F481750

General Info

Members Datasets Scaffolds Average Seq Length
809 366 709 264

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100356927|Ga0070668_1003569272
Length 273
Sequence MQLIEVPAKTGYVWFRQGIWLFRRNPLAFLTVFFAYLFVMTLISRIPVIGPILPLLVIPGVAVGFMAACRNTIAGKPVWPTILVDGFRSYGNVVSRRLLILGAIYIVAMGVIFALSALVDGGVLLSMMLGSGPTGDPETVAASFSPLAVLLAMACYIPVAMLFWFAPILVAWHDVSPAKALFFSFVSCWRNRGAFVFYGVLWIVIALAVSFGLTALMQALGAGQEMALAVLMPASILITTALYCSFYATYRGCFGVQSPDTPDIPGASDAPGV

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
15 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
16 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
17 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2519103095 Burkholderia sp. KJ006 Isolate Nodule
20 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
21 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
22 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
23 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
24 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
25 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
26 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
27 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
28 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
29 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
30 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
31 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
32 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
33 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
34 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
35 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
36 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
37 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
38 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
39 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
40 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
41 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
42 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
43 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
44 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
45 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
46 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
47 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
48 2818991450 Burkholderia sp. 604 Isolate Unclassified
49 2818991452 Burkholderia cepacia 561 Isolate Unclassified
50 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
51 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
52 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
53 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
54 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
55 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
56 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
57 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
58 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
59 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
60 2885266251 Ralstonia sp. SET104 Isolate Nodule
61 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
62 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
63 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
64 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
65 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
66 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
67 2904564687 Burkholderia sp. 571 Isolate Unclassified
68 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
69 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
70 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
71 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
72 2928058823 Ralstonia sp. 1138 Isolate Unclassified
73 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
74 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
75 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
76 2928163908 Burkholderia sp. 567 Isolate Unclassified
77 2928170801 Burkholderia sp. 572 Isolate Unclassified
78 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
79 2928536128 Burkholderia sola 565 Isolate Unclassified
80 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
81 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
82 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
83 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
84 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
85 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
86 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
87 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
88 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
89 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
90 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
91 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
92 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
93 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
94 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
95 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
96 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
97 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
98 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
99 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
100 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
101 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
102 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
103 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
104 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
105 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
106 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
107 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
108 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
109 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
112 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
115 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
116 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
117 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
120 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
121 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
122 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
126 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
127 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
128 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
129 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
132 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
133 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
147 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
148 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
149 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
164 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
165 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
166 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
220 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
223 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
224 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
225 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
241 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
264 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
292 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
300 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
301 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
302 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
303 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
304 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
305 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
313 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
314 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
333 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
334 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
335 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
336 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
341 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
345 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
350 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
351 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
352 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
353 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
354 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
355 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
356 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
357 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
358 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
359 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
360 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
361 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
362 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
363 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
364 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
365 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
366 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.53
Metatranscriptomes 1.11
Isolates 12.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.35
Nodule 3.21
Rhizoplane 5.81
Rhizosphere 64.15
Stem 0
Stem Tuber 0
Unclassified 13.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000501 3300001915 Bacteria 11970
2 JGI24740J21852_10010048 3300001979 Bacteria 3665
3 JGI24739J22299_10002683 3300001989 Bacteria 6851
4 JGI24739J22299_10003669 3300001989 Bacteria 5860
5 JGI24735J21928_10003635 3300002067 Bacteria 5232
6 JGI24735J21928_10009105 3300002067 Bacteria 3196
7 JGI24735J21928_10012431 3300002067 Bacteria 2691
8 JGI25156J39149_1001042 3300002705 Bacteria 12874
9 JGI25156J39149_1001070 3300002705 Bacteria 12599
10 JGI25156J39149_1001809 3300002705 Bacteria 8391
11 JGI25156J39149_1003257 3300002705 Bacteria 5393
12 JGI25151J46595_10000728 3300003187 Bacteria 27382
13 JGI25151J46595_10003126 3300003187 Bacteria 9308
14 JGI25165J46597_1001040 3300003214 Bacteria 18112
15 rootH2_10026413 3300003320 Bacteria 7449
16 rootH2_10072564 3300003320 Bacteria 3926
17 rootL2_10038342 3300003322 Bacteria 4967
18 rootH1_10021773 3300003323 Bacteria 5404
19 rootH1_10265235 3300003323 Bacteria 1754
20 JGI25160J50197_1000124 3300003354 Bacteria 69999
21 Ga0055539_1000068 3300003752 Bacteria 134912
22 Ga0055533_1000180 3300003756 Bacteria 53464
23 Ga0055533_1000875 3300003756 Bacteria 9128
24 Ga0055532_1000028 3300003758 Bacteria 234512
25 Ga0055532_1000069 3300003758 Bacteria 138614
26 Ga0055532_1000406 3300003758 Bacteria 21145
27 Ga0055532_1001525 3300003758 Bacteria 6267
28 Ga0055532_1001528 3300003758 Bacteria 6261
29 Ga0055525_1000598 3300003759 Bacteria 15433
30 Ga0055527_1000034 3300003760 Bacteria 138614
31 Ga0055527_1000250 3300003760 Bacteria 33140
32 Ga0055527_1000599 3300003760 Bacteria 11632
33 Ga0055527_1000969 3300003760 Bacteria 7059
34 Ga0055527_1005269 3300003760 Bacteria 1696
35 Ga0055535_1000022 3300003761 Bacteria 234512
36 Ga0055535_1000049 3300003761 Bacteria 138835
37 Ga0055535_1000529 3300003761 Bacteria 33140
38 Ga0055535_1000554 3300003761 Bacteria 31942
39 Ga0055542_1000077 3300003762 Bacteria 138614
40 Ga0055542_1000574 3300003762 Bacteria 32110
41 Ga0055542_1000960 3300003762 Bacteria 18833
42 Ga0055542_1001479 3300003762 Bacteria 11543
43 Ga0055529_1000063 3300003763 Bacteria 181573
44 Ga0055529_1000090 3300003763 Bacteria 138416
45 Ga0055529_1000145 3300003763 Bacteria 101255
46 Ga0055529_1000549 3300003763 Bacteria 31942
47 Ga0055529_1003682 3300003763 Bacteria 2485
