 3300006353 | Ga0075370_10048373 | Ga0075370_100483732 | 372 |
| 32 | 3300013296 | Ga0157374_10045188 | Ga0157374_100451882 | 372 |
| 33 | 3300025315 | Ga0207697_10020133 | Ga0207697_100201332 | 372 |
| 34 | 3300025904 | Ga0207647_10012253 | Ga0207647_100122532 | 372 |
| 35 | 3300025931 | Ga0207644_10076454 | Ga0207644_100764542 | 372 |
| 36 | 3300025941 | Ga0207711_10052652 | Ga0207711_100526523 | 372 |
| 37 | 3300026116 | Ga0207674_10026551 | Ga0207674_100265512 | 372 |
| 38 | 3300046542 | Ga0495597_0027431 | Ga0495597_0027431_805_2091 | 372 |
| 39 | 3300047443 | Ga0495687_015363 | Ga0495687_015363_204_1490 | 372 |
| 40 | 3300048905 | Ga0496102_0127619 | Ga0496102_0127619_74_1360 | 372 |
| 41 | 3300048907 | Ga0496104_0011552 | Ga0496104_0011552_3459_4745 | 372 |
| 42 | 3300048908 | Ga0496105_0020055 | Ga0496105_0020055_3333_4619 | 372 |
| 43 | 3300048911 | Ga0496108_0026234 | Ga0496108_0026234_114_1400 | 372 |
| 44 | 3300048912 | Ga0496109_0063433 | Ga0496109_0063433_473_1759 | 372 |
| 45 | 3300048914 | Ga0496111_0046795 | Ga0496111_0046795_825_2111 | 372 |
| 46 | 3300048915 | Ga0496112_0173505 | Ga0496112_0173505_295_1581 | 372 |
| 47 | 3300048921 | Ga0496118_0058206 | Ga0496118_0058206_1280_2566 | 372 |
| 48 | 3300050495 | nmdc:mga04h51_20567_c1 | nmdc:mga04h51_20567_c1_181_1467 | 372 |
| 49 | 3300050496 | nmdc:mga07m45_9035_c1 | nmdc:mga07m45_9035_c1_67_1353 | 372 |
| 50 | 3300027296 | Ga0209389_1000248 | Ga0209389_100024820 | 373 |
| 51 | 3300027357 | Ga0209589_1001871 | Ga0209589_100187120 | 373 |
| 52 | 3300027361 | Ga0209489_102684 | Ga0209489_10268414 | 373 |
| 53 | 3300053105 | Ga0500557_000038 | Ga0500557_000038_64922_66235 | 373 |
| 54 | 3300050492 | nmdc:mga0yw44_11198_c1 | nmdc:mga0yw44_11198_c1_2527_3813 | 375 |
| 55 | 3300005455 | Ga0070663_100048939 | Ga0070663_1000489392 | 376 |
| 56 | 3300033544 | Ga0316215_1002488 | Ga0316215_10024882 | 376 |
| 57 | 3300036401 | Ga0373937_0004613 | Ga0373937_0004613_1916_3169 | 376 |
| 58 | 3300036459 | Ga0372808_002623 | Ga0372808_002623_658_1911 | 376 |
| 59 | 3300047472 | Ga0495686_0076338 | Ga0495686_0076338_505_1755 | 376 |
| 60 | 3300053119 | Ga0500595_003257 | Ga0500595_003257_5370_6626 | 376 |
| 61 | 3300005843 | Ga0068860_100002033 | Ga0068860_1000020336 | 377 |
| 62 | 3300028381 | Ga0268264_10000174 | Ga0268264_1000017487 | 377 |
| 63 | 3300053104 | Ga0500556_0034880 | Ga0500556_0034880_363_1622 | 377 |
| 64 | 3300006028 | Ga0070717_10205460 | Ga0070717_102054601 | 378 |
| 65 | 3300049583 | Ga0501067_0083105 | Ga0501067_0083105_253_1566 | 379 |
| 66 | iso_pu_bacteria | 8006973647 | 8006974848 | 379 |
| 67 | 3300005436 | Ga0070713_100003057 | Ga0070713_1000030578 | 380 |
| 68 | 3300025928 | Ga0207700_10011952 | Ga0207700_100119524 | 380 |
| 69 | 3300005937 | Ga0081455_10055334 | Ga0081455_100553342 | 381 |
| 70 | 3300033180 | Ga0307510_10165981 | Ga0307510_101659811 | 381 |
| 71 | 3300046459 | Ga0495629_0006402 | Ga0495629_0006402_5884_7128 | 381 |
| 72 | 3300046462 | Ga0495651_0142626 | Ga0495651_0142626_404_1648 | 381 |
| 73 | 3300046559 | Ga0495667_0109928 | Ga0495667_0109928_31_1275 | 381 |
| 74 | 3300046642 | Ga0495634_0112395 | Ga0495634_0112395_273_1517 | 381 |
| 75 | 3300046663 | Ga0495635_0011274 | Ga0495635_0011274_968_2212 | 381 |
| 76 | 3300046690 | Ga0495624_0100052 | Ga0495624_0100052_225_1469 | 381 |
| 77 | 3300048907 | Ga0496104_0023546 | Ga0496104_0023546_415_1659 | 381 |
| 78 | 3300048908 | Ga0496105_0014373 | Ga0496105_0014373_3955_5199 | 381 |
| 79 | 3300048923 | Ga0496120_0044095 | Ga0496120_0044095_964_2208 | 381 |
| 80 | 3300048924 | Ga0496121_0000406 | Ga0496121_0000406_1036_2295 | 381 |
| 81 | 3300025297 | Ga0209758_1008219 | Ga0209758_10082192 | 382 |
| 82 | 3300031711 | Ga0265314_10008977 | Ga0265314_100089774 | 382 |
| 83 | 3300031712 | Ga0265342_10049875 | Ga0265342_100498752 | 382 |
| 84 | 3300044684 | Ga0466966_0001614 | Ga0466966_0001614_6175_7422 | 382 |
| 85 | 3300044693 | Ga0466961_0000192 | Ga0466961_0000192_6678_7925 | 382 |
| 86 | 3300045049 | Ga0466959_0000934 | Ga0466959_0000934_6749_7996 | 382 |
| 87 | 3300048918 | Ga0496115_0238430 | Ga0496115_0238430_187_1431 | 382 |
| 88 | 3300053090 | Ga0500646_0022926 | Ga0500646_0022926_116_1369 | 385 |
| 89 | 3300035724 | Ga0373933_0000204 | Ga0373933_0000204_8421_9677 | 386 |
| 90 | 3300036401 | Ga0373937_0182159 | Ga0373937_0182159_345_1598 | 386 |
| 91 | 3300046462 | Ga0495651_0001839 | Ga0495651_0001839_5328_6581 | 386 |
| 92 | 3300046477 | Ga0495664_0022227 | Ga0495664_0022227_1239_2492 | 386 |
| 93 | 3300046507 | Ga0495606_0013192 | Ga0495606_0013192_2831_4111 | 386 |
| 94 | 3300046516 | Ga0495628_0062610 | Ga0495628_0062610_503_1756 | 386 |
| 95 | 3300046529 | Ga0495652_0033108 | Ga0495652_0033108_1520_2773 | 386 |
| 96 | 3300046536 | Ga0495587_0004468 | Ga0495587_0004468_1826_3079 | 386 |
| 97 | 3300046559 | Ga0495667_0004352 | Ga0495667_0004352_6278_7531 | 386 |
| 98 | 3300046675 | Ga0495657_0004591 | Ga0495657_0004591_3324_4577 | 386 |
| 99 | 3300046678 | Ga0495599_0005172 | Ga0495599_0005172_2904_4157 | 386 |
| 100 | 3300046679 | Ga0495623_0029120 | Ga0495623_0029120_485_1738 | 386 |
| 101 | 3300046680 | Ga0495646_0078288 | Ga0495646_0078288_335_1588 | 386 |
| 102 | 3300047317 | Ga0495604_0007215 | Ga0495604_0007215_6230_7483 | 386 |
| 103 | 3300047319 | Ga0495674_0011929 | Ga0495674_0011929_5772_7025 | 386 |
| 104 | 3300047322 | Ga0495680_0001654 | Ga0495680_0001654_7246_8499 | 386 |
| 105 | 3300048088 | Ga0495602_0009939 | Ga0495602_0009939_1270_2523 | 386 |
| 106 | 3300050516 | nmdc:mga0sz30_4359_c1 | nmdc:mga0sz30_4359_c1_2297_3547 | 386 |
| 107 | 3300053121 | Ga0500607_017019 | Ga0500607_017019_243_1493 | 386 |
| 108 | 3300053136 | Ga0500559_0030442 | Ga0500559_0030442_227_1477 | 386 |
| 109 | 3300053177 | Ga0500636_0000762 | Ga0500636_0000762_4123_5376 | 386 |
| 110 | 3300003354 | JGI25160J50197_1012133 | JGI25160J50197_10121332 | 387 |
| 111 | 3300025295 | Ga0209564_1009894 | Ga0209564_10098944 | 387 |
| 112 | 3300025297 | Ga0209758_1000986 | Ga0209758_100098611 | 387 |
| 113 | 3300025302 | Ga0207426_1000632 | Ga0207426_100063213 | 387 |
| 114 | 3300025304 | Ga0209257_1023187 | Ga0209257_10231871 | 387 |
| 115 | 3300037068 | Ga0373925_0124477 | Ga0373925_0124477_14_1213 | 387 |
| 116 | 3300039437 | Ga0436365_1439813 | Ga0436365_1439813_21454_22671 | 387 |
| 117 | 3300039450 | Ga0436363_0832891 | Ga0436363_0832891_35_1285 | 387 |
| 118 | 3300047320 | Ga0495672_0067517 | Ga0495672_0067517_327_1553 | 387 |
| 119 | 3300048905 | Ga0496102_0162647 | Ga0496102_0162647_849_2078 | 387 |
| 120 | 3300048916 | Ga0496113_0093176 | Ga0496113_0093176_382_1611 | 387 |
| 121 | 3300048929 | Ga0496126_0000849 | Ga0496126_0000849_33973_35175 | 387 |
| 122 | 3300050490 | nmdc:mga03n38_36837_c1 | nmdc:mga03n38_36837_c1_276_1505 | 387 |
| 123 | 3300050494 | nmdc:mga06z11_714_c1 | nmdc:mga06z11_714_c1_4232_5461 | 387 |
| 124 | 3300053083 | Ga0495655_0003480 | Ga0495655_0003480_439_1725 | 387 |
| 125 | iso_pu_bacteria | 2935769743 | 2935776637 | 387 |
