F481710
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 808 | 334 | 1616 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300005981|Ga0081538_10006731|Ga0081538_100067312 |
| Length | 370 |
| Sequence | MAADQQKRWSASRPGLSGWTHNGWTPLTKTFTSKVTLWWRSGRVHSLREDDGRRLDHKTLEQLRIRAVRQIEQGAHPEDIAPALGMTRAAVDGWLAKYREGGLDALRAKPVPGRPPRLSGAQLQRLSTLVVGNDPRQLQFSFAVWTRAMVRELIGREFGVRLSEVSVGRLLGKLGLSPQRPLYRADQQNPQAVARWKAETYPQLRAEAAHAGTTWAPVGHTPVVAATGDRFGINLISAVAAKGKLRFAAYDGSLNGSVFIDFCRRLLHDTPGPVLLVLDGHPVHRSNAVKALAASTDGRLRLCFLPGYAPELSPDEWVWKHVKHDRIGRAGVSGPEDLKAKALAALHRLQKLPEVVRSFFRDPSLRYITS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 160 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 161 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 175 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 184 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 188 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 189 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 190 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 193 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 194 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 203 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 204 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 205 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 208 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 209 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 210 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 211 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 212 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 213 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 214 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 215 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 218 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 221 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 222 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 279 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 327 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 330 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 331 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 332 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 333 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 334 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.38 |
| Metatranscriptomes | 0 |
| Isolates | 0.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0.5 |
| Rhizoplane | 3.09 |
| Rhizosphere | 95.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081538_10006731 | 3300005981 | Bacteria | 10053 |
| 2 | JGI24743J22301_10024355 | 3300001991 | Bacteria | 1169 |
| 3 | JGI24744J21845_10025247 | 3300002077 | Bacteria | 1159 |
| 4 | JGI25406J46586_10063316 | 3300003203 | Bacteria | 1185 |
| 5 | JGI25407J50210_10014966 | 3300003373 | Bacteria | 2003 |
| 6 | JGI25407J50210_10016330 | 3300003373 | Unclassified | 1922 |
| 7 | JGI25407J50210_10017115 | 3300003373 | Bacteria | 1880 |
| 8 | JGI25407J50210_10031802 | 3300003373 | Bacteria | 1365 |
| 9 | JGI25407J50210_10036213 | 3300003373 | Bacteria | 1270 |
| 10 | JGI25407J50210_10042351 | 3300003373 | Bacteria | 1165 |
| 11 | JGI25407J50210_10044754 | 3300003373 | Bacteria | 1130 |
| 12 | Ga0070658_10188981 | 3300005327 | Bacteria | 1736 |
| 13 | Ga0070658_10312746 | 3300005327 | Bacteria | 1340 |
| 14 | Ga0070658_10358984 | 3300005327 | Bacteria | 1248 |
| 15 | Ga0070676_10147959 | 3300005328 | Bacteria | 1501 |
| 16 | Ga0070676_10253284 | 3300005328 | Bacteria | 1176 |
| 17 | Ga0070683_100357067 | 3300005329 | Bacteria | 1392 |
| 18 | Ga0070683_100444040 | 3300005329 | Bacteria | 1238 |
| 19 | Ga0070690_100193090 | 3300005330 | Bacteria | 1413 |
| 20 | Ga0070670_100414225 | 3300005331 | Bacteria | 1190 |
| 21 | Ga0070670_100423150 | 3300005331 | Bacteria | 1178 |
| 22 | Ga0068869_100166654 | 3300005334 | Bacteria | 1718 |
| 23 | Ga0068869_100337913 | 3300005334 | Bacteria | 1225 |
| 24 | Ga0068869_100350900 | 3300005334 | Bacteria | 1202 |
| 25 | Ga0070680_100311561 | 3300005336 | Bacteria | 1335 |
| 26 | Ga0070682_100035889 | 3300005337 | Bacteria | 3028 |
| 27 | Ga0070682_100109797 | 3300005337 | Bacteria | 1836 |
| 28 | Ga0070682_100129915 | 3300005337 | Bacteria | 1703 |
| 29 | Ga0068868_100240303 | 3300005338 | Bacteria | 1521 |
| 30 | Ga0068868_100251801 | 3300005338 | Bacteria | 1487 |
| 31 | Ga0068868_100293498 | 3300005338 | Bacteria | 1379 |
| 32 | Ga0068868_100381093 | 3300005338 | Bacteria | 1213 |
| 33 | Ga0068868_100397527 | 3300005338 | Bacteria | 1189 |
| 34 | Ga0070689_100161036 | 3300005340 | Bacteria | 1814 |
| 35 | Ga0070689_100330093 | 3300005340 | Bacteria | 1276 |
| 36 | Ga0070691_10095487 | 3300005341 | Bacteria | 1471 |
| 37 | Ga0070687_100065498 | 3300005343 | Bacteria | 1933 |
| 38 | Ga0070687_100166036 | 3300005343 | Bacteria | 1309 |
| 39 | Ga0070692_10136161 | 3300005345 | Bacteria | 1385 |
| 40 | Ga0070692_10160325 | 3300005345 | Bacteria | 1288 |
| 41 | Ga0070668_100106135 | 3300005347 | Bacteria | 2231 |
| 42 | Ga0070668_100366420 | 3300005347 | Unclassified | 1223 |
| 43 | Ga0070675_100371817 | 3300005354 | Bacteria | 1271 |
| 44 | Ga0070674_100093913 | 3300005356 | Bacteria | 2171 |
| 45 | Ga0070674_100273440 | 3300005356 | Unclassified | 1336 |
| 46 | Ga0070674_100325324 | 3300005356 | Bacteria | 1234 |
| 47 | Ga0070674_100365469 | 3300005356 | Bacteria | 1169 |
| 48 | Ga0070688_100216180 | 3300005365 | Bacteria | 1349 |
| 49 | Ga0070688_100255313 | 3300005365 | Bacteria | 1250 |
| 50 | Ga0070659_100226350 | 3300005366 | Bacteria | 1545 |
| 51 | Ga0070659_100304797 | 3300005366 | Unclassified | 1329 |
| 52 | Ga0070667_100324530 | 3300005367 | Bacteria | 1390 |
| 53 | Ga0070709_10220823 | 3300005434 | Unclassified | 1351 |
| 54 | Ga0070714_100044810 | 3300005435 | Bacteria | 3746 |
| 55 | Ga0070714_100403168 | 3300005435 | Bacteria | 1293 |
| 56 | Ga0070710_10090191 | 3300005437 | Bacteria | 1807 |
| 57 | Ga0070701_10139034 | 3300005438 | Bacteria | 1387 |
| 58 | Ga0070700_100172267 | 3300005441 | Bacteria | 1499 |
| 59 | Ga0070700_100191126 | 3300005441 | Bacteria | 1431 |
| 60 | Ga0070694_100254945 | 3300005444 | Unclassified | 1329 |
| 61 | Ga0070663_100274370 | 3300005455 | Bacteria | 1342 |
| 62 | Ga0070663_100279294 | 3300005455 | Bacteria | 1330 |
| 63 | Ga0070678_100104068 | 3300005456 | Bacteria | 2207 |
| 64 | Ga0070662_100115270 | 3300005457 | Bacteria | 2052 |
| 65 | Ga0070662_100202762 | 3300005457 | Unclassified | 1575 |
| 66 | Ga0068867_100263583 | 3300005459 | Bacteria | 1406 |
| 67 | Ga0070685_10099921 | 3300005466 | Bacteria | 1770 |
| 68 | Ga0070685_10202502 | 3300005466 | Bacteria | 1291 |
| 69 | Ga0070685_10206579 | 3300005466 | Bacteria | 1279 |
| 70 | Ga0070685_10231055 | 3300005466 | Unclassified | 1216 |
| 71 | Ga0070707_100173281 | 3300005468 | Bacteria | 2103 |
| 72 | Ga0070684_100126248 | 3300005535 | Bacteria | 2305 |
| 73 | Ga0070684_100232143 | 3300005535 | Bacteria | 1685 |
| 74 | Ga0070684_100381719 | 3300005535 | Bacteria | 1298 |
| 75 | Ga0070697_100264975 | 3300005536 | Bacteria | 1472 |
| 76 | Ga0068853_100436691 | 3300005539 | Bacteria | 1230 |
| 77 | Ga0070672_100375778 | 3300005543 | Bacteria | 1215 |
| 78 | Ga0070686_100110762 | 3300005544 | Bacteria | 1870 |
| 79 | Ga0070695_100154434 | 3300005545 | Bacteria | 1605 |
| 80 | Ga0070693_100088241 | 3300005547 | Bacteria | 1864 |
| 81 | Ga0070665_100131746 | 3300005548 | Bacteria | 2502 |
| 82 | Ga0070665_100258231 | 3300005548 | Bacteria | 1743 |
| 83 | Ga0070665_100407094 | 3300005548 | Bacteria | 1368 |
| 84 | Ga0070665_100417922 | 3300005548 | Bacteria | 1350 |
| 85 | Ga0070665_100593614 | 3300005548 | Bacteria | 1120 |
| 86 | Ga0068855_100626341 | 3300005563 | Bacteria | 1158 |
| 87 | Ga0070664_100257739 | 3300005564 | Bacteria | 1569 |
| 88 | Ga0070664_100472839 | 3300005564 | Bacteria | 1153 |
| 89 | Ga0068854_100345409 | 3300005578 | Bacteria | 1216 |
| 90 | Ga0068856_100327425 | 3300005614 | Bacteria | 1550 |
| 91 | Ga0068856_100359714 | 3300005614 | Bacteria | 1474 |
| 92 | Ga0068856_100368711 | 3300005614 | Bacteria | 1455 |
| 93 | Ga0070702_100144885 | 3300005615 | Bacteria | 1517 |
| 94 | Ga0070702_100179388 | 3300005615 | Bacteria | 1385 |
| 95 | Ga0068852_100493363 | 3300005616 | Bacteria | 1218 |
| 96 | Ga0068859_100325255 | 3300005617 | Bacteria | 1631 |
| 97 | Ga0068859_100414457 | 3300005617 | Bacteria | 1443 |
| 98 | Ga0068864_100467543 | 3300005618 | Bacteria | 1208 |
| 99 | Ga0068866_10074941 | 3300005718 | Bacteria | 1800 |
| 100 | Ga0068866_10124628 | 3300005718 | Bacteria | 1456 |
| 101 | Ga0068866_10136461 | 3300005718 | Bacteria | 1402 |
| 102 | Ga0068870_10068003 | 3300005840 | Bacteria | 1934 |
| 103 | Ga0068870_10202743 | 3300005840 | Bacteria | 1204 |
| 104 | Ga0068870_10226496 | 3300005840 | Unclassified | 1147 |
| 105 | Ga0068863_100292648 | 3300005841 | Bacteria | 1578 |
| 106 | Ga0068863_100403662 | 3300005841 | Bacteria | 1337 |
| 107 | Ga0068863_100499598 | 3300005841 | Bacteria | 1198 |
| 108 | Ga0068858_100237215 | 3300005842 | Bacteria | 1730 |
| 109 | Ga0068858_100466115 | 3300005842 | Bacteria | 1218 |
| 110 | Ga0068860_100170366 | 3300005843 | Bacteria | 2103 |
| 111 | Ga0068860_100509188 | 3300005843 | Bacteria | 1202 |
| 112 | Ga0068862_100272791 | 3300005844 | Bacteria | 1548 |
| 113 | Ga0081455_10018251 | 3300005937 | Bacteria | 6692 |
| 114 | Ga0081455_10023926 | 3300005937 | Bacteria | 5672 |
| 115 | Ga0081455_10128155 | 3300005937 | Bacteria | 1988 |
| 116 | Ga0081538_10000569 | 3300005981 | Bacteria | 40868 |
| 117 | Ga0081538_10001524 | 3300005981 | Bacteria | 23781 |
| 118 | Ga0081538_10004505 | 3300005981 | Bacteria | 12822 |
| 119 | Ga0081538_10004937 | 3300005981 | Bacteria | 12150 |
| 120 | Ga0081538_10010035 | 3300005981 | Bacteria | 7810 |
| 121 | Ga0081538_10010597 | 3300005981 | Bacteria | 7546 |
| 122 | Ga0081538_10013630 | 3300005981 | Bacteria | 6429 |
| 123 | Ga0081538_10014531 | 3300005981 | Bacteria | 6156 |