48 Ga0055526_1007927 3300003771 Bacteria 5402
49 Ga0055537_1005999 3300003773 Bacteria 3154
50 Ga0055524_1000290 3300003775 Bacteria 48740
51 Ga0055524_1021466 3300003775 Bacteria 2139
52 Ga0055536_1000074 3300003781 Bacteria 84660
53 Ga0055534_1001002 3300003784 Bacteria 12416
54 Ga0055534_1003364 3300003784 Bacteria 5046
55 Ga0055528_1004945 3300003790 Bacteria 6294
56 Ga0055541_1000439 3300003841 Bacteria 12033
57 Ga0055541_1003378 3300003841 Bacteria 3014
58 Ga0055541_1004447 3300003841 Bacteria 2541
59 Ga0058692_1011696 3300003856 Bacteria 2109
60 Ga0065165_1000637 3300005262 Bacteria 50736
61 Ga0070658_10008817 3300005327 Bacteria 8108
62 Ga0070660_100000095 3300005339 Bacteria 53558
63 Ga0070660_100000299 3300005339 Bacteria 33013
64 Ga0070660_100059093 3300005339 Bacteria 2973
65 Ga0070661_100000278 3300005344 Bacteria 41330
66 Ga0070661_100077560 3300005344 Bacteria 2450
67 Ga0070668_100356927 3300005347 Bacteria 1238
68 Ga0070659_100000427 3300005366 Bacteria 31862
69 Ga0070659_100001994 3300005366 Bacteria 14594
70 Ga0070659_100043123 3300005366 Bacteria 3528
71 Ga0070667_100037080 3300005367 Bacteria 4087
72 Ga0070714_100436421 3300005435 Bacteria 1242
73 Ga0070663_100000005 3300005455 Bacteria 251758
74 Ga0070663_100355538 3300005455 Bacteria 1187
75 Ga0070662_100401693 3300005457 Bacteria 1131
76 Ga0068855_100009290 3300005563 Bacteria 11876
77 Ga0068855_100014523 3300005563 Bacteria 9485
78 Ga0070664_100000001 3300005564 Bacteria 551832
79 Ga0068857_100204553 3300005577 Bacteria 1800
80 Ga0068854_100000030 3300005578 Bacteria 111321
81 Ga0068856_100000008 3300005614 Bacteria 190886
82 Ga0068852_100029851 3300005616 Bacteria 4482
83 Ga0068852_100495169 3300005616 Bacteria 1216
84 Ga0099826_10000015 3300006948 Bacteria 254837
85 Ga0105251_10000229 3300009011 Bacteria 56300
86 Ga0105251_10000300 3300009011 Bacteria 49582
87 Ga0105251_10102343 3300009011 Bacteria 1308
88 Ga0105250_10040867 3300009092 Bacteria 1860
89 Ga0105240_10002402 3300009093 Bacteria 30107
90 Ga0105240_10004298 3300009093 Bacteria 21761
91 Ga0105240_10026407 3300009093 Bacteria 7619
92 Ga0105240_10032468 3300009093 Bacteria 6759
93 Ga0105240_10032941 3300009093 Bacteria 6700
94 Ga0105240_10036745 3300009093 Bacteria 6298
95 Ga0105240_10156634 3300009093 Bacteria 2708
96 Ga0105245_10377777 3300009098 Bacteria 1410
97 Ga0105248_10036584 3300009177 Bacteria 5490
98 Ga0105237_10008689 3300009545 Bacteria 10975
99 Ga0105237_10023896 3300009545 Bacteria 6255
100 Ga0105237_10131794 3300009545 Bacteria 2494
101 Ga0105238_10013566 3300009551 Bacteria 8226
102 Ga0105238_10277754 3300009551 Bacteria 1656
103 Ga0105239_10002119 3300010375 Bacteria 25623
104 Ga0105239_10053120 3300010375 Bacteria 4445
105 Ga0105246_10038767 3300011119 Bacteria 3206
106 Ga0105246_10270284 3300011119 Bacteria 1359
107 Ga0157373_10007898 3300013100 Bacteria 7916
108 Ga0157373_10021547 3300013100 Bacteria 4680
109 Ga0157371_10000035 3300013102 Bacteria 223396
110 Ga0157371_10045755 3300013102 Bacteria 3113
111 Ga0157370_10000021 3300013104 Bacteria 166168
112 Ga0157370_10004905 3300013104 Bacteria 15160
113 Ga0157370_10020719 3300013104 Bacteria 6561
114 Ga0157370_10147295 3300013104 Bacteria 2192
115 Ga0157370_10286033 3300013104 Bacteria 1523
116 Ga0157369_10002035 3300013105 Bacteria 24367
117 Ga0157369_10009022 3300013105 Bacteria 11421
118 Ga0157369_10013854 3300013105 Bacteria 9110
119 Ga0157369_10044697 3300013105 Bacteria 4819
120 Ga0157374_10000083 3300013296 Bacteria 94408
121 Ga0157374_10249861 3300013296 Bacteria 1745
122 Ga0157374_10333333 3300013296 Bacteria 1505
123 Ga0163162_10016724 3300013306 Bacteria 7169
124 Ga0157372_10000331 3300013307 Bacteria 51927
125 Ga0157372_10003299 3300013307 Bacteria 17433
126 Ga0157372_10259566 3300013307 Bacteria 2018
127 Ga0157372_10336762 3300013307 Bacteria 1757
128 Ga0157375_10017497 3300013308 Bacteria 6470
129 Ga0182008_10030216 3300014497 Bacteria 2732
130 Ga0182006_1000956 3300015261 Bacteria 19183
131 Ga0182006_1023287 3300015261 Bacteria 2566
132 Ga0182007_10000180 3300015262 Bacteria 43031
133 Ga0182007_10031068 3300015262 Bacteria 1822
134 Ga0182005_1005069 3300015265 Bacteria 4156
135 Ga0183361_10003 3300016635 Bacteria 577277
136 Ga0197907_10618600 3300020069 Bacteria 1341
137 Ga0206351_10374936 3300020077 Bacteria 15602
138 Ga0206350_11409884 3300020080 Bacteria 1626
139 Ga0206354_10439040 3300020081 Bacteria 1735
140 Ga0154015_1042038 3300020610 Bacteria 50222
141 Ga0213872_10061412 3300021361 Bacteria 1699
142 Ga0224712_10000001 3300022467 Bacteria 72814
143 Ga0209784_100014 3300025224 Bacteria 496182
144 Ga0209784_100505 3300025224 Bacteria 15204
145 Ga0209566_100011 3300025225 Bacteria 496182
146 Ga0209566_100447 3300025225 Bacteria 30429
147 Ga0209566_101144 3300025225 Bacteria 10010
148 Ga0209566_101405 3300025225 Bacteria 7327
149 Ga0209674_100032 3300025226 Bacteria 426888
150 Ga0209674_100131 3300025226 Bacteria 118079
151 Ga0209674_100139 3300025226 Bacteria 110389
152 Ga0209674_100191 3300025226 Bacteria 66206
153 Ga0209674_105454 3300025226 Bacteria 1877
154 Ga0209672_100002 3300025228 Bacteria 1733325
155 Ga0209672_100036 3300025228 Bacteria 287801
156 Ga0209672_100050 3300025228 Bacteria 238103
157 Ga0209672_100217 3300025228 Bacteria 44942
158 Ga0209672_100430 3300025228 Bacteria 24357
159 Ga0209147_100002 3300025229 Bacteria 2158988
160 Ga0209147_100003 3300025229 Bacteria 1733325
161 Ga0209147_100066 3300025229 Bacteria 232474
162 Ga0209147_100075 3300025229 Bacteria 208215
163 Ga0209147_100166 3300025229 Bacteria 90046
164 Ga0209563_100029 3300025230 Bacteria 496182
165 Ga0209563_103125 3300025230 Bacteria 3508
166 Ga0209563_103349 3300025230 Bacteria 3339
167 Ga0209563_110167 3300025230 Bacteria 1386
168 Ga0209258_100002 3300025242 Bacteria 2158988
169 Ga0209258_100077 3300025242 Bacteria 264510
170 Ga0209258_100085 3300025242 Bacteria 244731
171 Ga0209258_100175 3300025242 Bacteria 141709
172 Ga0207425_1026865 3300025245 Bacteria 1178
173 Ga0209646_1000058 3300025246 Bacteria 259999
174 Ga0209026_1001980 3300025250 Bacteria 8182
175 Ga0209677_100042 3300025253 Bacteria 225037
176 Ga0209677_103828 3300025253 Bacteria 4646
177 Ga0209148_1000006 3300025254 Bacteria 1733325
178 Ga0209148_1000043 3300025254 Bacteria 461531
179 Ga0209148_1000174 3300025254 Bacteria 130039
180 Ga0209148_1000597 3300025254 Bacteria 32624
181 Ga0209759_1000170 3300025256 Bacteria 110023
182 Ga0209759_1000225 3300025256 Bacteria 84464
183 Ga0209759_1000334 3300025256 Bacteria 62007
184 Ga0209759_1001014 3300025256 Bacteria 18873
185 Ga0209759_1003477 3300025256 Bacteria 6248
186 Ga0209759_1005147 3300025256 Bacteria 4661
187 Ga0209759_1018849 3300025256 Bacteria 1657
188 Ga0209233_1000177 3300025261 Bacteria 141716
189 Ga0209565_1000329 3300025263 Bacteria 42233
190 Ga0209565_1013427 3300025263 Bacteria 1918
191 Ga0209455_1000009 3300025272 Bacteria 1042273
192 Ga0209455_1000139 3300025272 Bacteria 138993
193 Ga0209455_1000140 3300025272 Bacteria 138610
194 Ga0209455_1000424 3300025272 Bacteria 33191
195 Ga0209673_1000028 3300025273 Bacteria 358901
196 Ga0209130_1005627 3300025284 Bacteria 4292
197 Ga0209130_1011332 3300025284 Bacteria 2393
198 Ga0209675_1000070 3300025291 Bacteria 169161
199 Ga0209675_1000432 3300025291 Bacteria 33519
200 Ga0209676_1000012 3300025292 Bacteria 841431
201 Ga0209025_1001428 3300025294 Bacteria 31518
202 Ga0209025_1001621 3300025294 Bacteria 28120
203 Ga0209025_1002536 3300025294 Bacteria 19084
204 Ga0209025_1003983 3300025294 Bacteria 13262
205 Ga0209564_1000359 3300025295 Bacteria 84631
206 Ga0209564_1001697 3300025295 Bacteria 20841
207 Ga0209564_1005151 3300025295 Bacteria 7595
208 Ga0209564_1006178 3300025295 Bacteria 6561
209 Ga0209758_1026749 3300025297 Bacteria 2487
210 Ga0209050_1051342 3300025298 Bacteria 1040
211 Ga0209256_1000059 3300025299 Bacteria 272170
212 Ga0209256_1000149 3300025299 Bacteria 146390
213 Ga0207426_1000020 3300025302 Bacteria 558084
214 Ga0207426_1004899 3300025302 Bacteria 6321
215 Ga0209051_1019616 3300025303 Bacteria 2943
216 Ga0207696_1036398 3300025711 Bacteria 1461
217 Ga0207713_1000201 3300025735 Bacteria 82948
218 Ga0207713_1012592 3300025735 Bacteria 4507
219 Ga0207647_10001651 3300025904 Bacteria 17161
220 Ga0207647_10003526 3300025904 Bacteria 11736
221 Ga0207647_10018368 3300025904 Bacteria 4733
222 Ga0207647_10042140 3300025904 Bacteria 2866
223 Ga0207647_10133566 3300025904 Bacteria 1457
224 Ga0207705_10000851 3300025909 Bacteria 25007
225 Ga0207695_10001212 3300025913 Bacteria 44217
226 Ga0207695_10002489 3300025913 Bacteria 27124
227 Ga0207695_10010541 3300025913 Bacteria 11301
228 Ga0207695_10021338 3300025913 Bacteria 7391
229 Ga0207695_10058630 3300025913 Bacteria 3995
230 Ga0207695_10281805 3300025913 Bacteria 1556
231 Ga0207657_10000189 3300025919 Bacteria 64124
232 Ga0207657_10000686 3300025919 Bacteria 36064
233 Ga0207657_10104734 3300025919 Bacteria 2343
234 Ga0207657_10133274 3300025919 Bacteria 2035
235 Ga0207649_10000169 3300025920 Bacteria 53440
236 Ga0207694_10169043 3300025924 Bacteria 1770
237 Ga0207690_10000014 3300025932 Bacteria 263016
238 Ga0207690_10001870 3300025932 Bacteria 12922
239 Ga0207690_10028871 3300025932 Bacteria 3519
240 Ga0207706_10508594 3300025933 Bacteria 1039
241 Ga0207711_10129332 3300025941 Bacteria 2263
242 Ga0207679_10000003 3300025945 Bacteria 597553
243 Ga0207667_10002720 3300025949 Bacteria 21865
244 Ga0207667_10040487 3300025949 Bacteria 4962
245 Ga0207667_10123605 3300025949 Bacteria 2666
246 Ga0207668_10339082 3300025972 Bacteria 1253
247 Ga0207640_10000124 3300025981 Bacteria 58977
248 Ga0207658_10026188 3300025986 Bacteria 4087
249 Ga0207678_10000002 3300026067 Bacteria 371723
250 Ga0207678_10000791 3300026067 Bacteria 28969
251 Ga0207678_10423264 3300026067 Bacteria 1155
252 Ga0207702_10000031 3300026078 Bacteria 175405
253 Ga0207702_10391667 3300026078 Bacteria 1338
254 Ga0207674_10004769 3300026116 Bacteria 16262
255 Ga0207683_10287536 3300026121 Bacteria 1503
256 Ga0207698_10034029 3300026142 Bacteria 3710
257 Ga0209371_1000379 3300027312 Bacteria 47585
258 Ga0209282_1000031 3300027666 Bacteria 150666
259 Ga0265338_10000120 3300028800 Bacteria 145451
260 Ga0265338_10001517 3300028800 Bacteria 37494
261 Ga0268256_1000369 3300030500 Bacteria 42680
262 Ga0307408_100003182 3300031548 Bacteria 11313
263 Ga0307405_10068292 3300031731 Bacteria 2274
264 Ga0307412_10000064 3300031911 Bacteria 125607
265 Ga0307416_100052589 3300032002 Bacteria 3262
266 Ga0395899_0000097 3300037312 Bacteria 152056
267 Ga0395899_0128038 3300037312 Bacteria 1815
268 Ga0395899_0138090 3300037312 Bacteria 1736
269 Ga0395900_0000015 3300037418 Bacteria 384313
270 Ga0395900_0000225 3300037418 Bacteria 89034
271 Ga0395900_0015654 3300037418 Bacteria 7731
272 Ga0395900_0040450 3300037418 Bacteria 4804
273 Ga0395900_0093601 3300037418 Bacteria 3087
274 Ga0395900_0168357 3300037418 Bacteria 2232
275 Ga0395900_0354798 3300037418 Bacteria 1439
276 Ga0395898_0000407 3300037466 Bacteria 93281
277 Ga0395898_0000791 3300037466 Bacteria 53832
278 Ga0395898_0010835 3300037466 Bacteria 9525
279 Ga0395898_0016635 3300037466 Bacteria 7517
280 Ga0395898_0155202 3300037466 Bacteria 2189
281 Ga0395905_0000052 3300037471 Bacteria 215018
282 Ga0395905_0091549 3300037471 Bacteria 2851
283 Ga0395901_0000034 3300038443 Bacteria 230365
284 Ga0395901_0000121 3300038443 Bacteria 100690
285 Ga0395901_0001442 3300038443 Bacteria 24805
286 Ga0395901_0389705 3300038443 Bacteria 1432
287 Ga0436365_0026194 3300039437 Bacteria 2171
288 Ga0436361_0024686 3300039447 Bacteria 6652
289 Ga0436361_0721425 3300039447 Bacteria 980
290 Ga0439448_0000034 3300042005 Bacteria 22979