| 126 | iso_pu_bacteria | 2935777560 | 2935781530 | 387 |
| 127 | iso_pu_bacteria | 2935785616 | 2935789848 | 387 |
| 128 | iso_pu_bacteria | 2935793552 | 2935798386 | 387 |
| 129 | iso_pu_bacteria | 8016603502 | 8016607851 | 387 |
| 130 | iso_pu_bacteria | 8016613128 | 8016619634 | 387 |
| 131 | iso_pu_bacteria | 8019538911 | 8019541880 | 387 |
| 132 | 3300005614 | Ga0068856_100004436 | Ga0068856_10000443614 | 388 |
| 133 | 3300009094 | Ga0111539_10035547 | Ga0111539_100355472 | 388 |
| 134 | 3300009094 | Ga0111539_10398983 | Ga0111539_103989831 | 388 |
| 135 | 3300025914 | Ga0207671_10014288 | Ga0207671_100142885 | 388 |
| 136 | 3300026078 | Ga0207702_10000758 | Ga0207702_1000075814 | 388 |
| 137 | 3300035086 | Ga0373934_0023120 | Ga0373934_0023120_199_1455 | 388 |
| 138 | 3300035118 | Ga0373954_0012233 | Ga0373954_0012233_1572_2828 | 388 |
| 139 | 3300035119 | Ga0373956_0014888 | Ga0373956_0014888_1941_3197 | 388 |
| 140 | 3300035120 | Ga0373957_0008299 | Ga0373957_0008299_1858_3114 | 388 |
| 141 | 3300035172 | Ga0373955_0019272 | Ga0373955_0019272_908_2164 | 388 |
| 142 | 3300035410 | Ga0373924_0027599 | Ga0373924_0027599_282_1538 | 388 |
| 143 | 3300037466 | Ga0395898_0008444 | Ga0395898_0008444_4510_5751 | 388 |
| 144 | 3300039437 | Ga0436365_0488786 | Ga0436365_0488786_1543_2784 | 388 |
| 145 | 3300046454 | Ga0495592_0020497 | Ga0495592_0020497_1809_3065 | 388 |
| 146 | 3300046462 | Ga0495651_0045340 | Ga0495651_0045340_1908_3164 | 388 |
| 147 | 3300046463 | Ga0495653_0067979 | Ga0495653_0067979_1372_2628 | 388 |
| 148 | 3300046511 | Ga0495608_0038423 | Ga0495608_0038423_1324_2580 | 388 |
| 149 | 3300046516 | Ga0495628_0009352 | Ga0495628_0009352_3914_5170 | 388 |
| 150 | 3300046529 | Ga0495652_0094059 | Ga0495652_0094059_722_1978 | 388 |
| 151 | 3300046533 | Ga0495640_0040562 | Ga0495640_0040562_1949_3205 | 388 |
| 152 | 3300046535 | Ga0495586_0048634 | Ga0495586_0048634_146_1402 | 388 |
| 153 | 3300046543 | Ga0495645_0027524 | Ga0495645_0027524_1417_2673 | 388 |
| 154 | 3300046642 | Ga0495634_0032036 | Ga0495634_0032036_1104_2360 | 388 |
| 155 | 3300046675 | Ga0495657_0061694 | Ga0495657_0061694_954_2210 | 388 |
| 156 | 3300046678 | Ga0495599_0107887 | Ga0495599_0107887_282_1538 | 388 |
| 157 | 3300046679 | Ga0495623_0012014 | Ga0495623_0012014_4302_5558 | 388 |
| 158 | 3300046680 | Ga0495646_0011553 | Ga0495646_0011553_3499_4755 | 388 |
| 159 | 3300047317 | Ga0495604_0012818 | Ga0495604_0012818_23_1279 | 388 |
| 160 | 3300047322 | Ga0495680_0056996 | Ga0495680_0056996_1630_2886 | 388 |
| 161 | 3300047444 | Ga0495675_0023366 | Ga0495675_0023366_62_1318 | 388 |
| 162 | 3300047471 | Ga0495684_0131744 | Ga0495684_0131744_341_1597 | 388 |
| 163 | 3300048088 | Ga0495602_0075159 | Ga0495602_0075159_1250_2506 | 388 |
| 164 | 3300048909 | Ga0496106_0006865 | Ga0496106_0006865_405_1655 | 388 |
| 165 | 3300050511 | nmdc:mga08y16_83157_c1 | nmdc:mga08y16_83157_c1_1523_2728 | 388 |
| 166 | 3300050512 | nmdc:mga0n895_345783_c1 | nmdc:mga0n895_345783_c1_113_1318 | 388 |
| 167 | 3300053077 | Ga0495601_0037471 | Ga0495601_0037471_882_2138 | 388 |
| 168 | 3300003215 | JGI25153J46596_10001826 | JGI25153J46596_1000182610 | 389 |
| 169 | 3300005339 | Ga0070660_100034673 | Ga0070660_1000346732 | 389 |
| 170 | 3300005563 | Ga0068855_100117585 | Ga0068855_1001175852 | 389 |
| 171 | 3300005614 | Ga0068856_100202460 | Ga0068856_1002024602 | 389 |
| 172 | 3300025297 | Ga0209758_1001737 | Ga0209758_100173712 | 389 |
| 173 | 3300025919 | Ga0207657_10055057 | Ga0207657_100550573 | 389 |
| 174 | 3300025949 | Ga0207667_10196100 | Ga0207667_101961002 | 389 |
| 175 | 3300026142 | Ga0207698_10230349 | Ga0207698_102303492 | 389 |
| 176 | 3300037471 | Ga0395905_0146839 | Ga0395905_0146839_836_2095 | 389 |
| 177 | 3300037853 | Ga0436364_0787494 | Ga0436364_0787494_1326_2570 | 389 |
| 178 | iso_pu_bacteria | 2513237096 | 2513656139 | 389 |
| 179 | iso_pu_bacteria | 2513237137 | 2513859035 | 389 |
| 180 | iso_pu_bacteria | 2513237145 | 2513920852 | 389 |
| 181 | iso_pu_bacteria | 2517572143 | 2517895957 | 389 |
| 182 | iso_pu_bacteria | 2728368998 | 2728752348 | 389 |
| 183 | iso_pu_bacteria | 2791355197 | 2793069613 | 389 |
| 184 | iso_pu_bacteria | 2885374607 | 2885382984 | 389 |
| 185 | iso_pu_bacteria | 2904699407 | 2904707109 | 389 |
| 186 | iso_pu_bacteria | 2906635258 | 2906642021 | 389 |
| 187 | iso_pu_bacteria | 2906660503 | 2906665007 | 389 |
| 188 | iso_pu_bacteria | 2908739725 | 2908745606 | 389 |
| 189 | iso_pu_bacteria | 2922425934 | 2922432431 | 389 |
| 190 | iso_pu_bacteria | 2935630451 | 2935630754 | 389 |
| 191 | iso_pu_bacteria | 2941507105 | 2941507406 | 389 |
| 192 | iso_pu_bacteria | 2941515067 | 2941515833 | 389 |
| 193 | iso_pu_bacteria | 2941523033 | 2941523459 | 389 |
| 194 | iso_pu_bacteria | 8019555841 | 8019563779 | 389 |
| 195 | iso_pu_bacteria | 8019565922 | 8019573844 | 389 |
| 196 | 3300005329 | Ga0070683_100014616 | Ga0070683_1000146165 | 390 |
| 197 | 3300005336 | Ga0070680_100015059 | Ga0070680_1000150594 | 390 |
| 198 | 3300005337 | Ga0070682_100097116 | Ga0070682_1000971161 | 390 |
| 199 | 3300005458 | Ga0070681_10031485 | Ga0070681_100314852 | 390 |
| 200 | 3300005458 | Ga0070681_10117395 | Ga0070681_101173952 | 390 |
| 201 | 3300005530 | Ga0070679_100009249 | Ga0070679_1000092498 | 390 |
| 202 | 3300005535 | Ga0070684_100008556 | Ga0070684_1000085568 | 390 |
| 203 | 3300005577 | Ga0068857_100155307 | Ga0068857_1001553072 | 390 |
| 204 | 3300007788 | Ga0099795_10016452 | Ga0099795_100164522 | 390 |
| 205 | 3300009093 | Ga0105240_10108155 | Ga0105240_101081552 | 390 |
| 206 | 3300009174 | Ga0105241_10134404 | Ga0105241_101344042 | 390 |
| 207 | 3300025911 | Ga0207654_10041635 | Ga0207654_100416352 | 390 |
| 208 | 3300025912 | Ga0207707_10001541 | Ga0207707_1000154112 | 390 |
| 209 | 3300025912 | Ga0207707_10089328 | Ga0207707_100893282 | 390 |
| 210 | 3300025913 | Ga0207695_10077656 | Ga0207695_100776562 | 390 |
| 211 | 3300025917 | Ga0207660_10033682 | Ga0207660_100336822 | 390 |
| 212 | 3300025921 | Ga0207652_10016519 | Ga0207652_100165193 | 390 |
| 213 | 3300025921 | Ga0207652_10024907 | Ga0207652_100249073 | 390 |
| 214 | 3300025944 | Ga0207661_10011823 | Ga0207661_100118235 | 390 |
| 215 | 3300037418 | Ga0395900_0076163 | Ga0395900_0076163_286_1491 | 390 |
| 216 | 3300038443 | Ga0395901_0066938 | Ga0395901_0066938_1787_2992 | 390 |
| 217 | iso_pu_bacteria | 2507262055 | 2507511871 | 390 |
| 218 | iso_pu_bacteria | 2508501009 | 2508545535 | 390 |
| 219 | iso_pu_bacteria | 2508501042 | 2508694353 | 390 |
| 220 | iso_pu_bacteria | 2511231028 | 2511396664 | 390 |
| 221 | iso_pu_bacteria | 2513237095 | 2513651100 | 390 |
| 222 | iso_pu_bacteria | 2513237098 | 2513673492 | 390 |
| 223 | iso_pu_bacteria | 2513237101 | 2513696318 | 390 |
| 224 | iso_pu_bacteria | 2513237102 | 2513703536 | 390 |
| 225 | iso_pu_bacteria | 2513237104 | 2513717798 | 390 |
| 226 | iso_pu_bacteria | 2513237141 | 2513887720 | 390 |
| 227 | iso_pu_bacteria | 2517093001 | 2517108567 | 390 |