| 124 | Ga0081538_10016061 | 3300005981 | Bacteria | 5759 |
| 125 | Ga0081538_10016244 | 3300005981 | Bacteria | 5719 |
| 126 | Ga0081538_10016712 | 3300005981 | Bacteria | 5611 |
| 127 | Ga0081538_10021247 | 3300005981 | Bacteria | 4746 |
| 128 | Ga0081538_10024054 | 3300005981 | Bacteria | 4353 |
| 129 | Ga0081538_10028754 | 3300005981 | Bacteria | 3814 |
| 130 | Ga0081538_10029288 | 3300005981 | Bacteria | 3765 |
| 131 | Ga0081538_10030632 | 3300005981 | Plasmid | 3648 |
| 132 | Ga0081538_10040205 | 3300005981 | Bacteria | 2987 |
| 133 | Ga0081538_10052670 | 3300005981 | Bacteria | 2429 |
| 134 | Ga0081538_10095181 | 3300005981 | Bacteria | 1522 |
| 135 | Ga0081538_10117597 | 3300005981 | Unclassified | 1287 |
| 136 | Ga0081539_10038028 | 3300005985 | Bacteria | 2858 |
| 137 | Ga0081539_10114737 | 3300005985 | Bacteria | 1349 |
| 138 | Ga0070717_10259353 | 3300006028 | Bacteria | 1538 |
| 139 | Ga0070717_10273041 | 3300006028 | Bacteria | 1498 |
| 140 | Ga0075432_10058776 | 3300006058 | Bacteria | 1366 |
| 141 | Ga0070715_10091189 | 3300006163 | Unclassified | 1403 |
| 142 | Ga0070716_100011811 | 3300006173 | Bacteria | 4406 |
| 143 | Ga0070716_100078251 | 3300006173 | Bacteria | 1965 |
| 144 | Ga0070716_100157840 | 3300006173 | Bacteria | 1466 |
| 145 | Ga0070712_100147574 | 3300006175 | Bacteria | 1802 |
| 146 | Ga0070712_100314533 | 3300006175 | Bacteria | 1271 |
| 147 | Ga0070712_100367865 | 3300006175 | Bacteria | 1181 |
| 148 | Ga0097621_100329658 | 3300006237 | Bacteria | 1353 |
| 149 | Ga0068871_100202084 | 3300006358 | Bacteria | 1716 |
| 150 | Ga0068871_100318077 | 3300006358 | Bacteria | 1370 |
| 151 | Ga0075428_100007616 | 3300006844 | Bacteria | 12003 |
| 152 | Ga0075428_100392897 | 3300006844 | Bacteria | 1487 |
| 153 | Ga0075431_100466048 | 3300006847 | Bacteria | 1257 |
| 154 | Ga0075433_10195889 | 3300006852 | Bacteria | 1797 |
| 155 | Ga0068865_100108105 | 3300006881 | Bacteria | 2047 |
| 156 | Ga0068865_100334102 | 3300006881 | Bacteria | 1223 |
| 157 | Ga0075436_100155119 | 3300006914 | Bacteria | 1613 |
| 158 | Ga0075436_100238436 | 3300006914 | Bacteria | 1293 |
| 159 | Ga0097620_100325244 | 3300006931 | Bacteria | 1631 |
| 160 | Ga0097620_100414483 | 3300006931 | Bacteria | 1443 |
| 161 | Ga0075435_100364179 | 3300007076 | Unclassified | 1240 |
| 162 | Ga0111539_10171874 | 3300009094 | Bacteria | 2532 |
| 163 | Ga0111539_10245128 | 3300009094 | Bacteria | 2086 |
| 164 | Ga0111539_10316957 | 3300009094 | Bacteria | 1815 |
| 165 | Ga0111539_10319906 | 3300009094 | Bacteria | 1806 |
| 166 | Ga0105245_10105930 | 3300009098 | Bacteria | 2608 |
| 167 | Ga0105245_10344482 | 3300009098 | Bacteria | 1475 |
| 168 | Ga0105245_10458581 | 3300009098 | Bacteria | 1284 |
| 169 | Ga0105247_10178980 | 3300009101 | Bacteria | 1414 |
| 170 | Ga0105247_10204599 | 3300009101 | Bacteria | 1328 |
| 171 | Ga0114129_10037726 | 3300009147 | Bacteria | 6821 |
| 172 | Ga0114129_10349034 | 3300009147 | Bacteria | 1961 |
| 173 | Ga0105243_10356203 | 3300009148 | Bacteria | 1345 |
| 174 | Ga0105241_10173703 | 3300009174 | Bacteria | 1781 |
| 175 | Ga0105241_10202242 | 3300009174 | Bacteria | 1660 |
| 176 | Ga0105242_10207991 | 3300009176 | Bacteria | 1742 |
| 177 | Ga0105248_10081825 | 3300009177 | Bacteria | 3630 |
| 178 | Ga0105237_10290288 | 3300009545 | Unclassified | 1638 |
| 179 | Ga0105237_10326021 | 3300009545 | Bacteria | 1540 |
| 180 | Ga0105238_10091497 | 3300009551 | Plasmid | 3029 |
| 181 | Ga0105238_10133354 | 3300009551 | Unclassified | 2462 |
| 182 | Ga0105238_10341499 | 3300009551 | Bacteria | 1485 |
| 183 | Ga0105249_10278198 | 3300009553 | Bacteria | 1670 |
| 184 | Ga0105239_10218030 | 3300010375 | Bacteria | 2139 |
| 185 | Ga0105239_10435779 | 3300010375 | Bacteria | 1486 |
| 186 | Ga0105246_10058465 | 3300011119 | Bacteria | 2671 |
| 187 | Ga0105246_10205533 | 3300011119 | Bacteria | 1534 |
| 188 | Ga0105246_10232875 | 3300011119 | Bacteria | 1451 |
| 189 | Ga0157373_10230582 | 3300013100 | Bacteria | 1307 |
| 190 | Ga0157371_10225178 | 3300013102 | Bacteria | 1347 |
| 191 | Ga0157369_10273555 | 3300013105 | Bacteria | 1760 |
| 192 | Ga0157369_10283346 | 3300013105 | Bacteria | 1726 |
| 193 | Ga0157369_10530281 | 3300013105 | Bacteria | 1218 |
| 194 | Ga0157374_10391314 | 3300013296 | Bacteria | 1386 |
| 195 | Ga0157374_10441973 | 3300013296 | Bacteria | 1301 |
| 196 | Ga0157378_10409060 | 3300013297 | Bacteria | 1339 |
| 197 | Ga0157378_10463625 | 3300013297 | Unclassified | 1259 |
| 198 | Ga0163162_10463634 | 3300013306 | Bacteria | 1398 |
| 199 | Ga0163162_10658930 | 3300013306 | Bacteria | 1170 |
| 200 | Ga0157372_10191328 | 3300013307 | Bacteria | 2370 |
| 201 | Ga0157372_10532673 | 3300013307 | Bacteria | 1369 |
| 202 | Ga0157375_10246630 | 3300013308 | Unclassified | 1946 |
| 203 | Ga0157375_10309471 | 3300013308 | Bacteria | 1744 |
| 204 | Ga0157375_10328362 | 3300013308 | Bacteria | 1694 |
| 205 | Ga0157375_10402911 | 3300013308 | Bacteria | 1535 |
| 206 | Ga0157375_10609997 | 3300013308 | Bacteria | 1250 |
| 207 | Ga0163163_10353327 | 3300014325 | Bacteria | 1526 |
| 208 | Ga0163163_10432540 | 3300014325 | Bacteria | 1375 |
| 209 | Ga0163163_10449165 | 3300014325 | Bacteria | 1349 |
| 210 | Ga0163163_10502245 | 3300014325 | Bacteria | 1275 |
| 211 | Ga0157380_10290774 | 3300014326 | Bacteria | 1500 |
| 212 | Ga0157380_10421910 | 3300014326 | Bacteria | 1273 |
| 213 | Ga0182008_10103160 | 3300014497 | Unclassified | 1410 |
| 214 | Ga0157377_10128261 | 3300014745 | Bacteria | 1546 |
| 215 | Ga0157377_10138699 | 3300014745 | Bacteria | 1492 |
| 216 | Ga0157379_10347794 | 3300014968 | Bacteria | 1357 |
| 217 | Ga0157379_10398931 | 3300014968 | Bacteria | 1264 |
| 218 | Ga0157379_10497389 | 3300014968 | Bacteria | 1130 |
| 219 | Ga0157376_10241828 | 3300014969 | Bacteria | 1682 |
| 220 | Ga0163161_10201478 | 3300017792 | Bacteria | 1534 |
| 221 | Ga0163161_10280732 | 3300017792 | Bacteria | 1306 |
| 222 | Ga0207642_10048559 | 3300025899 | Bacteria | 1903 |
| 223 | Ga0207642_10165717 | 3300025899 | Bacteria | 1191 |
| 224 | Ga0207710_10136643 | 3300025900 | Bacteria | 1181 |
| 225 | Ga0207710_10157336 | 3300025900 | Bacteria | 1105 |
| 226 | Ga0207688_10028151 | 3300025901 | Bacteria | 3092 |
| 227 | Ga0207688_10097851 | 3300025901 | Bacteria | 1691 |
| 228 | Ga0207688_10146059 | 3300025901 | Bacteria | 1394 |
| 229 | Ga0207680_10078730 | 3300025903 | Unclassified | 2065 |
| 230 | Ga0207680_10238477 | 3300025903 | Bacteria | 1252 |
| 231 | Ga0207647_10169064 | 3300025904 | Bacteria | 1273 |
| 232 | Ga0207699_10177129 | 3300025906 | Bacteria | 1431 |
| 233 | Ga0207699_10297967 | 3300025906 | Unclassified | 1125 |
| 234 | Ga0207645_10054283 | 3300025907 | Bacteria | 2559 |
| 235 | Ga0207645_10094562 | 3300025907 | Bacteria | 1924 |
| 236 | Ga0207643_10014076 | 3300025908 | Bacteria | 4342 |
| 237 | Ga0207643_10085684 | 3300025908 | Bacteria | 1830 |
| 238 | Ga0207705_10264895 | 3300025909 | Bacteria | 1313 |
| 239 | Ga0207707_10306131 | 3300025912 | Bacteria | 1373 |
| 240 | Ga0207671_10356624 | 3300025914 | Bacteria | 1160 |
| 241 | Ga0207693_10135254 | 3300025915 | Bacteria | 1938 |
| 242 | Ga0207693_10145322 | 3300025915 | Bacteria | 1865 |
| 243 | Ga0207693_10195344 | 3300025915 | Bacteria | 1592 |
| 244 | Ga0207693_10225709 | 3300025915 | Unclassified | 1471 |
| 245 | Ga0207663_10171267 | 3300025916 | Bacteria | 1542 |
| 246 | Ga0207663_10347319 | 3300025916 | Unclassified | 1122 |
| 247 | Ga0207662_10017528 | 3300025918 | Bacteria | 4053 |
| 248 | Ga0207662_10048441 | 3300025918 | Bacteria | 2517 |
| 249 | Ga0207657_10247957 | 3300025919 | Unclassified | 1420 |
| 250 | Ga0207657_10296159 | 3300025919 | Bacteria | 1282 |
| 251 | Ga0207646_10296704 | 3300025922 | Bacteria | 1460 |
| 252 | Ga0207694_10422050 | 3300025924 | Bacteria | 1111 |
| 253 | Ga0207650_10388599 | 3300025925 | Bacteria | 1153 |
| 254 | Ga0207687_10064018 | 3300025927 | Bacteria | 2606 |
| 255 | Ga0207687_10250724 | 3300025927 | Unclassified | 1407 |
| 256 | Ga0207687_10321498 | 3300025927 | Bacteria | 1253 |
| 257 | Ga0207687_10414360 | 3300025927 | Bacteria | 1111 |
| 258 | Ga0207700_10207294 | 3300025928 | Bacteria | 1655 |
| 259 | Ga0207700_10257043 | 3300025928 | Bacteria | 1494 |
| 260 | Ga0207700_10475881 | 3300025928 | Unclassified | 1103 |
| 261 | Ga0207664_10453984 | 3300025929 | Bacteria | 1144 |
| 262 | Ga0207664_10464214 | 3300025929 | Bacteria | 1131 |
| 263 | Ga0207690_10319380 | 3300025932 | Bacteria | 1220 |
| 264 | Ga0207706_10272832 | 3300025933 | Bacteria | 1476 |
| 265 | Ga0207706_10356998 | 3300025933 | Bacteria | 1270 |
| 266 | Ga0207686_10328444 | 3300025934 | Bacteria | 1145 |
| 267 | Ga0207709_10320039 | 3300025935 | Bacteria | 1160 |
| 268 | Ga0207670_10044711 | 3300025936 | Bacteria | 2931 |
| 269 | Ga0207670_10232665 | 3300025936 | Bacteria | 1416 |
| 270 | Ga0207669_10307536 | 3300025937 | Bacteria | 1207 |
| 271 | Ga0207665_10161518 | 3300025939 | Bacteria | 1612 |
| 272 | Ga0207665_10209925 | 3300025939 | Unclassified | 1422 |
| 273 | Ga0207691_10375830 | 3300025940 | Bacteria | 1213 |
| 274 | Ga0207711_10506131 | 3300025941 | Bacteria | 1126 |
| 275 | Ga0207689_10099113 | 3300025942 | Bacteria | 2394 |
| 276 | Ga0207689_10237066 | 3300025942 | Bacteria | 1508 |
| 277 | Ga0207661_10224290 | 3300025944 | Bacteria | 1662 |
| 278 | Ga0207661_10251075 | 3300025944 | Bacteria | 1572 |
| 279 | Ga0207661_10440676 | 3300025944 | Bacteria | 1185 |
| 280 | Ga0207679_10341575 | 3300025945 | Bacteria | 1302 |
| 281 | Ga0207667_10473187 | 3300025949 | Bacteria | 1272 |
| 282 | Ga0207667_10505526 | 3300025949 | Unclassified | 1225 |
| 283 | Ga0207651_10184814 | 3300025960 | Bacteria | 1657 |
| 284 | Ga0207712_10194388 | 3300025961 | Bacteria | 1604 |
| 285 | Ga0207712_10328850 | 3300025961 | Bacteria | 1264 |
| 286 | Ga0207668_10333109 | 3300025972 | Bacteria | 1263 |
| 287 | Ga0207668_10337158 | 3300025972 | Bacteria | 1256 |
| 288 | Ga0207640_10233316 | 3300025981 | Bacteria | 1417 |
| 289 | Ga0207640_10372678 | 3300025981 | Bacteria | 1154 |