291 Ga0439455_0086032 3300042012 Bacteria 858
292 Ga0466969_0007828 3300044656 Bacteria 5678
293 Ga0466972_0172921 3300044658 Bacteria 1013
294 Ga0466973_0020274 3300044659 Bacteria 6353
295 Ga0466977_0000096 3300044666 Bacteria 18311
296 Ga0466978_0078295 3300044671 Bacteria 2063
297 Ga0466965_0012566 3300044683 Bacteria 3985
298 Ga0466965_0208553 3300044683 Bacteria 1038
299 Ga0466966_0000056 3300044684 Bacteria 81439
300 Ga0466966_0000313 3300044684 Bacteria 31287
301 Ga0466966_0008530 3300044684 Bacteria 6785
302 Ga0466961_0000173 3300044693 Bacteria 43874
303 Ga0466961_0001585 3300044693 Bacteria 14100
304 Ga0466961_0006206 3300044693 Bacteria 7591
305 Ga0466961_0014433 3300044693 Bacteria 5071
306 Ga0466961_0019365 3300044693 Bacteria 4377
307 Ga0466961_0023146 3300044693 Bacteria 3995
308 Ga0466963_0005061 3300044694 Bacteria 7702
309 Ga0466963_0005362 3300044694 Bacteria 7502
310 Ga0466963_0102160 3300044694 Bacteria 1963
311 Ga0466964_0005152 3300044706 Bacteria 4842
312 Ga0466964_0095296 3300044706 Bacteria 1302
313 Ga0466971_0006091 3300044719 Bacteria 5246
314 Ga0466971_0008558 3300044719 Bacteria 4464
315 Ga0466968_0015334 3300044735 Bacteria 3035
316 Ga0466968_0021564 3300044735 Bacteria 2610
317 Ga0466970_0023662 3300044765 Bacteria 3210
318 Ga0466970_0026573 3300044765 Bacteria 3033
319 Ga0466970_0039146 3300044765 Bacteria 2516
320 Ga0466970_0052834 3300044765 Bacteria 2169
321 Ga0466970_0128420 3300044765 Bacteria 1391
322 Ga0466957_0002393 3300044842 Bacteria 10072
323 Ga0466957_0005235 3300044842 Bacteria 7260
324 Ga0466957_0014520 3300044842 Bacteria 4586
325 Ga0466957_0019579 3300044842 Bacteria 3982
326 Ga0466957_0083721 3300044842 Bacteria 1990
327 Ga0466959_0005102 3300045049 Bacteria 8935
328 Ga0466959_0005932 3300045049 Bacteria 8417
329 Ga0466959_0011352 3300045049 Bacteria 6399
330 Ga0466959_0016000 3300045049 Bacteria 5474
331 Ga0466959_0028001 3300045049 Bacteria 4178
332 Ga0466959_0109222 3300045049 Bacteria 1975
333 Ga0466958_0001291 3300045836 Bacteria 11774
334 Ga0466958_0009891 3300045836 Bacteria 5325
335 Ga0466967_0015919 3300045976 Bacteria 5911
336 Ga0495592_0002026 3300046454 Bacteria 14285
337 Ga0495592_0008385 3300046454 Bacteria 7751
338 Ga0495603_0000841 3300046455 Bacteria 17602
339 Ga0495603_0010798 3300046455 Bacteria 5540
340 Ga0495603_0102508 3300046455 Bacteria 1670
341 Ga0495603_0285609 3300046455 Bacteria 948
342 Ga0495590_0003314 3300046457 Bacteria 6593
343 Ga0495590_0015988 3300046457 Bacteria 2714
344 Ga0495590_0024324 3300046457 Bacteria 2134
345 Ga0495590_0025981 3300046457 Bacteria 2057
346 Ga0495591_000432 3300046458 Bacteria 34380
347 Ga0495629_0000127 3300046459 Bacteria 66745
348 Ga0495629_0000426 3300046459 Bacteria 35078
349 Ga0495629_0000889 3300046459 Bacteria 24036
350 Ga0495629_0010764 3300046459 Bacteria 6653
351 Ga0495629_0020794 3300046459 Bacteria 4685
352 Ga0495629_0254664 3300046459 Bacteria 1207
353 Ga0495638_0006164 3300046460 Bacteria 8759
354 Ga0495638_0010175 3300046460 Bacteria 6549
355 Ga0495641_0081316 3300046461 Bacteria 1451
356 Ga0495651_0003119 3300046462 Bacteria 12786
357 Ga0495651_0019663 3300046462 Bacteria 5236
358 Ga0495653_0001458 3300046463 Bacteria 18456
359 Ga0495653_0004291 3300046463 Bacteria 11547
360 Ga0495653_0011127 3300046463 Bacteria 7357
361 Ga0495653_0109111 3300046463 Bacteria 1992
362 Ga0495650_0001593 3300046471 Bacteria 21240
363 Ga0495650_0006665 3300046471 Bacteria 7157
364 Ga0495650_0010011 3300046471 Bacteria 5334
365 Ga0495650_0012308 3300046471 Bacteria 4609
366 Ga0495650_0054845 3300046471 Bacteria 1625
367 Ga0495650_0076611 3300046471 Bacteria 1299
368 Ga0495650_0084789 3300046471 Bacteria 1215
369 Ga0495580_0000611 3300046472 Bacteria 30196
370 Ga0495580_0001756 3300046472 Bacteria 19051
371 Ga0495580_0017349 3300046472 Bacteria 5385
372 Ga0495580_0032771 3300046472 Bacteria 3746
373 Ga0495580_0114344 3300046472 Bacteria 1874
374 Ga0495580_0122839 3300046472 Bacteria 1802
375 Ga0495580_0165524 3300046472 Bacteria 1529
376 Ga0495582_0000464 3300046473 Bacteria 22202
377 Ga0495582_0004932 3300046473 Bacteria 7480
378 Ga0495582_0253573 3300046473 Bacteria 1009
379 Ga0495605_0002814 3300046474 Bacteria 10575
380 Ga0495605_0008996 3300046474 Bacteria 5622
381 Ga0495605_0009237 3300046474 Bacteria 5539
382 Ga0495605_0010861 3300046474 Bacteria 5086
383 Ga0495605_0013399 3300046474 Bacteria 4519
384 Ga0495662_0058256 3300046476 Bacteria 1866
385 Ga0495664_0002386 3300046477 Bacteria 10071
386 Ga0495664_0003145 3300046477 Bacteria 8962
387 Ga0495664_0009565 3300046477 Bacteria 5425
388 Ga0495664_0119121 3300046477 Bacteria 1596
389 Ga0495664_0129195 3300046477 Bacteria 1529
390 Ga0495585_0051408 3300046492 Bacteria 2284
391 Ga0495594_0008865 3300046499 Bacteria 5188
392 Ga0495596_0001353 3300046500 Bacteria 14135
393 Ga0495596_0003864 3300046500 Bacteria 7435
394 Ga0495596_0146701 3300046500 Bacteria 916
395 Ga0495607_0084236 3300046501 Bacteria 1740
396 Ga0495607_0108456 3300046501 Bacteria 1475
397 Ga0495607_0114075 3300046501 Bacteria 1428
398 Ga0495583_0007319 3300046506 Bacteria 6967
399 Ga0495583_0106865 3300046506 Bacteria 1189
400 Ga0495606_0004933 3300046507 Bacteria 13055
401 Ga0495606_0012112 3300046507 Bacteria 6955
402 Ga0495606_0036402 3300046507 Bacteria 3352
403 Ga0495606_0051889 3300046507 Bacteria 2672
404 Ga0495606_0073580 3300046507 Bacteria 2143
405 Ga0495606_0235458 3300046507 Bacteria 1024
406 Ga0495608_0002927 3300046511 Bacteria 12219
407 Ga0495608_0010391 3300046511 Bacteria 6496
408 Ga0495610_0003389 3300046512 Bacteria 12453
409 Ga0495610_0004911 3300046512 Bacteria 9707
410 Ga0495616_0003505 3300046513 Bacteria 10038
411 Ga0495618_0006148 3300046514 Bacteria 7282
412 Ga0495618_0007914 3300046514 Bacteria 6432
413 Ga0495618_0164271 3300046514 Bacteria 1414
414 Ga0495620_0007989 3300046515 Bacteria 5704
415 Ga0495620_0066637 3300046515 Bacteria 1483
416 Ga0495628_0002937 3300046516 Bacteria 15290
417 Ga0495628_0019034 3300046516 Bacteria 5681
418 Ga0495628_0019360 3300046516 Bacteria 5628
419 Ga0495628_0027677 3300046516 Bacteria 4609
420 Ga0495628_0308272 3300046516 Bacteria 1170
421 Ga0495630_0011582 3300046517 Bacteria 6387
422 Ga0495630_0012994 3300046517 Bacteria 6048
423 Ga0495630_0021317 3300046517 Bacteria 4784
424 Ga0495643_0056191 3300046522 Bacteria 2102
425 Ga0495643_0077829 3300046522 Bacteria 1732
426 Ga0495648_0002395 3300046524 Bacteria 17417
427 Ga0495648_0017409 3300046524 Bacteria 5136
428 Ga0495648_0039069 3300046524 Bacteria 3025
429 Ga0495648_0149737 3300046524 Bacteria 1218
430 Ga0495666_0001657 3300046526 Bacteria 10984
431 Ga0495666_0001790 3300046526 Bacteria 10609
432 Ga0495666_0004062 3300046526 Bacteria 7394
433 Ga0495666_0006010 3300046526 Bacteria 6115
434 Ga0495666_0094474 3300046526 Bacteria 1410
435 Ga0495642_0013276 3300046528 Bacteria 3184
436 Ga0495642_0025133 3300046528 Bacteria 2359
437 Ga0495642_0050527 3300046528 Bacteria 1710
438 Ga0495652_0014261 3300046529 Bacteria 7135
439 Ga0495652_0023285 3300046529 Bacteria 5490
440 Ga0495652_0045976 3300046529 Bacteria 3749
441 Ga0495652_0117296 3300046529 Bacteria 2130
442 Ga0495652_0260948 3300046529 Bacteria 1279
443 Ga0495652_0277998 3300046529 Bacteria 1227
444 Ga0495665_0002607 3300046531 Bacteria 9722
445 Ga0495665_0008135 3300046531 Bacteria 5686
446 Ga0495665_0012583 3300046531 Bacteria 4581
447 Ga0495665_0053635 3300046531 Bacteria 2131
448 Ga0495665_0059572 3300046531 Bacteria 2015
449 Ga0495640_0001692 3300046533 Bacteria 17480
450 Ga0495640_0008723 3300046533 Bacteria 7944
451 Ga0495640_0011786 3300046533 Bacteria 6708
452 Ga0495640_0238523 3300046533 Bacteria 1142
453 Ga0495586_0017125 3300046535 Bacteria 3852
454 Ga0495586_0025736 3300046535 Bacteria 3149
455 Ga0495586_0308787 3300046535 Bacteria 906
456 Ga0495587_0002128 3300046536 Bacteria 13240
457 Ga0495587_0002572 3300046536 Bacteria 12127
458 Ga0495597_0049392 3300046542 Bacteria 1859
459 Ga0495597_0076122 3300046542 Bacteria 1439
460 Ga0495645_0002333 3300046543 Bacteria 12884
461 Ga0495645_0022208 3300046543 Bacteria 4590
462 Ga0495645_0032134 3300046543 Bacteria 3827
463 Ga0495645_0314824 3300046543 Bacteria 1018
464 Ga0495622_0000261 3300046557 Bacteria 40237
465 Ga0495622_0061176 3300046557 Bacteria 1744
466 Ga0495667_0012275 3300046559 Bacteria 5807
467 Ga0495667_0086624 3300046559 Bacteria 2031
468 Ga0495667_0199437 3300046559 Bacteria 1281
469 Ga0495667_0368928 3300046559 Bacteria 906
470 Ga0495634_0013485 3300046642 Bacteria 5904
471 Ga0495634_0022592 3300046642 Bacteria 4431
472 Ga0495634_0025826 3300046642 Bacteria 4102
473 Ga0495634_0130015 3300046642 Bacteria 1606
474 Ga0495625_0043075 3300046660 Bacteria 3276
475 Ga0495635_0001389 3300046663 Bacteria 16149
476 Ga0495635_0001568 3300046663 Bacteria 15347
477 Ga0495635_0002914 3300046663 Bacteria 11758
478 Ga0495635_0009299 3300046663 Bacteria 6865
479 Ga0495661_0004582 3300046665 Bacteria 9948
480 Ga0495661_0008864 3300046665 Bacteria 6933
481 Ga0495661_0016112 3300046665 Bacteria 4966
482 Ga0495661_0019414 3300046665 Bacteria 4453
483 Ga0495588_0091803 3300046674 Bacteria 1591
484 Ga0495657_0025883 3300046675 Bacteria 4162
485 Ga0495657_0072273 3300046675 Bacteria 2250
486 Ga0495657_0136087 3300046675 Bacteria 1535
487 Ga0495599_0004990 3300046678 Bacteria 7892
488 Ga0495599_0006633 3300046678 Bacteria 6984
489 Ga0495599_0028497 3300046678 Bacteria 3500
490 Ga0495623_0004012 3300046679 Bacteria 9688
491 Ga0495623_0009974 3300046679 Bacteria 6152
492 Ga0495623_0017269 3300046679 Bacteria 4661
493 Ga0495623_0021130 3300046679 Bacteria 4206
494 Ga0495623_0204261 3300046679 Bacteria 1134
495 Ga0495646_0000876 3300046680 Bacteria 17098
496 Ga0495646_0001158 3300046680 Bacteria 15413
497 Ga0495646_0008842 3300046680 Bacteria 6395
498 Ga0495646_0013704 3300046680 Bacteria 5153
499 Ga0495646_0084889 3300046680 Bacteria 1838
500 Ga0495646_0095152 3300046680 Bacteria 1714
501 Ga0495669_0002443 3300046684 Bacteria 7590
502 Ga0495669_0034441 3300046684 Bacteria 2233
503 Ga0495669_0056694 3300046684 Bacteria 1766
504 Ga0495669_0179912 3300046684 Bacteria 1008
505 Ga0495613_0011272 3300046689 Bacteria 6639
506 Ga0495613_0061570 3300046689 Bacteria 2748
507 Ga0495613_0063426 3300046689 Bacteria 2703
508 Ga0495624_0000760 3300046690 Bacteria 25421
509 Ga0495624_0000837 3300046690 Bacteria 24386
510 Ga0495624_0015612 3300046690 Bacteria 5122
511 Ga0495624_0026511 3300046690 Bacteria 3797
512 Ga0495624_0130225 3300046690 Bacteria 1542
513 Ga0495670_0034885 3300046691 Bacteria 2507
514 Ga0495671_0001641 3300046692 Bacteria 14671
515 Ga0495671_0013399 3300046692 Bacteria 4443
516 Ga0495671_0078096 3300046692 Bacteria 1623
517 Ga0495671_0100786 3300046692 Bacteria 1412
518 Ga0495649_0003950 3300046694 Bacteria 9796
519 Ga0495649_0019044 3300046694 Bacteria 3856
520 Ga0495649_0040150 3300046694 Bacteria 2564
521 Ga0495649_0040160 3300046694 Bacteria 2563
522 Ga0495649_0049077 3300046694 Bacteria 2293
523 Ga0495649_0115186 3300046694 Bacteria 1423
524 Ga0495649_0255842 3300046694 Bacteria 898
525 Ga0495589_0002074 3300046794 Bacteria 11340
526 Ga0495589_0074589 3300046794 Bacteria 1655
527 Ga0495589_0102612 3300046794 Bacteria 1383
528 Ga0495600_0001036 3300046809 Bacteria 15035
529 Ga0495600_0004100 3300046809 Bacteria 8666
530 Ga0495600_0278850 3300046809 Bacteria 1058
531 Ga0495660_0062448 3300046810 Bacteria 1997
532 Ga0495581_0000205 3300047315 Bacteria 27705
533 Ga0495581_0001037 3300047315 Bacteria 15033
534 Ga0495581_0007062 3300047315 Bacteria 6508
535 Ga0495604_0003933 3300047317 Bacteria 11835
536 Ga0495604_0007249 3300047317 Bacteria 8776