| 228 | iso_pu_bacteria | 2524023210 | 2524467513 | 390 |
| 229 | iso_pu_bacteria | 2528768022 | 2528854950 | 390 |
| 230 | iso_pu_bacteria | 2617270735 | 2617349624 | 390 |
| 231 | iso_pu_bacteria | 2617270741 | 2617376810 | 390 |
| 232 | iso_pu_bacteria | 2721755755 | 2723842815 | 390 |
| 233 | iso_pu_bacteria | 2791355199 | 2793080284 | 390 |
| 234 | iso_pu_bacteria | 2816332527 | 2818242184 | 390 |
| 235 | iso_pu_bacteria | 2824600985 | 2824608010 | 390 |
| 236 | iso_pu_bacteria | 2824609381 | 2824615050 | 390 |
| 237 | iso_pu_bacteria | 2824617872 | 2824624844 | 390 |
| 238 | iso_pu_bacteria | 2824626560 | 2824633750 | 390 |
| 239 | iso_pu_bacteria | 2824635225 | 2824642313 | 390 |
| 240 | iso_pu_bacteria | 2824644064 | 2824649641 | 390 |
| 241 | iso_pu_bacteria | 2824653114 | 2824659524 | 390 |
| 242 | iso_pu_bacteria | 2824661429 | 2824670052 | 390 |
| 243 | iso_pu_bacteria | 2824671348 | 2824676709 | 390 |
| 244 | iso_pu_bacteria | 2824679649 | 2824686164 | 390 |
| 245 | iso_pu_bacteria | 2824687955 | 2824692990 | 390 |
| 246 | iso_pu_bacteria | 2824696289 | 2824702585 | 390 |
| 247 | iso_pu_bacteria | 2824704595 | 2824711458 | 390 |
| 248 | iso_pu_bacteria | 2824714736 | 2824719743 | 390 |
| 249 | iso_pu_bacteria | 2824723954 | 2824730046 | 390 |
| 250 | iso_pu_bacteria | 2824732956 | 2824738287 | 390 |
| 251 | iso_pu_bacteria | 2824746037 | 2824751736 | 390 |
| 252 | iso_pu_bacteria | 2824753945 | 2824762968 | 390 |
| 253 | iso_pu_bacteria | 2824763712 | 2824772963 | 390 |
| 254 | iso_pu_bacteria | 2824773399 | 2824776996 | 390 |
| 255 | iso_pu_bacteria | 2838122688 | 2838128386 | 390 |
| 256 | iso_pu_bacteria | 2841941048 | 2841942246 | 390 |
| 257 | iso_pu_bacteria | 2841949485 | 2841955624 | 390 |
| 258 | iso_pu_bacteria | 2841957949 | 2841963521 | 390 |
| 259 | iso_pu_bacteria | 2841966195 | 2841971233 | 390 |
| 260 | iso_pu_bacteria | 2841974524 | 2841982353 | 390 |
| 261 | iso_pu_bacteria | 2841983080 | 2841984260 | 390 |
| 262 | iso_pu_bacteria | 2842038055 | 2842042008 | 390 |
| 263 | iso_pu_bacteria | 2842045827 | 2842050051 | 390 |
| 264 | iso_pu_bacteria | 2844315083 | 2844321088 | 390 |
| 265 | iso_pu_bacteria | 2847939898 | 2847943546 | 390 |
| 266 | iso_pu_bacteria | 2849076700 | 2849077268 | 390 |
| 267 | iso_pu_bacteria | 2874604998 | 2874606512 | 390 |
| 268 | iso_pu_bacteria | 2874620515 | 2874624004 | 390 |
| 269 | iso_pu_bacteria | 2874628541 | 2874630988 | 390 |
| 270 | iso_pu_bacteria | 2874645413 | 2874647367 | 390 |
| 271 | iso_pu_bacteria | 2876761206 | 2876767409 | 390 |
| 272 | iso_pu_bacteria | 2876771140 | 2876774778 | 390 |
| 273 | iso_pu_bacteria | 2876808645 | 2876809823 | 390 |
| 274 | iso_pu_bacteria | 2876818435 | 2876819731 | 390 |
| 275 | iso_pu_bacteria | 2879074833 | 2879079346 | 390 |
| 276 | iso_pu_bacteria | 2879099564 | 2879101404 | 390 |
| 277 | iso_pu_bacteria | 2879110137 | 2879113768 | 390 |
| 278 | iso_pu_bacteria | 2879127579 | 2879129080 | 390 |
| 279 | iso_pu_bacteria | 2879142872 | 2879144765 | 390 |
| 280 | iso_pu_bacteria | 2881364244 | 2881371135 | 390 |
| 281 | iso_pu_bacteria | 2881665667 | 2881673233 | 390 |
| 282 | iso_pu_bacteria | 2885366525 | 2885374065 | 390 |
| 283 | iso_pu_bacteria | 2885409591 | 2885412853 | 390 |
| 284 | iso_pu_bacteria | 2888378607 | 2888387381 | 390 |
| 285 | iso_pu_bacteria | 2888388044 | 2888391822 | 390 |
| 286 | iso_pu_bacteria | 2888419890 | 2888426602 | 390 |
| 287 | iso_pu_bacteria | 2889033259 | 2889033858 | 390 |
| 288 | iso_pu_bacteria | 2903727486 | 2903728511 | 390 |
| 289 | iso_pu_bacteria | 2904666416 | 2904670715 | 390 |
| 290 | iso_pu_bacteria | 2904711408 | 2904718957 | 390 |
| 291 | iso_pu_bacteria | 2906602504 | 2906607703 | 390 |
| 292 | iso_pu_bacteria | 2906626472 | 2906629322 | 390 |
| 293 | iso_pu_bacteria | 2908775508 | 2908782708 | 390 |
| 294 | iso_pu_bacteria | 2922361189 | 2922367281 | 390 |
| 295 | iso_pu_bacteria | 2922368715 | 2922370564 | 390 |
| 296 | iso_pu_bacteria | 2922386360 | 2922390015 | 390 |
| 297 | iso_pu_bacteria | 2922393267 | 2922396435 | 390 |
| 298 | iso_pu_bacteria | 2929615660 | 2929620140 | 390 |
| 299 | iso_pu_bacteria | 2929624759 | 2929629453 | 390 |
| 300 | iso_pu_bacteria | 2932784394 | 2932791495 | 390 |
| 301 | iso_pu_bacteria | 2932794094 | 2932796898 | 390 |
| 302 | iso_pu_bacteria | 2932801729 | 2932802324 | 390 |
| 303 | iso_pu_bacteria | 2932809354 | 2932816751 | 390 |
| 304 | iso_pu_bacteria | 2932818245 | 2932824067 | 390 |
| 305 | iso_pu_bacteria | 2932828146 | 2932835397 | 390 |
| 306 | iso_pu_bacteria | 2935616580 | 2935621140 | 390 |
| 307 | iso_pu_bacteria | 2935638405 | 2935643553 | 390 |
| 308 | iso_pu_bacteria | 2935648319 | 2935650482 | 390 |
| 309 | iso_pu_bacteria | 2935656913 | 2935662924 | 390 |
| 310 | iso_pu_bacteria | 2935665750 | 2935671137 | 390 |
| 311 | iso_pu_bacteria | 2935675223 | 2935681257 | 390 |
| 312 | iso_pu_bacteria | 2935684952 | 2935689400 | 390 |
| 313 | iso_pu_bacteria | 2935694250 | 2935699975 | 390 |
| 314 | iso_pu_bacteria | 2935703347 | 2935712094 | 390 |
| 315 | iso_pu_bacteria | 2935713505 | 2935720346 | 390 |
| 316 | iso_pu_bacteria | 2935722832 | 2935728037 | 390 |
| 317 | iso_pu_bacteria | 2935732158 | 2935737366 | 390 |
| 318 | iso_pu_bacteria | 2935741537 | 2935746573 | 390 |
| 319 | iso_pu_bacteria | 2935750917 | 2935757540 | 390 |
| 320 | iso_pu_bacteria | 2935760218 | 2935763917 | 390 |
| 321 | iso_pu_bacteria | 2935801545 | 2935807894 | 390 |
| 322 | iso_pu_bacteria | 2935810662 | 2935818772 | 390 |
| 323 | iso_pu_bacteria | 2935827899 | 2935833070 | 390 |
| 324 | iso_pu_bacteria | 2935837841 | 2935844274 | 390 |
| 325 | iso_pu_bacteria | 2935855204 | 2935859667 | 390 |
| 326 | iso_pu_bacteria | 2935864058 | 2935872065 | 390 |
| 327 | iso_pu_bacteria | 2935873716 | 2935879011 | 390 |
| 328 | iso_pu_bacteria | 2935883170 | 2935887236 | 390 |
| 329 | iso_pu_bacteria | 2935959822 | 2935965614 | 390 |
| 330 | iso_pu_bacteria | 2935975950 | 2935982045 | 390 |
| 331 | iso_pu_bacteria | 2935984226 | 2935990616 | 390 |
| 332 | iso_pu_bacteria | 2935992306 | 2936000358 | 390 |
| 333 | iso_pu_bacteria | 2936002035 | 2936008516 | 390 |
| 334 | iso_pu_bacteria | 2936011229 | 2936017162 | 390 |
| 335 | iso_pu_bacteria | 2936019824 | 2936026703 | 390 |
| 336 | iso_pu_bacteria | 2936028420 | 2936035446 | 390 |
| 337 | iso_pu_bacteria | 2936037263 | 2936045582 | 390 |
| 338 | iso_pu_bacteria | 2936046547 | 2936053595 | 390 |
| 339 | iso_pu_bacteria | 2936055302 | 2936062673 | 390 |
| 340 | iso_pu_bacteria | 2940556831 | 2940563638 | 390 |
| 341 | iso_pu_bacteria | 2941531003 | 2941537264 | 390 |
| 342 | iso_pu_bacteria | 2941538514 | 2941542606 | 390 |
| 343 | iso_pu_bacteria | 3005483717 | 3005490191 | 390 |
| 344 | iso_pu_bacteria | 3005506211 | 3005506911 | 390 |
| 345 | iso_pu_bacteria | 3005587118 | 3005591718 | 390 |
| 346 | iso_pu_bacteria | 3005594810 | 3005601427 | 390 |
| 347 | iso_pu_bacteria | 3005718088 | 3005724121 | 390 |