| 290 | Ga0207640_10374125 | 3300025981 | Bacteria | 1152 |
| 291 | Ga0207658_10085869 | 3300025986 | Bacteria | 2425 |
| 292 | Ga0207677_10415637 | 3300026023 | Bacteria | 1144 |
| 293 | Ga0207677_10416474 | 3300026023 | Bacteria | 1143 |
| 294 | Ga0207703_10403254 | 3300026035 | Bacteria | 1269 |
| 295 | Ga0207703_10506174 | 3300026035 | Bacteria | 1134 |
| 296 | Ga0207678_10053930 | 3300026067 | Bacteria | 3463 |
| 297 | Ga0207678_10148050 | 3300026067 | Bacteria | 2004 |
| 298 | Ga0207678_10324312 | 3300026067 | Unclassified | 1325 |
| 299 | Ga0207708_10042308 | 3300026075 | Bacteria | 3473 |
| 300 | Ga0207708_10118333 | 3300026075 | Bacteria | 2063 |
| 301 | Ga0207702_10246549 | 3300026078 | Bacteria | 1676 |
| 302 | Ga0207702_10343884 | 3300026078 | Bacteria | 1425 |
| 303 | Ga0207702_10447030 | 3300026078 | Bacteria | 1253 |
| 304 | Ga0207641_10539451 | 3300026088 | Bacteria | 1136 |
| 305 | Ga0207648_10292961 | 3300026089 | Bacteria | 1458 |
| 306 | Ga0207676_10386933 | 3300026095 | Bacteria | 1303 |
| 307 | Ga0207676_10391166 | 3300026095 | Bacteria | 1297 |
| 308 | Ga0207674_10348306 | 3300026116 | Bacteria | 1432 |
| 309 | Ga0207675_100081387 | 3300026118 | Bacteria | 3036 |
| 310 | Ga0207675_100333076 | 3300026118 | Bacteria | 1484 |
| 311 | Ga0207683_10176398 | 3300026121 | Bacteria | 1937 |
| 312 | Ga0207698_10527640 | 3300026142 | Bacteria | 1153 |
| 313 | Ga0207698_10537524 | 3300026142 | Bacteria | 1143 |
| 314 | Ga0209998_10038763 | 3300027717 | Bacteria | 1076 |
| 315 | Ga0207428_10151001 | 3300027907 | Bacteria | 1768 |
| 316 | Ga0207428_10164131 | 3300027907 | Bacteria | 1685 |
| 317 | Ga0207428_10322026 | 3300027907 | Unclassified | 1142 |
| 318 | Ga0207428_10343175 | 3300027907 | Bacteria | 1100 |
| 319 | Ga0268266_10357992 | 3300028379 | Bacteria | 1372 |
| 320 | Ga0268266_10515761 | 3300028379 | Bacteria | 1142 |
| 321 | Ga0268264_10478588 | 3300028381 | Bacteria | 1211 |
| 322 | Ga0268264_10528350 | 3300028381 | Bacteria | 1154 |
| 323 | Ga0265322_10053883 | 3300028654 | Bacteria | 1141 |
| 324 | Ga0307408_100150535 | 3300031548 | Bacteria | 1836 |
| 325 | Ga0307408_100170884 | 3300031548 | Bacteria | 1735 |
| 326 | Ga0307408_100233935 | 3300031548 | Bacteria | 1506 |
| 327 | Ga0307408_100366300 | 3300031548 | Bacteria | 1227 |
| 328 | Ga0307408_100409444 | 3300031548 | Bacteria | 1166 |
| 329 | Ga0307508_10044271 | 3300031616 | Bacteria | 3983 |
| 330 | Ga0265342_10119720 | 3300031712 | Bacteria | 1483 |
| 331 | Ga0316576_10229327 | 3300031727 | Bacteria | 1396 |
| 332 | Ga0307405_10057442 | 3300031731 | Unclassified | 2444 |
| 333 | Ga0307405_10058761 | 3300031731 | Bacteria | 2421 |
| 334 | Ga0307405_10114734 | 3300031731 | Unclassified | 1831 |
| 335 | Ga0307405_10125102 | 3300031731 | Bacteria | 1766 |
| 336 | Ga0307405_10144194 | 3300031731 | Bacteria | 1665 |
| 337 | Ga0307405_10163004 | 3300031731 | Bacteria | 1581 |
| 338 | Ga0307405_10191083 | 3300031731 | Bacteria | 1479 |
| 339 | Ga0307405_10207229 | 3300031731 | Bacteria | 1428 |
| 340 | Ga0307405_10280745 | 3300031731 | Bacteria | 1253 |
| 341 | Ga0307405_10306233 | 3300031731 | Bacteria | 1207 |
| 342 | Ga0307405_10373515 | 3300031731 | Unclassified | 1107 |
| 343 | Ga0307413_10053358 | 3300031824 | Unclassified | 2447 |
| 344 | Ga0307413_10125061 | 3300031824 | Bacteria | 1749 |
| 345 | Ga0307413_10205316 | 3300031824 | Unclassified | 1426 |
| 346 | Ga0307413_10245232 | 3300031824 | Bacteria | 1325 |
| 347 | Ga0307413_10301335 | 3300031824 | Bacteria | 1215 |
| 348 | Ga0307413_10369050 | 3300031824 | Bacteria | 1114 |
| 349 | Ga0307410_10043212 | 3300031852 | Bacteria | 2985 |
| 350 | Ga0307410_10139908 | 3300031852 | Bacteria | 1789 |
| 351 | Ga0307410_10195544 | 3300031852 | Bacteria | 1540 |
| 352 | Ga0307410_10222588 | 3300031852 | Bacteria | 1452 |
| 353 | Ga0307410_10272919 | 3300031852 | Bacteria | 1323 |
| 354 | Ga0307410_10280918 | 3300031852 | Bacteria | 1306 |
| 355 | Ga0307406_10049631 | 3300031901 | Unclassified | 2656 |
| 356 | Ga0307406_10279034 | 3300031901 | Bacteria | 1273 |
| 357 | Ga0307406_10287737 | 3300031901 | Bacteria | 1256 |
| 358 | Ga0307406_10294110 | 3300031901 | Unclassified | 1244 |
| 359 | Ga0307406_10320698 | 3300031901 | Bacteria | 1198 |
| 360 | Ga0307406_10353193 | 3300031901 | Bacteria | 1149 |
| 361 | Ga0307406_10366217 | 3300031901 | Bacteria | 1131 |
| 362 | Ga0307406_10386145 | 3300031901 | Bacteria | 1105 |
| 363 | Ga0307407_10157344 | 3300031903 | Bacteria | 1483 |
| 364 | Ga0307407_10170848 | 3300031903 | Bacteria | 1431 |
| 365 | Ga0307407_10201406 | 3300031903 | Bacteria | 1334 |
| 366 | Ga0307407_10243295 | 3300031903 | Unclassified | 1228 |
| 367 | Ga0307407_10249410 | 3300031903 | Bacteria | 1215 |
| 368 | Ga0307407_10259046 | 3300031903 | Unclassified | 1195 |
| 369 | Ga0307407_10259997 | 3300031903 | Bacteria | 1193 |
| 370 | Ga0307407_10279054 | 3300031903 | Bacteria | 1156 |
| 371 | Ga0307412_10155325 | 3300031911 | Unclassified | 1693 |
| 372 | Ga0307412_10161564 | 3300031911 | Bacteria | 1665 |
| 373 | Ga0307412_10283131 | 3300031911 | Bacteria | 1302 |
| 374 | Ga0307412_10361768 | 3300031911 | Bacteria | 1169 |
| 375 | Ga0307412_10373267 | 3300031911 | Bacteria | 1152 |
| 376 | Ga0307409_100008677 | 3300031995 | Bacteria | 6186 |
| 377 | Ga0307409_100213431 | 3300031995 | Bacteria | 1736 |
| 378 | Ga0307409_100304812 | 3300031995 | Bacteria | 1483 |
| 379 | Ga0307409_100382452 | 3300031995 | Bacteria | 1338 |
| 380 | Ga0307409_100425859 | 3300031995 | Bacteria | 1274 |
| 381 | Ga0307409_100485730 | 3300031995 | Bacteria | 1199 |
| 382 | Ga0307409_100500626 | 3300031995 | Bacteria | 1183 |
| 383 | Ga0307409_100517988 | 3300031995 | Unclassified | 1164 |
| 384 | Ga0307409_100547242 | 3300031995 | Bacteria | 1135 |
| 385 | Ga0307409_100556772 | 3300031995 | Bacteria | 1126 |
| 386 | Ga0307416_100005616 | 3300032002 | Bacteria | 7735 |
| 387 | Ga0307416_100147451 | 3300032002 | Bacteria | 2151 |
| 388 | Ga0307416_100246125 | 3300032002 | Bacteria | 1736 |
| 389 | Ga0307416_100252841 | 3300032002 | Bacteria | 1716 |
| 390 | Ga0307416_100419711 | 3300032002 | Bacteria | 1381 |
| 391 | Ga0307416_100426455 | 3300032002 | Bacteria | 1372 |
| 392 | Ga0307416_100487003 | 3300032002 | Bacteria | 1294 |
| 393 | Ga0307416_100489688 | 3300032002 | Unclassified | 1291 |
| 394 | Ga0307416_100513887 | 3300032002 | Bacteria | 1264 |
| 395 | Ga0307416_100525225 | 3300032002 | Unclassified | 1252 |
| 396 | Ga0307416_100525226 | 3300032002 | Bacteria | 1252 |
| 397 | Ga0307416_100540926 | 3300032002 | Bacteria | 1236 |
| 398 | Ga0307416_100573609 | 3300032002 | Bacteria | 1204 |
| 399 | Ga0307416_100625979 | 3300032002 | Bacteria | 1158 |
| 400 | Ga0307416_100642094 | 3300032002 | Bacteria | 1145 |
| 401 | Ga0307414_10145559 | 3300032004 | Bacteria | 1861 |
| 402 | Ga0307414_10149948 | 3300032004 | Bacteria | 1838 |
| 403 | Ga0307414_10181601 | 3300032004 | Unclassified | 1693 |
| 404 | Ga0307414_10265093 | 3300032004 | Bacteria | 1435 |
| 405 | Ga0307414_10324787 | 3300032004 | Bacteria | 1311 |
| 406 | Ga0307414_10405226 | 3300032004 | Bacteria | 1185 |
| 407 | Ga0307414_10421418 | 3300032004 | Bacteria | 1164 |
| 408 | Ga0307414_10427355 | 3300032004 | Bacteria | 1156 |
| 409 | Ga0307411_10031311 | 3300032005 | Bacteria | 3271 |
| 410 | Ga0307411_10205220 | 3300032005 | Bacteria | 1517 |
| 411 | Ga0307411_10221458 | 3300032005 | Bacteria | 1468 |
| 412 | Ga0307411_10253332 | 3300032005 | Unclassified | 1385 |
| 413 | Ga0307411_10265230 | 3300032005 | Unclassified | 1358 |
| 414 | Ga0307411_10317662 | 3300032005 | Bacteria | 1256 |
| 415 | Ga0307411_10377804 | 3300032005 | Bacteria | 1164 |
| 416 | Ga0307411_10386625 | 3300032005 | Bacteria | 1152 |
| 417 | Ga0307415_100044723 | 3300032126 | Bacteria | 2962 |
| 418 | Ga0307415_100121300 | 3300032126 | Bacteria | 1961 |
| 419 | Ga0307415_100127770 | 3300032126 | Bacteria | 1918 |
| 420 | Ga0307415_100239231 | 3300032126 | Unclassified | 1467 |
| 421 | Ga0307415_100275253 | 3300032126 | Bacteria | 1381 |
| 422 | Ga0307415_100296410 | 3300032126 | Bacteria | 1337 |
| 423 | Ga0307415_100314312 | 3300032126 | Unclassified | 1303 |
| 424 | Ga0307415_100347847 | 3300032126 | Bacteria | 1246 |
| 425 | Ga0307415_100355121 | 3300032126 | Bacteria | 1235 |
| 426 | Ga0307415_100376005 | 3300032126 | Bacteria | 1204 |
| 427 | Ga0307415_100380324 | 3300032126 | Bacteria | 1198 |
| 428 | Ga0307415_100398970 | 3300032126 | Bacteria | 1173 |
| 429 | Ga0307415_100421542 | 3300032126 | Unclassified | 1145 |
| 430 | Ga0307415_100426741 | 3300032126 | Bacteria | 1139 |
| 431 | Ga0316212_1006543 | 3300033547 | Bacteria | 1687 |
| 432 | Ga0373934_0063146 | 3300035086 | Unclassified | 1477 |
| 433 | Ga0373923_0009983 | 3300035111 | Bacteria | 3439 |
| 434 | Ga0373936_0022649 | 3300035113 | Bacteria | 2446 |
| 435 | Ga0373954_0010635 | 3300035118 | Bacteria | 4064 |
| 436 | Ga0373956_0070671 | 3300035119 | Unclassified | 1592 |
| 437 | Ga0373956_0135560 | 3300035119 | Bacteria | 1154 |
| 438 | Ga0373957_0009209 | 3300035120 | Bacteria | 3224 |
| 439 | Ga0373957_0009214 | 3300035120 | Bacteria | 3223 |
| 440 | Ga0373957_0058989 | 3300035120 | Unclassified | 1483 |
| 441 | Ga0373955_0003181 | 3300035172 | Bacteria | 7189 |
| 442 | Ga0373955_0031479 | 3300035172 | Bacteria | 2779 |
| 443 | Ga0373955_0056730 | 3300035172 | Bacteria | 2149 |
| 444 | Ga0316574_0024580 | 3300035398 | Bacteria | 3607 |
| 445 | Ga0316574_0229833 | 3300035398 | Unclassified | 1187 |
| 446 | Ga0373935_0029239 | 3300035692 | Bacteria | 3410 |
| 447 | Ga0373935_0058167 | 3300035692 | Bacteria | 2468 |
| 448 | Ga0373935_0197863 | 3300035692 | Bacteria | 1387 |
| 449 | Ga0373933_0009123 | 3300035724 | Bacteria | 5413 |
| 450 | Ga0373933_0023097 | 3300035724 | Bacteria | 3549 |
| 451 | Ga0373933_0080270 | 3300035724 | Bacteria | 1999 |
| 452 | Ga0373933_0190885 | 3300035724 | Unclassified | 1308 |
| 453 | Ga0373933_0217017 | 3300035724 | Bacteria | 1226 |
| 454 | Ga0373937_0262256 | 3300036401 | Bacteria | 1629 |