537 Ga0495604_0008793 3300047317 Bacteria 7982
538 Ga0495604_0031015 3300047317 Bacteria 4241
539 Ga0495604_0065729 3300047317 Bacteria 2760
540 Ga0495636_0004910 3300047318 Bacteria 5241
541 Ga0495674_0009179 3300047319 Bacteria 9397
542 Ga0495674_0029315 3300047319 Bacteria 5013
543 Ga0495674_0038257 3300047319 Bacteria 4307
544 Ga0495674_0043002 3300047319 Bacteria 4025
545 Ga0495674_0086256 3300047319 Bacteria 2688
546 Ga0495674_0132220 3300047319 Bacteria 2102
547 Ga0495674_0172244 3300047319 Bacteria 1805
548 Ga0495672_0002139 3300047320 Bacteria 18503
549 Ga0495672_0037456 3300047320 Bacteria 2967
550 Ga0495672_0065113 3300047320 Bacteria 2084
551 Ga0495672_0087196 3300047320 Bacteria 1724
552 Ga0495676_0021991 3300047321 Bacteria 5557
553 Ga0495676_0053150 3300047321 Bacteria 3230
554 Ga0495676_0120433 3300047321 Bacteria 1910
555 Ga0495676_0185946 3300047321 Bacteria 1452
556 Ga0495676_0265647 3300047321 Bacteria 1166
557 Ga0495680_0003346 3300047322 Bacteria 15852
558 Ga0495680_0014131 3300047322 Bacteria 6934
559 Ga0495680_0018949 3300047322 Bacteria 5828
560 Ga0495680_0061093 3300047322 Bacteria 2900
561 Ga0495680_0068559 3300047322 Bacteria 2709
562 Ga0495680_0096316 3300047322 Bacteria 2210
563 Ga0495680_0298105 3300047322 Bacteria 1132
564 Ga0495683_0001095 3300047323 Bacteria 18700
565 Ga0495683_0001218 3300047323 Bacteria 17520
566 Ga0495683_0004336 3300047323 Bacteria 8084
567 Ga0495683_0007441 3300047323 Bacteria 5919
568 Ga0495683_0029302 3300047323 Bacteria 2813
569 Ga0495683_0033657 3300047323 Bacteria 2607
570 Ga0495687_000121 3300047443 Bacteria 120336
571 Ga0495687_009193 3300047443 Bacteria 5557
572 Ga0495687_023302 3300047443 Bacteria 2958
573 Ga0495687_024410 3300047443 Bacteria 2874
574 Ga0495687_034640 3300047443 Bacteria 2279
575 Ga0495687_063610 3300047443 Bacteria 1510
576 Ga0495675_0001385 3300047444 Bacteria 14702
577 Ga0495675_0015401 3300047444 Bacteria 4836
578 Ga0495675_0027284 3300047444 Bacteria 3639
579 Ga0495675_0122752 3300047444 Bacteria 1617
580 Ga0495675_0278239 3300047444 Bacteria 998
581 Ga0495679_000104 3300047446 Bacteria 76092
582 Ga0495679_001709 3300047446 Bacteria 12146
583 Ga0495679_002309 3300047446 Bacteria 9815
584 Ga0495679_050828 3300047446 Bacteria 1245
585 Ga0495673_0001658 3300047469 Bacteria 17171
586 Ga0495673_0020806 3300047469 Bacteria 3258
587 Ga0495673_0071240 3300047469 Bacteria 1462
588 Ga0495684_0003570 3300047471 Bacteria 12141
589 Ga0495684_0056634 3300047471 Bacteria 2988
590 Ga0495686_0000029 3300047472 Bacteria 369110
591 Ga0495686_0167648 3300047472 Bacteria 1279
592 Ga0495686_0299600 3300047472 Bacteria 888
593 Ga0495593_0000318 3300047673 Bacteria 26611
594 Ga0495593_0003012 3300047673 Bacteria 10155
595 Ga0495593_0004851 3300047673 Bacteria 7982
596 Ga0495593_0005400 3300047673 Bacteria 7556
597 Ga0495593_0015794 3300047673 Bacteria 4267
598 Ga0495602_0004873 3300048088 Bacteria 14054
599 Ga0495602_0012845 3300048088 Bacteria 8585
600 Ga0495602_0026888 3300048088 Bacteria 5540
601 Ga0495602_0042354 3300048088 Bacteria 4149
602 Ga0495602_0044746 3300048088 Bacteria 4011
603 Ga0495602_0045862 3300048088 Bacteria 3952
604 Ga0495602_0048673 3300048088 Bacteria 3806
605 Ga0495614_0001394 3300048089 Bacteria 10422
606 Ga0495614_0009436 3300048089 Bacteria 4313
607 Ga0495614_0015509 3300048089 Bacteria 3322
608 Ga0495626_0005536 3300048091 Bacteria 7348
609 Ga0495626_0024956 3300048091 Bacteria 2926
610 Ga0495626_0046809 3300048091 Bacteria 2013
611 Ga0496100_0000649 3300048903 Bacteria 16516
612 Ga0496101_0001358 3300048904 Bacteria 14658
613 Ga0496101_0050352 3300048904 Bacteria 2998
614 Ga0496101_0101991 3300048904 Bacteria 2149
615 Ga0496101_0181997 3300048904 Bacteria 1618
616 Ga0496101_0184800 3300048904 Bacteria 1606
617 Ga0496102_0004884 3300048905 Bacteria 11350
618 Ga0496102_0049979 3300048905 Bacteria 3806
619 Ga0496102_0124609 3300048905 Bacteria 2408
620 Ga0496102_0145151 3300048905 Bacteria 2227
621 Ga0496102_0240940 3300048905 Bacteria 1705
622 Ga0496102_0354822 3300048905 Bacteria 1380
623 Ga0496103_0001036 3300048906 Bacteria 19456
624 Ga0496103_0002646 3300048906 Bacteria 11204
625 Ga0496104_0032486 3300048907 Bacteria 4858
626 Ga0496104_0142614 3300048907 Bacteria 2301
627 Ga0496104_0213880 3300048907 Bacteria 1839
628 Ga0496105_0011734 3300048908 Bacteria 6933
629 Ga0496105_0058456 3300048908 Bacteria 3183
630 Ga0496105_0091612 3300048908 Bacteria 2510
631 Ga0496105_0158479 3300048908 Bacteria 1858
632 Ga0496105_0273560 3300048908 Bacteria 1363
633 Ga0496106_0000008 3300048909 Bacteria 248430
634 Ga0496106_0001646 3300048909 Bacteria 16768
635 Ga0496106_0048626 3300048909 Bacteria 3194
636 Ga0496106_0202125 3300048909 Bacteria 1581
637 Ga0496107_0040907 3300048910 Bacteria 3328
638 Ga0496110_0022256 3300048913 Bacteria 5379
639 Ga0496110_0543560 3300048913 Bacteria 1056
640 Ga0496111_0044660 3300048914 Bacteria 3185
641 Ga0496112_0026025 3300048915 Bacteria 5624
642 Ga0496112_0055391 3300048915 Bacteria 3899
643 Ga0496113_0003960 3300048916 Bacteria 8995
644 Ga0496113_0004344 3300048916 Bacteria 8685
645 Ga0496114_0085255 3300048917 Bacteria 2676
646 Ga0496114_0182499 3300048917 Bacteria 1833
647 Ga0496115_0082855 3300048918 Bacteria 2614
648 Ga0496115_0184026 3300048918 Bacteria 1726
649 Ga0496115_0260887 3300048918 Bacteria 1425
650 Ga0496115_0331433 3300048918 Bacteria 1243
651 Ga0496115_0350720 3300048918 Bacteria 1204
652 Ga0496116_0001067 3300048919 Bacteria 33110
653 Ga0496116_0014324 3300048919 Bacteria 6339
654 Ga0496116_0022841 3300048919 Bacteria 4673
655 Ga0496116_0027277 3300048919 Bacteria 4161
656 Ga0496116_0107651 3300048919 Bacteria 1647
657 Ga0496117_0000524 3300048920 Bacteria 63297
658 Ga0496117_0007007 3300048920 Bacteria 11169
659 Ga0496117_0045265 3300048920 Bacteria 3181
660 Ga0496117_0096840 3300048920 Bacteria 1881
661 Ga0496117_0165008 3300048920 Bacteria 1293
662 Ga0496117_0170237 3300048920 Bacteria 1265
663 Ga0496117_0209950 3300048920 Bacteria 1092
664 Ga0496117_0225768 3300048920 Bacteria 1038
665 Ga0496118_0000495 3300048921 Bacteria 65385
666 Ga0496118_0001212 3300048921 Bacteria 39684
667 Ga0496118_0001688 3300048921 Bacteria 32271
668 Ga0496118_0020303 3300048921 Bacteria 5895
669 Ga0496118_0026876 3300048921 Bacteria 4887
670 Ga0496118_0041110 3300048921 Bacteria 3665
671 Ga0496118_0041494 3300048921 Bacteria 3642
672 Ga0496118_0152366 3300048921 Bacteria 1445
673 Ga0496118_0162331 3300048921 Bacteria 1379
674 Ga0496119_0036771 3300048922 Bacteria 3190
675 Ga0496120_0098009 3300048923 Bacteria 1555
676 Ga0496121_0001094 3300048924 Bacteria 47846
677 Ga0496121_0002471 3300048924 Bacteria 28191
678 Ga0496121_0002912 3300048924 Bacteria 25105
679 Ga0496121_0005525 3300048924 Bacteria 16155
680 Ga0496121_0027948 3300048924 Bacteria 5266
681 Ga0496121_0054557 3300048924 Bacteria 3338
682 Ga0496121_0397089 3300048924 Bacteria 904
683 Ga0496122_0013659 3300048925 Bacteria 7926
684 Ga0496122_0018958 3300048925 Bacteria 6315
685 Ga0496123_0017175 3300048926 Bacteria 5838
686 Ga0496123_0020291 3300048926 Bacteria 5204
687 Ga0496124_0008642 3300048927 Bacteria 10608
688 Ga0496124_0043409 3300048927 Bacteria 3866
689 Ga0496125_0026155 3300048928 Bacteria 5328
690 Ga0496125_0031511 3300048928 Bacteria 4725
691 Ga0496126_0000197 3300048929 Bacteria 134050
692 Ga0496126_0000277 3300048929 Bacteria 108040
693 Ga0496126_0000949 3300048929 Bacteria 49771
694 Ga0496126_0021680 3300048929 Bacteria 6271
695 Ga0496126_0181791 3300048929 Bacteria 1786
696 Ga0496126_0492895 3300048929 Bacteria 980
697 Ga0495678_016093 3300049459 Bacteria 3429
698 Ga0495682_0017076 3300049460 Bacteria 2743
699 Ga0495682_0023676 3300049460 Bacteria 2291
700 Ga0501034_0000188 3300049571 Bacteria 115935
701 Ga0501043_0264764 3300049579 Bacteria 1321
702 Ga0500618_001173 3300053125 Bacteria 12647
703 Ga0587088_000141 3300059508 Bacteria 4524
704 Ga0587067_000199 3300059640 Bacteria 4457
705 Ga0587072_000094 3300059643 Bacteria 6924
706 Ga0466962_0004256 3300061719 Bacteria 6857
707 Ga0466962_0032005 3300061719 Bacteria 2518
708 Ga0466962_0073040 3300061719 Bacteria 1639
709 Ga0466962_0082239 3300061719 Bacteria 1540

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300061719 Ga0466962_0082239 Ga0466962_0082239_499_1305 215
2 3300048915 Ga0496112_0055391 Ga0496112_0055391_11_709 222
3 3300003758 Ga0055532_1001525 Ga0055532_10015252 230
4 3300003841 Ga0055541_1004447 Ga0055541_10044472 230
5 3300025225 Ga0209566_101405 Ga0209566_1014051 230
6 3300025229 Ga0209147_100166 Ga0209147_10016680 230
7 3300025913 Ga0207695_10001212 Ga0207695_1000121234 230
8 3300053125 Ga0500618_001173 Ga0500618_001173_3036_3842 231
9 3300009093 Ga0105240_10002402 Ga0105240_1000240212 232
10 3300014497 Ga0182008_10030216 Ga0182008_100302163 235
11 3300015262 Ga0182007_10031068 Ga0182007_100310682 235
12 3300039447 Ga0436361_0721425 Ga0436361_0721425_37_840 237
13 3300003320 rootH2_10072564 rootH2_100725645 238
14 3300003758 Ga0055532_1000406 Ga0055532_100040616 238
15 3300003758 Ga0055532_1001528 Ga0055532_10015282 238
16 3300003760 Ga0055527_1000250 Ga0055527_100025030 238
17 3300003760 Ga0055527_1000599 Ga0055527_10005994 238
18 3300003761 Ga0055535_1000529 Ga0055535_100052930 238
19 3300003761 Ga0055535_1000554 Ga0055535_100055430 238
20 3300003762 Ga0055542_1000574 Ga0055542_100057430 238
21 3300003762 Ga0055542_1001479 Ga0055542_10014794 238
22 3300003763 Ga0055529_1000549 Ga0055529_100054930 238
23 3300003763 Ga0055529_1003682 Ga0055529_10036821 238
24 3300003790 Ga0055528_1004945 Ga0055528_10049455 238
25 3300003856 Ga0058692_1011696 Ga0058692_10116963 238
26 3300025228 Ga0209672_100036 Ga0209672_100036208 238
27 3300025228 Ga0209672_100050 Ga0209672_100050113 238
28 3300025229 Ga0209147_100066 Ga0209147_100066208 238
29 3300025229 Ga0209147_100075 Ga0209147_10007577 238
30 3300025242 Ga0209258_100085 Ga0209258_100085208 238
31 3300025242 Ga0209258_100175 Ga0209258_100175113 238
32 3300025254 Ga0209148_1000174 Ga0209148_1000174113 238
33 3300025254 Ga0209148_1000597 Ga0209148_10005979 238
34 3300025256 Ga0209759_1001014 Ga0209759_10010143 238
35 3300025263 Ga0209565_1013427 Ga0209565_10134272 238
36 3300025272 Ga0209455_1000139 Ga0209455_100013992 238
37 3300025272 Ga0209455_1000424 Ga0209455_100042410 238
38 3300025273 Ga0209673_1000028 Ga0209673_100002833 238
39 3300025295 Ga0209564_1005151 Ga0209564_10051517 238
40 3300027312 Ga0209371_1000379 Ga0209371_100037942 238
41 3300030500 Ga0268256_1000369 Ga0268256_100036943 238
42 3300039437 Ga0436365_0026194 Ga0436365_0026194_1111_1920 240
43 3300044693 Ga0466961_0023146 Ga0466961_0023146_84_893 241
44 3300044765 Ga0466970_0023662 Ga0466970_0023662_28_837 241
45 3300037312 Ga0395899_0138090 Ga0395899_0138090_964_1710 242
46 3300044842 Ga0466957_0083721 Ga0466957_0083721_857_1666 245
47 3300005455 Ga0070663_100355538 Ga0070663_1003555382 249
48 3300009098 Ga0105245_10377777 Ga0105245_103777771 249
49 3300013105 Ga0157369_10044697 Ga0157369_100446971 249
50 3300025256 Ga0209759_1005147 Ga0209759_10051475 249
51 3300025904 Ga0207647_10042140 Ga0207647_100421403 249
52 3300025919 Ga0207657_10104734 Ga0207657_101047342 249
53 3300025924 Ga0207694_10169043 Ga0207694_101690432 249
54 3300026067 Ga0207678_10423264 Ga0207678_104232642 249
55 3300031911 Ga0307412_10000064 Ga0307412_1000006478 249
56 3300046474 Ga0495605_0002814 Ga0495605_0002814_1593_2402 249
57 3300046500 Ga0495596_0146701 Ga0495596_0146701_43_852 249
58 3300046507 Ga0495606_0073580 Ga0495606_0073580_1223_2032 249
59 3300046512 Ga0495610_0003389 Ga0495610_0003389_9774_10583 249
60 3300046522 Ga0495643_0056191 Ga0495643_0056191_314_1123 249