| 348 | iso_pu_bacteria | 8006964411 | 8006966131 | 390 |
| 349 | iso_pu_bacteria | 8006984368 | 8006989700 | 390 |
| 350 | iso_pu_bacteria | 8006994254 | 8006998093 | 390 |
| 351 | iso_pu_bacteria | 8016511872 | 8016519494 | 390 |
| 352 | iso_pu_bacteria | 8016522445 | 8016524861 | 390 |
| 353 | iso_pu_bacteria | 8016539877 | 8016542719 | 390 |
| 354 | iso_pu_bacteria | 8016548790 | 8016550562 | 390 |
| 355 | iso_pu_bacteria | 8016566248 | 8016568103 | 390 |
| 356 | iso_pu_bacteria | 8016575299 | 8016580779 | 390 |
| 357 | iso_pu_bacteria | 8016595262 | 8016596943 | 390 |
| 358 | iso_pu_bacteria | 8016622563 | 8016629974 | 390 |
| 359 | iso_pu_bacteria | 8016630954 | 8016637192 | 390 |
| 360 | iso_pu_bacteria | 8017057580 | 8017066028 | 390 |
| 361 | iso_pu_bacteria | 8019547302 | 8019548918 | 390 |
| 362 | iso_pu_bacteria | 8019576017 | 8019578604 | 390 |
| 363 | iso_pu_bacteria | 8019586578 | 8019596654 | 390 |
| 364 | iso_pu_bacteria | 8019597564 | 8019605049 | 390 |
| 365 | iso_pu_bacteria | 8019608314 | 8019613486 | 390 |
| 366 | iso_pu_bacteria | 8019619141 | 8019624156 | 390 |
| 367 | iso_pu_bacteria | 8019629233 | 8019637870 | 390 |
| 368 | iso_pu_bacteria | 8019638758 | 8019641753 | 390 |
| 369 | iso_pu_bacteria | 8019648815 | 8019653676 | 390 |
| 370 | iso_pu_bacteria | 8019659431 | 8019665800 | 390 |
| 371 | iso_pu_bacteria | 8019668869 | 8019675326 | 390 |
| 372 | iso_pu_bacteria | 8019678201 | 8019680779 | 390 |
| 373 | iso_pu_bacteria | 8056967851 | 8056975886 | 390 |
| 374 | 3300036401 | Ga0373937_0019760 | Ga0373937_0019760_1870_3114 | 391 |
| 375 | 3300046543 | Ga0495645_0086668 | Ga0495645_0086668_944_2194 | 391 |
| 376 | 3300049581 | Ga0501047_0071264 | Ga0501047_0071264_540_1790 | 391 |
| 377 | 3300049586 | Ga0501070_0012988 | Ga0501070_0012988_2624_3874 | 391 |
| 378 | 3300049589 | Ga0501073_0065004 | Ga0501073_0065004_1252_2502 | 391 |
| 379 | 3300049742 | Ga0501080_0002767 | Ga0501080_0002767_3959_5209 | 391 |
| 380 | 3300049823 | Ga0501044_0246961 | Ga0501044_0246961_50_1300 | 391 |
| 381 | 3300013104 | Ga0157370_10144768 | Ga0157370_101447682 | 392 |
| 382 | 3300013105 | Ga0157369_10048074 | Ga0157369_100480742 | 392 |
| 383 | 3300025898 | Ga0207692_10009404 | Ga0207692_100094044 | 392 |
| 384 | 3300025906 | Ga0207699_10001069 | Ga0207699_100010698 | 392 |
| 385 | 3300025915 | Ga0207693_10008187 | Ga0207693_100081877 | 392 |
| 386 | 3300025916 | Ga0207663_10005579 | Ga0207663_100055794 | 392 |
| 387 | 3300031235 | Ga0265330_10035657 | Ga0265330_100356572 | 392 |
| 388 | 3300031247 | Ga0265340_10003101 | Ga0265340_100031017 | 392 |
| 389 | 3300031712 | Ga0265342_10094168 | Ga0265342_100941681 | 392 |
| 390 | 3300035086 | Ga0373934_0008383 | Ga0373934_0008383_2529_3791 | 392 |
| 391 | 3300035111 | Ga0373923_0001005 | Ga0373923_0001005_775_2037 | 392 |
| 392 | 3300035117 | Ga0373953_0000415 | Ga0373953_0000415_2857_4119 | 392 |
| 393 | 3300035118 | Ga0373954_0004190 | Ga0373954_0004190_2322_3584 | 392 |
| 394 | 3300035119 | Ga0373956_0001481 | Ga0373956_0001481_1059_2321 | 392 |
| 395 | 3300035172 | Ga0373955_0002049 | Ga0373955_0002049_5747_7009 | 392 |
| 396 | 3300035724 | Ga0373933_0004702 | Ga0373933_0004702_1060_2322 | 392 |
| 397 | 3300036401 | Ga0373937_0008188 | Ga0373937_0008188_7602_8864 | 392 |
| 398 | 3300038443 | Ga0395901_0015903 | Ga0395901_0015903_877_2130 | 392 |
| 399 | 3300046454 | Ga0495592_0008971 | Ga0495592_0008971_1943_3205 | 392 |
| 400 | 3300046459 | Ga0495629_0004778 | Ga0495629_0004778_2722_3984 | 392 |
| 401 | 3300046462 | Ga0495651_0016963 | Ga0495651_0016963_1653_2915 | 392 |
| 402 | 3300046463 | Ga0495653_0009797 | Ga0495653_0009797_5766_7028 | 392 |
| 403 | 3300046511 | Ga0495608_0004649 | Ga0495608_0004649_5952_7214 | 392 |
| 404 | 3300046514 | Ga0495618_0050333 | Ga0495618_0050333_788_2050 | 392 |
| 405 | 3300046529 | Ga0495652_0088520 | Ga0495652_0088520_931_2193 | 392 |
| 406 | 3300046536 | Ga0495587_0032943 | Ga0495587_0032943_808_2070 | 392 |
| 407 | 3300046543 | Ga0495645_0006792 | Ga0495645_0006792_592_1854 | 392 |
| 408 | 3300046559 | Ga0495667_0034624 | Ga0495667_0034624_680_1942 | 392 |
| 409 | 3300046642 | Ga0495634_0001493 | Ga0495634_0001493_18519_19781 | 392 |
| 410 | 3300046663 | Ga0495635_0004810 | Ga0495635_0004810_2725_3987 | 392 |
| 411 | 3300046675 | Ga0495657_0003079 | Ga0495657_0003079_4680_5942 | 392 |
| 412 | 3300046678 | Ga0495599_0001945 | Ga0495599_0001945_6027_7289 | 392 |
| 413 | 3300046679 | Ga0495623_0005899 | Ga0495623_0005899_931_2193 | 392 |
| 414 | 3300046680 | Ga0495646_0001642 | Ga0495646_0001642_5269_6531 | 392 |
| 415 | 3300046809 | Ga0495600_0003270 | Ga0495600_0003270_931_2193 | 392 |
| 416 | 3300047317 | Ga0495604_0007221 | Ga0495604_0007221_680_1942 | 392 |
| 417 | 3300047319 | Ga0495674_0119907 | Ga0495674_0119907_734_1996 | 392 |
| 418 | 3300047322 | Ga0495680_0025270 | Ga0495680_0025270_931_2193 | 392 |
| 419 | 3300047444 | Ga0495675_0041984 | Ga0495675_0041984_1435_2697 | 392 |
| 420 | 3300047471 | Ga0495684_0001399 | Ga0495684_0001399_10397_11659 | 392 |
| 421 | 3300047673 | Ga0495593_0004938 | Ga0495593_0004938_6426_7688 | 392 |
| 422 | 3300048088 | Ga0495602_0031141 | Ga0495602_0031141_2726_3988 | 392 |
| 423 | 3300048928 | Ga0496125_0000158 | Ga0496125_0000158_111289_112569 | 392 |
| 424 | 3300049822 | Ga0501035_0207447 | Ga0501035_0207447_127_1374 | 392 |
| 425 | 3300053084 | Ga0495595_0000637 | Ga0495595_0000637_5915_7177 | 392 |
| 426 | 3300053085 | Ga0495619_0001080 | Ga0495619_0001080_808_2070 | 392 |
| 427 | 3300005329 | Ga0070683_100030271 | Ga0070683_1000302711 | 393 |
| 428 | 3300005355 | Ga0070671_100068590 | Ga0070671_1000685902 | 393 |
| 429 | 3300005577 | Ga0068857_100034471 | Ga0068857_1000344714 | 393 |
| 430 | 3300009545 | Ga0105237_10286844 | Ga0105237_102868442 | 393 |
| 431 | 3300049575 | Ga0501039_0087726 | Ga0501039_0087726_656_1903 | 393 |
| 432 | 3300053094 | Ga0500566_0021179 | Ga0500566_0021179_1305_2564 | 393 |
| 433 | 3300053119 | Ga0500595_000842 | Ga0500595_000842_15977_17236 | 393 |
| 434 | 3300053162 | Ga0500638_001609 | Ga0500638_001609_31_1290 | 393 |
| 435 | 3300053178 | Ga0500637_0000251 | Ga0500637_0000251_16001_17260 | 393 |
| 436 | 3300055283 | Ga0500661_003392 | Ga0500661_003392_472_1731 | 393 |
| 437 | 3300060353 | Ga0501082_0173716 | Ga0501082_0173716_193_1479 | 393 |
| 438 | iso_pu_bacteria | 2524023205 | 2524438313 | 393 |
| 439 | iso_pu_bacteria | 2744054633 | 2745078541 | 393 |
| 440 | 3300003203 | JGI25406J46586_10011327 | JGI25406J46586_100113273 | 394 |
| 441 | 3300005329 | Ga0070683_100028855 | Ga0070683_1000288552 | 394 |
| 442 | 3300005334 | Ga0068869_100048784 | Ga0068869_1000487842 | 394 |
| 443 | 3300005334 | Ga0068869_100118836 | Ga0068869_1001188362 | 394 |
| 444 | 3300005336 | Ga0070680_100265806 | Ga0070680_1002658061 | 394 |
| 445 | 3300005337 | Ga0070682_100204237 | Ga0070682_1002042371 | 394 |
| 446 | 3300005339 | Ga0070660_100065521 | Ga0070660_1000655212 | 394 |
| 447 | 3300005341 | Ga0070691_10025478 | Ga0070691_100254782 | 394 |