| 455 | Ga0373937_0301124 | 3300036401 | Unclassified | 1515 |
| 456 | Ga0373937_0352114 | 3300036401 | Unclassified | 1395 |
| 457 | Ga0373937_0374760 | 3300036401 | Bacteria | 1349 |
| 458 | Ga0373937_0423565 | 3300036401 | Unclassified | 1263 |
| 459 | Ga0373937_0498114 | 3300036401 | Bacteria | 1157 |
| 460 | Ga0373925_0403240 | 3300037068 | Unclassified | 1115 |
| 461 | Ga0395899_0071168 | 3300037312 | Bacteria | 2545 |
| 462 | Ga0395899_0186340 | 3300037312 | Bacteria | 1454 |
| 463 | Ga0395899_0230079 | 3300037312 | Bacteria | 1280 |
| 464 | Ga0395899_0258389 | 3300037312 | Bacteria | 1192 |
| 465 | Ga0395899_0275442 | 3300037312 | Unclassified | 1146 |
| 466 | Ga0395900_0105094 | 3300037418 | Bacteria | 2901 |
| 467 | Ga0395900_0125036 | 3300037418 | Plasmid | 2637 |
| 468 | Ga0395900_0255804 | 3300037418 | Bacteria | 1751 |
| 469 | Ga0395900_0313424 | 3300037418 | Bacteria | 1551 |
| 470 | Ga0395900_0363391 | 3300037418 | Bacteria | 1418 |
| 471 | Ga0395900_0436768 | 3300037418 | Bacteria | 1267 |
| 472 | Ga0395900_0441147 | 3300037418 | Bacteria | 1259 |
| 473 | Ga0395900_0494947 | 3300037418 | Bacteria | 1173 |
| 474 | Ga0395900_0501224 | 3300037418 | Bacteria | 1164 |
| 475 | Ga0395898_0047758 | 3300037466 | Bacteria | 4199 |
| 476 | Ga0395898_0077521 | 3300037466 | Bacteria | 3208 |
| 477 | Ga0395898_0088555 | 3300037466 | Bacteria | 2980 |
| 478 | Ga0395898_0089490 | 3300037466 | Bacteria | 2962 |
| 479 | Ga0395898_0137811 | 3300037466 | Bacteria | 2336 |
| 480 | Ga0395898_0201439 | 3300037466 | Bacteria | 1900 |
| 481 | Ga0395898_0227841 | 3300037466 | Bacteria | 1777 |
| 482 | Ga0395898_0247359 | 3300037466 | Unclassified | 1701 |
| 483 | Ga0395898_0340448 | 3300037466 | Bacteria | 1430 |
| 484 | Ga0395898_0406597 | 3300037466 | Bacteria | 1298 |
| 485 | Ga0395898_0499912 | 3300037466 | Bacteria | 1156 |
| 486 | Ga0395898_0511799 | 3300037466 | Bacteria | 1141 |
| 487 | Ga0395898_0552634 | 3300037466 | Bacteria | 1093 |
| 488 | Ga0395905_0071909 | 3300037471 | Bacteria | 3242 |
| 489 | Ga0395905_0172829 | 3300037471 | Bacteria | 2029 |
| 490 | Ga0395905_0351741 | 3300037471 | Bacteria | 1365 |
| 491 | Ga0395905_0359621 | 3300037471 | Bacteria | 1348 |
| 492 | Ga0395905_0377855 | 3300037471 | Bacteria | 1310 |
| 493 | Ga0395905_0484457 | 3300037471 | Bacteria | 1136 |
| 494 | Ga0395901_0002454 | 3300038443 | Bacteria | 18800 |
| 495 | Ga0395901_0029491 | 3300038443 | Bacteria | 5650 |
| 496 | Ga0395901_0036918 | 3300038443 | Bacteria | 5052 |
| 497 | Ga0395901_0045774 | 3300038443 | Bacteria | 4542 |
| 498 | Ga0395901_0084271 | 3300038443 | Bacteria | 3322 |
| 499 | Ga0395901_0105309 | 3300038443 | Bacteria | 2960 |
| 500 | Ga0395901_0187170 | 3300038443 | Bacteria | 2171 |
| 501 | Ga0395901_0348543 | 3300038443 | Bacteria | 1528 |
| 502 | Ga0395901_0464037 | 3300038443 | Unclassified | 1294 |
| 503 | Ga0395901_0472159 | 3300038443 | Bacteria | 1280 |
| 504 | Ga0395901_0497632 | 3300038443 | Bacteria | 1241 |
| 505 | Ga0395901_0514694 | 3300038443 | Bacteria | 1216 |
| 506 | Ga0395901_0546512 | 3300038443 | Bacteria | 1174 |
| 507 | Ga0395901_0568178 | 3300038443 | Unclassified | 1147 |
| 508 | Ga0395901_0576349 | 3300038443 | Unclassified | 1137 |
| 509 | Ga0436363_1145716 | 3300039450 | Bacteria | 1449 |
| 510 | Ga0436362_1287969 | 3300039453 | Bacteria | 1458 |
| 511 | Ga0451789_0140450 | 3300041443 | Bacteria | 1333 |
| 512 | Ga0451793_1668073 | 3300041452 | Bacteria | 1711 |
| 513 | Ga0451795_0352230 | 3300041456 | Bacteria | 1362 |
| 514 | Ga0451798_0850043 | 3300041458 | Bacteria | 1260 |
| 515 | Ga0451800_0911729 | 3300041459 | Bacteria | 1615 |
| 516 | Ga0451802_0500978 | 3300041460 | Bacteria | 1311 |
| 517 | Ga0451804_0235963 | 3300041463 | Bacteria | 1538 |
| 518 | Ga0451807_0360181 | 3300041486 | Bacteria | 1673 |
| 519 | Ga0451833_0997737 | 3300041491 | Bacteria | 1307 |
| 520 | Ga0451849_1141966 | 3300041505 | Bacteria | 1399 |
| 521 | Ga0451851_1085776 | 3300041507 | Bacteria | 1252 |
| 522 | Ga0451855_0041179 | 3300041511 | Bacteria | 1387 |
| 523 | Ga0451853_0075624 | 3300041512 | Bacteria | 1444 |
| 524 | Ga0439448_0035766 | 3300042005 | Bacteria | 1591 |
| 525 | Ga0439448_0037015 | 3300042005 | Bacteria | 1566 |
| 526 | Ga0439448_0049495 | 3300042005 | Bacteria | 1373 |
| 527 | Ga0439448_0051994 | 3300042005 | Unclassified | 1342 |
| 528 | Ga0439448_0064454 | 3300042005 | Bacteria | 1214 |
| 529 | Ga0439448_0069192 | 3300042005 | Unclassified | 1174 |
| 530 | Ga0439448_0075803 | 3300042005 | Bacteria | 1124 |
| 531 | Ga0439449_0085380 | 3300042007 | Bacteria | 1164 |
| 532 | Ga0439450_017449 | 3300042008 | Bacteria | 1496 |
| 533 | Ga0439450_018195 | 3300042008 | Bacteria | 1473 |
| 534 | Ga0439450_027497 | 3300042008 | Bacteria | 1260 |
| 535 | Ga0439450_031727 | 3300042008 | Unclassified | 1190 |
| 536 | Ga0439454_006006 | 3300042011 | Unclassified | 1475 |
| 537 | Ga0439455_0039060 | 3300042012 | Bacteria | 1209 |
| 538 | Ga0439455_0044402 | 3300042012 | Bacteria | 1146 |
| 539 | Ga0439455_0046705 | 3300042012 | Unclassified | 1122 |
| 540 | Ga0439463_009327 | 3300042016 | Bacteria | 2414 |
| 541 | Ga0439463_018478 | 3300042016 | Bacteria | 1735 |
| 542 | Ga0439463_018488 | 3300042016 | Bacteria | 1734 |
| 543 | Ga0439463_024273 | 3300042016 | Bacteria | 1519 |
| 544 | Ga0439463_033451 | 3300042016 | Bacteria | 1300 |
| 545 | Ga0439463_039819 | 3300042016 | Unclassified | 1193 |
| 546 | Ga0450922_004391 | 3300042124 | Unclassified | 1294 |
| 547 | Ga0450890_010928 | 3300042127 | Bacteria | 1169 |
| 548 | Ga0450905_008155 | 3300042142 | Bacteria | 1431 |
| 549 | Ga0450905_011651 | 3300042142 | Unclassified | 1231 |
| 550 | Ga0439458_0025568 | 3300042157 | Unclassified | 1385 |
| 551 | Ga0439458_0038818 | 3300042157 | Bacteria | 1150 |
| 552 | Ga0439458_0041437 | 3300042157 | Bacteria | 1118 |
| 553 | Ga0439459_0007899 | 3300042438 | Bacteria | 1806 |
| 554 | Ga0439459_0008738 | 3300042438 | Bacteria | 1738 |
| 555 | Ga0439459_0023912 | 3300042438 | Bacteria | 1194 |
| 556 | Ga0439459_0025396 | 3300042438 | Bacteria | 1169 |
| 557 | Ga0439464_0018297 | 3300042439 | Bacteria | 1905 |
| 558 | Ga0439464_0033184 | 3300042439 | Bacteria | 1452 |
| 559 | Ga0439464_0046591 | 3300042439 | Unclassified | 1246 |
| 560 | Ga0439464_0047734 | 3300042439 | Unclassified | 1232 |
| 561 | Ga0439464_0057660 | 3300042439 | Unclassified | 1132 |
| 562 | Ga0439460_0014852 | 3300042461 | Bacteria | 2053 |
| 563 | Ga0439460_0015081 | 3300042461 | Bacteria | 2040 |
| 564 | Ga0439460_0029261 | 3300042461 | Bacteria | 1558 |
| 565 | Ga0439460_0039171 | 3300042461 | Unclassified | 1384 |
| 566 | Ga0450916_007108 | 3300042530 | Bacteria | 1336 |
| 567 | Ga0450918_017263 | 3300042531 | Bacteria | 1256 |
| 568 | Ga0439440_0005874 | 3300042993 | Unclassified | 2450 |
| 569 | Ga0439440_0006468 | 3300042993 | Unclassified | 2358 |
| 570 | Ga0439440_0021938 | 3300042993 | Bacteria | 1443 |
| 571 | Ga0439440_0029006 | 3300042993 | Bacteria | 1295 |
| 572 | Ga0439440_0030410 | 3300042993 | Unclassified | 1271 |
| 573 | Ga0439440_0030970 | 3300042993 | Bacteria | 1262 |
| 574 | Ga0466963_0209723 | 3300044694 | Bacteria | 1363 |
| 575 | Ga0453684_0426810 | 3300044712 | Bacteria | 1480 |
| 576 | Ga0495592_0024377 | 3300046454 | Unclassified | 4600 |
| 577 | Ga0495592_0165446 | 3300046454 | Unclassified | 1518 |
| 578 | Ga0495629_0032154 | 3300046459 | Bacteria | 3715 |
| 579 | Ga0495629_0216337 | 3300046459 | Unclassified | 1322 |
| 580 | Ga0495638_0183902 | 3300046460 | Bacteria | 1190 |
| 581 | Ga0495651_0036902 | 3300046462 | Bacteria | 3805 |
| 582 | Ga0495651_0053876 | 3300046462 | Bacteria | 3095 |
| 583 | Ga0495651_0177507 | 3300046462 | Bacteria | 1510 |
| 584 | Ga0495653_0020725 | 3300046463 | Bacteria | 5324 |
| 585 | Ga0495653_0085436 | 3300046463 | Bacteria | 2321 |
| 586 | Ga0495653_0197101 | 3300046463 | Unclassified | 1369 |
| 587 | Ga0495653_0252306 | 3300046463 | Bacteria | 1170 |
| 588 | Ga0495580_0224772 | 3300046472 | Bacteria | 1289 |
| 589 | Ga0495605_0104274 | 3300046474 | Bacteria | 1300 |
| 590 | Ga0495662_0153361 | 3300046476 | Unclassified | 1134 |
| 591 | Ga0495664_0003957 | 3300046477 | Bacteria | 8086 |
| 592 | Ga0495664_0051143 | 3300046477 | Unclassified | 2453 |
| 593 | Ga0495664_0068845 | 3300046477 | Bacteria | 2112 |
| 594 | Ga0495596_0109315 | 3300046500 | Unclassified | 1073 |
| 595 | Ga0495606_0182032 | 3300046507 | Bacteria | 1211 |
| 596 | Ga0495608_0034597 | 3300046511 | Bacteria | 3410 |
| 597 | Ga0495608_0062540 | 3300046511 | Bacteria | 2445 |
| 598 | Ga0495608_0226229 | 3300046511 | Unclassified | 1172 |
| 599 | Ga0495618_0085806 | 3300046514 | Unclassified | 2012 |
| 600 | Ga0495628_0019925 | 3300046516 | Bacteria | 5542 |
| 601 | Ga0495628_0074483 | 3300046516 | Bacteria | 2644 |
| 602 | Ga0495628_0240359 | 3300046516 | Unclassified | 1355 |
| 603 | Ga0495630_0109010 | 3300046517 | Unclassified | 2097 |
| 604 | Ga0495630_0174427 | 3300046517 | Bacteria | 1639 |
| 605 | Ga0495644_0056783 | 3300046523 | Bacteria | 1471 |
| 606 | Ga0495652_0065272 | 3300046529 | Bacteria | 3059 |
| 607 | Ga0495652_0095308 | 3300046529 | Bacteria | 2425 |
| 608 | Ga0495652_0238898 | 3300046529 | Bacteria | 1353 |
| 609 | Ga0495652_0267726 | 3300046529 | Bacteria | 1257 |
| 610 | Ga0495652_0269083 | 3300046529 | Unclassified | 1253 |
| 611 | Ga0495654_0007082 | 3300046530 | Bacteria | 6308 |
| 612 | Ga0495665_0018933 | 3300046531 | Bacteria | 3700 |
| 613 | Ga0495665_0026997 | 3300046531 | Bacteria | 3083 |
| 614 | Ga0495665_0154194 | 3300046531 | Unclassified | 1198 |
| 615 | Ga0495640_0090894 | 3300046533 | Unclassified | 2014 |
| 616 | Ga0495586_0065198 | 3300046535 | Unclassified | 1985 |
| 617 | Ga0495587_0032801 | 3300046536 | Bacteria | 3137 |
| 618 | Ga0495587_0051245 | 3300046536 | Bacteria | 2440 |
| 619 | Ga0495587_0095224 | 3300046536 | Bacteria | 1718 |
| 620 | Ga0495587_0189843 | 3300046536 | Unclassified | 1163 |
| 621 | Ga0495645_0007816 | 3300046543 | Bacteria | 7439 |