61 3300046694 Ga0495649_0115186 Ga0495649_0115186_344_1153 249
62 3300047323 Ga0495683_0007441 Ga0495683_0007441_1506_2315 249
63 3300048921 Ga0496118_0162331 Ga0496118_0162331_328_1137 249
64 3300028800 Ga0265338_10000120 Ga0265338_1000012088 250
65 3300002067 JGI24735J21928_10009105 JGI24735J21928_100091054 252
66 3300009011 Ga0105251_10000300 Ga0105251_1000030024 252
67 3300011119 Ga0105246_10038767 Ga0105246_100387672 252
68 3300013296 Ga0157374_10333333 Ga0157374_103333332 252
69 3300025302 Ga0207426_1004899 Ga0207426_10048995 252
70 3300025735 Ga0207713_1012592 Ga0207713_10125924 252
71 3300046457 Ga0495590_0015988 Ga0495590_0015988_754_1575 252
72 3300046477 Ga0495664_0009565 Ga0495664_0009565_3871_4692 252
73 3300046507 Ga0495606_0051889 Ga0495606_0051889_496_1317 252
74 3300046680 Ga0495646_0084889 Ga0495646_0084889_719_1540 252
75 3300046684 Ga0495669_0034441 Ga0495669_0034441_968_1789 252
76 3300046694 Ga0495649_0040150 Ga0495649_0040150_1456_2277 252
77 3300047319 Ga0495674_0132220 Ga0495674_0132220_179_1000 252
78 3300047322 Ga0495680_0298105 Ga0495680_0298105_92_913 252
79 3300047323 Ga0495683_0004336 Ga0495683_0004336_3892_4713 252
80 3300047443 Ga0495687_063610 Ga0495687_063610_94_915 252
81 3300047444 Ga0495675_0027284 Ga0495675_0027284_441_1262 252
82 3300047444 Ga0495675_0278239 Ga0495675_0278239_155_976 252
83 3300048904 Ga0496101_0181997 Ga0496101_0181997_773_1594 252
84 3300048905 Ga0496102_0354822 Ga0496102_0354822_25_846 252
85 3300048906 Ga0496103_0002646 Ga0496103_0002646_9398_10219 252
86 3300048907 Ga0496104_0213880 Ga0496104_0213880_658_1479 252
87 3300048908 Ga0496105_0091612 Ga0496105_0091612_1314_2135 252
88 3300048909 Ga0496106_0001646 Ga0496106_0001646_2351_3172 252
89 3300048914 Ga0496111_0044660 Ga0496111_0044660_1561_2382 252
90 3300048915 Ga0496112_0026025 Ga0496112_0026025_3425_4246 252
91 3300048916 Ga0496113_0004344 Ga0496113_0004344_5480_6301 252
92 3300048919 Ga0496116_0001067 Ga0496116_0001067_27602_28423 252
93 3300048920 Ga0496117_0096840 Ga0496117_0096840_966_1787 252
94 3300048921 Ga0496118_0041110 Ga0496118_0041110_1212_2033 252
95 3300048923 Ga0496120_0098009 Ga0496120_0098009_488_1309 252
96 3300048924 Ga0496121_0002471 Ga0496121_0002471_4209_5030 252
97 3300048925 Ga0496122_0018958 Ga0496122_0018958_1325_2146 252
98 3300048926 Ga0496123_0017175 Ga0496123_0017175_587_1408 252
99 3300048927 Ga0496124_0008642 Ga0496124_0008642_9157_9978 252
100 3300048928 Ga0496125_0026155 Ga0496125_0026155_4048_4869 252
101 3300002067 JGI24735J21928_10012431 JGI24735J21928_100124313 253
102 3300002705 JGI25156J39149_1001070 JGI25156J39149_10010707 253
103 3300002705 JGI25156J39149_1001809 JGI25156J39149_10018093 253
104 3300003214 JGI25165J46597_1001040 JGI25165J46597_10010409 253
105 3300003756 Ga0055533_1000180 Ga0055533_100018013 253
106 3300003756 Ga0055533_1000875 Ga0055533_10008753 253
107 3300003758 Ga0055532_1000069 Ga0055532_100006935 253
108 3300003760 Ga0055527_1000034 Ga0055527_100003435 253
109 3300003761 Ga0055535_1000049 Ga0055535_100004935 253
110 3300003762 Ga0055542_1000077 Ga0055542_100007798 253
111 3300003763 Ga0055529_1000090 Ga0055529_100009034 253
112 3300009093 Ga0105240_10156634 Ga0105240_101566342 253
113 3300009551 Ga0105238_10277754 Ga0105238_102777542 253
114 3300037471 Ga0395905_0091549 Ga0395905_0091549_482_1303 253
115 3300044659 Ga0466973_0020274 Ga0466973_0020274_3648_4454 253
116 3300044693 Ga0466961_0001585 Ga0466961_0001585_6974_7780 253
117 3300044694 Ga0466963_0005061 Ga0466963_0005061_5678_6484 253
118 3300044706 Ga0466964_0095296 Ga0466964_0095296_85_891 253
119 3300044719 Ga0466971_0006091 Ga0466971_0006091_2484_3290 253
120 3300044765 Ga0466970_0128420 Ga0466970_0128420_293_1099 253
121 3300044842 Ga0466957_0002393 Ga0466957_0002393_1629_2435 253
122 3300045049 Ga0466959_0005102 Ga0466959_0005102_5721_6527 253
123 iso_pu_bacteria 2515154123 2515690251 253
124 3300025226 Ga0209674_100139 Ga0209674_10013991 254
125 3300025226 Ga0209674_100191 Ga0209674_10019151 254
126 3300025228 Ga0209672_100002 Ga0209672_1000021383 254
127 3300025229 Ga0209147_100003 Ga0209147_1000031383 254
128 3300025230 Ga0209563_103125 Ga0209563_1031254 254
129 3300025242 Ga0209258_100077 Ga0209258_10007738 254
130 3300025254 Ga0209148_1000006 Ga0209148_10000061383 254
131 3300025256 Ga0209759_1000170 Ga0209759_100017091 254
132 3300025256 Ga0209759_1000334 Ga0209759_100033437 254
133 3300025261 Ga0209233_1000177 Ga0209233_100017791 254
134 3300025272 Ga0209455_1000140 Ga0209455_100014092 254
135 3300025904 Ga0207647_10133566 Ga0207647_101335662 254
136 3300046454 Ga0495592_0008385 Ga0495592_0008385_6376_7185 254
137 3300046459 Ga0495629_0010764 Ga0495629_0010764_2537_3346 254
138 3300046463 Ga0495653_0011127 Ga0495653_0011127_3116_3925 254
139 3300046471 Ga0495650_0076611 Ga0495650_0076611_32_841 254
140 3300046472 Ga0495580_0032771 Ga0495580_0032771_2276_3085 254
141 3300046473 Ga0495582_0004932 Ga0495582_0004932_3580_4389 254
142 3300046477 Ga0495664_0119121 Ga0495664_0119121_580_1389 254
143 3300046511 Ga0495608_0010391 Ga0495608_0010391_2840_3649 254
144 3300046515 Ga0495620_0066637 Ga0495620_0066637_550_1359 254
145 3300046516 Ga0495628_0308272 Ga0495628_0308272_158_967 254
146 3300046517 Ga0495630_0012994 Ga0495630_0012994_4231_5040 254
147 3300046522 Ga0495643_0077829 Ga0495643_0077829_183_992 254
148 3300046526 Ga0495666_0001657 Ga0495666_0001657_5824_6633 254
149 3300046529 Ga0495652_0023285 Ga0495652_0023285_870_1679 254
150 3300046531 Ga0495665_0008135 Ga0495665_0008135_2062_2871 254
151 3300046533 Ga0495640_0008723 Ga0495640_0008723_566_1375 254
152 3300046535 Ga0495586_0017125 Ga0495586_0017125_2671_3480 254
153 3300046542 Ga0495597_0049392 Ga0495597_0049392_60_869 254
154 3300046543 Ga0495645_0022208 Ga0495645_0022208_3331_4140 254
155 3300046559 Ga0495667_0012275 Ga0495667_0012275_238_1047 254
156 3300046642 Ga0495634_0013485 Ga0495634_0013485_335_1144 254
157 3300046663 Ga0495635_0002914 Ga0495635_0002914_4599_5408 254
158 3300046675 Ga0495657_0025883 Ga0495657_0025883_2702_3511 254
159 3300046679 Ga0495623_0017269 Ga0495623_0017269_3517_4326 254
160 3300046680 Ga0495646_0013704 Ga0495646_0013704_3639_4448 254
161 3300046684 Ga0495669_0179912 Ga0495669_0179912_182_991 254
162 3300046689 Ga0495613_0061570 Ga0495613_0061570_787_1596 254
163 3300046690 Ga0495624_0026511 Ga0495624_0026511_2928_3737 254
164 3300046694 Ga0495649_0019044 Ga0495649_0019044_2256_3065 254
165 3300046794 Ga0495589_0102612 Ga0495589_0102612_206_1015 254
166 3300046809 Ga0495600_0004100 Ga0495600_0004100_6361_7170 254
167 3300047315 Ga0495581_0001037 Ga0495581_0001037_10583_11392 254
168 3300047317 Ga0495604_0031015 Ga0495604_0031015_505_1314 254
169 3300047319 Ga0495674_0038257 Ga0495674_0038257_3469_4278 254
170 3300047321 Ga0495676_0185946 Ga0495676_0185946_208_1017 254
171 3300047322 Ga0495680_0096316 Ga0495680_0096316_777_1586 254
172 3300047323 Ga0495683_0001095 Ga0495683_0001095_735_1544 254
173 3300047443 Ga0495687_024410 Ga0495687_024410_1598_2407 254
174 3300047444 Ga0495675_0015401 Ga0495675_0015401_2364_3173 254
175 3300047471 Ga0495684_0056634 Ga0495684_0056634_1134_1943 254
176 3300047673 Ga0495593_0015794 Ga0495593_0015794_531_1340 254
177 3300048088 Ga0495602_0044746 Ga0495602_0044746_87_896 254
178 3300048089 Ga0495614_0001394 Ga0495614_0001394_2816_3625 254
179 iso_pu_bacteria 2519103095 2519461239 254
180 iso_pu_bacteria 2582581311 2585290115 254
181 iso_pu_bacteria 2599185239 2599735487 254
182 iso_pu_bacteria 2599185240 2599745764 254
183 iso_pu_bacteria 2599185355 2600207672 254
184 iso_pu_bacteria 2675903129 2676745222 254
185 iso_pu_bacteria 2808606384 2808974371 254
186 iso_pu_bacteria 2808606390 2809009157 254
187 iso_pu_bacteria 2808606391 2809016308 254
188 iso_pu_bacteria 2816332253 2817258935 254
189 iso_pu_bacteria 2816332256 2817280644 254
190 iso_pu_bacteria 2816332286 2817454848 254
191 iso_pu_bacteria 2818991452 2819630486 254
192 iso_pu_bacteria 2863421361 2863425979 254
193 iso_pu_bacteria 2870068957 2870074923 254
194 iso_pu_bacteria 2904564687 2904565421 254
195 iso_pu_bacteria 2904571731 2904571883 254
196 iso_pu_bacteria 2928157003 2928157644 254
197 iso_pu_bacteria 2928163908 2928165397 254
198 iso_pu_bacteria 2928170801 2928174258 254
199 iso_pu_bacteria 2928536128 2928537199 254
200 iso_pu_bacteria 2981990288 2981990665 254
201 iso_pu_bacteria 641736154 642418159 254
202 iso_pu_bacteria 8018845410 8018851819 254
203 iso_pu_bacteria 8020807995 8020809131 254
204 iso_pu_bacteria 8020938398 8020941566 254
205 iso_pu_bacteria 8020945358 8020948725 254
206 iso_pu_bacteria 8020953355 8020955545 254
207 iso_pu_bacteria 8021120328 8021120977 254
208 iso_pu_bacteria 8039098773 8039101701 254
209 iso_pu_bacteria 8040167225 8040168056 254
210 iso_pu_bacteria 8040173305 8040174523 254
211 3300013105 Ga0157369_10013854 Ga0157369_100138549 255
212 3300037312 Ga0395899_0000097 Ga0395899_0000097_71828_72634 255
213 3300037418 Ga0395900_0000225 Ga0395900_0000225_8806_9612 255
214 3300037466 Ga0395898_0000407 Ga0395898_0000407_71605_72411 255
215 3300044683 Ga0466965_0208553 Ga0466965_0208553_66_887 256
216 3300044765 Ga0466970_0039146 Ga0466970_0039146_946_1767 256
217 3300045049 Ga0466959_0109222 Ga0466959_0109222_221_1042 256
218 3300046455 Ga0495603_0010798 Ga0495603_0010798_1633_2454 256
219 3300046459 Ga0495629_0000127 Ga0495629_0000127_59679_60485 256
220 3300046459 Ga0495629_0000426 Ga0495629_0000426_16837_17658 256
221 3300046462 Ga0495651_0019663 Ga0495651_0019663_176_982 256
222 3300046463 Ga0495653_0001458 Ga0495653_0001458_15329_16135 256
223 3300046463 Ga0495653_0109111 Ga0495653_0109111_210_1016 256
224 3300046471 Ga0495650_0001593 Ga0495650_0001593_764_1585 256
225 3300046471 Ga0495650_0010011 Ga0495650_0010011_611_1417 256
226 3300046472 Ga0495580_0000611 Ga0495580_0000611_23131_23937 256
227 3300046472 Ga0495580_0165524 Ga0495580_0165524_186_992 256
228 3300046473 Ga0495582_0253573 Ga0495582_0253573_137_958 256
229 3300046476 Ga0495662_0058256 Ga0495662_0058256_653_1474 256
230 3300046506 Ga0495583_0106865 Ga0495583_0106865_318_1139 256
231 3300046507 Ga0495606_0004933 Ga0495606_0004933_5845_6666 256
232 3300046507 Ga0495606_0036402 Ga0495606_0036402_591_1412 256
233 3300046516 Ga0495628_0019034 Ga0495628_0019034_1552_2358 256
234 3300046516 Ga0495628_0019360 Ga0495628_0019360_1222_2028 256
235 3300046526 Ga0495666_0004062 Ga0495666_0004062_832_1638 256
236 3300046528 Ga0495642_0013276 Ga0495642_0013276_1523_2344 256
237 3300046529 Ga0495652_0117296 Ga0495652_0117296_1278_2099 256
238 3300046529 Ga0495652_0260948 Ga0495652_0260948_156_962 256
239 3300046529 Ga0495652_0277998 Ga0495652_0277998_142_948 256
240 3300046535 Ga0495586_0025736 Ga0495586_0025736_113_934 256
241 3300046543 Ga0495645_0032134 Ga0495645_0032134_422_1243 256
242 3300046559 Ga0495667_0086624 Ga0495667_0086624_695_1516 256
243 3300046559 Ga0495667_0368928 Ga0495667_0368928_73_879 256
244 3300046642 Ga0495634_0130015 Ga0495634_0130015_169_990 256
245 3300046674 Ga0495588_0091803 Ga0495588_0091803_79_900 256
246 3300046675 Ga0495657_0072273 Ga0495657_0072273_165_971 256
247 3300046678 Ga0495599_0004990 Ga0495599_0004990_6239_7045 256
248 3300046679 Ga0495623_0204261 Ga0495623_0204261_141_947 256
249 3300046680 Ga0495646_0095152 Ga0495646_0095152_472_1278 256
250 3300046690 Ga0495624_0000837 Ga0495624_0000837_6259_7065 256
251 3300046690 Ga0495624_0015612 Ga0495624_0015612_1012_1818 256
252 3300046692 Ga0495671_0078096 Ga0495671_0078096_210_1016 256
253 3300046692 Ga0495671_0100786 Ga0495671_0100786_312_1133 256
254 3300046694 Ga0495649_0003950 Ga0495649_0003950_5795_6616 256