| 448 | 3300005347 | Ga0070668_100031147 | Ga0070668_1000311473 | 394 |
| 449 | 3300005347 | Ga0070668_100118162 | Ga0070668_1001181621 | 394 |
| 450 | 3300005353 | Ga0070669_100033219 | Ga0070669_1000332192 | 394 |
| 451 | 3300005355 | Ga0070671_100075345 | Ga0070671_1000753452 | 394 |
| 452 | 3300005356 | Ga0070674_100008657 | Ga0070674_1000086572 | 394 |
| 453 | 3300005356 | Ga0070674_100065540 | Ga0070674_1000655402 | 394 |
| 454 | 3300005366 | Ga0070659_100026378 | Ga0070659_1000263782 | 394 |
| 455 | 3300005366 | Ga0070659_100127078 | Ga0070659_1001270782 | 394 |
| 456 | 3300005367 | Ga0070667_100171521 | Ga0070667_1001715212 | 394 |
| 457 | 3300005434 | Ga0070709_10002262 | Ga0070709_100022628 | 394 |
| 458 | 3300005435 | Ga0070714_100011322 | Ga0070714_1000113224 | 394 |
| 459 | 3300005436 | Ga0070713_100013210 | Ga0070713_1000132104 | 394 |
| 460 | 3300005436 | Ga0070713_100060660 | Ga0070713_1000606602 | 394 |
| 461 | 3300005437 | Ga0070710_10023090 | Ga0070710_100230902 | 394 |
| 462 | 3300005439 | Ga0070711_100030272 | Ga0070711_1000302722 | 394 |
| 463 | 3300005444 | Ga0070694_100098788 | Ga0070694_1000987882 | 394 |
| 464 | 3300005455 | Ga0070663_100163359 | Ga0070663_1001633591 | 394 |
| 465 | 3300005456 | Ga0070678_100137012 | Ga0070678_1001370121 | 394 |
| 466 | 3300005456 | Ga0070678_100169963 | Ga0070678_1001699631 | 394 |
| 467 | 3300005457 | Ga0070662_100064814 | Ga0070662_1000648142 | 394 |
| 468 | 3300005457 | Ga0070662_100073964 | Ga0070662_1000739642 | 394 |
| 469 | 3300005458 | Ga0070681_10067186 | Ga0070681_100671862 | 394 |
| 470 | 3300005471 | Ga0070698_100103345 | Ga0070698_1001033452 | 394 |
| 471 | 3300005535 | Ga0070684_100013708 | Ga0070684_1000137084 | 394 |
| 472 | 3300005536 | Ga0070697_100015893 | Ga0070697_1000158934 | 394 |
| 473 | 3300005539 | Ga0068853_100002207 | Ga0068853_1000022073 | 394 |
| 474 | 3300005539 | Ga0068853_100030556 | Ga0068853_1000305565 | 394 |
| 475 | 3300005548 | Ga0070665_100073740 | Ga0070665_1000737403 | 394 |
| 476 | 3300005548 | Ga0070665_100089381 | Ga0070665_1000893812 | 394 |
| 477 | 3300005563 | Ga0068855_100192942 | Ga0068855_1001929422 | 394 |
| 478 | 3300005563 | Ga0068855_100284371 | Ga0068855_1002843712 | 394 |
| 479 | 3300005616 | Ga0068852_100107521 | Ga0068852_1001075212 | 394 |
| 480 | 3300005719 | Ga0068861_100107403 | Ga0068861_1001074032 | 394 |
| 481 | 3300005834 | Ga0068851_10015046 | Ga0068851_100150462 | 394 |
| 482 | 3300005937 | Ga0081455_10004676 | Ga0081455_100046765 | 394 |
| 483 | 3300005937 | Ga0081455_10023105 | Ga0081455_100231052 | 394 |
| 484 | 3300005937 | Ga0081455_10042566 | Ga0081455_100425662 | 394 |
| 485 | 3300005937 | Ga0081455_10105146 | Ga0081455_101051461 | 394 |
| 486 | 3300005983 | Ga0081540_1005189 | Ga0081540_10051897 | 394 |
| 487 | 3300005983 | Ga0081540_1007118 | Ga0081540_10071188 | 394 |
| 488 | 3300005983 | Ga0081540_1008316 | Ga0081540_10083168 | 394 |
| 489 | 3300005983 | Ga0081540_1009524 | Ga0081540_10095242 | 394 |
| 490 | 3300005983 | Ga0081540_1033115 | Ga0081540_10331152 | 394 |
| 491 | 3300005985 | Ga0081539_10000958 | Ga0081539_1000095852 | 394 |
| 492 | 3300005985 | Ga0081539_10075359 | Ga0081539_100753592 | 394 |
| 493 | 3300006038 | Ga0075365_10007229 | Ga0075365_100072297 | 394 |
| 494 | 3300006038 | Ga0075365_10017120 | Ga0075365_100171203 | 394 |
| 495 | 3300006038 | Ga0075365_10070828 | Ga0075365_100708281 | 394 |
| 496 | 3300006042 | Ga0075368_10010213 | Ga0075368_100102133 | 394 |
| 497 | 3300006048 | Ga0075363_100024415 | Ga0075363_1000244151 | 394 |
| 498 | 3300006048 | Ga0075363_100029979 | Ga0075363_1000299792 | 394 |
| 499 | 3300006048 | Ga0075363_100039740 | Ga0075363_1000397402 | 394 |
| 500 | 3300006163 | Ga0070715_10003525 | Ga0070715_100035255 | 394 |
| 501 | 3300006173 | Ga0070716_100105346 | Ga0070716_1001053462 | 394 |
| 502 | 3300006175 | Ga0070712_100010132 | Ga0070712_1000101323 | 394 |
| 503 | 3300006177 | Ga0075362_10003381 | Ga0075362_100033812 | 394 |
| 504 | 3300006178 | Ga0075367_10008443 | Ga0075367_100084435 | 394 |
| 505 | 3300006178 | Ga0075367_10011965 | Ga0075367_100119652 | 394 |
| 506 | 3300006178 | Ga0075367_10016996 | Ga0075367_100169962 | 394 |
| 507 | 3300006353 | Ga0075370_10101950 | Ga0075370_101019502 | 394 |
| 508 | 3300006844 | Ga0075428_100107116 | Ga0075428_1001071162 | 394 |
| 509 | 3300006871 | Ga0075434_100090790 | Ga0075434_1000907902 | 394 |
| 510 | 3300006881 | Ga0068865_100024542 | Ga0068865_1000245422 | 394 |
| 511 | 3300009093 | Ga0105240_10088824 | Ga0105240_100888243 | 394 |
| 512 | 3300009094 | Ga0111539_10038005 | Ga0111539_100380053 | 394 |
| 513 | 3300009098 | Ga0105245_10016400 | Ga0105245_100164003 | 394 |
| 514 | 3300009101 | Ga0105247_10161614 | Ga0105247_101616141 | 394 |
| 515 | 3300009545 | Ga0105237_10012102 | Ga0105237_100121028 | 394 |
| 516 | 3300009545 | Ga0105237_10045894 | Ga0105237_100458943 | 394 |
| 517 | 3300009545 | Ga0105237_10184946 | Ga0105237_101849462 | 394 |
| 518 | 3300009551 | Ga0105238_10003421 | Ga0105238_100034219 | 394 |
| 519 | 3300009553 | Ga0105249_10259876 | Ga0105249_102598761 | 394 |
| 520 | 3300010375 | Ga0105239_10039377 | Ga0105239_100393774 | 394 |
| 521 | 3300010375 | Ga0105239_10141081 | Ga0105239_101410812 | 394 |
| 522 | 3300011119 | Ga0105246_10122556 | Ga0105246_101225562 | 394 |
| 523 | 3300013104 | Ga0157370_10124163 | Ga0157370_101241632 | 394 |
| 524 | 3300013105 | Ga0157369_10053962 | Ga0157369_100539622 | 394 |
| 525 | 3300013105 | Ga0157369_10145823 | Ga0157369_101458232 | 394 |
| 526 | 3300013296 | Ga0157374_10003262 | Ga0157374_100032622 | 394 |
| 527 | 3300013297 | Ga0157378_10004948 | Ga0157378_100049489 | 394 |
| 528 | 3300013297 | Ga0157378_10095220 | Ga0157378_100952201 | 394 |
| 529 | 3300013306 | Ga0163162_10140685 | Ga0163162_101406852 | 394 |
| 530 | 3300014325 | Ga0163163_10117367 | Ga0163163_101173672 | 394 |
| 531 | 3300014325 | Ga0163163_10153434 | Ga0163163_101534342 | 394 |
| 532 | 3300014326 | Ga0157380_10023470 | Ga0157380_100234703 | 394 |
| 533 | 3300014326 | Ga0157380_10093329 | Ga0157380_100933292 | 394 |
| 534 | 3300014968 | Ga0157379_10070458 | Ga0157379_100704582 | 394 |
| 535 | 3300021320 | Ga0214544_1000163 | Ga0214544_100016374 | 394 |
| 536 | 3300021321 | Ga0214542_1000156 | Ga0214542_100015636 | 394 |
| 537 | 3300021324 | Ga0214545_1000078 | Ga0214545_100007874 | 394 |
| 538 | 3300021327 | Ga0214543_1000136 | Ga0214543_100013674 | 394 |
| 539 | 3300025297 | Ga0209758_1000932 | Ga0209758_100093234 | 394 |
| 540 | 3300025297 | Ga0209758_1003580 | Ga0209758_10035809 | 394 |
| 541 | 3300025321 | Ga0207656_10011027 | Ga0207656_100110272 | 394 |
| 542 | 3300025898 | Ga0207692_10003950 | Ga0207692_100039502 | 394 |
| 543 | 3300025909 | Ga0207705_10055052 | Ga0207705_100550522 | 394 |
| 544 | 3300025911 | Ga0207654_10013829 | Ga0207654_100138292 | 394 |
| 545 | 3300025912 | Ga0207707_10022607 | Ga0207707_100226072 | 394 |
| 546 | 3300025912 | Ga0207707_10178212 | Ga0207707_101782121 | 394 |