| 622 | Ga0495645_0128866 | 3300046543 | Bacteria | 1775 |
| 623 | Ga0495645_0165683 | 3300046543 | Unclassified | 1524 |
| 624 | Ga0495667_0001679 | 3300046559 | Bacteria | 14690 |
| 625 | Ga0495667_0011463 | 3300046559 | Bacteria | 6000 |
| 626 | Ga0495667_0052741 | 3300046559 | Bacteria | 2678 |
| 627 | Ga0495667_0195761 | 3300046559 | Unclassified | 1294 |
| 628 | Ga0495667_0209684 | 3300046559 | Unclassified | 1245 |
| 629 | Ga0495634_0066585 | 3300046642 | Unclassified | 2384 |
| 630 | Ga0495635_0011622 | 3300046663 | Bacteria | 6170 |
| 631 | Ga0495635_0021503 | 3300046663 | Bacteria | 4497 |
| 632 | Ga0495635_0262810 | 3300046663 | Unclassified | 1162 |
| 633 | Ga0495657_0029015 | 3300046675 | Bacteria | 3883 |
| 634 | Ga0495657_0088877 | 3300046675 | Bacteria | 1985 |
| 635 | Ga0495657_0126977 | 3300046675 | Bacteria | 1601 |
| 636 | Ga0495657_0200193 | 3300046675 | Unclassified | 1217 |
| 637 | Ga0495657_0218750 | 3300046675 | Unclassified | 1155 |
| 638 | Ga0495599_0072521 | 3300046678 | Unclassified | 2149 |
| 639 | Ga0495599_0203541 | 3300046678 | Unclassified | 1215 |
| 640 | Ga0495623_0048307 | 3300046679 | Plasmid | 2699 |
| 641 | Ga0495623_0115037 | 3300046679 | Unclassified | 1626 |
| 642 | Ga0495623_0183795 | 3300046679 | Bacteria | 1212 |
| 643 | Ga0495646_0102588 | 3300046680 | Bacteria | 1638 |
| 644 | Ga0495646_0168213 | 3300046680 | Unclassified | 1209 |
| 645 | Ga0495658_0084042 | 3300046683 | Bacteria | 1873 |
| 646 | Ga0495669_0015937 | 3300046684 | Bacteria | 3218 |
| 647 | Ga0495669_0144461 | 3300046684 | Bacteria | 1124 |
| 648 | Ga0495613_0041290 | 3300046689 | Bacteria | 3417 |
| 649 | Ga0495613_0072323 | 3300046689 | Bacteria | 2513 |
| 650 | Ga0495624_0153808 | 3300046690 | Unclassified | 1406 |
| 651 | Ga0495589_0007664 | 3300046794 | Bacteria | 5654 |
| 652 | Ga0495600_0023065 | 3300046809 | Bacteria | 4002 |
| 653 | Ga0495600_0175842 | 3300046809 | Unclassified | 1380 |
| 654 | Ga0495600_0189755 | 3300046809 | Bacteria | 1322 |
| 655 | Ga0495581_0008893 | 3300047315 | Bacteria | 5815 |
| 656 | Ga0495581_0032972 | 3300047315 | Bacteria | 2998 |
| 657 | Ga0495581_0162528 | 3300047315 | Unclassified | 1305 |
| 658 | Ga0495581_0195725 | 3300047315 | Bacteria | 1182 |
| 659 | Ga0495604_0031538 | 3300047317 | Bacteria | 4203 |
| 660 | Ga0495604_0226509 | 3300047317 | Unclassified | 1284 |
| 661 | Ga0495604_0227989 | 3300047317 | Bacteria | 1279 |
| 662 | Ga0495604_0273496 | 3300047317 | Unclassified | 1143 |
| 663 | Ga0495674_0017778 | 3300047319 | Bacteria | 6621 |
| 664 | Ga0495674_0087822 | 3300047319 | Unclassified | 2660 |
| 665 | Ga0495674_0170158 | 3300047319 | Unclassified | 1818 |
| 666 | Ga0495674_0219486 | 3300047319 | Bacteria | 1572 |
| 667 | Ga0495674_0360191 | 3300047319 | Unclassified | 1179 |
| 668 | Ga0495674_0383115 | 3300047319 | Bacteria | 1137 |
| 669 | Ga0495672_0144665 | 3300047320 | Bacteria | 1238 |
| 670 | Ga0495680_0081410 | 3300047322 | Bacteria | 2444 |
| 671 | Ga0495680_0118872 | 3300047322 | Bacteria | 1952 |
| 672 | Ga0495680_0275266 | 3300047322 | Unclassified | 1187 |
| 673 | Ga0495683_0029810 | 3300047323 | Bacteria | 2787 |
| 674 | Ga0495683_0097626 | 3300047323 | Bacteria | 1416 |
| 675 | Ga0495675_0025320 | 3300047444 | Bacteria | 3783 |
| 676 | Ga0495675_0202919 | 3300047444 | Bacteria | 1206 |
| 677 | Ga0495673_0084421 | 3300047469 | Bacteria | 1309 |
| 678 | Ga0495684_0154320 | 3300047471 | Unclassified | 1715 |
| 679 | Ga0495684_0243524 | 3300047471 | Bacteria | 1310 |
| 680 | Ga0495593_0050589 | 3300047673 | Bacteria | 2201 |
| 681 | Ga0495602_0233893 | 3300048088 | Unclassified | 1378 |
| 682 | Ga0495602_0249823 | 3300048088 | Bacteria | 1322 |
| 683 | Ga0495602_0288607 | 3300048088 | Unclassified | 1205 |
| 684 | Ga0495602_0303495 | 3300048088 | Unclassified | 1167 |
| 685 | Ga0495626_0092541 | 3300048091 | Bacteria | 1328 |
| 686 | Ga0496100_0190856 | 3300048903 | Bacteria | 1487 |
| 687 | Ga0496101_0042563 | 3300048904 | Bacteria | 3242 |
| 688 | Ga0496101_0349140 | 3300048904 | Bacteria | 1162 |
| 689 | Ga0496103_0205378 | 3300048906 | Bacteria | 1267 |
| 690 | Ga0496104_0133754 | 3300048907 | Bacteria | 2382 |
| 691 | Ga0496106_0321361 | 3300048909 | Bacteria | 1242 |
| 692 | Ga0496106_0339932 | 3300048909 | Bacteria | 1205 |
| 693 | Ga0496107_0249826 | 3300048910 | Bacteria | 1320 |
| 694 | Ga0496108_0354021 | 3300048911 | Bacteria | 1281 |
| 695 | Ga0496108_0381640 | 3300048911 | Bacteria | 1230 |
| 696 | Ga0496109_0476488 | 3300048912 | Bacteria | 1178 |
| 697 | Ga0496109_0477198 | 3300048912 | Bacteria | 1177 |
| 698 | Ga0496110_0278346 | 3300048913 | Unclassified | 1523 |
| 699 | Ga0496112_0507516 | 3300048915 | Bacteria | 1141 |
| 700 | Ga0496114_0049425 | 3300048917 | Bacteria | 3499 |
| 701 | Ga0496114_0467726 | 3300048917 | Bacteria | 1116 |
| 702 | Ga0496115_0037513 | 3300048918 | Bacteria | 3840 |
| 703 | Ga0501031_0027627 | 3300049568 | Bacteria | 3699 |
| 704 | Ga0501031_0167736 | 3300049568 | Bacteria | 1434 |
| 705 | Ga0501031_0177080 | 3300049568 | Bacteria | 1393 |
| 706 | Ga0501032_0015998 | 3300049569 | Bacteria | 5281 |
| 707 | Ga0501032_0170034 | 3300049569 | Bacteria | 1429 |
| 708 | Ga0501033_0044525 | 3300049570 | Plasmid | 3304 |
| 709 | Ga0501033_0138755 | 3300049570 | Bacteria | 1758 |
| 710 | Ga0501033_0150767 | 3300049570 | Bacteria | 1677 |
| 711 | Ga0501034_0361618 | 3300049571 | Bacteria | 1378 |
| 712 | Ga0501036_0003693 | 3300049572 | Bacteria | 12258 |
| 713 | Ga0501036_0272342 | 3300049572 | Bacteria | 1417 |
| 714 | Ga0501036_0291186 | 3300049572 | Bacteria | 1366 |
| 715 | Ga0501037_0061047 | 3300049573 | Bacteria | 2749 |
| 716 | Ga0501037_0107150 | 3300049573 | Bacteria | 2013 |
| 717 | Ga0501037_0175603 | 3300049573 | Bacteria | 1521 |
| 718 | Ga0501038_0019337 | 3300049574 | Bacteria | 6142 |
| 719 | Ga0501038_0282484 | 3300049574 | Bacteria | 1306 |
| 720 | Ga0501039_0000588 | 3300049575 | Bacteria | 26263 |
| 721 | Ga0501039_0032036 | 3300049575 | Bacteria | 4052 |
| 722 | Ga0501039_0067351 | 3300049575 | Bacteria | 2780 |
| 723 | Ga0501039_0278409 | 3300049575 | Bacteria | 1315 |
| 724 | Ga0501040_0002681 | 3300049576 | Bacteria | 11470 |
| 725 | Ga0501040_0064714 | 3300049576 | Plasmid | 2517 |
| 726 | Ga0501041_0000115 | 3300049577 | Bacteria | 33723 |
| 727 | Ga0501041_0019181 | 3300049577 | Bacteria | 4080 |
| 728 | Ga0501041_0064590 | 3300049577 | Bacteria | 2241 |
| 729 | Ga0501042_0001183 | 3300049578 | Bacteria | 15102 |
| 730 | Ga0501042_0007262 | 3300049578 | Bacteria | 7246 |
| 731 | Ga0501042_0100694 | 3300049578 | Bacteria | 2077 |
| 732 | Ga0501042_0167445 | 3300049578 | Bacteria | 1585 |
| 733 | Ga0501043_0227239 | 3300049579 | Bacteria | 1442 |
| 734 | Ga0501043_0286552 | 3300049579 | Bacteria | 1261 |
| 735 | Ga0501046_0000459 | 3300049580 | Bacteria | 40774 |
| 736 | Ga0501046_0034928 | 3300049580 | Bacteria | 4054 |
| 737 | Ga0501046_0136258 | 3300049580 | Bacteria | 1859 |
| 738 | Ga0501047_0303816 | 3300049581 | Bacteria | 1437 |
| 739 | Ga0501048_0003163 | 3300049582 | Bacteria | 12547 |
| 740 | Ga0501048_0017429 | 3300049582 | Bacteria | 5289 |
| 741 | Ga0501048_0033028 | 3300049582 | Bacteria | 3739 |
| 742 | Ga0501048_0208775 | 3300049582 | Bacteria | 1385 |
| 743 | Ga0501071_0000198 | 3300049587 | Bacteria | 27162 |
| 744 | Ga0501072_0000254 | 3300049588 | Bacteria | 39115 |
| 745 | Ga0501072_0032518 | 3300049588 | Bacteria | 4086 |
| 746 | Ga0501073_0147163 | 3300049589 | Bacteria | 1632 |
| 747 | Ga0501073_0255039 | 3300049589 | Bacteria | 1211 |
| 748 | Ga0501074_0008969 | 3300049590 | Bacteria | 7255 |
| 749 | Ga0501074_0025274 | 3300049590 | Bacteria | 4314 |
| 750 | Ga0501075_0004753 | 3300049591 | Bacteria | 9232 |
| 751 | Ga0501075_0284227 | 3300049591 | Bacteria | 1260 |
| 752 | Ga0501076_0019742 | 3300049592 | Bacteria | 5154 |
| 753 | Ga0501076_0190247 | 3300049592 | Bacteria | 1674 |
| 754 | Ga0501077_0003426 | 3300049593 | Bacteria | 9538 |
| 755 | Ga0501077_0044340 | 3300049593 | Bacteria | 2825 |
| 756 | Ga0501079_0009043 | 3300049741 | Bacteria | 7546 |
| 757 | Ga0501079_0034750 | 3300049741 | Bacteria | 3879 |
| 758 | Ga0501080_0074646 | 3300049742 | Bacteria | 3154 |
| 759 | Ga0501080_0355440 | 3300049742 | Bacteria | 1322 |
| 760 | Ga0501081_0003492 | 3300049743 | Bacteria | 10050 |
| 761 | Ga0501081_0043264 | 3300049743 | Plasmid | 3088 |
| 762 | Ga0501081_0282396 | 3300049743 | Bacteria | 1215 |
| 763 | Ga0501083_0145160 | 3300049744 | Bacteria | 1553 |
| 764 | Ga0501035_0070492 | 3300049822 | Plasmid | 3096 |
| 765 | Ga0501035_0217087 | 3300049822 | Bacteria | 1634 |
| 766 | Ga0501035_0260954 | 3300049822 | Bacteria | 1468 |
| 767 | Ga0501035_0325961 | 3300049822 | Bacteria | 1289 |
| 768 | Ga0501044_0159340 | 3300049823 | Unclassified | 2235 |
| 769 | Ga0501044_0274831 | 3300049823 | Bacteria | 1619 |
| 770 | Ga0501045_0003217 | 3300049824 | Bacteria | 11170 |
| 771 | Ga0501045_0005365 | 3300049824 | Bacteria | 8882 |
| 772 | Ga0501045_0180115 | 3300049824 | Bacteria | 1574 |
| 773 | nmdc:mga05p37_248507_c1 | 3300050507 | Unclassified | 2135 |
| 774 | nmdc:mga05p37_345983_c1 | 3300050507 | Bacteria | 1752 |
| 775 | nmdc:mga05p37_571427_c1 | 3300050507 | Bacteria | 1282 |
| 776 | nmdc:mga05p37_58855_c1 | 3300050507 | Bacteria | 4732 |
| 777 | nmdc:mga09592_216443_c1 | 3300050508 | Bacteria | 1660 |
| 778 | nmdc:mga06r32_309980_c1 | 3300050510 | Bacteria | 1564 |
| 779 | nmdc:mga06r32_445180_c1 | 3300050510 | Bacteria | 1275 |
| 780 | nmdc:mga08y16_184684_c1 | 3300050511 | Bacteria | 2164 |
| 781 | nmdc:mga08y16_370728_c1 | 3300050511 | Bacteria | 1469 |
| 782 | nmdc:mga08y16_477038_c1 | 3300050511 | Unclassified | 1270 |
| 783 | nmdc:mga0n895_252019_c1 | 3300050512 | Bacteria | 1792 |
| 784 | nmdc:mga0n895_255122_c1 | 3300050512 | Bacteria | 1780 |
| 785 | nmdc:mga0rr50_214623_c1 | 3300050513 | Bacteria | 1587 |
| 786 | nmdc:mga0a205_366652_c1 | 3300050515 | Unclassified | 1307 |
| 787 | Ga0495601_0100650 | 3300053077 | Bacteria | 1866 |