255 3300046794 Ga0495589_0074589 Ga0495589_0074589_551_1372 256
256 3300047315 Ga0495581_0007062 Ga0495581_0007062_3939_4760 256
257 3300047317 Ga0495604_0007249 Ga0495604_0007249_5572_6378 256
258 3300047322 Ga0495680_0061093 Ga0495680_0061093_499_1305 256
259 3300047323 Ga0495683_0033657 Ga0495683_0033657_1131_1952 256
260 3300047443 Ga0495687_009193 Ga0495687_009193_1670_2491 256
261 3300047446 Ga0495679_050828 Ga0495679_050828_88_909 256
262 3300047673 Ga0495593_0004851 Ga0495593_0004851_6293_7099 256
263 3300048088 Ga0495602_0045862 Ga0495602_0045862_2700_3506 256
264 3300048904 Ga0496101_0050352 Ga0496101_0050352_1482_2303 256
265 3300048905 Ga0496102_0049979 Ga0496102_0049979_1770_2576 256
266 3300048907 Ga0496104_0032486 Ga0496104_0032486_1939_2760 256
267 3300048908 Ga0496105_0273560 Ga0496105_0273560_100_921 256
268 3300048917 Ga0496114_0085255 Ga0496114_0085255_1653_2474 256
269 3300048918 Ga0496115_0331433 Ga0496115_0331433_105_926 256
270 3300048920 Ga0496117_0225768 Ga0496117_0225768_117_923 256
271 3300048921 Ga0496118_0001688 Ga0496118_0001688_5562_6368 256
272 3300048929 Ga0496126_0000949 Ga0496126_0000949_24407_25213 256
273 3300002067 JGI24735J21928_10003635 JGI24735J21928_100036355 257
274 3300005339 Ga0070660_100000299 Ga0070660_1000002997 257
275 3300005435 Ga0070714_100436421 Ga0070714_1004364212 257
276 3300005563 Ga0068855_100009290 Ga0068855_1000092902 257
277 3300005616 Ga0068852_100495169 Ga0068852_1004951691 257
278 3300009093 Ga0105240_10004298 Ga0105240_100042984 257
279 3300009545 Ga0105237_10008689 Ga0105237_100086898 257
280 3300010375 Ga0105239_10002119 Ga0105239_1000211916 257
281 3300013100 Ga0157373_10007898 Ga0157373_100078986 257
282 3300013104 Ga0157370_10004905 Ga0157370_100049055 257
283 3300013296 Ga0157374_10000083 Ga0157374_1000008367 257
284 3300013307 Ga0157372_10003299 Ga0157372_100032994 257
285 3300020069 Ga0197907_10618600 Ga0197907_106186002 257
286 3300025904 Ga0207647_10001651 Ga0207647_1000165110 257
287 3300025913 Ga0207695_10010541 Ga0207695_100105416 257
288 3300025919 Ga0207657_10000686 Ga0207657_1000068620 257
289 3300025949 Ga0207667_10040487 Ga0207667_100404874 257
290 3300042005 Ga0439448_0000034 Ga0439448_0000034_7193_7987 257
291 3300042012 Ga0439455_0086032 Ga0439455_0086032_47_841 257
292 3300044656 Ga0466969_0007828 Ga0466969_0007828_1038_1832 257
293 3300044684 Ga0466966_0008530 Ga0466966_0008530_5237_6031 257
294 3300044693 Ga0466961_0019365 Ga0466961_0019365_3243_4037 257
295 3300044765 Ga0466970_0052834 Ga0466970_0052834_13_807 257
296 3300045049 Ga0466959_0011352 Ga0466959_0011352_4031_4825 257
297 iso_pu_bacteria 2513237166 2514054216 257
298 iso_pu_bacteria 2562617112 2563058413 257
299 iso_pu_bacteria 2711768613 2713475048 257
300 iso_pu_bacteria 2721755763 2723877008 257
301 iso_pu_bacteria 2791355137 2792836205 257
302 iso_pu_bacteria 2904615490 2904616034 257
303 iso_pu_bacteria 2921643360 2921653679 257
304 iso_pu_bacteria 642555112 642596164 257
305 3300001989 JGI24739J22299_10003669 JGI24739J22299_100036692 258
306 3300003760 Ga0055527_1005269 Ga0055527_10052692 258
307 3300005339 Ga0070660_100000095 Ga0070660_10000009536 258
308 3300005344 Ga0070661_100077560 Ga0070661_1000775603 258
309 3300005366 Ga0070659_100000427 Ga0070659_1000004277 258
310 3300005616 Ga0068852_100029851 Ga0068852_1000298515 258
311 3300009092 Ga0105250_10040867 Ga0105250_100408672 258
312 3300009093 Ga0105240_10032941 Ga0105240_100329415 258
313 3300009545 Ga0105237_10023896 Ga0105237_100238967 258
314 3300009551 Ga0105238_10013566 Ga0105238_100135664 258
315 3300010375 Ga0105239_10053120 Ga0105239_100531203 258
316 3300013104 Ga0157370_10286033 Ga0157370_102860331 258
317 3300013296 Ga0157374_10249861 Ga0157374_102498612 258
318 3300013307 Ga0157372_10259566 Ga0157372_102595662 258
319 3300015261 Ga0182006_1023287 Ga0182006_10232872 258
320 3300015265 Ga0182005_1005069 Ga0182005_10050694 258
321 3300025228 Ga0209672_100430 Ga0209672_10043018 258
322 3300025711 Ga0207696_1036398 Ga0207696_10363982 258
323 3300025904 Ga0207647_10003526 Ga0207647_100035263 258
324 3300025913 Ga0207695_10281805 Ga0207695_102818052 258
325 3300025919 Ga0207657_10000189 Ga0207657_1000018925 258
326 3300025932 Ga0207690_10000014 Ga0207690_10000014208 258
327 3300025949 Ga0207667_10123605 Ga0207667_101236053 258
328 3300026067 Ga0207678_10000791 Ga0207678_100007914 258
329 3300026142 Ga0207698_10034029 Ga0207698_100340291 258
330 3300028800 Ga0265338_10001517 Ga0265338_100015174 258
331 3300037466 Ga0395898_0010835 Ga0395898_0010835_6296_7102 258
332 3300037471 Ga0395905_0000052 Ga0395905_0000052_151493_152308 258
333 3300044684 Ga0466966_0000056 Ga0466966_0000056_35358_36164 258
334 3300044693 Ga0466961_0000173 Ga0466961_0000173_12586_13392 258
335 3300044694 Ga0466963_0102160 Ga0466963_0102160_1026_1832 258
336 3300045049 Ga0466959_0005932 Ga0466959_0005932_2771_3577 258
337 3300048919 Ga0496116_0107651 Ga0496116_0107651_44_853 258
338 3300048920 Ga0496117_0209950 Ga0496117_0209950_35_844 258
339 3300048921 Ga0496118_0041494 Ga0496118_0041494_2726_3535 258
340 3300048924 Ga0496121_0397089 Ga0496121_0397089_31_840 258
341 3300061719 Ga0466962_0073040 Ga0466962_0073040_464_1270 258
342 iso_pu_bacteria 2501025501 2501076480 258
343 iso_pu_bacteria 2501025502 2501079923 258
344 iso_pu_bacteria 2501025504 2501412141 258
345 iso_pu_bacteria 2508501125 2509130895 258
346 iso_pu_bacteria 2510065045 2510248154 258
347 iso_pu_bacteria 2510917013 2511087810 258
348 iso_pu_bacteria 2510917014 2511101704 258
349 iso_pu_bacteria 2510917015 2511107790 258
350 iso_pu_bacteria 2512047030 2512349922 258
351 iso_pu_bacteria 2513237082 2513553435 258
352 iso_pu_bacteria 2513237083 2513559639 258
353 iso_pu_bacteria 2513237151 2513962781 258
354 iso_pu_bacteria 2515154122 2515684947 258
355 iso_pu_bacteria 2515154189 2516018081 258
356 iso_pu_bacteria 2526164713 2527079610 258
357 iso_pu_bacteria 2600255067 2600814042 258
358 iso_pu_bacteria 2718217991 2719643417 258
359 iso_pu_bacteria 2738541296 2738823693 258
360 iso_pu_bacteria 2738541298 2738836043 258
361 iso_pu_bacteria 2738541306 2738877573 258
362 iso_pu_bacteria 2738543002 2739189320 258
363 iso_pu_bacteria 2738543008 2739224166 258
364 iso_pu_bacteria 2744054900 2746090700 258
365 iso_pu_bacteria 2744054901 2746092439 258
366 iso_pu_bacteria 2751185846 2753570612 258
367 iso_pu_bacteria 2818991450 2819623770 258
368 iso_pu_bacteria 2842324504 2842326044 258
369 iso_pu_bacteria 2842348783 2842351436 258
370 iso_pu_bacteria 2842454564 2842455364 258
371 iso_pu_bacteria 2856287931 2856289777 258
372 iso_pu_bacteria 2857357740 2857363184 258
373 iso_pu_bacteria 2883087390 2883088387 258
374 iso_pu_bacteria 2885270888 2885276473 258
375 iso_pu_bacteria 2900634093 2900639456 258
376 iso_pu_bacteria 2902682994 2902683978 258
377 iso_pu_bacteria 2904483920 2904490344 258
378 iso_pu_bacteria 2919527303 2919533514 258
379 iso_pu_bacteria 2928108538 2928112879 258
380 iso_pu_bacteria 2928135762 2928139808 258
381 iso_pu_bacteria 2928503688 2928507028 258
382 iso_pu_bacteria 2945934425 2945941070 258
383 iso_pu_bacteria 2990703756 2990708114 258
384 iso_pu_bacteria 641736151 642421932 258
385 iso_pu_bacteria 642555113 642617825 258
386 iso_pu_bacteria 8003400568 8003401848 258
387 iso_pu_bacteria 8003955200 8003956518 258
388 iso_pu_bacteria 8055266321 8055270976 258
389 iso_pu_bacteria 8055301274 8055307244 258
390 iso_pu_bacteria 2834641062 2834644800 259
391 iso_pu_bacteria 2858688981 2858697941 259
392 3300021361 Ga0213872_10061412 Ga0213872_100614122 260
393 3300039447 Ga0436361_0024686 Ga0436361_0024686_1770_2561 260
394 3300044666 Ga0466977_0000096 Ga0466977_0000096_2158_2967 260
395 3300046524 Ga0495648_0149737 Ga0495648_0149737_383_1189 260
396 3300049579 Ga0501043_0264764 Ga0501043_0264764_83_892 260
397 iso_pu_bacteria 2513237150 2513955875 260
398 iso_pu_bacteria 2513237165 2514045646 260
399 iso_pu_bacteria 2901300506 2901312074 260
400 iso_pu_bacteria 644736347 644748564 260
401 3300003320 rootH2_10026413 rootH2_100264137 261
402 3300003322 rootL2_10038342 rootL2_100383424 261
403 3300003323 rootH1_10021773 rootH1_100217733 261
404 3300003354 JGI25160J50197_1000124 JGI25160J50197_100012458 261
405 3300003762 Ga0055542_1000960 Ga0055542_10009606 261
406 3300003841 Ga0055541_1000439 Ga0055541_100043910 261
407 3300005262 Ga0065165_1000637 Ga0065165_100063737 261
408 3300009093 Ga0105240_10026407 Ga0105240_100264074 261
409 3300016635 Ga0183361_10003 Ga0183361_10003504 261
410 3300025224 Ga0209784_100505 Ga0209784_10050511 261
411 3300025225 Ga0209566_100447 Ga0209566_10044720 261
412 3300025226 Ga0209674_100131 Ga0209674_10013120 261
413 3300025230 Ga0209563_110167 Ga0209563_1101672 261
414 3300025246 Ga0209646_1000058 Ga0209646_1000058140 261
415 3300025250 Ga0209026_1001980 Ga0209026_10019804 261
416 3300025253 Ga0209677_103828 Ga0209677_1038282 261
417 3300025254 Ga0209148_1000043 Ga0209148_1000043336 261
418 3300025256 Ga0209759_1018849 Ga0209759_10188492 261
419 3300025284 Ga0209130_1005627 Ga0209130_10056274 261
420 3300025302 Ga0207426_1000020 Ga0207426_1000020466 261
421 3300025913 Ga0207695_10021338 Ga0207695_100213384 261
422 3300046455 Ga0495603_0000841 Ga0495603_0000841_14407_15222 261
423 3300046457 Ga0495590_0024324 Ga0495590_0024324_515_1330 261
424 3300046457 Ga0495590_0025981 Ga0495590_0025981_241_1056 261
425 3300046472 Ga0495580_0114344 Ga0495580_0114344_258_1073 261
426 3300046474 Ga0495605_0013399 Ga0495605_0013399_209_1024 261
427 3300046506 Ga0495583_0007319 Ga0495583_0007319_621_1436 261
428 3300046524 Ga0495648_0017409 Ga0495648_0017409_3287_4102 261
429 3300046531 Ga0495665_0059572 Ga0495665_0059572_276_1091 261
430 3300046542 Ga0495597_0076122 Ga0495597_0076122_374_1189 261
431 3300046557 Ga0495622_0061176 Ga0495622_0061176_634_1449 261
432 3300046694 Ga0495649_0049077 Ga0495649_0049077_1292_2107 261
433 3300047319 Ga0495674_0009179 Ga0495674_0009179_5224_6039 261
434 3300047320 Ga0495672_0065113 Ga0495672_0065113_867_1682 261
435 3300047443 Ga0495687_023302 Ga0495687_023302_131_946 261
436 3300048091 Ga0495626_0046809 Ga0495626_0046809_408_1223 261
437 3300048903 Ga0496100_0000649 Ga0496100_0000649_4023_4835 261
438 3300048904 Ga0496101_0001358 Ga0496101_0001358_3616_4428 261
439 3300048905 Ga0496102_0004884 Ga0496102_0004884_4059_4871 261
440 3300048905 Ga0496102_0124609 Ga0496102_0124609_446_1264 261
441 3300048905 Ga0496102_0240940 Ga0496102_0240940_906_1694 261
442 3300048906 Ga0496103_0001036 Ga0496103_0001036_15160_15972 261
443 3300048907 Ga0496104_0142614 Ga0496104_0142614_1355_2170 261
444 3300048908 Ga0496105_0158479 Ga0496105_0158479_786_1601 261
445 3300048909 Ga0496106_0000008 Ga0496106_0000008_222603_223400 261
446 3300048909 Ga0496106_0202125 Ga0496106_0202125_35_847 261
447 3300048913 Ga0496110_0543560 Ga0496110_0543560_64_879 261
448 3300048916 Ga0496113_0003960 Ga0496113_0003960_7399_8214 261
449 3300048918 Ga0496115_0184026 Ga0496115_0184026_669_1484 261
450 3300048918 Ga0496115_0260887 Ga0496115_0260887_173_988 261
451 3300048919 Ga0496116_0014324 Ga0496116_0014324_876_1664 261
452 3300048920 Ga0496117_0000524 Ga0496117_0000524_3690_4502 261
453 3300048920 Ga0496117_0007007 Ga0496117_0007007_8192_9010 261
454 3300048921 Ga0496118_0000495 Ga0496118_0000495_61037_61849 261
455 3300048921 Ga0496118_0026876 Ga0496118_0026876_2749_3567 261
456 3300048922 Ga0496119_0036771 Ga0496119_0036771_952_1764 261
457 3300048924 Ga0496121_0002912 Ga0496121_0002912_4058_4870 261
458 3300048924 Ga0496121_0005525 Ga0496121_0005525_14126_14923 261
459 3300048927 Ga0496124_0043409 Ga0496124_0043409_1112_1909 261
460 3300048929 Ga0496126_0000277 Ga0496126_0000277_8113_8931 261