| 547 | 3300025913 | Ga0207695_10065019 | Ga0207695_100650192 | 394 |
| 548 | 3300025914 | Ga0207671_10023986 | Ga0207671_100239862 | 394 |
| 549 | 3300025915 | Ga0207693_10000565 | Ga0207693_100005658 | 394 |
| 550 | 3300025915 | Ga0207693_10003555 | Ga0207693_100035554 | 394 |
| 551 | 3300025915 | Ga0207693_10020827 | Ga0207693_100208272 | 394 |
| 552 | 3300025916 | Ga0207663_10000239 | Ga0207663_1000023910 | 394 |
| 553 | 3300025916 | Ga0207663_10082976 | Ga0207663_100829762 | 394 |
| 554 | 3300025917 | Ga0207660_10010184 | Ga0207660_100101842 | 394 |
| 555 | 3300025919 | Ga0207657_10005246 | Ga0207657_1000524612 | 394 |
| 556 | 3300025919 | Ga0207657_10104597 | Ga0207657_101045971 | 394 |
| 557 | 3300025920 | Ga0207649_10028886 | Ga0207649_100288862 | 394 |
| 558 | 3300025921 | Ga0207652_10025737 | Ga0207652_100257372 | 394 |
| 559 | 3300025927 | Ga0207687_10002549 | Ga0207687_100025494 | 394 |
| 560 | 3300025927 | Ga0207687_10126782 | Ga0207687_101267822 | 394 |
| 561 | 3300025928 | Ga0207700_10005630 | Ga0207700_100056304 | 394 |
| 562 | 3300025928 | Ga0207700_10021183 | Ga0207700_100211832 | 394 |
| 563 | 3300025929 | Ga0207664_10008257 | Ga0207664_100082576 | 394 |
| 564 | 3300025932 | Ga0207690_10097110 | Ga0207690_100971102 | 394 |
| 565 | 3300025933 | Ga0207706_10028509 | Ga0207706_100285093 | 394 |
| 566 | 3300025933 | Ga0207706_10055808 | Ga0207706_100558082 | 394 |
| 567 | 3300025936 | Ga0207670_10072310 | Ga0207670_100723102 | 394 |
| 568 | 3300025937 | Ga0207669_10014357 | Ga0207669_100143574 | 394 |
| 569 | 3300025939 | Ga0207665_10000127 | Ga0207665_1000012745 | 394 |
| 570 | 3300025939 | Ga0207665_10147606 | Ga0207665_101476062 | 394 |
| 571 | 3300025940 | Ga0207691_10050355 | Ga0207691_100503552 | 394 |
| 572 | 3300025942 | Ga0207689_10014870 | Ga0207689_100148707 | 394 |
| 573 | 3300025949 | Ga0207667_10012980 | Ga0207667_100129803 | 394 |
| 574 | 3300025949 | Ga0207667_10128800 | Ga0207667_101288002 | 394 |
| 575 | 3300025961 | Ga0207712_10016234 | Ga0207712_100162342 | 394 |
| 576 | 3300025961 | Ga0207712_10060450 | Ga0207712_100604502 | 394 |
| 577 | 3300025972 | Ga0207668_10003544 | Ga0207668_1000354411 | 394 |
| 578 | 3300025972 | Ga0207668_10134984 | Ga0207668_101349842 | 394 |
| 579 | 3300026023 | Ga0207677_10140768 | Ga0207677_101407682 | 394 |
| 580 | 3300026041 | Ga0207639_10016989 | Ga0207639_100169892 | 394 |
| 581 | 3300026067 | Ga0207678_10036953 | Ga0207678_100369532 | 394 |
| 582 | 3300026067 | Ga0207678_10130789 | Ga0207678_101307891 | 394 |
| 583 | 3300026075 | Ga0207708_10044384 | Ga0207708_100443842 | 394 |
| 584 | 3300026088 | Ga0207641_10215815 | Ga0207641_102158152 | 394 |
| 585 | 3300026089 | Ga0207648_10046275 | Ga0207648_100462753 | 394 |
| 586 | 3300026089 | Ga0207648_10280973 | Ga0207648_102809731 | 394 |
| 587 | 3300026095 | Ga0207676_10027584 | Ga0207676_100275842 | 394 |
| 588 | 3300026116 | Ga0207674_10025987 | Ga0207674_100259874 | 394 |
| 589 | 3300026118 | Ga0207675_100077746 | Ga0207675_1000777462 | 394 |
| 590 | 3300026118 | Ga0207675_100125875 | Ga0207675_1001258752 | 394 |
| 591 | 3300026142 | Ga0207698_10046695 | Ga0207698_100466952 | 394 |
| 592 | 3300027907 | Ga0207428_10132076 | Ga0207428_101320762 | 394 |
| 593 | 3300028379 | Ga0268266_10022369 | Ga0268266_100223692 | 394 |
| 594 | 3300028379 | Ga0268266_10023902 | Ga0268266_100239024 | 394 |
| 595 | 3300028379 | Ga0268266_10048656 | Ga0268266_100486562 | 394 |
| 596 | 3300028379 | Ga0268266_10158379 | Ga0268266_101583791 | 394 |
| 597 | 3300028380 | Ga0268265_10023047 | Ga0268265_100230474 | 394 |
| 598 | 3300028380 | Ga0268265_10023969 | Ga0268265_100239692 | 394 |
| 599 | 3300028800 | Ga0265338_10188674 | Ga0265338_101886741 | 394 |
| 600 | 3300031238 | Ga0265332_10012460 | Ga0265332_100124602 | 394 |
| 601 | 3300031249 | Ga0265339_10006267 | Ga0265339_100062677 | 394 |
| 602 | 3300031344 | Ga0265316_10070564 | Ga0265316_100705642 | 394 |
| 603 | 3300031507 | Ga0307509_10033214 | Ga0307509_100332142 | 394 |
| 604 | 3300031616 | Ga0307508_10000063 | Ga0307508_1000006345 | 394 |
| 605 | 3300031616 | Ga0307508_10027504 | Ga0307508_100275045 | 394 |
| 606 | 3300031730 | Ga0307516_10018150 | Ga0307516_100181508 | 394 |
| 607 | 3300031730 | Ga0307516_10059002 | Ga0307516_100590024 | 394 |
| 608 | 3300031730 | Ga0307516_10137777 | Ga0307516_101377772 | 394 |
| 609 | 3300033180 | Ga0307510_10010372 | Ga0307510_1001037210 | 394 |
| 610 | 3300033180 | Ga0307510_10041830 | Ga0307510_100418304 | 394 |
| 611 | 3300035113 | Ga0373936_0031660 | Ga0373936_0031660_267_1526 | 394 |
| 612 | 3300035113 | Ga0373936_0035701 | Ga0373936_0035701_447_1700 | 394 |
| 613 | 3300035172 | Ga0373955_0035628 | Ga0373955_0035628_828_2087 | 394 |
| 614 | 3300035691 | Ga0373931_0014884 | Ga0373931_0014884_669_1928 | 394 |
| 615 | 3300035692 | Ga0373935_0054232 | Ga0373935_0054232_935_2194 | 394 |
| 616 | 3300035695 | Ga0373927_0023634 | Ga0373927_0023634_356_1615 | 394 |
| 617 | 3300035725 | Ga0373947_0000455 | Ga0373947_0000455_11545_12798 | 394 |
| 618 | 3300035725 | Ga0373947_0013349 | Ga0373947_0013349_2293_3552 | 394 |
| 619 | 3300036401 | Ga0373937_0009140 | Ga0373937_0009140_3617_4876 | 394 |
| 620 | 3300037068 | Ga0373925_0006046 | Ga0373925_0006046_7603_8862 | 394 |
| 621 | 3300039453 | Ga0436362_1202653 | Ga0436362_1202653_1072_2322 | 394 |
| 622 | 3300046455 | Ga0495603_0000239 | Ga0495603_0000239_18390_19649 | 394 |
| 623 | 3300046455 | Ga0495603_0004059 | Ga0495603_0004059_4648_5907 | 394 |
| 624 | 3300046455 | Ga0495603_0042269 | Ga0495603_0042269_327_1586 | 394 |
| 625 | 3300046459 | Ga0495629_0000457 | Ga0495629_0000457_7453_8712 | 394 |
| 626 | 3300046460 | Ga0495638_0015338 | Ga0495638_0015338_2228_3487 | 394 |
| 627 | 3300046461 | Ga0495641_0002157 | Ga0495641_0002157_13582_14841 | 394 |
| 628 | 3300046463 | Ga0495653_0107165 | Ga0495653_0107165_512_1771 | 394 |
| 629 | 3300046471 | Ga0495650_0037007 | Ga0495650_0037007_693_1952 | 394 |
| 630 | 3300046472 | Ga0495580_0004703 | Ga0495580_0004703_3140_4399 | 394 |
| 631 | 3300046472 | Ga0495580_0062964 | Ga0495580_0062964_74_1333 | 394 |
| 632 | 3300046473 | Ga0495582_0000077 | Ga0495582_0000077_37318_38577 | 394 |
| 633 | 3300046475 | Ga0495639_0000101 | Ga0495639_0000101_20231_21490 | 394 |
| 634 | 3300046475 | Ga0495639_0044668 | Ga0495639_0044668_522_1781 | 394 |
| 635 | 3300046476 | Ga0495662_0010930 | Ga0495662_0010930_645_1904 | 394 |
| 636 | 3300046499 | Ga0495594_0000083 | Ga0495594_0000083_4980_6239 | 394 |
| 637 | 3300046500 | Ga0495596_0050823 | Ga0495596_0050823_129_1388 | 394 |
| 638 | 3300046529 | Ga0495652_0095391 | Ga0495652_0095391_478_1737 | 394 |
| 639 | 3300046531 | Ga0495665_0000055 | Ga0495665_0000055_23450_24709 | 394 |
| 640 | 3300046533 | Ga0495640_0004679 | Ga0495640_0004679_2627_3886 | 394 |
| 641 | 3300046543 | Ga0495645_0154405 | Ga0495645_0154405_315_1574 | 394 |
| 642 | 3300046642 | Ga0495634_0000720 | Ga0495634_0000720_2837_4096 | 394 |
| 643 | 3300046660 | Ga0495625_0085379 | Ga0495625_0085379_679_1938 | 394 |