| 788 | Ga0495601_0210707 | 3300053077 | Unclassified | 1269 |
| 789 | Ga0495612_0049312 | 3300053078 | Unclassified | 1727 |
| 790 | Ga0495612_0101993 | 3300053078 | Unclassified | 1222 |
| 791 | Ga0495595_0105733 | 3300053084 | Unclassified | 1361 |
| 792 | Ga0495619_0027928 | 3300053085 | Bacteria | 3639 |
| 793 | Ga0495619_0227993 | 3300053085 | Bacteria | 1290 |
| 794 | Ga0501084_0074445 | 3300054114 | Plasmid | 2843 |
| 795 | Ga0590075_018490 | 3300059424 | Bacteria | 1724 |
| 796 | Ga0590075_041879 | 3300059424 | Unclassified | 1170 |
| 797 | Ga0590077_002493 | 3300059426 | Bacteria | 3916 |
| 798 | Ga0590077_024523 | 3300059426 | Unclassified | 1295 |
| 799 | Ga0501082_0034259 | 3300060353 | Plasmid | 4379 |
| 800 | Ga0501082_0035297 | 3300060353 | Bacteria | 4310 |
| 801 | Ga0530510_0009198 | 3300061734 | Bacteria | 6924 |
| 802 | Ga0530510_0108866 | 3300061734 | Bacteria | 2028 |
| 803 | Ga0530510_0251012 | 3300061734 | Bacteria | 1318 |
| 804 | 2510249592 | 2510065045 | Bacteria | 7761063 |
| 805 | 2512352681 | 2512047030 | Bacteria | 9031815 |
| 806 | 2513554002 | 2513237082 | Bacteria | 8640282 |
| 807 | 2719642001 | 2718217991 | Bacteria | 7829542 |
| 808 | 2816506943 | 2816332139 | Bacteria | 9138787 |
| 809 | Ga0081538_10006731 | |||
| 810 | JGI24743J22301_10024355 | |||
| 811 | JGI24744J21845_10025247 | |||
| 812 | JGI25406J46586_10063316 | |||
| 813 | JGI25407J50210_10014966 | |||
| 814 | JGI25407J50210_10016330 | |||
| 815 | JGI25407J50210_10017115 | |||
| 816 | JGI25407J50210_10031802 | |||
| 817 | JGI25407J50210_10036213 | |||
| 818 | JGI25407J50210_10042351 | |||
| 819 | JGI25407J50210_10044754 | |||
| 820 | Ga0070658_10188981 | |||
| 821 | Ga0070658_10312746 | |||
| 822 | Ga0070658_10358984 | |||
| 823 | Ga0070676_10147959 | |||
| 824 | Ga0070676_10253284 | |||
| 825 | Ga0070683_100357067 | |||
| 826 | Ga0070683_100444040 | |||
| 827 | Ga0070690_100193090 | |||
| 828 | Ga0070670_100414225 | |||
| 829 | Ga0070670_100423150 | |||
| 830 | Ga0068869_100166654 | |||
| 831 | Ga0068869_100337913 | |||
| 832 | Ga0068869_100350900 | |||
| 833 | Ga0070680_100311561 | |||
| 834 | Ga0070682_100035889 | |||
| 835 | Ga0070682_100109797 | |||
| 836 | Ga0070682_100129915 | |||
| 837 | Ga0068868_100240303 | |||
| 838 | Ga0068868_100251801 | |||
| 839 | Ga0068868_100293498 | |||
| 840 | Ga0068868_100381093 | |||
| 841 | Ga0068868_100397527 | |||
| 842 | Ga0070689_100161036 | |||
| 843 | Ga0070689_100330093 | |||
| 844 | Ga0070691_10095487 | |||
| 845 | Ga0070687_100065498 | |||
| 846 | Ga0070687_100166036 | |||
| 847 | Ga0070692_10136161 | |||
| 848 | Ga0070692_10160325 | |||
| 849 | Ga0070668_100106135 | |||
| 850 | Ga0070668_100366420 | |||
| 851 | Ga0070675_100371817 | |||
| 852 | Ga0070674_100093913 | |||
| 853 | Ga0070674_100273440 | |||
| 854 | Ga0070674_100325324 | |||
| 855 | Ga0070674_100365469 | |||
| 856 | Ga0070688_100216180 | |||
| 857 | Ga0070688_100255313 | |||
| 858 | Ga0070659_100226350 | |||
| 859 | Ga0070659_100304797 | |||
| 860 | Ga0070667_100324530 | |||
| 861 | Ga0070709_10220823 | |||
| 862 | Ga0070714_100044810 | |||
| 863 | Ga0070714_100403168 | |||
| 864 | Ga0070710_10090191 | |||
| 865 | Ga0070701_10139034 | |||
| 866 | Ga0070700_100172267 | |||
| 867 | Ga0070700_100191126 | |||
| 868 | Ga0070694_100254945 | |||
| 869 | Ga0070663_100274370 | |||
| 870 | Ga0070663_100279294 | |||
| 871 | Ga0070678_100104068 | |||
| 872 | Ga0070662_100115270 | |||
| 873 | Ga0070662_100202762 | |||
| 874 | Ga0068867_100263583 | |||
| 875 | Ga0070685_10099921 | |||
| 876 | Ga0070685_10202502 | |||
| 877 | Ga0070685_10206579 | |||
| 878 | Ga0070685_10231055 | |||
| 879 | Ga0070707_100173281 | |||
| 880 | Ga0070684_100126248 | |||
| 881 | Ga0070684_100232143 | |||
| 882 | Ga0070684_100381719 | |||
| 883 | Ga0070697_100264975 | |||
| 884 | Ga0068853_100436691 | |||
| 885 | Ga0070672_100375778 | |||
| 886 | Ga0070686_100110762 | |||
| 887 | Ga0070695_100154434 | |||
| 888 | Ga0070693_100088241 | |||
| 889 | Ga0070665_100131746 | |||
| 890 | Ga0070665_100258231 | |||
| 891 | Ga0070665_100407094 | |||
| 892 | Ga0070665_100417922 | |||
| 893 | Ga0070665_100593614 | |||
| 894 | Ga0068855_100626341 | |||
| 895 | Ga0070664_100257739 | |||
| 896 | Ga0070664_100472839 | |||
| 897 | Ga0068854_100345409 | |||
| 898 | Ga0068856_100327425 | |||
| 899 | Ga0068856_100359714 | |||
| 900 | Ga0068856_100368711 | |||
| 901 | Ga0070702_100144885 | |||
| 902 | Ga0070702_100179388 | |||
| 903 | Ga0068852_100493363 | |||
| 904 | Ga0068859_100325255 | |||
| 905 | Ga0068859_100414457 | |||
| 906 | Ga0068864_100467543 | |||
| 907 | Ga0068866_10074941 | |||
| 908 | Ga0068866_10124628 | |||
| 909 | Ga0068866_10136461 | |||
| 910 | Ga0068870_10068003 | |||
| 911 | Ga0068870_10202743 | |||
| 912 | Ga0068870_10226496 | |||
| 913 | Ga0068863_100292648 | |||
| 914 | Ga0068863_100403662 | |||
| 915 | Ga0068863_100499598 | |||
| 916 | Ga0068858_100237215 | |||
| 917 | Ga0068858_100466115 | |||
| 918 | Ga0068860_100170366 | |||
| 919 | Ga0068860_100509188 | |||
| 920 | Ga0068862_100272791 | |||
| 921 | Ga0081455_10018251 | |||
| 922 | Ga0081455_10023926 | |||
| 923 | Ga0081455_10128155 | |||
| 924 | Ga0081538_10000569 | |||
| 925 | Ga0081538_10001524 | |||
| 926 | Ga0081538_10004505 | |||
| 927 | Ga0081538_10004937 | |||
| 928 | Ga0081538_10010035 | |||
| 929 | Ga0081538_10010597 | |||
| 930 | Ga0081538_10013630 | |||
| 931 | Ga0081538_10014531 | |||
| 932 | Ga0081538_10016061 | |||
| 933 | Ga0081538_10016244 | |||
| 934 | Ga0081538_10016712 | |||
| 935 | Ga0081538_10021247 | |||
| 936 | Ga0081538_10024054 | |||
| 937 | Ga0081538_10028754 | |||
| 938 | Ga0081538_10029288 | |||
| 939 | Ga0081538_10030632 | |||
| 940 | Ga0081538_10040205 | |||
| 941 | Ga0081538_10052670 | |||
| 942 | Ga0081538_10095181 | |||
| 943 | Ga0081538_10117597 | |||
| 944 | Ga0081539_10038028 | |||
| 945 | Ga0081539_10114737 | |||
| 946 | Ga0070717_10259353 | |||
| 947 | Ga0070717_10273041 | |||
| 948 | Ga0075432_10058776 | |||
| 949 | Ga0070715_10091189 | |||
| 950 | Ga0070716_100011811 | |||
| 951 | Ga0070716_100078251 | |||
| 952 | Ga0070716_100157840 | |||
| 953 | Ga0070712_100147574 | |||
| 954 | Ga0070712_100314533 | |||
| 955 | Ga0070712_100367865 | |||
| 956 | Ga0097621_100329658 | |||
| 957 | Ga0068871_100202084 | |||
| 958 | Ga0068871_100318077 | |||
| 959 | Ga0075428_100007616 | |||
| 960 | Ga0075428_100392897 | |||
| 961 | Ga0075431_100466048 | |||
| 962 | Ga0075433_10195889 | |||
| 963 | Ga0068865_100108105 | |||
| 964 | Ga0068865_100334102 | |||
| 965 | Ga0075436_100155119 | |||
| 966 | Ga0075436_100238436 | |||
| 967 | Ga0097620_100325244 | |||
| 968 | Ga0097620_100414483 | |||
| 969 | Ga0075435_100364179 | |||
| 970 | Ga0111539_10171874 | |||
| 971 | Ga0111539_10245128 | |||
| 972 | Ga0111539_10316957 | |||
| 973 | Ga0111539_10319906 | |||
| 974 | Ga0105245_10105930 | |||
| 975 | Ga0105245_10344482 | |||
| 976 | Ga0105245_10458581 | |||
| 977 | Ga0105247_10178980 | |||
| 978 | Ga0105247_10204599 | |||
| 979 | Ga0114129_10037726 | |||
| 980 | Ga0114129_10349034 | |||
| 981 | Ga0105243_10356203 | |||
| 982 | Ga0105241_10173703 | |||
| 983 | Ga0105241_10202242 | |||
| 984 | Ga0105242_10207991 | |||
| 985 | Ga0105248_10081825 | |||
| 986 | Ga0105237_10290288 | |||
| 987 | Ga0105237_10326021 | |||
| 988 | Ga0105238_10091497 | |||
| 989 | Ga0105238_10133354 | |||
| 990 | Ga0105238_10341499 | |||
| 991 | Ga0105249_10278198 | |||
| 992 | Ga0105239_10218030 | |||
| 993 | Ga0105239_10435779 | |||
| 994 | Ga0105246_10058465 | |||
| 995 | Ga0105246_10205533 | |||
| 996 | Ga0105246_10232875 | |||
| 997 | Ga0157373_10230582 | |||
| 998 | Ga0157371_10225178 | |||
| 999 | Ga0157369_10273555 | |||
| 1000 | Ga0157369_10283346 | |||
| 1001 | Ga0157369_10530281 | |||
| 1002 | Ga0157374_10391314 | |||
| 1003 | Ga0157374_10441973 | |||
| 1004 | Ga0157378_10409060 | |||
| 1005 | Ga0157378_10463625 | |||
| 1006 | Ga0163162_10463634 | |||
| 1007 | Ga0163162_10658930 | |||
| 1008 | Ga0157372_10191328 | |||
| 1009 | Ga0157372_10532673 | |||
| 1010 | Ga0157375_10246630 | |||
| 1011 | Ga0157375_10309471 | |||
| 1012 | Ga0157375_10328362 | |||
| 1013 | Ga0157375_10402911 | |||
| 1014 | Ga0157375_10609997 | |||
| 1015 | Ga0163163_10353327 | |||
| 1016 | Ga0163163_10432540 | |||
| 1017 | Ga0163163_10449165 | |||
| 1018 | Ga0163163_10502245 | |||
| 1019 | Ga0157380_10290774 | |||
| 1020 | Ga0157380_10421910 | |||
| 1021 | Ga0182008_10103160 | |||
| 1022 | Ga0157377_10128261 | |||
| 1023 | Ga0157377_10138699 | |||
| 1024 | Ga0157379_10347794 | |||
| 1025 | Ga0157379_10398931 | |||
| 1026 | Ga0157379_10497389 | |||
| 1027 | Ga0157376_10241828 | |||
| 1028 | Ga0163161_10201478 | |||
| 1029 | Ga0163161_10280732 | |||
| 1030 | Ga0207642_10048559 | |||
| 1031 | Ga0207642_10165717 | |||
| 1032 | Ga0207710_10136643 | |||
| 1033 | Ga0207710_10157336 | |||
| 1034 | Ga0207688_10028151 | |||
| 1035 | Ga0207688_10097851 | |||
| 1036 | Ga0207688_10146059 | |||
| 1037 | Ga0207680_10078730 | |||
| 1038 | Ga0207680_10238477 | |||
| 1039 | Ga0207647_10169064 | |||
| 1040 | Ga0207699_10177129 | |||
| 1041 | Ga0207699_10297967 | |||
| 1042 | Ga0207645_10054283 | |||
| 1043 | Ga0207645_10094562 | |||
| 1044 | Ga0207643_10014076 | |||
| 1045 | Ga0207643_10085684 | |||
| 1046 | Ga0207705_10264895 | |||
| 1047 | Ga0207707_10306131 | |||
| 1048 | Ga0207671_10356624 | |||
| 1049 | Ga0207693_10135254 | |||
| 1050 | Ga0207693_10145322 | |||
| 1051 | Ga0207693_10195344 | |||
| 1052 | Ga0207693_10225709 | |||
| 1053 | Ga0207663_10171267 | |||
| 1054 | Ga0207663_10347319 | |||
| 1055 | Ga0207662_10017528 | |||
| 1056 | Ga0207662_10048441 | |||
| 1057 | Ga0207657_10247957 | |||
| 1058 | Ga0207657_10296159 | |||
| 1059 | Ga0207646_10296704 | |||
| 1060 | Ga0207694_10422050 | |||
| 1061 | Ga0207650_10388599 | |||
| 1062 | Ga0207687_10064018 | |||
| 1063 | Ga0207687_10250724 | |||
| 1064 | Ga0207687_10321498 | |||
| 1065 | Ga0207687_10414360 | |||
| 1066 | Ga0207700_10207294 | |||
| 1067 | Ga0207700_10257043 | |||
| 1068 | Ga0207700_10475881 | |||
| 1069 | Ga0207664_10453984 | |||
| 1070 | Ga0207664_10464214 | |||
| 1071 | Ga0207690_10319380 | |||
| 1072 | Ga0207706_10272832 | |||
| 1073 | Ga0207706_10356998 | |||
| 1074 | Ga0207686_10328444 | |||
| 1075 | Ga0207709_10320039 | |||
| 1076 | Ga0207670_10044711 | |||
| 1077 | Ga0207670_10232665 | |||
| 1078 | Ga0207669_10307536 | |||
| 1079 | Ga0207665_10161518 | |||
| 1080 | Ga0207665_10209925 | |||
| 1081 | Ga0207691_10375830 | |||
| 1082 | Ga0207711_10506131 | |||
| 1083 | Ga0207689_10099113 | |||
| 1084 | Ga0207689_10237066 | |||
| 1085 | Ga0207661_10224290 | |||
| 1086 | Ga0207661_10251075 | |||
| 1087 | Ga0207661_10440676 | |||
| 1088 | Ga0207679_10341575 | |||
| 1089 | Ga0207667_10473187 | |||
| 1090 | Ga0207667_10505526 | |||
| 1091 | Ga0207651_10184814 | |||
| 1092 | Ga0207712_10194388 | |||
| 1093 | Ga0207712_10328850 | |||
| 1094 | Ga0207668_10333109 | |||
| 1095 | Ga0207668_10337158 | |||
| 1096 | Ga0207640_10233316 | |||
| 1097 | Ga0207640_10372678 | |||
| 1098 | Ga0207640_10374125 | |||
| 1099 | Ga0207658_10085869 | |||
| 1100 | Ga0207677_10415637 | |||
| 1101 | Ga0207677_10416474 | |||
| 1102 | Ga0207703_10403254 | |||
| 1103 | Ga0207703_10506174 | |||
| 1104 | Ga0207678_10053930 | |||
| 1105 | Ga0207678_10148050 | |||
| 1106 | Ga0207678_10324312 | |||
| 1107 | Ga0207708_10042308 | |||
| 1108 | Ga0207708_10118333 | |||
| 1109 | Ga0207702_10246549 | |||
| 1110 | Ga0207702_10343884 | |||
| 1111 | Ga0207702_10447030 | |||
| 1112 | Ga0207641_10539451 | |||
| 1113 | Ga0207648_10292961 | |||
| 1114 | Ga0207676_10386933 | |||
| 1115 | Ga0207676_10391166 | |||
| 1116 | Ga0207674_10348306 | |||
| 1117 | Ga0207675_100081387 | |||
| 1118 | Ga0207675_100333076 | |||
| 1119 | Ga0207683_10176398 | |||
| 1120 | Ga0207698_10527640 | |||
| 1121 | Ga0207698_10537524 | |||
| 1122 | Ga0209998_10038763 | |||
| 1123 | Ga0207428_10151001 | |||
| 1124 | Ga0207428_10164131 | |||
| 1125 | Ga0207428_10322026 | |||
| 1126 | Ga0207428_10343175 | |||
| 1127 | Ga0268266_10357992 | |||
| 1128 | Ga0268266_10515761 | |||
| 1129 | Ga0268264_10478588 | |||
| 1130 | Ga0268264_10528350 | |||
| 1131 | Ga0265322_10053883 | |||
| 1132 | Ga0307408_100150535 | |||
| 1133 | Ga0307408_100170884 | |||
| 1134 | Ga0307408_100233935 | |||
| 1135 | Ga0307408_100366300 | |||
| 1136 | Ga0307408_100409444 | |||
| 1137 | Ga0307508_10044271 | |||
| 1138 | Ga0265342_10119720 | |||
| 1139 | Ga0316576_10229327 | |||
| 1140 | Ga0307405_10057442 | |||
| 1141 | Ga0307405_10058761 | |||
| 1142 | Ga0307405_10114734 | |||
| 1143 | Ga0307405_10125102 | |||
| 1144 | Ga0307405_10144194 | |||
| 1145 | Ga0307405_10163004 | |||
| 1146 | Ga0307405_10191083 | |||
| 1147 | Ga0307405_10207229 | |||
| 1148 | Ga0307405_10280745 | |||
| 1149 | Ga0307405_10306233 | |||
| 1150 | Ga0307405_10373515 | |||
| 1151 | Ga0307413_10053358 | |||
| 1152 | Ga0307413_10125061 | |||
| 1153 | Ga0307413_10205316 | |||
| 1154 | Ga0307413_10245232 | |||
| 1155 | Ga0307413_10301335 | |||
| 1156 | Ga0307413_10369050 | |||
| 1157 | Ga0307410_10043212 | |||
| 1158 | Ga0307410_10139908 | |||
| 1159 | Ga0307410_10195544 | |||
| 1160 | Ga0307410_10222588 | |||
| 1161 | Ga0307410_10272919 | |||
| 1162 | Ga0307410_10280918 | |||
| 1163 | Ga0307406_10049631 | |||
| 1164 | Ga0307406_10279034 | |||
| 1165 | Ga0307406_10287737 | |||
| 1166 | Ga0307406_10294110 | |||
| 1167 | Ga0307406_10320698 | |||
| 1168 | Ga0307406_10353193 | |||
| 1169 | Ga0307406_10366217 | |||
| 1170 | Ga0307406_10386145 | |||
| 1171 | Ga0307407_10157344 | |||
| 1172 | Ga0307407_10170848 | |||
| 1173 | Ga0307407_10201406 | |||
| 1174 | Ga0307407_10243295 | |||
| 1175 | Ga0307407_10249410 | |||
| 1176 | Ga0307407_10259046 | |||
| 1177 | Ga0307407_10259997 | |||
| 1178 | Ga0307407_10279054 | |||
| 1179 | Ga0307412_10155325 | |||
| 1180 | Ga0307412_10161564 | |||
| 1181 | Ga0307412_10283131 | |||
| 1182 | Ga0307412_10361768 | |||
| 1183 | Ga0307412_10373267 | |||
| 1184 | Ga0307409_100008677 | |||
| 1185 | Ga0307409_100213431 | |||
| 1186 | Ga0307409_100304812 | |||
| 1187 | Ga0307409_100382452 | |||
| 1188 | Ga0307409_100425859 | |||
| 1189 | Ga0307409_100485730 | |||
| 1190 | Ga0307409_100500626 | |||
| 1191 | Ga0307409_100517988 | |||
| 1192 | Ga0307409_100547242 | |||
| 1193 | Ga0307409_100556772 | |||
| 1194 | Ga0307416_100005616 | |||
| 1195 | Ga0307416_100147451 | |||
| 1196 | Ga0307416_100246125 | |||
| 1197 | Ga0307416_100252841 | |||
| 1198 | Ga0307416_100419711 | |||
| 1199 | Ga0307416_100426455 | |||
| 1200 | Ga0307416_100487003 | |||
| 1201 | Ga0307416_100489688 | |||
| 1202 | Ga0307416_100513887 | |||
| 1203 | Ga0307416_100525225 | |||
| 1204 | Ga0307416_100525226 | |||
| 1205 | Ga0307416_100540926 | |||
| 1206 | Ga0307416_100573609 | |||
| 1207 | Ga0307416_100625979 | |||
| 1208 | Ga0307416_100642094 | |||
| 1209 | Ga0307414_10145559 | |||
| 1210 | Ga0307414_10149948 | |||
| 1211 | Ga0307414_10181601 | |||
| 1212 | Ga0307414_10265093 | |||
| 1213 | Ga0307414_10324787 | |||
| 1214 | Ga0307414_10405226 | |||
| 1215 | Ga0307414_10421418 | |||
| 1216 | Ga0307414_10427355 | |||
| 1217 | Ga0307411_10031311 | |||
| 1218 | Ga0307411_10205220 | |||
| 1219 | Ga0307411_10221458 | |||
| 1220 | Ga0307411_10253332 | |||
| 1221 | Ga0307411_10265230 | |||
| 1222 | Ga0307411_10317662 | |||
| 1223 | Ga0307411_10377804 | |||
| 1224 | Ga0307411_10386625 | |||
| 1225 | Ga0307415_100044723 | |||
| 1226 | Ga0307415_100121300 | |||
| 1227 | Ga0307415_100127770 | |||
| 1228 | Ga0307415_100239231 | |||
| 1229 | Ga0307415_100275253 | |||
| 1230 | Ga0307415_100296410 | |||
| 1231 | Ga0307415_100314312 | |||
| 1232 | Ga0307415_100347847 | |||
| 1233 | Ga0307415_100355121 | |||
| 1234 | Ga0307415_100376005 | |||
| 1235 | Ga0307415_100380324 | |||
| 1236 | Ga0307415_100398970 | |||
| 1237 | Ga0307415_100421542 | |||
| 1238 | Ga0307415_100426741 | |||
| 1239 | Ga0316212_1006543 | |||
| 1240 | Ga0373934_0063146 | |||
| 1241 | Ga0373923_0009983 | |||
| 1242 | Ga0373936_0022649 | |||
| 1243 | Ga0373954_0010635 | |||
| 1244 | Ga0373956_0070671 | |||
| 1245 | Ga0373956_0135560 | |||
| 1246 | Ga0373957_0009209 | |||
| 1247 | Ga0373957_0009214 | |||
| 1248 | Ga0373957_0058989 | |||
| 1249 | Ga0373955_0003181 | |||
| 1250 | Ga0373955_0031479 | |||
| 1251 | Ga0373955_0056730 | |||
| 1252 | Ga0316574_0024580 | |||
| 1253 | Ga0316574_0229833 | |||
| 1254 | Ga0373935_0029239 | |||
| 1255 | Ga0373935_0058167 | |||
| 1256 | Ga0373935_0197863 | |||
| 1257 | Ga0373933_0009123 | |||
| 1258 | Ga0373933_0023097 | |||
| 1259 | Ga0373933_0080270 | |||
| 1260 | Ga0373933_0190885 | |||
| 1261 | Ga0373933_0217017 | |||
| 1262 | Ga0373937_0262256 | |||
| 1263 | Ga0373937_0301124 | |||
| 1264 | Ga0373937_0352114 | |||
| 1265 | Ga0373937_0374760 | |||
| 1266 | Ga0373937_0423565 | |||
| 1267 | Ga0373937_0498114 | |||
| 1268 | Ga0373925_0403240 | |||
| 1269 | Ga0395899_0071168 | |||
| 1270 | Ga0395899_0186340 | |||
| 1271 | Ga0395899_0230079 | |||
| 1272 | Ga0395899_0258389 | |||
| 1273 | Ga0395899_0275442 | |||
| 1274 | Ga0395900_0105094 | |||
| 1275 | Ga0395900_0125036 | |||
| 1276 | Ga0395900_0255804 | |||
| 1277 | Ga0395900_0313424 | |||
| 1278 | Ga0395900_0363391 | |||
| 1279 | Ga0395900_0436768 | |||
| 1280 | Ga0395900_0441147 | |||
| 1281 | Ga0395900_0494947 | |||
| 1282 | Ga0395900_0501224 | |||
| 1283 | Ga0395898_0047758 | |||
| 1284 | Ga0395898_0077521 | |||
| 1285 | Ga0395898_0088555 | |||
| 1286 | Ga0395898_0089490 | |||
| 1287 | Ga0395898_0137811 | |||
| 1288 | Ga0395898_0201439 | |||
| 1289 | Ga0395898_0227841 | |||
| 1290 | Ga0395898_0247359 | |||
| 1291 | Ga0395898_0340448 | |||
| 1292 | Ga0395898_0406597 | |||
| 1293 | Ga0395898_0499912 | |||
| 1294 | Ga0395898_0511799 | |||
| 1295 | Ga0395898_0552634 | |||
| 1296 | Ga0395905_0071909 | |||
| 1297 | Ga0395905_0172829 | |||
| 1298 | Ga0395905_0351741 | |||
| 1299 | Ga0395905_0359621 | |||
| 1300 | Ga0395905_0377855 | |||
| 1301 | Ga0395905_0484457 | |||
| 1302 | Ga0395901_0002454 | |||
| 1303 | Ga0395901_0029491 | |||
| 1304 | Ga0395901_0036918 | |||
| 1305 | Ga0395901_0045774 | |||
| 1306 | Ga0395901_0084271 | |||
| 1307 | Ga0395901_0105309 | |||
| 1308 | Ga0395901_0187170 | |||
| 1309 | Ga0395901_0348543 | |||
| 1310 | Ga0395901_0464037 | |||
| 1311 | Ga0395901_0472159 | |||
| 1312 | Ga0395901_0497632 | |||
| 1313 | Ga0395901_0514694 | |||
| 1314 | Ga0395901_0546512 | |||
| 1315 | Ga0395901_0568178 | |||
| 1316 | Ga0395901_0576349 | |||
| 1317 | Ga0436363_1145716 | |||
| 1318 | Ga0436362_1287969 | |||
| 1319 | Ga0451789_0140450 | |||
| 1320 | Ga0451793_1668073 | |||
| 1321 | Ga0451795_0352230 | |||
| 1322 | Ga0451798_0850043 | |||
| 1323 | Ga0451800_0911729 | |||
| 1324 | Ga0451802_0500978 | |||
| 1325 | Ga0451804_0235963 | |||
| 1326 | Ga0451807_0360181 | |||
| 1327 | Ga0451833_0997737 | |||
| 1328 | Ga0451849_1141966 | |||
| 1329 | Ga0451851_1085776 | |||
| 1330 | Ga0451855_0041179 | |||
| 1331 | Ga0451853_0075624 | |||
| 1332 | Ga0439448_0035766 | |||
| 1333 | Ga0439448_0037015 | |||
| 1334 | Ga0439448_0049495 | |||
| 1335 | Ga0439448_0051994 | |||
| 1336 | Ga0439448_0064454 | |||
| 1337 | Ga0439448_0069192 | |||
| 1338 | Ga0439448_0075803 | |||
| 1339 | Ga0439449_0085380 | |||
| 1340 | Ga0439450_017449 | |||
| 1341 | Ga0439450_018195 | |||
| 1342 | Ga0439450_027497 | |||
| 1343 | Ga0439450_031727 | |||
| 1344 | Ga0439454_006006 | |||
| 1345 | Ga0439455_0039060 | |||
| 1346 | Ga0439455_0044402 | |||
| 1347 | Ga0439455_0046705 | |||
| 1348 | Ga0439463_009327 | |||
| 1349 | Ga0439463_018478 | |||
| 1350 | Ga0439463_018488 | |||
| 1351 | Ga0439463_024273 | |||
| 1352 | Ga0439463_033451 | |||
| 1353 | Ga0439463_039819 | |||
| 1354 | Ga0450922_004391 | |||
| 1355 | Ga0450890_010928 | |||
| 1356 | Ga0450905_008155 | |||
| 1357 | Ga0450905_011651 | |||
| 1358 | Ga0439458_0025568 | |||
| 1359 | Ga0439458_0038818 | |||
| 1360 | Ga0439458_0041437 | |||
| 1361 | Ga0439459_0007899 | |||
| 1362 | Ga0439459_0008738 | |||
| 1363 | Ga0439459_0023912 | |||
| 1364 | Ga0439459_0025396 | |||
| 1365 | Ga0439464_0018297 | |||
| 1366 | Ga0439464_0033184 | |||