461 iso_pu_bacteria 2596583598 2597029867 261
462 iso_pu_bacteria 2599185178 2599443722 261
463 iso_pu_bacteria 2885266251 2885267386 261
464 iso_pu_bacteria 2900577576 2900582945 261
465 iso_pu_bacteria 2928058823 2928061984 261
466 3300001989 JGI24739J22299_10002683 JGI24739J22299_100026833 262
467 3300002705 JGI25156J39149_1001042 JGI25156J39149_10010423 262
468 3300005327 Ga0070658_10008817 Ga0070658_100088173 262
469 3300005339 Ga0070660_100059093 Ga0070660_1000590933 262
470 3300005347 Ga0070668_100356927 Ga0070668_1003569272 262
471 3300005366 Ga0070659_100043123 Ga0070659_1000431233 262
472 3300005367 Ga0070667_100037080 Ga0070667_1000370802 262
473 3300005457 Ga0070662_100401693 Ga0070662_1004016932 262
474 3300005563 Ga0068855_100014523 Ga0068855_1000145235 262
475 3300009011 Ga0105251_10000229 Ga0105251_100002295 262
476 3300009093 Ga0105240_10036745 Ga0105240_100367455 262
477 3300009177 Ga0105248_10036584 Ga0105248_100365845 262
478 3300009545 Ga0105237_10131794 Ga0105237_101317942 262
479 3300011119 Ga0105246_10270284 Ga0105246_102702842 262
480 3300013102 Ga0157371_10045755 Ga0157371_100457552 262
481 3300013104 Ga0157370_10020719 Ga0157370_100207193 262
482 3300013104 Ga0157370_10147295 Ga0157370_101472953 262
483 3300013105 Ga0157369_10002035 Ga0157369_1000203513 262
484 3300013105 Ga0157369_10009022 Ga0157369_100090222 262
485 3300013306 Ga0163162_10016724 Ga0163162_100167245 262
486 3300013307 Ga0157372_10336762 Ga0157372_103367622 262
487 3300013308 Ga0157375_10017497 Ga0157375_100174976 262
488 3300015262 Ga0182007_10000180 Ga0182007_1000018025 262
489 3300020080 Ga0206350_11409884 Ga0206350_114098842 262
490 3300020081 Ga0206354_10439040 Ga0206354_104390402 262
491 3300022467 Ga0224712_10000001 Ga0224712_1000000140 262
492 3300025256 Ga0209759_1000225 Ga0209759_10002259 262
493 3300025735 Ga0207713_1000201 Ga0207713_100020163 262
494 3300025904 Ga0207647_10018368 Ga0207647_100183684 262
495 3300025909 Ga0207705_10000851 Ga0207705_100008513 262
496 3300025913 Ga0207695_10058630 Ga0207695_100586304 262
497 3300025919 Ga0207657_10133274 Ga0207657_101332742 262
498 3300025932 Ga0207690_10028871 Ga0207690_100288713 262
499 3300025933 Ga0207706_10508594 Ga0207706_105085941 262
500 3300025941 Ga0207711_10129332 Ga0207711_101293322 262
501 3300025949 Ga0207667_10002720 Ga0207667_100027207 262
502 3300025972 Ga0207668_10339082 Ga0207668_103390822 262
503 3300025986 Ga0207658_10026188 Ga0207658_100261883 262
504 3300026078 Ga0207702_10391667 Ga0207702_103916673 262
505 3300026121 Ga0207683_10287536 Ga0207683_102875362 262
506 3300031548 Ga0307408_100003182 Ga0307408_1000031824 262
507 3300031731 Ga0307405_10068292 Ga0307405_100682922 262
508 3300032002 Ga0307416_100052589 Ga0307416_1000525894 262
509 3300037418 Ga0395900_0000015 Ga0395900_0000015_305675_306481 262
510 3300037418 Ga0395900_0093601 Ga0395900_0093601_1231_2037 262
511 3300037418 Ga0395900_0168357 Ga0395900_0168357_987_1793 262
512 3300037418 Ga0395900_0354798 Ga0395900_0354798_557_1363 262
513 3300037466 Ga0395898_0000791 Ga0395898_0000791_37724_38530 262
514 3300037466 Ga0395898_0155202 Ga0395898_0155202_470_1276 262
515 3300038443 Ga0395901_0000034 Ga0395901_0000034_98071_98877 262
516 3300038443 Ga0395901_0000121 Ga0395901_0000121_87396_88202 262
517 3300038443 Ga0395901_0389705 Ga0395901_0389705_342_1148 262
518 3300044684 Ga0466966_0000313 Ga0466966_0000313_2609_3415 262
519 3300044693 Ga0466961_0014433 Ga0466961_0014433_2355_3167 262
520 3300044694 Ga0466963_0005362 Ga0466963_0005362_5073_5879 262
521 3300044719 Ga0466971_0008558 Ga0466971_0008558_2962_3768 262
522 3300044735 Ga0466968_0021564 Ga0466968_0021564_1070_1882 262
523 3300044765 Ga0466970_0026573 Ga0466970_0026573_488_1300 262
524 3300044842 Ga0466957_0005235 Ga0466957_0005235_3566_4378 262
525 3300044842 Ga0466957_0019579 Ga0466957_0019579_928_1734 262
526 3300045049 Ga0466959_0028001 Ga0466959_0028001_1939_2751 262
527 3300045836 Ga0466958_0001291 Ga0466958_0001291_2794_3600 262
528 3300045836 Ga0466958_0009891 Ga0466958_0009891_3089_3901 262
529 3300046454 Ga0495592_0002026 Ga0495592_0002026_12749_13555 262
530 3300046455 Ga0495603_0102508 Ga0495603_0102508_848_1657 262
531 3300046455 Ga0495603_0285609 Ga0495603_0285609_32_853 262
532 3300046457 Ga0495590_0003314 Ga0495590_0003314_4289_5095 262
533 3300046458 Ga0495591_000432 Ga0495591_000432_8162_8968 262
534 3300046459 Ga0495629_0000889 Ga0495629_0000889_14744_15553 262
535 3300046459 Ga0495629_0020794 Ga0495629_0020794_3295_4101 262
536 3300046459 Ga0495629_0254664 Ga0495629_0254664_335_1144 262
537 3300046460 Ga0495638_0006164 Ga0495638_0006164_4535_5341 262
538 3300046460 Ga0495638_0010175 Ga0495638_0010175_207_1028 262
539 3300046461 Ga0495641_0081316 Ga0495641_0081316_597_1406 262
540 3300046462 Ga0495651_0003119 Ga0495651_0003119_10251_11057 262
541 3300046463 Ga0495653_0004291 Ga0495653_0004291_6765_7574 262
542 3300046471 Ga0495650_0006665 Ga0495650_0006665_900_1706 262
543 3300046471 Ga0495650_0012308 Ga0495650_0012308_3641_4447 262
544 3300046471 Ga0495650_0054845 Ga0495650_0054845_207_1013 262
545 3300046471 Ga0495650_0084789 Ga0495650_0084789_155_976 262
546 3300046472 Ga0495580_0001756 Ga0495580_0001756_4368_5177 262
547 3300046472 Ga0495580_0017349 Ga0495580_0017349_2498_3304 262
548 3300046472 Ga0495580_0122839 Ga0495580_0122839_429_1250 262
549 3300046473 Ga0495582_0000464 Ga0495582_0000464_18061_18870 262
550 3300046474 Ga0495605_0008996 Ga0495605_0008996_4344_5150 262
551 3300046474 Ga0495605_0010861 Ga0495605_0010861_594_1415 262
552 3300046477 Ga0495664_0002386 Ga0495664_0002386_8749_9555 262
553 3300046477 Ga0495664_0003145 Ga0495664_0003145_5860_6669 262
554 3300046477 Ga0495664_0129195 Ga0495664_0129195_73_894 262
555 3300046492 Ga0495585_0051408 Ga0495585_0051408_263_1084 262
556 3300046499 Ga0495594_0008865 Ga0495594_0008865_2801_3610 262
557 3300046500 Ga0495596_0001353 Ga0495596_0001353_5685_6491 262
558 3300046501 Ga0495607_0084236 Ga0495607_0084236_55_861 262
559 3300046501 Ga0495607_0108456 Ga0495607_0108456_195_1016 262
560 3300046507 Ga0495606_0012112 Ga0495606_0012112_5250_6056 262
561 3300046507 Ga0495606_0235458 Ga0495606_0235458_76_885 262
562 3300046511 Ga0495608_0002927 Ga0495608_0002927_5767_6573 262
563 3300046514 Ga0495618_0006148 Ga0495618_0006148_3732_4538 262
564 3300046514 Ga0495618_0007914 Ga0495618_0007914_5610_6419 262
565 3300046514 Ga0495618_0164271 Ga0495618_0164271_187_993 262
566 3300046515 Ga0495620_0007989 Ga0495620_0007989_1110_1916 262
567 3300046516 Ga0495628_0002937 Ga0495628_0002937_4085_4894 262
568 3300046516 Ga0495628_0027677 Ga0495628_0027677_3212_4033 262
569 3300046517 Ga0495630_0011582 Ga0495630_0011582_656_1465 262
570 3300046517 Ga0495630_0021317 Ga0495630_0021317_3404_4210 262
571 3300046524 Ga0495648_0002395 Ga0495648_0002395_11338_12147 262
572 3300046524 Ga0495648_0039069 Ga0495648_0039069_1362_2171 262
573 3300046526 Ga0495666_0001790 Ga0495666_0001790_5855_6661 262
574 3300046526 Ga0495666_0006010 Ga0495666_0006010_2078_2887 262
575 3300046526 Ga0495666_0094474 Ga0495666_0094474_153_959 262
576 3300046528 Ga0495642_0025133 Ga0495642_0025133_1247_2068 262
577 3300046528 Ga0495642_0050527 Ga0495642_0050527_853_1662 262
578 3300046529 Ga0495652_0014261 Ga0495652_0014261_5638_6459 262
579 3300046529 Ga0495652_0045976 Ga0495652_0045976_2799_3608 262
580 3300046531 Ga0495665_0002607 Ga0495665_0002607_6026_6847 262
581 3300046531 Ga0495665_0012583 Ga0495665_0012583_2397_3203 262
582 3300046531 Ga0495665_0053635 Ga0495665_0053635_277_1086 262
583 3300046533 Ga0495640_0001692 Ga0495640_0001692_14208_15014 262
584 3300046533 Ga0495640_0011786 Ga0495640_0011786_1222_2031 262
585 3300046533 Ga0495640_0238523 Ga0495640_0238523_215_1036 262
586 3300046535 Ga0495586_0308787 Ga0495586_0308787_84_893 262
587 3300046536 Ga0495587_0002128 Ga0495587_0002128_7112_7921 262
588 3300046536 Ga0495587_0002572 Ga0495587_0002572_5682_6488 262
589 3300046543 Ga0495645_0002333 Ga0495645_0002333_6684_7493 262
590 3300046543 Ga0495645_0314824 Ga0495645_0314824_156_965 262
591 3300046557 Ga0495622_0000261 Ga0495622_0000261_31266_32072 262
592 3300046559 Ga0495667_0199437 Ga0495667_0199437_26_832 262
593 3300046642 Ga0495634_0022592 Ga0495634_0022592_2515_3321 262
594 3300046642 Ga0495634_0025826 Ga0495634_0025826_495_1304 262
595 3300046660 Ga0495625_0043075 Ga0495625_0043075_194_1000 262
596 3300046663 Ga0495635_0001389 Ga0495635_0001389_2589_3395 262
597 3300046663 Ga0495635_0001568 Ga0495635_0001568_13945_14754 262
598 3300046663 Ga0495635_0009299 Ga0495635_0009299_4369_5190 262
599 3300046665 Ga0495661_0004582 Ga0495661_0004582_8699_9505 262
600 3300046665 Ga0495661_0008864 Ga0495661_0008864_5323_6132 262
601 3300046665 Ga0495661_0016112 Ga0495661_0016112_71_877 262
602 3300046675 Ga0495657_0136087 Ga0495657_0136087_75_881 262
603 3300046678 Ga0495599_0006633 Ga0495599_0006633_2431_3240 262
604 3300046678 Ga0495599_0028497 Ga0495599_0028497_1409_2215 262
605 3300046679 Ga0495623_0004012 Ga0495623_0004012_5510_6316 262
606 3300046679 Ga0495623_0009974 Ga0495623_0009974_4155_4976 262
607 3300046679 Ga0495623_0021130 Ga0495623_0021130_2843_3649 262
608 3300046680 Ga0495646_0000876 Ga0495646_0000876_10852_11661 262
609 3300046680 Ga0495646_0001158 Ga0495646_0001158_1276_2082 262
610 3300046680 Ga0495646_0008842 Ga0495646_0008842_1289_2110 262
611 3300046684 Ga0495669_0002443 Ga0495669_0002443_966_1787 262
612 3300046684 Ga0495669_0056694 Ga0495669_0056694_249_1055 262
613 3300046689 Ga0495613_0011272 Ga0495613_0011272_5554_6363 262
614 3300046689 Ga0495613_0063426 Ga0495613_0063426_637_1443 262
615 3300046690 Ga0495624_0000760 Ga0495624_0000760_18156_18977 262
616 3300046690 Ga0495624_0130225 Ga0495624_0130225_14_823 262
617 3300046691 Ga0495670_0034885 Ga0495670_0034885_776_1597 262
618 3300046692 Ga0495671_0013399 Ga0495671_0013399_2261_3067 262
619 3300046694 Ga0495649_0040160 Ga0495649_0040160_469_1275 262
620 3300046794 Ga0495589_0002074 Ga0495589_0002074_6791_7612 262
621 3300046809 Ga0495600_0001036 Ga0495600_0001036_8548_9354 262
622 3300046809 Ga0495600_0278850 Ga0495600_0278850_172_993 262
623 3300046810 Ga0495660_0062448 Ga0495660_0062448_620_1441 262
624 3300047315 Ga0495581_0000205 Ga0495581_0000205_20029_20838 262
625 3300047317 Ga0495604_0003933 Ga0495604_0003933_5484_6290 262
626 3300047317 Ga0495604_0008793 Ga0495604_0008793_6454_7263 262
627 3300047317 Ga0495604_0065729 Ga0495604_0065729_1751_2572 262
628 3300047319 Ga0495674_0029315 Ga0495674_0029315_4085_4903 262
629 3300047319 Ga0495674_0043002 Ga0495674_0043002_2160_2966 262
630 3300047319 Ga0495674_0086256 Ga0495674_0086256_1009_1818 262
631 3300047319 Ga0495674_0172244 Ga0495674_0172244_277_1086 262
632 3300047320 Ga0495672_0002139 Ga0495672_0002139_13589_14407 262
633 3300047320 Ga0495672_0087196 Ga0495672_0087196_23_832 262
634 3300047321 Ga0495676_0021991 Ga0495676_0021991_4121_4930 262
635 3300047321 Ga0495676_0053150 Ga0495676_0053150_1962_2768 262
636 3300047321 Ga0495676_0120433 Ga0495676_0120433_911_1720 262
637 3300047321 Ga0495676_0265647 Ga0495676_0265647_129_935 262
638 3300047322 Ga0495680_0003346 Ga0495680_0003346_14555_15364 262
639 3300047322 Ga0495680_0014131 Ga0495680_0014131_5682_6488 262
640 3300047322 Ga0495680_0018949 Ga0495680_0018949_4294_5115 262
641 3300047322 Ga0495680_0068559 Ga0495680_0068559_1394_2200 262
642 3300047323 Ga0495683_0001218 Ga0495683_0001218_11035_11841 262
643 3300047323 Ga0495683_0029302 Ga0495683_0029302_1178_1984 262
644 3300047443 Ga0495687_000121 Ga0495687_000121_17373_18194 262
645 3300047443 Ga0495687_034640 Ga0495687_034640_1317_2123 262