| 644 | 3300046663 | Ga0495635_0012169 | Ga0495635_0012169_1860_3119 | 394 |
| 645 | 3300046680 | Ga0495646_0037952 | Ga0495646_0037952_884_2143 | 394 |
| 646 | 3300046683 | Ga0495658_0001572 | Ga0495658_0001572_5584_6843 | 394 |
| 647 | 3300046684 | Ga0495669_0002048 | Ga0495669_0002048_1710_2972 | 394 |
| 648 | 3300046689 | Ga0495613_0021735 | Ga0495613_0021735_1667_2926 | 394 |
| 649 | 3300046690 | Ga0495624_0000235 | Ga0495624_0000235_7988_9247 | 394 |
| 650 | 3300046690 | Ga0495624_0117211 | Ga0495624_0117211_324_1583 | 394 |
| 651 | 3300047315 | Ga0495581_0000041 | Ga0495581_0000041_24265_25524 | 394 |
| 652 | 3300047315 | Ga0495581_0068564 | Ga0495581_0068564_176_1435 | 394 |
| 653 | 3300047315 | Ga0495581_0083442 | Ga0495581_0083442_364_1623 | 394 |
| 654 | 3300047319 | Ga0495674_0010515 | Ga0495674_0010515_3469_4728 | 394 |
| 655 | 3300047320 | Ga0495672_0011925 | Ga0495672_0011925_2673_3923 | 394 |
| 656 | 3300047321 | Ga0495676_0042790 | Ga0495676_0042790_929_2188 | 394 |
| 657 | 3300047673 | Ga0495593_0000024 | Ga0495593_0000024_18253_19512 | 394 |
| 658 | 3300048904 | Ga0496101_0019807 | Ga0496101_0019807_990_2249 | 394 |
| 659 | 3300048904 | Ga0496101_0053295 | Ga0496101_0053295_722_1984 | 394 |
| 660 | 3300048905 | Ga0496102_0022602 | Ga0496102_0022602_1473_2732 | 394 |
| 661 | 3300048905 | Ga0496102_0026012 | Ga0496102_0026012_419_1678 | 394 |
| 662 | 3300048906 | Ga0496103_0037403 | Ga0496103_0037403_1265_2524 | 394 |
| 663 | 3300048907 | Ga0496104_0036831 | Ga0496104_0036831_2475_3734 | 394 |
| 664 | 3300048907 | Ga0496104_0182244 | Ga0496104_0182244_85_1344 | 394 |
| 665 | 3300048908 | Ga0496105_0004780 | Ga0496105_0004780_3442_4701 | 394 |
| 666 | 3300048909 | Ga0496106_0032587 | Ga0496106_0032587_744_2003 | 394 |
| 667 | 3300048909 | Ga0496106_0069534 | Ga0496106_0069534_72_1331 | 394 |
| 668 | 3300048910 | Ga0496107_0006673 | Ga0496107_0006673_567_1826 | 394 |
| 669 | 3300048911 | Ga0496108_0096093 | Ga0496108_0096093_249_1508 | 394 |
| 670 | 3300048911 | Ga0496108_0104576 | Ga0496108_0104576_289_1545 | 394 |
| 671 | 3300048913 | Ga0496110_0014165 | Ga0496110_0014165_3246_4505 | 394 |
| 672 | 3300048913 | Ga0496110_0044935 | Ga0496110_0044935_2199_3458 | 394 |
| 673 | 3300048913 | Ga0496110_0079832 | Ga0496110_0079832_1453_2709 | 394 |
| 674 | 3300048914 | Ga0496111_0011527 | Ga0496111_0011527_2756_4015 | 394 |
| 675 | 3300048914 | Ga0496111_0039640 | Ga0496111_0039640_1535_2791 | 394 |
| 676 | 3300048915 | Ga0496112_0035596 | Ga0496112_0035596_1253_2512 | 394 |
| 677 | 3300048915 | Ga0496112_0100431 | Ga0496112_0100431_872_2134 | 394 |
| 678 | 3300048916 | Ga0496113_0032329 | Ga0496113_0032329_1633_2889 | 394 |
| 679 | 3300048917 | Ga0496114_0265033 | Ga0496114_0265033_175_1434 | 394 |
| 680 | 3300048918 | Ga0496115_0001250 | Ga0496115_0001250_13102_14361 | 394 |
| 681 | 3300048918 | Ga0496115_0058775 | Ga0496115_0058775_587_1846 | 394 |
| 682 | 3300048921 | Ga0496118_0014888 | Ga0496118_0014888_3130_4383 | 394 |
| 683 | 3300048924 | Ga0496121_0124517 | Ga0496121_0124517_512_1765 | 394 |
| 684 | 3300048929 | Ga0496126_0009829 | Ga0496126_0009829_4823_6082 | 394 |
| 685 | 3300048929 | Ga0496126_0060149 | Ga0496126_0060149_894_2144 | 394 |
| 686 | 3300048929 | Ga0496126_0062869 | Ga0496126_0062869_268_1527 | 394 |
| 687 | 3300048929 | Ga0496126_0116044 | Ga0496126_0116044_289_1548 | 394 |
| 688 | 3300049579 | Ga0501043_0148437 | Ga0501043_0148437_331_1572 | 394 |
| 689 | 3300049581 | Ga0501047_0104480 | Ga0501047_0104480_461_1702 | 394 |
| 690 | 3300050489 | nmdc:mga03683_20124_c1 | nmdc:mga03683_20124_c1_1230_2489 | 394 |
| 691 | 3300050489 | nmdc:mga03683_4811_c1 | nmdc:mga03683_4811_c1_1093_2355 | 394 |
| 692 | 3300050492 | nmdc:mga0yw44_10099_c1 | nmdc:mga0yw44_10099_c1_718_1980 | 394 |
| 693 | 3300050492 | nmdc:mga0yw44_48604_c1 | nmdc:mga0yw44_48604_c1_295_1554 | 394 |
| 694 | 3300050492 | nmdc:mga0yw44_8041_c1 | nmdc:mga0yw44_8041_c1_3904_5163 | 394 |
| 695 | 3300050493 | nmdc:mga0k408_50283_c1 | nmdc:mga0k408_50283_c1_1078_2337 | 394 |
| 696 | 3300050494 | nmdc:mga06z11_67292_c1 | nmdc:mga06z11_67292_c1_217_1479 | 394 |
| 697 | 3300050496 | nmdc:mga07m45_13095_c1 | nmdc:mga07m45_13095_c1_26_1285 | 394 |
| 698 | 3300050496 | nmdc:mga07m45_18945_c1 | nmdc:mga07m45_18945_c1_1656_2915 | 394 |
| 699 | 3300050496 | nmdc:mga07m45_25456_c1 | nmdc:mga07m45_25456_c1_112_1374 | 394 |
| 700 | 3300050507 | nmdc:mga05p37_41080_c1 | nmdc:mga05p37_41080_c1_3090_4346 | 394 |
| 701 | 3300053077 | Ga0495601_0107617 | Ga0495601_0107617_339_1598 | 394 |
| 702 | 3300053080 | Ga0500635_0002813 | Ga0500635_0002813_828_2087 | 394 |
| 703 | 3300053094 | Ga0500566_0001419 | Ga0500566_0001419_5747_7000 | 394 |
| 704 | 3300053095 | Ga0500640_000253 | Ga0500640_000253_5732_6985 | 394 |
| 705 | 3300053096 | Ga0500641_0014230 | Ga0500641_0014230_624_1901 | 394 |
| 706 | 3300053111 | Ga0500572_000199 | Ga0500572_000199_852_2105 | 394 |
| 707 | 3300053119 | Ga0500595_025937 | Ga0500595_025937_751_2013 | 394 |
| 708 | 3300053122 | Ga0500608_047543 | Ga0500608_047543_39_1292 | 394 |
| 709 | 3300053123 | Ga0500614_004636 | Ga0500614_004636_115_1368 | 394 |
| 710 | 3300053130 | Ga0500642_0013926 | Ga0500642_0013926_1519_2775 | 394 |
| 711 | 3300053134 | Ga0500658_0078263 | Ga0500658_0078263_91_1350 | 394 |
| 712 | 3300053136 | Ga0500559_0004076 | Ga0500559_0004076_2864_4117 | 394 |
| 713 | 3300053140 | Ga0500573_0103966 | Ga0500573_0103966_157_1410 | 394 |
| 714 | 3300053150 | Ga0500603_000580 | Ga0500603_000580_5266_6519 | 394 |
| 715 | 3300053150 | Ga0500603_000944 | Ga0500603_000944_5347_6606 | 394 |
| 716 | 3300053159 | Ga0500630_000573 | Ga0500630_000573_10472_11725 | 394 |
| 717 | 3300053162 | Ga0500638_002393 | Ga0500638_002393_4208_5461 | 394 |
| 718 | 3300053163 | Ga0500639_000006 | Ga0500639_000006_156991_158244 | 394 |
| 719 | 3300053177 | Ga0500636_0042735 | Ga0500636_0042735_1207_2466 | 394 |
| 720 | 3300053178 | Ga0500637_0052393 | Ga0500637_0052393_577_1836 | 394 |
| 721 | 3300053735 | Ga0500596_001442 | Ga0500596_001442_1006_2259 | 394 |
| 722 | 3300005617 | Ga0068859_100062487 | Ga0068859_1000624873 | 396 |
| 723 | 3300006931 | Ga0097620_100062488 | Ga0097620_1000624883 | 396 |
| 724 | 3300025961 | Ga0207712_10176810 | Ga0207712_101768102 | 396 |
| 725 | 3300048929 | Ga0496126_0034696 | Ga0496126_0034696_2543_3796 | 396 |
| 726 | iso_pu_bacteria | 2524023228 | 2524534834 | 396 |
| 727 | iso_pu_bacteria | 8006933436 | 8006934880 | 396 |
| 728 | 3300010375 | Ga0105239_10354715 | Ga0105239_103547152 | 397 |
| 729 | iso_pu_bacteria | 2513237139 | 2513875293 | 397 |
| 730 | iso_pu_bacteria | 2802429603 | 2805921867 | 397 |
| 731 | iso_pu_bacteria | 2933577622 | 2933582057 | 397 |
| 732 | iso_pu_bacteria | 2935608549 | 2935613486 | 397 |
| 733 | iso_pu_bacteria | 2935819856 | 2935824661 | 397 |
| 734 | iso_pu_bacteria | 2935847175 | 2935851881 | 397 |
| 735 | iso_pu_bacteria | 2935908558 | 2935911231 | 397 |
| 736 | iso_pu_bacteria | 2935916978 | 2935920763 | 397 |