| 1367 | Ga0439464_0046591 | |||
| 1368 | Ga0439464_0047734 | |||
| 1369 | Ga0439464_0057660 | |||
| 1370 | Ga0439460_0014852 | |||
| 1371 | Ga0439460_0015081 | |||
| 1372 | Ga0439460_0029261 | |||
| 1373 | Ga0439460_0039171 | |||
| 1374 | Ga0450916_007108 | |||
| 1375 | Ga0450918_017263 | |||
| 1376 | Ga0439440_0005874 | |||
| 1377 | Ga0439440_0006468 | |||
| 1378 | Ga0439440_0021938 | |||
| 1379 | Ga0439440_0029006 | |||
| 1380 | Ga0439440_0030410 | |||
| 1381 | Ga0439440_0030970 | |||
| 1382 | Ga0466963_0209723 | |||
| 1383 | Ga0453684_0426810 | |||
| 1384 | Ga0495592_0024377 | |||
| 1385 | Ga0495592_0165446 | |||
| 1386 | Ga0495629_0032154 | |||
| 1387 | Ga0495629_0216337 | |||
| 1388 | Ga0495638_0183902 | |||
| 1389 | Ga0495651_0036902 | |||
| 1390 | Ga0495651_0053876 | |||
| 1391 | Ga0495651_0177507 | |||
| 1392 | Ga0495653_0020725 | |||
| 1393 | Ga0495653_0085436 | |||
| 1394 | Ga0495653_0197101 | |||
| 1395 | Ga0495653_0252306 | |||
| 1396 | Ga0495580_0224772 | |||
| 1397 | Ga0495605_0104274 | |||
| 1398 | Ga0495662_0153361 | |||
| 1399 | Ga0495664_0003957 | |||
| 1400 | Ga0495664_0051143 | |||
| 1401 | Ga0495664_0068845 | |||
| 1402 | Ga0495596_0109315 | |||
| 1403 | Ga0495606_0182032 | |||
| 1404 | Ga0495608_0034597 | |||
| 1405 | Ga0495608_0062540 | |||
| 1406 | Ga0495608_0226229 | |||
| 1407 | Ga0495618_0085806 | |||
| 1408 | Ga0495628_0019925 | |||
| 1409 | Ga0495628_0074483 | |||
| 1410 | Ga0495628_0240359 | |||
| 1411 | Ga0495630_0109010 | |||
| 1412 | Ga0495630_0174427 | |||
| 1413 | Ga0495644_0056783 | |||
| 1414 | Ga0495652_0065272 | |||
| 1415 | Ga0495652_0095308 | |||
| 1416 | Ga0495652_0238898 | |||
| 1417 | Ga0495652_0267726 | |||
| 1418 | Ga0495652_0269083 | |||
| 1419 | Ga0495654_0007082 | |||
| 1420 | Ga0495665_0018933 | |||
| 1421 | Ga0495665_0026997 | |||
| 1422 | Ga0495665_0154194 | |||
| 1423 | Ga0495640_0090894 | |||
| 1424 | Ga0495586_0065198 | |||
| 1425 | Ga0495587_0032801 | |||
| 1426 | Ga0495587_0051245 | |||
| 1427 | Ga0495587_0095224 | |||
| 1428 | Ga0495587_0189843 | |||
| 1429 | Ga0495645_0007816 | |||
| 1430 | Ga0495645_0128866 | |||
| 1431 | Ga0495645_0165683 | |||
| 1432 | Ga0495667_0001679 | |||
| 1433 | Ga0495667_0011463 | |||
| 1434 | Ga0495667_0052741 | |||
| 1435 | Ga0495667_0195761 | |||
| 1436 | Ga0495667_0209684 | |||
| 1437 | Ga0495634_0066585 | |||
| 1438 | Ga0495635_0011622 | |||
| 1439 | Ga0495635_0021503 | |||
| 1440 | Ga0495635_0262810 | |||
| 1441 | Ga0495657_0029015 | |||
| 1442 | Ga0495657_0088877 | |||
| 1443 | Ga0495657_0126977 | |||
| 1444 | Ga0495657_0200193 | |||
| 1445 | Ga0495657_0218750 | |||
| 1446 | Ga0495599_0072521 | |||
| 1447 | Ga0495599_0203541 | |||
| 1448 | Ga0495623_0048307 | |||
| 1449 | Ga0495623_0115037 | |||
| 1450 | Ga0495623_0183795 | |||
| 1451 | Ga0495646_0102588 | |||
| 1452 | Ga0495646_0168213 | |||
| 1453 | Ga0495658_0084042 | |||
| 1454 | Ga0495669_0015937 | |||
| 1455 | Ga0495669_0144461 | |||
| 1456 | Ga0495613_0041290 | |||
| 1457 | Ga0495613_0072323 | |||
| 1458 | Ga0495624_0153808 | |||
| 1459 | Ga0495589_0007664 | |||
| 1460 | Ga0495600_0023065 | |||
| 1461 | Ga0495600_0175842 | |||
| 1462 | Ga0495600_0189755 | |||
| 1463 | Ga0495581_0008893 | |||
| 1464 | Ga0495581_0032972 | |||
| 1465 | Ga0495581_0162528 | |||
| 1466 | Ga0495581_0195725 | |||
| 1467 | Ga0495604_0031538 | |||
| 1468 | Ga0495604_0226509 | |||
| 1469 | Ga0495604_0227989 | |||
| 1470 | Ga0495604_0273496 | |||
| 1471 | Ga0495674_0017778 | |||
| 1472 | Ga0495674_0087822 | |||
| 1473 | Ga0495674_0170158 | |||
| 1474 | Ga0495674_0219486 | |||
| 1475 | Ga0495674_0360191 | |||
| 1476 | Ga0495674_0383115 | |||
| 1477 | Ga0495672_0144665 | |||
| 1478 | Ga0495680_0081410 | |||
| 1479 | Ga0495680_0118872 | |||
| 1480 | Ga0495680_0275266 | |||
| 1481 | Ga0495683_0029810 | |||
| 1482 | Ga0495683_0097626 | |||
| 1483 | Ga0495675_0025320 | |||
| 1484 | Ga0495675_0202919 | |||
| 1485 | Ga0495673_0084421 | |||
| 1486 | Ga0495684_0154320 | |||
| 1487 | Ga0495684_0243524 | |||
| 1488 | Ga0495593_0050589 | |||
| 1489 | Ga0495602_0233893 | |||
| 1490 | Ga0495602_0249823 | |||
| 1491 | Ga0495602_0288607 | |||
| 1492 | Ga0495602_0303495 | |||
| 1493 | Ga0495626_0092541 | |||
| 1494 | Ga0496100_0190856 | |||
| 1495 | Ga0496101_0042563 | |||
| 1496 | Ga0496101_0349140 | |||
| 1497 | Ga0496103_0205378 | |||
| 1498 | Ga0496104_0133754 | |||
| 1499 | Ga0496106_0321361 | |||
| 1500 | Ga0496106_0339932 | |||
| 1501 | Ga0496107_0249826 | |||
| 1502 | Ga0496108_0354021 | |||
| 1503 | Ga0496108_0381640 | |||
| 1504 | Ga0496109_0476488 | |||
| 1505 | Ga0496109_0477198 | |||
| 1506 | Ga0496110_0278346 | |||
| 1507 | Ga0496112_0507516 | |||
| 1508 | Ga0496114_0049425 | |||
| 1509 | Ga0496114_0467726 | |||
| 1510 | Ga0496115_0037513 | |||
| 1511 | Ga0501031_0027627 | |||
| 1512 | Ga0501031_0167736 | |||
| 1513 | Ga0501031_0177080 | |||
| 1514 | Ga0501032_0015998 | |||
| 1515 | Ga0501032_0170034 | |||
| 1516 | Ga0501033_0044525 | |||
| 1517 | Ga0501033_0138755 | |||
| 1518 | Ga0501033_0150767 | |||
| 1519 | Ga0501034_0361618 | |||
| 1520 | Ga0501036_0003693 | |||
| 1521 | Ga0501036_0272342 | |||
| 1522 | Ga0501036_0291186 | |||
| 1523 | Ga0501037_0061047 | |||
| 1524 | Ga0501037_0107150 | |||
| 1525 | Ga0501037_0175603 | |||
| 1526 | Ga0501038_0019337 | |||
| 1527 | Ga0501038_0282484 | |||
| 1528 | Ga0501039_0000588 | |||
| 1529 | Ga0501039_0032036 | |||
| 1530 | Ga0501039_0067351 | |||
| 1531 | Ga0501039_0278409 | |||
| 1532 | Ga0501040_0002681 | |||
| 1533 | Ga0501040_0064714 | |||
| 1534 | Ga0501041_0000115 | |||
| 1535 | Ga0501041_0019181 | |||
| 1536 | Ga0501041_0064590 | |||
| 1537 | Ga0501042_0001183 | |||
| 1538 | Ga0501042_0007262 | |||
| 1539 | Ga0501042_0100694 | |||
| 1540 | Ga0501042_0167445 | |||
| 1541 | Ga0501043_0227239 | |||
| 1542 | Ga0501043_0286552 | |||
| 1543 | Ga0501046_0000459 | |||
| 1544 | Ga0501046_0034928 | |||
| 1545 | Ga0501046_0136258 | |||
| 1546 | Ga0501047_0303816 | |||
| 1547 | Ga0501048_0003163 | |||
| 1548 | Ga0501048_0017429 | |||
| 1549 | Ga0501048_0033028 | |||
| 1550 | Ga0501048_0208775 | |||
| 1551 | Ga0501071_0000198 | |||
| 1552 | Ga0501072_0000254 | |||
| 1553 | Ga0501072_0032518 | |||
| 1554 | Ga0501073_0147163 | |||
| 1555 | Ga0501073_0255039 | |||
| 1556 | Ga0501074_0008969 | |||
| 1557 | Ga0501074_0025274 | |||
| 1558 | Ga0501075_0004753 | |||
| 1559 | Ga0501075_0284227 | |||
| 1560 | Ga0501076_0019742 | |||
| 1561 | Ga0501076_0190247 | |||
| 1562 | Ga0501077_0003426 | |||
| 1563 | Ga0501077_0044340 | |||
| 1564 | Ga0501079_0009043 | |||
| 1565 | Ga0501079_0034750 | |||
| 1566 | Ga0501080_0074646 | |||
| 1567 | Ga0501080_0355440 | |||
| 1568 | Ga0501081_0003492 | |||
| 1569 | Ga0501081_0043264 | |||
| 1570 | Ga0501081_0282396 | |||
| 1571 | Ga0501083_0145160 | |||
| 1572 | Ga0501035_0070492 | |||
| 1573 | Ga0501035_0217087 | |||
| 1574 | Ga0501035_0260954 | |||
| 1575 | Ga0501035_0325961 | |||
| 1576 | Ga0501044_0159340 | |||
| 1577 | Ga0501044_0274831 | |||
| 1578 | Ga0501045_0003217 | |||
| 1579 | Ga0501045_0005365 | |||
| 1580 | Ga0501045_0180115 | |||
| 1581 | nmdc:mga05p37_248507_c1 | |||
| 1582 | nmdc:mga05p37_345983_c1 | |||
| 1583 | nmdc:mga05p37_571427_c1 | |||
| 1584 | nmdc:mga05p37_58855_c1 | |||
| 1585 | nmdc:mga09592_216443_c1 | |||
| 1586 | nmdc:mga06r32_309980_c1 | |||
| 1587 | nmdc:mga06r32_445180_c1 | |||
| 1588 | nmdc:mga08y16_184684_c1 | |||
| 1589 | nmdc:mga08y16_370728_c1 | |||
| 1590 | nmdc:mga08y16_477038_c1 | |||
| 1591 | nmdc:mga0n895_252019_c1 | |||
| 1592 | nmdc:mga0n895_255122_c1 | |||
| 1593 | nmdc:mga0rr50_214623_c1 | |||
| 1594 | nmdc:mga0a205_366652_c1 | |||
| 1595 | Ga0495601_0100650 | |||
| 1596 | Ga0495601_0210707 | |||
| 1597 | Ga0495612_0049312 | |||
| 1598 | Ga0495612_0101993 | |||
| 1599 | Ga0495595_0105733 | |||
| 1600 | Ga0495619_0027928 | |||
| 1601 | Ga0495619_0227993 | |||
| 1602 | Ga0501084_0074445 | |||
| 1603 | Ga0590075_018490 | |||
| 1604 | Ga0590075_041879 | |||
| 1605 | Ga0590077_002493 | |||
| 1606 | Ga0590077_024523 | |||
| 1607 | Ga0501082_0034259 | |||
| 1608 | Ga0501082_0035297 | |||
| 1609 | Ga0530510_0009198 | |||
| 1610 | Ga0530510_0108866 | |||
| 1611 | Ga0530510_0251012 | |||
| 1612 | 2510249592 | |||
| 1613 | 2512352681 | |||
| 1614 | 2513554002 | |||
| 1615 | 2719642001 | |||
| 1616 | 2816506943 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mq3-assembly1.cif.gz_A | the 1.1 angstrom structure of catalytic core domain of fiv integrase | 0.7452 | 166 | 319 |
| 3vqp-assembly1.cif.gz_A | hiv-1 in core domain in complex with 2,3-dihydro-1,4-benzodioxin-5-ylmethanol | 0.7445 | 166 | 317 |
| 3s3o-assembly1.cif.gz_B-2 | crystal structure of the prototype foamy virus (pfv) n224h mutant intasome in complex with magnesium and dolutegravir (s/gsk1349572) | 0.7409 | 166 | 299 |
| 1c6v-assembly1.cif.gz_D | siv integrase (catalytic domain + dna biding domain comprising residues 50-293) mutant with phe 185 replaced by his (f185h) | 0.7402 | 166 | 317 |
| 4bac-assembly1.cif.gz_B-2 | prototype foamy virus strand transfer complexes on product dna | 0.7402 | 166 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r0qF02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9047 | 16 | 50 | 1.10.10.60 |
| af_Q21972_79_144_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8323 | 5 | 55 | 1.10.10.10 |
| 1gdtB03 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8023 | 4 | 50 | 1.10.10.60 |
| 3l2qA03 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.7954 | 167 | 321 | 3.30.420.10 |
| 6paxA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7826 | 5 | 63 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0T5Z818-F1-model_v4 | Transposase | 0.9649 | 203 | 339 |
GO:0003676
|
| AF-A0A6H1RB55-F1-model_v4 | Transposase | 0.9601 | 204 | 338 |
GO:0003676
|
| AF-A0A1F4M787-F1-model_v4 | Tc1-like transposase DDE domain-containing protein | 0.96 | 201 | 278 |
GO:0003676
|
| AF-Q5GW53-F1-model_v4 | Transposase | 0.9589 | 207 | 338 |
GO:0003676
|
| AF-T1CL52-F1-model_v4 | ISXoo2 transposase | 0.9548 | 220 | 340 |
GO:0003676
|