646 3300047444 Ga0495675_0001385 Ga0495675_0001385_11421_12227 262
647 3300047444 Ga0495675_0122752 Ga0495675_0122752_728_1549 262
648 3300047446 Ga0495679_000104 Ga0495679_000104_15584_16390 262
649 3300047446 Ga0495679_001709 Ga0495679_001709_8355_9164 262
650 3300047446 Ga0495679_002309 Ga0495679_002309_3572_4378 262
651 3300047469 Ga0495673_0001658 Ga0495673_0001658_3611_4417 262
652 3300047469 Ga0495673_0071240 Ga0495673_0071240_528_1349 262
653 3300047471 Ga0495684_0003570 Ga0495684_0003570_5922_6731 262
654 3300047472 Ga0495686_0167648 Ga0495686_0167648_290_1096 262
655 3300047472 Ga0495686_0299600 Ga0495686_0299600_69_869 262
656 3300047673 Ga0495593_0000318 Ga0495593_0000318_23629_24438 262
657 3300047673 Ga0495593_0003012 Ga0495593_0003012_5582_6403 262
658 3300047673 Ga0495593_0005400 Ga0495593_0005400_3482_4288 262
659 3300048088 Ga0495602_0004873 Ga0495602_0004873_5813_6634 262
660 3300048088 Ga0495602_0012845 Ga0495602_0012845_6263_7069 262
661 3300048088 Ga0495602_0026888 Ga0495602_0026888_3909_4715 262
662 3300048088 Ga0495602_0042354 Ga0495602_0042354_1763_2569 262
663 3300048088 Ga0495602_0048673 Ga0495602_0048673_792_1601 262
664 3300048089 Ga0495614_0009436 Ga0495614_0009436_276_1085 262
665 3300048089 Ga0495614_0015509 Ga0495614_0015509_45_851 262
666 3300048091 Ga0495626_0005536 Ga0495626_0005536_1538_2344 262
667 3300048091 Ga0495626_0024956 Ga0495626_0024956_1872_2693 262
668 3300048904 Ga0496101_0101991 Ga0496101_0101991_839_1660 262
669 3300048904 Ga0496101_0184800 Ga0496101_0184800_109_930 262
670 3300048905 Ga0496102_0145151 Ga0496102_0145151_721_1527 262
671 3300048908 Ga0496105_0011734 Ga0496105_0011734_2114_2935 262
672 3300048908 Ga0496105_0058456 Ga0496105_0058456_891_1712 262
673 3300048909 Ga0496106_0048626 Ga0496106_0048626_1593_2414 262
674 3300048910 Ga0496107_0040907 Ga0496107_0040907_2224_3045 262
675 3300048913 Ga0496110_0022256 Ga0496110_0022256_107_928 262
676 3300048917 Ga0496114_0182499 Ga0496114_0182499_827_1648 262
677 3300048918 Ga0496115_0082855 Ga0496115_0082855_49_870 262
678 3300048918 Ga0496115_0350720 Ga0496115_0350720_92_901 262
679 3300048919 Ga0496116_0027277 Ga0496116_0027277_2671_3471 262
680 3300048920 Ga0496117_0045265 Ga0496117_0045265_2187_2993 262
681 3300048920 Ga0496117_0165008 Ga0496117_0165008_255_1064 262
682 3300048920 Ga0496117_0170237 Ga0496117_0170237_302_1102 262
683 3300048921 Ga0496118_0001212 Ga0496118_0001212_26525_27331 262
684 3300048921 Ga0496118_0020303 Ga0496118_0020303_3549_4355 262
685 3300048921 Ga0496118_0152366 Ga0496118_0152366_403_1203 262
686 3300048924 Ga0496121_0001094 Ga0496121_0001094_22177_22983 262
687 3300048924 Ga0496121_0054557 Ga0496121_0054557_2099_2905 262
688 3300048929 Ga0496126_0000197 Ga0496126_0000197_111224_112024 262
689 3300048929 Ga0496126_0021680 Ga0496126_0021680_2193_2999 262
690 3300048929 Ga0496126_0492895 Ga0496126_0492895_18_824 262
691 3300049459 Ga0495678_016093 Ga0495678_016093_466_1272 262
692 3300049460 Ga0495682_0017076 Ga0495682_0017076_1371_2177 262
693 3300049460 Ga0495682_0023676 Ga0495682_0023676_160_966 262
694 3300061719 Ga0466962_0004256 Ga0466962_0004256_1823_2629 262
695 3300006948 Ga0099826_10000015 Ga0099826_1000001538 263
696 3300009011 Ga0105251_10102343 Ga0105251_101023432 263
697 3300027666 Ga0209282_1000031 Ga0209282_100003182 263
698 3300037312 Ga0395899_0128038 Ga0395899_0128038_373_1191 263
699 3300037418 Ga0395900_0040450 Ga0395900_0040450_3301_4119 263
700 3300037466 Ga0395898_0016635 Ga0395898_0016635_2104_2922 263
701 3300038443 Ga0395901_0001442 Ga0395901_0001442_18004_18822 263
702 3300046474 Ga0495605_0009237 Ga0495605_0009237_1834_2634 263
703 3300046500 Ga0495596_0003864 Ga0495596_0003864_3643_4443 263
704 3300046501 Ga0495607_0114075 Ga0495607_0114075_88_888 263
705 3300046512 Ga0495610_0004911 Ga0495610_0004911_3814_4614 263
706 3300046513 Ga0495616_0003505 Ga0495616_0003505_4962_5762 263
707 3300046665 Ga0495661_0019414 Ga0495661_0019414_2329_3129 263
708 3300046692 Ga0495671_0001641 Ga0495671_0001641_12296_13096 263
709 3300046694 Ga0495649_0255842 Ga0495649_0255842_67_867 263
710 3300047320 Ga0495672_0037456 Ga0495672_0037456_745_1545 263
711 3300047469 Ga0495673_0020806 Ga0495673_0020806_1731_2531 263
712 3300047472 Ga0495686_0000029 Ga0495686_0000029_32798_33619 263
713 3300048919 Ga0496116_0022841 Ga0496116_0022841_802_1602 263
714 3300048924 Ga0496121_0027948 Ga0496121_0027948_1553_2353 263
715 3300048925 Ga0496122_0013659 Ga0496122_0013659_2921_3721 263
716 3300048926 Ga0496123_0020291 Ga0496123_0020291_3026_3826 263
717 3300048929 Ga0496126_0181791 Ga0496126_0181791_602_1402 263
718 3300003187 JGI25151J46595_10000728 JGI25151J46595_1000072812 264
719 3300003187 JGI25151J46595_10003126 JGI25151J46595_100031262 264
720 3300003771 Ga0055526_1007927 Ga0055526_10079272 264
721 3300003773 Ga0055537_1005999 Ga0055537_10059993 264
722 3300003775 Ga0055524_1000290 Ga0055524_100029020 264
723 3300003775 Ga0055524_1021466 Ga0055524_10214661 264
724 3300003781 Ga0055536_1000074 Ga0055536_100007455 264
725 3300003784 Ga0055534_1001002 Ga0055534_10010025 264
726 3300003784 Ga0055534_1003364 Ga0055534_10033644 264
727 3300025245 Ga0207425_1026865 Ga0207425_10268652 264
728 3300025263 Ga0209565_1000329 Ga0209565_100032922 264
729 3300025284 Ga0209130_1011332 Ga0209130_10113323 264
730 3300025291 Ga0209675_1000070 Ga0209675_1000070151 264
731 3300025291 Ga0209675_1000432 Ga0209675_100043221 264
732 3300025292 Ga0209676_1000012 Ga0209676_1000012472 264
733 3300025294 Ga0209025_1001428 Ga0209025_10014284 264
734 3300025294 Ga0209025_1001621 Ga0209025_100162122 264
735 3300025294 Ga0209025_1002536 Ga0209025_100253614 264
736 3300025294 Ga0209025_1003983 Ga0209025_100398311 264
737 3300025295 Ga0209564_1000359 Ga0209564_100035967 264
738 3300025295 Ga0209564_1001697 Ga0209564_100169714 264
739 3300025295 Ga0209564_1006178 Ga0209564_10061784 264
740 3300025297 Ga0209758_1026749 Ga0209758_10267492 264
741 3300025298 Ga0209050_1051342 Ga0209050_10513421 264
742 3300025299 Ga0209256_1000059 Ga0209256_100005970 264
743 3300025299 Ga0209256_1000149 Ga0209256_1000149109 264
744 3300025303 Ga0209051_1019616 Ga0209051_10196162 264
745 3300047318 Ga0495636_0004910 Ga0495636_0004910_3636_4433 264
746 3300049571 Ga0501034_0000188 Ga0501034_0000188_39514_40311 264
747 3300001915 JGI24741J21665_1000501 JGI24741J21665_10005014 265
748 3300001979 JGI24740J21852_10010048 JGI24740J21852_100100482 265
749 3300002705 JGI25156J39149_1003257 JGI25156J39149_10032573 265
750 3300003323 rootH1_10265235 rootH1_102652352 265
751 3300003752 Ga0055539_1000068 Ga0055539_1000068101 265
752 3300003758 Ga0055532_1000028 Ga0055532_100002868 265
753 3300003759 Ga0055525_1000598 Ga0055525_100059813 265
754 3300003760 Ga0055527_1000969 Ga0055527_10009695 265
755 3300003761 Ga0055535_1000022 Ga0055535_100002268 265
756 3300003763 Ga0055529_1000063 Ga0055529_100006323 265
757 3300003763 Ga0055529_1000145 Ga0055529_100014520 265
758 3300003841 Ga0055541_1003378 Ga0055541_10033782 265
759 3300005344 Ga0070661_100000278 Ga0070661_1000002782 265
760 3300005366 Ga0070659_100001994 Ga0070659_1000019944 265
761 3300005455 Ga0070663_100000005 Ga0070663_100000005133 265
762 3300005564 Ga0070664_100000001 Ga0070664_10000000191 265
763 3300005577 Ga0068857_100204553 Ga0068857_1002045532 265
764 3300005578 Ga0068854_100000030 Ga0068854_1000000306 265
765 3300005614 Ga0068856_100000008 Ga0068856_10000000816 265
766 3300009093 Ga0105240_10032468 Ga0105240_100324683 265
767 3300013100 Ga0157373_10021547 Ga0157373_100215474 265
768 3300013102 Ga0157371_10000035 Ga0157371_1000003522 265
769 3300013104 Ga0157370_10000021 Ga0157370_1000002192 265
770 3300013307 Ga0157372_10000331 Ga0157372_1000033128 265
771 3300015261 Ga0182006_1000956 Ga0182006_100095614 265
772 3300020077 Ga0206351_10374936 Ga0206351_103749364 265
773 3300020610 Ga0154015_1042038 Ga0154015_104203818 265
774 3300025224 Ga0209784_100014 Ga0209784_100014345 265
775 3300025225 Ga0209566_100011 Ga0209566_100011345 265
776 3300025225 Ga0209566_101144 Ga0209566_1011446 265
777 3300025226 Ga0209674_100032 Ga0209674_100032140 265
778 3300025226 Ga0209674_105454 Ga0209674_1054542 265
779 3300025228 Ga0209672_100217 Ga0209672_10021730 265
780 3300025229 Ga0209147_100002 Ga0209147_100002621 265
781 3300025230 Ga0209563_100029 Ga0209563_100029140 265
782 3300025230 Ga0209563_103349 Ga0209563_1033492 265
783 3300025242 Ga0209258_100002 Ga0209258_100002621 265
784 3300025253 Ga0209677_100042 Ga0209677_10004272 265
785 3300025256 Ga0209759_1003477 Ga0209759_10034773 265
786 3300025272 Ga0209455_1000009 Ga0209455_1000009502 265
787 3300025913 Ga0207695_10002489 Ga0207695_1000248910 265
788 3300025920 Ga0207649_10000169 Ga0207649_1000016937 265
789 3300025932 Ga0207690_10001870 Ga0207690_100018708 265
790 3300025945 Ga0207679_10000003 Ga0207679_10000003432 265
791 3300025981 Ga0207640_10000124 Ga0207640_100001246 265
792 3300026067 Ga0207678_10000002 Ga0207678_10000002300 265
793 3300026078 Ga0207702_10000031 Ga0207702_10000031152 265
794 3300026116 Ga0207674_10004769 Ga0207674_1000476913 265
795 3300037418 Ga0395900_0015654 Ga0395900_0015654_1531_2328 265
796 3300044658 Ga0466972_0172921 Ga0466972_0172921_108_905 265
797 3300044671 Ga0466978_0078295 Ga0466978_0078295_353_1150 265
798 3300044683 Ga0466965_0012566 Ga0466965_0012566_1603_2400 265
799 3300044693 Ga0466961_0006206 Ga0466961_0006206_4180_4977 265
800 3300044706 Ga0466964_0005152 Ga0466964_0005152_3027_3824 265
801 3300044735 Ga0466968_0015334 Ga0466968_0015334_1181_1978 265
802 3300044842 Ga0466957_0014520 Ga0466957_0014520_1812_2609 265
803 3300045049 Ga0466959_0016000 Ga0466959_0016000_2834_3631 265
804 3300045976 Ga0466967_0015919 Ga0466967_0015919_2253_3050 265
805 3300048928 Ga0496125_0031511 Ga0496125_0031511_1285_2082 265
806 3300059508 Ga0587088_000141 Ga0587088_000141_2708_3505 265
807 3300059640 Ga0587067_000199 Ga0587067_000199_2658_3455 265
808 3300059643 Ga0587072_000094 Ga0587072_000094_4999_5796 265
809 3300061719 Ga0466962_0032005 Ga0466962_0032005_1486_2283 265

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.5192 21 255
7wwb-assembly1.cif.gz_B choline transporter-like protein 1 0.47 21 255
4ca5-assembly1.cif.gz_A human angiotensin converting enzyme in complex with a phosphinic tripeptide fi 0.3014 77 249
7o3v-assembly1.cif.gz_H stalk complex structure (trwj/virb5-trwi/virb6) from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.288 40 198
6vkt-assembly1.cif.gz_C cryo-electron microscopy structures of a gonococcal multidrug efflux pump illuminate a mechanism of erythromycin drug recognition 0.2545 67 251
ID Description Score Start End Superfamily
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5097 11 250 1.20.1070.10
af_I1KMF2_37_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4708 11 250 1.20.1070.10
af_Q7K0L7_21_331_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4605 62 249 1.50.40.10
af_F1R4U0_32_316_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.424 58 248 1.50.40.10
af_Q9VAY3_103_293_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4231 50 219 1.50.40.10
ID Description Score Start End GO Terms
AF-A0A254PTJ7-F1-model_v4 Transmembrane protein 0.9599 1 256 GO:0016020
AF-A0A5P2H5J7-F1-model_v4 DUF2189 domain-containing protein 0.9418 1 265 GO:0016020
AF-A0A254PTJ7-F1-model_v4 Transmembrane protein 0.9418 1 256 GO:0016020
AF-A0A1W1YFI2-F1-model_v4 Transmembrane protein 0.9141 1 265 GO:0016020
AF-A0A1H2PSX3-F1-model_v4 Transmembrane protein 0.9131 1 251 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.71 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map