| 737 | iso_pu_bacteria | 2935926038 | 2935928260 | 397 |
| 738 | iso_pu_bacteria | 2935934488 | 2935937905 | 397 |
| 739 | iso_pu_bacteria | 2935942939 | 2935945187 | 397 |
| 740 | iso_pu_bacteria | 2935951376 | 2935954307 | 397 |
| 741 | iso_pu_bacteria | 2935967501 | 2935971425 | 397 |
| 742 | iso_pu_bacteria | 8016583857 | 8016588690 | 397 |
| 743 | iso_pu_bacteria | 8019687851 | 8019694989 | 397 |
| 744 | iso_pu_bacteria | 8055742211 | 8055750107 | 397 |
| 745 | iso_pu_bacteria | 8056673599 | 8056675117 | 397 |
| 746 | 3300046477 | Ga0495664_0007665 | Ga0495664_0007665_503_1855 | 398 |
| 747 | 3300046678 | Ga0495599_0067586 | Ga0495599_0067586_548_1900 | 398 |
| 748 | iso_pu_bacteria | 8006926726 | 8006929463 | 398 |
| 749 | 3300005618 | Ga0068864_100051077 | Ga0068864_1000510773 | 399 |
| 750 | 3300009093 | Ga0105240_10028981 | Ga0105240_100289817 | 399 |
| 751 | 3300009545 | Ga0105237_10135130 | Ga0105237_101351302 | 399 |
| 752 | 3300013105 | Ga0157369_10008923 | Ga0157369_100089238 | 399 |
| 753 | 3300013307 | Ga0157372_10265646 | Ga0157372_102656461 | 399 |
| 754 | 3300025944 | Ga0207661_10010620 | Ga0207661_100106202 | 399 |
| 755 | 3300033180 | Ga0307510_10024996 | Ga0307510_100249968 | 399 |
| 756 | 3300035118 | Ga0373954_0071911 | Ga0373954_0071911_181_1467 | 399 |
| 757 | 3300035170 | Ga0373943_0004735 | Ga0373943_0004735_4238_5524 | 399 |
| 758 | 3300035692 | Ga0373935_0036629 | Ga0373935_0036629_1394_2680 | 399 |
| 759 | 3300037418 | Ga0395900_0012087 | Ga0395900_0012087_4928_6223 | 399 |
| 760 | 3300037466 | Ga0395898_0011301 | Ga0395898_0011301_1337_2632 | 399 |
| 761 | 3300046472 | Ga0495580_0009906 | Ga0495580_0009906_2799_4085 | 399 |
| 762 | 3300046516 | Ga0495628_0074155 | Ga0495628_0074155_1284_2570 | 399 |
| 763 | 3300046526 | Ga0495666_0056332 | Ga0495666_0056332_551_1837 | 399 |
| 764 | 3300046529 | Ga0495652_0027178 | Ga0495652_0027178_1466_2752 | 399 |
| 765 | 3300046533 | Ga0495640_0018966 | Ga0495640_0018966_2986_4272 | 399 |
| 766 | 3300046642 | Ga0495634_0027825 | Ga0495634_0027825_1392_2678 | 399 |
| 767 | 3300046663 | Ga0495635_0023852 | Ga0495635_0023852_2949_4235 | 399 |
| 768 | 3300046678 | Ga0495599_0072228 | Ga0495599_0072228_276_1562 | 399 |
| 769 | 3300046681 | Ga0495647_0010240 | Ga0495647_0010240_761_2047 | 399 |
| 770 | 3300053080 | Ga0500635_0036346 | Ga0500635_0036346_296_1579 | 399 |
| 771 | 3300009545 | Ga0105237_10022395 | Ga0105237_100223952 | 400 |
| 772 | 3300009545 | Ga0105237_10027380 | Ga0105237_100273803 | 400 |
| 773 | 3300013307 | Ga0157372_10037760 | Ga0157372_100377605 | 400 |
| 774 | 3300049568 | Ga0501031_0000398 | Ga0501031_0000398_261_1541 | 400 |
| 775 | 3300049569 | Ga0501032_0000916 | Ga0501032_0000916_1889_3169 | 400 |
| 776 | 3300049570 | Ga0501033_0001463 | Ga0501033_0001463_5828_7108 | 400 |
| 777 | 3300049571 | Ga0501034_0000072 | Ga0501034_0000072_59959_61239 | 400 |
| 778 | 3300049572 | Ga0501036_0000250 | Ga0501036_0000250_1217_2497 | 400 |
| 779 | 3300049573 | Ga0501037_0000030 | Ga0501037_0000030_65442_66722 | 400 |
| 780 | 3300049574 | Ga0501038_0000039 | Ga0501038_0000039_116990_118270 | 400 |
| 781 | 3300049575 | Ga0501039_0000060 | Ga0501039_0000060_8435_9715 | 400 |
| 782 | 3300049579 | Ga0501043_0003512 | Ga0501043_0003512_5786_7066 | 400 |
| 783 | 3300049580 | Ga0501046_0000419 | Ga0501046_0000419_3093_4373 | 400 |
| 784 | 3300049581 | Ga0501047_0000174 | Ga0501047_0000174_52654_53934 | 400 |
| 785 | 3300049582 | Ga0501048_0000068 | Ga0501048_0000068_7078_8358 | 400 |
| 786 | 3300049583 | Ga0501067_0000068 | Ga0501067_0000068_42356_43636 | 400 |
| 787 | 3300049584 | Ga0501068_0000949 | Ga0501068_0000949_5460_6740 | 400 |
| 788 | 3300049586 | Ga0501070_0007372 | Ga0501070_0007372_5155_6435 | 400 |
| 789 | 3300049588 | Ga0501072_0003432 | Ga0501072_0003432_4967_6247 | 400 |
| 790 | 3300049589 | Ga0501073_0000009 | Ga0501073_0000009_75784_77064 | 400 |
| 791 | 3300049590 | Ga0501074_0001057 | Ga0501074_0001057_10751_12031 | 400 |
| 792 | 3300049744 | Ga0501083_0006137 | Ga0501083_0006137_3525_4805 | 400 |
| 793 | 3300049822 | Ga0501035_0000067 | Ga0501035_0000067_52084_53364 | 400 |
| 794 | 3300054114 | Ga0501084_0001174 | Ga0501084_0001174_3369_4649 | 400 |
| 795 | 3300060353 | Ga0501082_0001593 | Ga0501082_0001593_4307_5587 | 400 |
| 796 | iso_pu_bacteria | 2667528175 | 2671122751 | 400 |
| 797 | 3300028786 | Ga0307517_10021811 | Ga0307517_100218116 | 401 |
| 798 | 3300028794 | Ga0307515_10221687 | Ga0307515_102216871 | 401 |
| 799 | 3300035116 | Ga0373945_0017685 | Ga0373945_0017685_96_1391 | 401 |
| 800 | 3300035170 | Ga0373943_0005037 | Ga0373943_0005037_4166_5461 | 401 |
| 801 | 3300039437 | Ga0436365_1552881 | Ga0436365_1552881_777_2057 | 401 |
| 802 | 3300048918 | Ga0496115_0177837 | Ga0496115_0177837_275_1609 | 401 |
| 803 | iso_pu_bacteria | 2508501128 | 2509146628 | 401 |
| 804 | 3300009093 | Ga0105240_10076492 | Ga0105240_100764924 | 402 |
| 805 | 3300003203 | JGI25406J46586_10000064 | JGI25406J46586_1000006433 | 404 |
| 806 | 3300005985 | Ga0081539_10000099 | Ga0081539_10000099103 | 404 |
| 807 | 3300009551 | Ga0105238_10171357 | Ga0105238_101713572 | 404 |
| 808 | 3300046507 | Ga0495606_0000357 | Ga0495606_0000357_13539_14828 | 404 |
| 809 | 3300048915 | Ga0496112_0000052 | Ga0496112_0000052_40241_41530 | 404 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hpk-assembly1.cif.gz_A | crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form | 0.8509 | 20 | 395 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8457 | 21 | 396 |
| 6kkj-assembly1.cif.gz_B | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward open conformation | 0.8327 | 21 | 396 |
| 6kki-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward-occluded conformation | 0.8315 | 20 | 396 |
| 6kkl-assembly1.cif.gz_A | crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) | 0.8305 | 20 | 396 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P52067_222_406_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9734 | 220 | 403 | 1.20.1250.20 |
| af_P52067_222_406_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9631 | 220 | 403 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9469 | 20 | 201 | 1.20.1250.20 |
| af_O94607_344_515_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9069 | 225 | 372 | 1.20.1250.20 |
| af_P52067_17_206_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9041 | 20 | 201 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A9JEU6-F1-model_v4 | MFS transporter | 0.9701 | 21 | 397 |
GO:0005886
GO:0022857 |
| AF-A0A1H5UN65-F1-model_v4 | MFS transporter, FSR family, fosmidomycin resistance protein | 0.967 | 21 | 401 |
GO:0005886
GO:0022857 |
| AF-A0A7X1WME5-F1-model_v4 | MFS transporter | 0.9655 | 139 | 402 |
GO:0005886
GO:0022857 |
| AF-A0A0M8MHA8-F1-model_v4 | Fosmidomycin resistance protein | 0.9653 | 21 | 404 |
GO:0005886
GO:0022857 |
| AF-A0A7X1WME5-F1-model_v4 | MFS transporter | 0.9619 | 139 | 402 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar