F481672
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 807 | 419 | 709 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300005364|Ga0070673_100859380|Ga0070673_1008593802 |
| Length | 135 |
| Sequence | MLKYLLDTNLCIRVLRDRPQGLREKFNAEASSLCISSVVLYELLYRAAKSSRPVENRHAVEAFAAHMEVIDFDADAAAHAGEIRADLERQGTPIGSYNLLIAGHARSRGLIVITGNLGEFRRVDGLRCDDWELPN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 5 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 6 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 7 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 8 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 9 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 10 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 11 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 12 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 13 | 2537561728 | Pectobacterium wasabiae CFBP 3304 | Isolate | Rhizoplane |
| 14 | 2585427591 | Rahnella aquatilis OV744 | Isolate | Rhizosphere |
| 15 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 16 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 17 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 18 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 19 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 20 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 21 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 22 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 23 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 24 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 25 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 26 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 27 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 28 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 29 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 30 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 31 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 32 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 33 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 34 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 35 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 36 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 37 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 38 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 39 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 40 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 41 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 42 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 43 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 44 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 45 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 46 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 47 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 48 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 49 | 2791355010 | Kosakonia pseudosacchari NN143 | Isolate | Unclassified |
| 50 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 51 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 52 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 53 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 54 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 55 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 56 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 57 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 58 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 59 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 60 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 61 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 62 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 63 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 64 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 65 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 66 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 67 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 68 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 69 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 70 | 2858466076 | Pectobacterium polaris SS28 | Isolate | Stem Tuber |
| 71 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 72 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 73 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 74 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 75 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 76 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 77 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 78 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 79 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 80 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 81 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 82 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 83 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 84 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 85 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 86 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 87 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 88 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 89 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 90 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 91 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 92 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 93 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 94 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 95 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 96 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 97 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 98 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 99 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 100 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 101 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 102 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 103 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 104 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 105 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 106 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 107 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 109 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 110 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 111 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 112 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 113 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 114 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 115 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 128 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 130 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 131 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 132 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 133 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 134 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 135 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 136 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 137 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 138 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 139 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 140 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 141 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 142 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 143 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 145 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 146 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 147 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 148 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 149 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 150 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 161 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 176 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 177 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 183 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 221 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 226 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 227 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 228 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 229 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 230 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 231 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 232 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 233 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 236 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 237 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 238 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 241 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 242 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 243 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 244 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 246 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 247 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 248 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 255 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 262 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 263 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 264 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 265 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 266 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 267 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 268 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 269 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 270 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 271 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 272 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 273 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 274 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 275 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 276 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 277 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 278 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 279 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 280 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 281 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 282 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 283 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 284 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 285 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 286 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 287 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 294 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 376 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 382 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 385 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 386 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 389 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 391 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 399 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 402 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 403 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 404 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 405 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 406 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 408 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 409 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 410 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 411 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 412 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 413 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 414 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 415 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 416 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 417 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 418 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 419 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.48 |
| Metatranscriptomes | 0.37 |
| Isolates | 12.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.78 |
| Nodule | 2.85 |
| Rhizoplane | 2.48 |
| Rhizosphere | 71.62 |
| Stem | 0 |
| Stem Tuber | 0.12 |
| Unclassified | 12.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C7519 | 2010549000 | Bacteria | 4197 |
| 2 | MRS2a_Contig_11594 | 2124908027 | Bacteria | 815 |
| 3 | SwRhRL2b_contig_30749 | 2162886007 | Bacteria | 1418 |
| 4 | SwRhRL2b_contig_519226 | 2162886007 | Bacteria | 1658 |
| 5 | JGI25162J39368_1001056 | 3300002737 | Bacteria | 16862 |
| 6 | JGI25158J39367_1002355 | 3300002739 | Bacteria | 3092 |
| 7 | JGI25163J39215_1003290 | 3300002771 | Bacteria | 1344 |
| 8 | JGI25164J39214_1000563 | 3300002772 | Bacteria | 16855 |
| 9 | JGI25159J45721_1000083 | 3300002987 | Bacteria | 44911 |
| 10 | JGI25159J45721_1000466 | 3300002987 | Bacteria | 18688 |
| 11 | JGI25151J46595_10036444 | 3300003187 | Bacteria | 1856 |
| 12 | JGI25165J46597_1001123 | 3300003214 | Bacteria | 16862 |
| 13 | rootH1_10044342 | 3300003316 | Bacteria | 20524 |
| 14 | rootH1_10130566 | 3300003316 | Bacteria | 1494 |
| 15 | rootH2_10081916 | 3300003320 | Bacteria | 2517 |
| 16 | rootH1_10328791 | 3300003323 | Unclassified | 1006 |
| 17 | JGI25160J50197_1000005 | 3300003354 | Bacteria | 417280 |
| 18 | JGI25161J50226_1000349 | 3300003374 | Bacteria | 24501 |
| 19 | Ga0006562J51391_1008015 | 3300003578 | Bacteria | 4010 |
| 20 | Ga0055526_1002592 | 3300003771 | Bacteria | 12087 |
| 21 | Ga0055524_1033754 | 3300003775 | Bacteria | 1427 |
| 22 | Ga0055536_1004642 | 3300003781 | Bacteria | 6949 |
| 23 | Ga0055536_1016156 | 3300003781 | Bacteria | 2510 |
| 24 | Ga0055536_1016300 | 3300003781 | Bacteria | 2491 |
| 25 | Ga0055530_10008853 | 3300003791 | Bacteria | 3962 |
| 26 | Ga0055530_10012947 | 3300003791 | Bacteria | 2878 |
| 27 | Ga0055530_10032239 | 3300003791 | Bacteria | 1365 |
| 28 | Ga0055540_1012563 | 3300003792 | Bacteria | 2648 |
| 29 | Ga0055540_1068700 | 3300003792 | Bacteria | 695 |
| 30 | Ga0055531_10001364 | 3300003794 | Bacteria | 18136 |
| 31 | Ga0055531_10004249 | 3300003794 | Bacteria | 8812 |
| 32 | Ga0055531_10073595 | 3300003794 | Bacteria | 778 |
| 33 | Ga0058692_1015795 | 3300003856 | Bacteria | 1692 |
| 34 | Ga0058692_1018212 | 3300003856 | Bacteria | 1523 |
| 35 | Ga0055543_1000324 | 3300004625 | Bacteria | 33093 |
| 36 | Ga0065165_1000002 | 3300005262 | Bacteria | 444192 |
| 37 | Ga0065165_1000264 | 3300005262 | Bacteria | 90435 |
| 38 | Ga0065714_10009236 | 3300005288 | Bacteria | 3678 |
| 39 | Ga0065714_10020005 | 3300005288 | Bacteria | 1716 |
| 40 | Ga0065714_10112802 | 3300005288 | Bacteria | 1450 |
| 41 | Ga0065714_10233113 | 3300005288 | Bacteria | 812 |
| 42 | Ga0065714_10308760 | 3300005288 | Bacteria | 682 |
| 43 | Ga0065714_10316355 | 3300005288 | Bacteria | 674 |
| 44 | Ga0065704_10085495 | 3300005289 | Bacteria | 3216 |
| 45 | Ga0065704_10098219 | 3300005289 | Bacteria | 2361 |
| 46 | Ga0065704_10148567 | 3300005289 | Bacteria | 1448 |
| 47 | Ga0065704_10357297 | 3300005289 | Bacteria | 791 |
| 48 | Ga0065712_10079004 | 3300005290 | Bacteria | 3270 |
| 49 | Ga0065715_10887876 | 3300005293 | Bacteria | 579 |
| 50 | Ga0070676_11025332 | 3300005328 | Unclassified | 620 |
| 51 | Ga0070660_100047978 | 3300005339 | Unclassified | 3279 |
| 52 | Ga0070660_100734940 | 3300005339 | Bacteria | 828 |
| 53 | Ga0070669_100168990 | 3300005353 | Bacteria | 1704 |
| 54 | Ga0070671_100042696 | 3300005355 | Bacteria | 3769 |
| 55 | Ga0070673_100859380 | 3300005364 | Unclassified | 840 |
| 56 | Ga0070659_100095774 | 3300005366 | Bacteria | 2384 |
| 57 | Ga0070667_100726123 | 3300005367 | Bacteria | 920 |
| 58 | Ga0070709_10929164 | 3300005434 | Bacteria | 689 |
| 59 | Ga0070713_101026596 | 3300005436 | Unclassified | 796 |
| 60 | Ga0070710_11375397 | 3300005437 | Unclassified | 527 |
| 61 | Ga0070662_100203815 | 3300005457 | Bacteria | 1571 |
| 62 | Ga0070665_100293480 | 3300005548 | Bacteria | 1628 |
| 63 | Ga0070665_100473519 | 3300005548 | Bacteria | 1263 |
| 64 | Ga0068855_100788564 | 3300005563 | Bacteria | 1011 |
| 65 | Ga0070664_101156832 | 3300005564 | Bacteria | 729 |
| 66 | Ga0068854_100649812 | 3300005578 | Bacteria | 905 |
| 67 | Ga0068854_101751431 | 3300005578 | Unclassified | 569 |
| 68 | Ga0068856_101674170 | 3300005614 | Bacteria | 649 |
| 69 | Ga0068864_100000218 | 3300005618 | Bacteria | 51909 |
| 70 | Ga0068864_100211383 | 3300005618 | Bacteria | 1786 |
| 71 | Ga0068866_10484335 | 3300005718 | Unclassified | 815 |
| 72 | Ga0068861_100166465 | 3300005719 | Bacteria | 1823 |
| 73 | Ga0068851_10947323 | 3300005834 | Unclassified | 541 |
| 74 | Ga0068858_100000352 | 3300005842 | Bacteria | 48455 |
| 75 | Ga0068858_100001656 | 3300005842 | Bacteria | 22765 |
| 76 | Ga0068862_101091742 | 3300005844 | Unclassified | 793 |
| 77 | Ga0081455_10404061 | 3300005937 | Bacteria | 947 |
| 78 | Ga0075365_10011682 | 3300006038 | Bacteria | 5174 |
| 79 | Ga0075365_10017919 | 3300006038 | Bacteria | 4345 |
| 80 | Ga0075365_10831908 | 3300006038 | Bacteria | 651 |
| 81 | Ga0075364_10010433 | 3300006051 | Bacteria | 5611 |
| 82 | Ga0075364_10104148 | 3300006051 | Bacteria | 1890 |
| 83 | Ga0075364_10110610 | 3300006051 | Bacteria | 1833 |
| 84 | Ga0075432_10055925 | 3300006058 | Bacteria | 1398 |
| 85 | Ga0075432_10096218 | 3300006058 | Bacteria | 1089 |
| 86 | Ga0075432_10113606 | 3300006058 | Bacteria | 1011 |
| 87 | Ga0075432_10278232 | 3300006058 | Bacteria | 688 |
| 88 | Ga0075432_10602777 | 3300006058 | Bacteria | 502 |
| 89 | Ga0075362_10056386 | 3300006177 | Bacteria | 1768 |
| 90 | Ga0075362_10444025 | 3300006177 | Bacteria | 658 |
| 91 | Ga0075369_10004738 | 3300006186 | Bacteria | 5048 |
| 92 | Ga0075369_10143099 | 3300006186 | Bacteria | 1091 |
| 93 | Ga0097621_100903195 | 3300006237 | Unclassified | 823 |
| 94 | Ga0075370_10065222 | 3300006353 | Bacteria | 2077 |
| 95 | Ga0068871_100789896 | 3300006358 | Unclassified | 874 |
| 96 | Ga0075430_100468458 | 3300006846 | Unclassified | 1040 |
| 97 | Ga0075436_100110011 | 3300006914 | Bacteria | 1922 |
| 98 | Ga0075436_100343702 | 3300006914 | Bacteria | 1074 |
| 99 | Ga0079104_1000104 | 3300006946 | Bacteria | 123967 |
| 100 | Ga0079104_1001328 | 3300006946 | Bacteria | 16967 |
| 101 | Ga0079104_1073514 | 3300006946 | Bacteria | 713 |
| 102 | Ga0099826_10004152 | 3300006948 | Bacteria | 10078 |
| 103 | Ga0105251_10000466 | 3300009011 | Bacteria | 38664 |
| 104 | Ga0105251_10034510 | 3300009011 | Bacteria | 2502 |
| 105 | Ga0105251_10157004 | 3300009011 | Bacteria | 1026 |
| 106 | Ga0105251_10372385 | 3300009011 | Bacteria | 654 |
| 107 | Ga0105251_10519238 | 3300009011 | Bacteria | 558 |
| 108 | Ga0105244_10027860 | 3300009036 | Bacteria | 3038 |
| 109 | Ga0105244_10028008 | 3300009036 | Bacteria | 3028 |
| 110 | Ga0105244_10147147 | 3300009036 | Bacteria | 1130 |
| 111 | Ga0105244_10156728 | 3300009036 | Bacteria | 1089 |
| 112 | Ga0105244_10170343 | 3300009036 | Bacteria | 1036 |
| 113 | Ga0105244_10180080 | 3300009036 | Bacteria | 1003 |
| 114 | Ga0105250_10034265 | 3300009092 | Bacteria | 2038 |
| 115 | Ga0105250_10035115 | 3300009092 | Bacteria | 2011 |
| 116 | Ga0105250_10060380 | 3300009092 | Bacteria | 1524 |
| 117 | Ga0105250_10132132 | 3300009092 | Bacteria | 1031 |
| 118 | Ga0105250_10210668 | 3300009092 | Bacteria | 822 |
| 119 | Ga0105250_10227803 | 3300009092 | Bacteria | 792 |
| 120 | Ga0105250_10303352 | 3300009092 | Bacteria | 691 |
| 121 | Ga0105240_10549366 | 3300009093 | Bacteria | 1278 |
| 122 | Ga0105245_10001436 | 3300009098 | Bacteria | 21598 |
| 123 | Ga0105243_10049280 | 3300009148 | Bacteria | 3322 |
| 124 | Ga0105243_10096200 | 3300009148 | Bacteria | 2449 |
| 125 | Ga0105243_10736276 | 3300009148 | Bacteria | 965 |
| 126 | Ga0105242_11572672 | 3300009176 | Bacteria | 690 |
| 127 | Ga0105248_10007725 | 3300009177 | Bacteria | 11809 |
| 128 | Ga0105238_11554376 | 3300009551 | Bacteria | 691 |
| 129 | Ga0105249_10157648 | 3300009553 | Bacteria | 2191 |
| 130 | Ga0157345_1000879 | 3300012498 | Bacteria | 2247 |
| 131 | Ga0157373_10000160 | 3300013100 | Bacteria | 54531 |
| 132 | Ga0157373_10009880 | 3300013100 | Bacteria | 7031 |
| 133 | Ga0157373_10875215 | 3300013100 | Bacteria | 665 |
| 134 | Ga0157373_11159517 | 3300013100 | Bacteria | 581 |
| 135 | Ga0157371_10071919 | 3300013102 | Bacteria | 2449 |
| 136 | Ga0157371_10175867 | 3300013102 | Bacteria | 1530 |
| 137 | Ga0157371_10257754 | 3300013102 | Bacteria | 1257 |
| 138 | Ga0157370_10086690 | 3300013104 | Bacteria | 2941 |
| 139 | Ga0157370_10386681 | 3300013104 | Bacteria | 1288 |
| 140 | Ga0157370_10630297 | 3300013104 | Bacteria | 981 |
| 141 | Ga0157369_10039023 | 3300013105 | Bacteria | 5191 |
| 142 | Ga0157378_10059990 | 3300013297 | Bacteria | 3395 |
| 143 | Ga0163162_10015191 | 3300013306 | Bacteria | 7521 |
| 144 | Ga0163162_10156336 | 3300013306 | Bacteria | 2400 |
| 145 | Ga0163162_10183183 | 3300013306 | Bacteria | 2221 |
| 146 | Ga0163162_10299871 | 3300013306 | Bacteria | 1739 |
| 147 | Ga0163162_10386341 | 3300013306 | Bacteria | 1533 |
| 148 | Ga0157375_10175495 | 3300013308 | Bacteria | 2292 |
| 149 | Ga0157375_11178675 | 3300013308 | Bacteria | 898 |
| 150 | Ga0157375_11300329 | 3300013308 | Bacteria | 855 |
| 151 | Ga0157375_12375899 | 3300013308 | Bacteria | 632 |
| 152 | Ga0182008_10007709 | 3300014497 | Bacteria | 5926 |
| 153 | Ga0182008_10013620 | 3300014497 | Bacteria | 4273 |
| 154 | Ga0182008_10027370 | 3300014497 | Bacteria | 2889 |
| 155 | Ga0182008_10068729 | 3300014497 | Bacteria | 1743 |
| 156 | Ga0182008_10117058 | 3300014497 | Bacteria | 1323 |
| 157 | Ga0182008_10195381 | 3300014497 | Bacteria | 1028 |
| 158 | Ga0157379_10724279 | 3300014968 | Unclassified | 935 |
| 159 | Ga0157376_11382100 | 3300014969 | Unclassified | 735 |
| 160 | Ga0182006_1012939 | 3300015261 | Bacteria | 3639 |
| 161 | Ga0182006_1096870 | 3300015261 | Bacteria | 1053 |
| 162 | Ga0182007_10003173 | 3300015262 | Bacteria | 7866 |
| 163 | Ga0182007_10053020 | 3300015262 | Bacteria | 1336 |
| 164 | Ga0182007_10137833 | 3300015262 | Bacteria | 824 |
| 165 | Ga0182005_1046895 | 3300015265 | Bacteria | 1174 |
| 166 | Ga0182005_1052573 | 3300015265 | Bacteria | 1109 |
| 167 | Ga0182005_1052661 | 3300015265 | Bacteria | 1108 |
| 168 | Ga0182005_1120672 | 3300015265 | Bacteria | 746 |
| 169 | Ga0182005_1193945 | 3300015265 | Bacteria | 608 |
| 170 | Ga0163161_10120991 | 3300017792 | Bacteria | 1967 |
| 171 | Ga0163161_10161158 | 3300017792 | Bacteria | 1710 |
| 172 | Ga0163161_10228308 | 3300017792 | Bacteria | 1444 |
| 173 | Ga0163161_10410367 | 3300017792 | Bacteria | 1088 |
| 174 | Ga0163161_11295858 | 3300017792 | Unclassified | 633 |
| 175 | Ga0213872_10000747 | 3300021361 | Bacteria | 24034 |
| 176 | Ga0213872_10003934 | 3300021361 | Bacteria | 8043 |
| 177 | Ga0213872_10030473 | 3300021361 | Unclassified | 2472 |
| 178 | Ga0213872_10032524 | 3300021361 | Unclassified | 2390 |
| 179 | Ga0213872_10163047 | 3300021361 | Unclassified | 969 |
| 180 | Ga0213872_10317277 | 3300021361 | Unclassified | 644 |
| 181 | Ga0213875_10012055 | 3300021388 | Bacteria | 4281 |
| 182 | Ga0209760_100140 | 3300025207 | Bacteria | 45356 |
| 183 | Ga0209436_100162 | 3300025208 | Bacteria | 32237 |
| 184 | Ga0209147_103422 | 3300025229 | Bacteria | 3098 |
| 185 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 186 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 187 | Ga0209759_1001860 | 3300025256 | Bacteria | 10499 |
| 188 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 189 | Ga0209565_1010830 | 3300025263 | Bacteria | 2248 |
| 190 | Ga0209130_1000010 | 3300025284 | Bacteria | 444920 |
| 191 | Ga0209676_1000308 | 3300025292 | Bacteria | 95847 |
| 192 | Ga0209676_1000320 | 3300025292 | Bacteria | 93515 |
| 193 | Ga0209676_1004904 | 3300025292 | Bacteria | 7212 |
| 194 | Ga0209676_1058390 | 3300025292 | Bacteria | 974 |
| 195 | Ga0209025_1000687 | 3300025294 | Bacteria | 58005 |
| 196 | Ga0209025_1012644 | 3300025294 | Bacteria | 5389 |
| 197 | Ga0209564_1000025 | 3300025295 | Bacteria | 520535 |
| 198 | Ga0209758_1046347 | 3300025297 | Bacteria | 1569 |
| 199 | Ga0209050_1000466 | 3300025298 | Bacteria | 71734 |
| 200 | Ga0209050_1000911 | 3300025298 | Bacteria | 39103 |
| 201 | Ga0209050_1011196 | 3300025298 | Bacteria | 4292 |
| 202 | Ga0209050_1016963 | 3300025298 | Bacteria | 2939 |
| 203 | Ga0209256_1002250 | 3300025299 | Bacteria | 16402 |
| 204 | Ga0209256_1059132 | 3300025299 | Bacteria | 899 |
| 205 | Ga0207426_1000036 | 3300025302 | Bacteria | 444920 |
| 206 | Ga0209051_1001718 | 3300025303 | Bacteria | 17480 |
| 207 | Ga0209051_1023299 | 3300025303 | Bacteria | 2579 |
| 208 | Ga0209257_1000338 | 3300025304 | Bacteria | 97721 |
| 209 | Ga0209257_1005664 | 3300025304 | Bacteria | 8624 |
| 210 | Ga0209257_1006123 | 3300025304 | Bacteria | 7978 |
| 211 | Ga0207656_10675497 | 3300025321 | Unclassified | 528 |
| 212 | Ga0207696_1000065 | 3300025711 | Bacteria | 231818 |
| 213 | Ga0207696_1024123 | 3300025711 | Bacteria | 1910 |
| 214 | Ga0207696_1053180 | 3300025711 | Bacteria | 1153 |
| 215 | Ga0207696_1121838 | 3300025711 | Bacteria | 703 |
| 216 | Ga0207655_1001270 | 3300025728 | Bacteria | 24082 |
| 217 | Ga0207655_1053490 | 3300025728 | Bacteria | 1613 |
| 218 | Ga0207655_1058326 | 3300025728 | Bacteria | 1510 |
| 219 | Ga0207713_1000269 | 3300025735 | Bacteria | 63990 |
| 220 | Ga0207713_1031081 | 3300025735 | Bacteria | 2367 |
| 221 | Ga0207713_1059262 | 3300025735 | Bacteria | 1470 |
| 222 | Ga0207713_1096087 | 3300025735 | Bacteria | 1032 |
| 223 | Ga0207682_10139640 | 3300025893 | Unclassified | 1087 |
| 224 | Ga0207699_10713177 | 3300025906 | Bacteria | 735 |
| 225 | Ga0207671_10031074 | 3300025914 | Bacteria | 3981 |
| 226 | Ga0207693_10152945 | 3300025915 | Unclassified | 1815 |
| 227 | Ga0207657_10237338 | 3300025919 | Bacteria | 1457 |
| 228 | Ga0207681_10129611 | 3300025923 | Bacteria | 1863 |
| 229 | Ga0207687_10006357 | 3300025927 | Bacteria | 7807 |
| 230 | Ga0207644_11244799 | 3300025931 | Unclassified | 625 |
| 231 | Ga0207690_10184943 | 3300025932 | Bacteria | 1572 |
| 232 | Ga0207706_10113871 | 3300025933 | Bacteria | 2379 |
| 233 | Ga0207709_10138897 | 3300025935 | Bacteria | 1668 |
| 234 | Ga0207709_11136771 | 3300025935 | Bacteria | 642 |
| 235 | Ga0207711_10012751 | 3300025941 | Bacteria | 6981 |
| 236 | Ga0207679_11101425 | 3300025945 | Bacteria | 729 |
| 237 | Ga0207667_10164706 | 3300025949 | Bacteria | 2280 |
| 238 | Ga0207651_10860459 | 3300025960 | Unclassified | 806 |
| 239 | Ga0207712_10075390 | 3300025961 | Bacteria | 2438 |
| 240 | Ga0207658_10662785 | 3300025986 | Bacteria | 941 |
| 241 | Ga0207703_10001551 | 3300026035 | Bacteria | 20833 |
| 242 | Ga0207703_10001574 | 3300026035 | Bacteria | 20688 |
| 243 | Ga0207703_10727604 | 3300026035 | Bacteria | 945 |
| 244 | Ga0207676_10000169 | 3300026095 | Bacteria | 57208 |
| 245 | Ga0207676_10016717 | 3300026095 | Bacteria | 5312 |
| 246 | Ga0207675_100088146 | 3300026118 | Bacteria | 2915 |
| 247 | Ga0207683_10150499 | 3300026121 | Bacteria | 2100 |
| 248 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 249 | Ga0209281_1000717 | 3300027111 | Bacteria | 33033 |
| 250 | Ga0209281_1004352 | 3300027111 | Bacteria | 4262 |
| 251 | Ga0209371_1015214 | 3300027312 | Bacteria | 2077 |
| 252 | Ga0209282_1008607 | 3300027666 | Bacteria | 6443 |
| 253 | Ga0207428_10049800 | 3300027907 | Bacteria | 3355 |
| 254 | Ga0207428_10092593 | 3300027907 | Bacteria | 2346 |
| 255 | Ga0207428_10231474 | 3300027907 | Bacteria | 1383 |
| 256 | Ga0207428_10506715 | 3300027907 | Bacteria | 876 |
| 257 | Ga0268266_10204833 | 3300028379 | Bacteria | 1807 |
| 258 | Ga0268266_10723832 | 3300028379 | Bacteria | 960 |
| 259 | Ga0307517_10281107 | 3300028786 | Bacteria | 949 |
| 260 | Ga0307515_10024017 | 3300028794 | Bacteria | 10646 |
| 261 | Ga0316177_1190406 | 3300030731 | Bacteria | 3184 |
| 262 | Ga0316179_1092971 | 3300030734 | Bacteria | 1341 |
| 263 | Ga0316178_1122809 | 3300030735 | Bacteria | 6550 |
| 264 | Ga0316183_1049590 | 3300030742 | Bacteria | 752 |
| 265 | Ga0316181_1086264 | 3300030744 | Bacteria | 1443 |
| 266 | Ga0265332_10053652 | 3300031238 | Bacteria | 1730 |
| 267 | Ga0265320_10003123 | 3300031240 | Bacteria | 11245 |
| 268 | Ga0307513_10906385 | 3300031456 | Bacteria | 589 |
| 269 | Ga0307408_100191072 | 3300031548 | Bacteria | 1649 |
| 270 | Ga0307408_100231849 | 3300031548 | Bacteria | 1512 |
| 271 | Ga0307408_100233888 | 3300031548 | Bacteria | 1506 |
| 272 | Ga0265313_10024553 | 3300031595 | Bacteria | 3217 |
| 273 | Ga0307508_10019520 | 3300031616 | Bacteria | 6161 |
| 274 | Ga0265314_10016259 | 3300031711 | Bacteria | 5886 |
| 275 | Ga0307405_10018767 | 3300031731 | Bacteria | 3823 |
| 276 | Ga0307405_10613597 | 3300031731 | Bacteria | 889 |
| 277 | Ga0307405_10816243 | 3300031731 | Bacteria | 782 |
| 278 | Ga0307405_11148512 | 3300031731 | Bacteria | 669 |
| 279 | Ga0307413_10038575 | 3300031824 | Bacteria | 2770 |
| 280 | Ga0307410_10427034 | 3300031852 | Bacteria | 1076 |
| 281 | Ga0307406_10149843 | 3300031901 | Bacteria | 1663 |
| 282 | Ga0307406_10940704 | 3300031901 | Unclassified | 738 |
| 283 | Ga0307407_10559516 | 3300031903 | Bacteria | 846 |
| 284 | Ga0307407_10587893 | 3300031903 | Bacteria | 827 |
| 285 | Ga0307407_11380459 | 3300031903 | Unclassified | 555 |
| 286 | Ga0307412_10005974 | 3300031911 | Bacteria | 6858 |
| 287 | Ga0307412_10130162 | 3300031911 | Bacteria | 1826 |
| 288 | Ga0307412_10756137 | 3300031911 | Bacteria | 839 |
| 289 | Ga0307409_101213218 | 3300031995 | Bacteria | 778 |
| 290 | Ga0307409_101524136 | 3300031995 | Bacteria | 696 |
| 291 | Ga0307409_101802802 | 3300031995 | Unclassified | 641 |
| 292 | Ga0307416_100138423 | 3300032002 | Bacteria | 2207 |
| 293 | Ga0307416_100347869 | 3300032002 | Bacteria | 1498 |
| 294 | Ga0307416_101227973 | 3300032002 | Bacteria | 855 |
| 295 | Ga0307414_10011896 | 3300032004 | Bacteria | 5126 |
| 296 | Ga0307414_10084898 | 3300032004 | Bacteria | 2330 |
| 297 | Ga0307414_10161278 | 3300032004 | Bacteria | 1781 |
| 298 | Ga0307414_10163398 | 3300032004 | Bacteria | 1771 |
| 299 | Ga0307414_10402729 | 3300032004 | Bacteria | 1189 |
| 300 | Ga0307414_10701448 | 3300032004 | Bacteria | 916 |
| 301 | Ga0307414_11078803 | 3300032004 | Unclassified | 741 |
| 302 | Ga0307411_10116667 | 3300032005 | Bacteria | 1922 |
| 303 | Ga0307411_11153981 | 3300032005 | Bacteria | 701 |
| 304 | Ga0307415_100927767 | 3300032126 | Bacteria | 804 |
| 305 | Ga0307415_100968663 | 3300032126 | Unclassified | 789 |
| 306 | Ga0316574_0171125 | 3300035398 | Bacteria | 1398 |
| 307 | Ga0373933_0456734 | 3300035724 | Bacteria | 836 |
| 308 | Ga0395899_0001089 | 3300037312 | Bacteria | 24380 |
| 309 | Ga0395899_0335206 | 3300037312 | Bacteria | 1015 |
| 310 | Ga0395899_0798720 | 3300037312 | Bacteria | 583 |
| 311 | Ga0395900_0000108 | 3300037418 | Bacteria | 147706 |
| 312 | Ga0395900_0007617 | 3300037418 | Bacteria | 11180 |
| 313 | Ga0395900_0222737 | 3300037418 | Bacteria | 1900 |
| 314 | Ga0395900_0670367 | 3300037418 | Bacteria | 972 |
| 315 | Ga0395898_0009141 | 3300037466 | Bacteria | 10441 |
| 316 | Ga0395898_0060019 | 3300037466 | Unclassified | 3697 |
| 317 | Ga0395898_0185182 | 3300037466 | Bacteria | 1989 |
| 318 | Ga0395905_0026339 | 3300037471 | Bacteria | 5483 |
| 319 | Ga0395905_0077250 | 3300037471 | Bacteria | 3120 |
| 320 | Ga0395905_1411360 | 3300037471 | Unclassified | 600 |
| 321 | Ga0395905_1701214 | 3300037471 | Unclassified | 536 |
| 322 | Ga0436364_0051522 | 3300037853 | Bacteria | 3570 |
| 323 | Ga0436364_0061348 | 3300037853 | Unclassified | 1758 |
| 324 | Ga0436364_0524095 | 3300037853 | Bacteria | 8185 |
| 325 | Ga0395901_0000023 | 3300038443 | Bacteria | 283968 |
| 326 | Ga0395901_0000050 | 3300038443 | Bacteria | 171046 |
| 327 | Ga0395901_0000183 | 3300038443 | Bacteria | 81275 |
| 328 | Ga0395901_0003967 | 3300038443 | Bacteria | 14881 |
| 329 | Ga0395901_0237761 | 3300038443 | Bacteria | 1900 |
| 330 | Ga0395901_0473364 | 3300038443 | Bacteria | 1278 |
| 331 | Ga0436365_0118027 | 3300039437 | Bacteria | 1568 |
| 332 | Ga0436361_0060925 | 3300039447 | Bacteria | 6643 |
| 333 | Ga0436361_0422046 | 3300039447 | Bacteria | 2754 |
| 334 | Ga0436361_0513574 | 3300039447 | Bacteria | 1182 |
| 335 | Ga0436361_0576973 | 3300039447 | Bacteria | 5287 |
| 336 | Ga0436361_0821550 | 3300039447 | Unclassified | 1368 |
| 337 | Ga0436361_1057455 | 3300039447 | Bacteria | 40673 |
| 338 | Ga0436361_1103751 | 3300039447 | Unclassified | 1271 |
| 339 | Ga0436363_0398739 | 3300039450 | Bacteria | 2009 |
| 340 | Ga0436363_0741000 | 3300039450 | Bacteria | 1470 |
| 341 | Ga0436362_0250573 | 3300039453 | Bacteria | 1639 |
| 342 | Ga0439438_000385 | 3300041405 | Bacteria | 19779 |
| 343 | Ga0439438_001237 | 3300041405 | Bacteria | 11324 |
| 344 | Ga0439438_002736 | 3300041405 | Bacteria | 7403 |
| 345 | Ga0439438_009887 | 3300041405 | Bacteria | 3058 |
| 346 | Ga0439438_017263 | 3300041405 | Bacteria | 2081 |
| 347 | Ga0439438_046412 | 3300041405 | Bacteria | 1115 |
| 348 | Ga0439438_064997 | 3300041405 | Bacteria | 909 |
| 349 | Ga0439447_019572 | 3300041407 | Bacteria | 1803 |
| 350 | Ga0439447_032890 | 3300041407 | Bacteria | 1294 |
| 351 | Ga0439447_037780 | 3300041407 | Bacteria | 1188 |
| 352 | Ga0439466_0003407 | 3300041411 | Bacteria | 6169 |
| 353 | Ga0439466_0004719 | 3300041411 | Bacteria | 5236 |
| 354 | Ga0439466_0014078 | 3300041411 | Bacteria | 2918 |
| 355 | Ga0439466_0079893 | 3300041411 | Bacteria | 1032 |
| 356 | Ga0439445_0044591 | 3300042004 | Bacteria | 1185 |
| 357 | Ga0439445_0048139 | 3300042004 | Bacteria | 1146 |
| 358 | Ga0439445_0210972 | 3300042004 | Bacteria | 575 |
| 359 | Ga0439432_000116 | 3300042006 | Bacteria | 25928 |
| 360 | Ga0439432_002197 | 3300042006 | Bacteria | 7369 |
| 361 | Ga0439432_008638 | 3300042006 | Bacteria | 3574 |
| 362 | Ga0439432_058708 | 3300042006 | Bacteria | 1189 |
| 363 | Ga0439432_061222 | 3300042006 | Bacteria | 1160 |
| 364 | Ga0439432_067791 | 3300042006 | Bacteria | 1091 |
| 365 | Ga0439451_000777 | 3300042009 | Bacteria | 6068 |
| 366 | Ga0439451_001521 | 3300042009 | Bacteria | 4586 |
| 367 | Ga0439451_005945 | 3300042009 | Bacteria | 2493 |
| 368 | Ga0439451_032790 | 3300042009 | Bacteria | 1044 |
| 369 | Ga0439452_000530 | 3300042010 | Bacteria | 20404 |
| 370 | Ga0439452_003840 | 3300042010 | Bacteria | 5159 |
| 371 | Ga0439452_051112 | 3300042010 | Bacteria | 946 |
| 372 | Ga0439456_003572 | 3300042013 | Bacteria | 3155 |
| 373 | Ga0439456_008683 | 3300042013 | Bacteria | 2097 |
| 374 | Ga0439456_008846 | 3300042013 | Bacteria | 2080 |
| 375 | Ga0439456_013705 | 3300042013 | Bacteria | 1688 |
| 376 | Ga0439463_005539 | 3300042016 | Bacteria | 3139 |
| 377 | Ga0439463_014377 | 3300042016 | Bacteria | 1951 |
| 378 | Ga0439463_030225 | 3300042016 | Bacteria | 1365 |
| 379 | Ga0439463_098875 | 3300042016 | Bacteria | 752 |
| 380 | Ga0450911_000394 | 3300042115 | Bacteria | 14425 |
| 381 | Ga0450911_008569 | 3300042115 | Bacteria | 1452 |
| 382 | Ga0450911_014078 | 3300042115 | Bacteria | 1066 |
| 383 | Ga0450900_001734 | 3300042136 | Bacteria | 2194 |
| 384 | Ga0450902_013760 | 3300042137 | Bacteria | 1304 |
| 385 | Ga0450902_015032 | 3300042137 | Bacteria | 1254 |
| 386 | Ga0450902_015424 | 3300042137 | Bacteria | 1239 |
| 387 | Ga0450903_013304 | 3300042138 | Bacteria | 1309 |
| 388 | Ga0450904_005957 | 3300042139 | Bacteria | 1223 |
| 389 | Ga0450905_010235 | 3300042142 | Bacteria | 1296 |
| 390 | Ga0450905_016590 | 3300042142 | Bacteria | 1063 |
| 391 | Ga0450905_023307 | 3300042142 | Bacteria | 923 |
| 392 | Ga0450906_000140 | 3300042145 | Bacteria | 13120 |
| 393 | Ga0450907_001261 | 3300042146 | Bacteria | 5673 |
| 394 | Ga0450907_033870 | 3300042146 | Bacteria | 870 |
| 395 | Ga0439446_0001111 | 3300042156 | Bacteria | 5953 |
| 396 | Ga0450909_001851 | 3300042185 | Bacteria | 2976 |
| 397 | Ga0450909_007526 | 3300042185 | Bacteria | 1577 |
| 398 | Ga0439434_0001029 | 3300042435 | Bacteria | 8072 |
| 399 | Ga0439435_0019100 | 3300042436 | Bacteria | 1752 |
| 400 | Ga0439460_0007980 | 3300042461 | Bacteria | 2664 |
| 401 | Ga0439460_0338570 | 3300042461 | Bacteria | 529 |
| 402 | Ga0450918_013240 | 3300042531 | Bacteria | 1435 |
| 403 | Ga0450893_0028057 | 3300042532 | Bacteria | 994 |
| 404 | Ga0450901_003932 | 3300042533 | Bacteria | 1540 |
| 405 | Ga0439440_0003458 | 3300042993 | Bacteria | 3042 |
| 406 | Ga0466969_0045482 | 3300044656 | Bacteria | 2179 |
| 407 | Ga0466969_0154463 | 3300044656 | Bacteria | 1056 |
| 408 | Ga0466965_0012519 | 3300044683 | Bacteria | 3991 |
| 409 | Ga0466966_0028921 | 3300044684 | Bacteria | 3608 |
| 410 | Ga0466961_0000467 | 3300044693 | Bacteria | 25598 |
| 411 | Ga0466961_0093771 | 3300044693 | Bacteria | 1894 |
| 412 | Ga0466961_0117619 | 3300044693 | Unclassified | 1670 |
| 413 | Ga0466963_0097683 | 3300044694 | Bacteria | 2007 |
| 414 | Ga0466963_0117680 | 3300044694 | Bacteria | 1827 |
| 415 | Ga0466971_0291496 | 3300044719 | Bacteria | 782 |
| 416 | Ga0466970_0658095 | 3300044765 | Bacteria | 609 |
| 417 | Ga0466957_0148978 | 3300044842 | Bacteria | 1512 |
| 418 | Ga0466959_0055078 | 3300045049 | Bacteria | 2904 |
| 419 | Ga0466959_0385630 | 3300045049 | Unclassified | 953 |
| 420 | Ga0466958_0180722 | 3300045836 | Bacteria | 1338 |
| 421 | Ga0466967_0531768 | 3300045976 | Bacteria | 1156 |
| 422 | Ga0466967_0687015 | 3300045976 | Bacteria | 1013 |
| 423 | Ga0495617_003151 | 3300046452 | Bacteria | 6279 |
| 424 | Ga0495617_037873 | 3300046452 | Bacteria | 1614 |
| 425 | Ga0495617_129350 | 3300046452 | Bacteria | 810 |
| 426 | Ga0495627_000084 | 3300046453 | Bacteria | 112950 |
| 427 | Ga0495627_002251 | 3300046453 | Bacteria | 9551 |
| 428 | Ga0495603_0492377 | 3300046455 | Bacteria | 702 |
| 429 | Ga0495590_0055542 | 3300046457 | Bacteria | 1383 |
| 430 | Ga0495590_0206280 | 3300046457 | Bacteria | 723 |
| 431 | Ga0495591_026286 | 3300046458 | Bacteria | 1811 |
| 432 | Ga0495591_032156 | 3300046458 | Bacteria | 1565 |
| 433 | Ga0495591_037994 | 3300046458 | Bacteria | 1389 |
| 434 | Ga0495638_0012479 | 3300046460 | Bacteria | 5821 |
| 435 | Ga0495638_0035413 | 3300046460 | Bacteria | 3182 |
| 436 | Ga0495638_0143926 | 3300046460 | Bacteria | 1388 |
| 437 | Ga0495638_0221501 | 3300046460 | Bacteria | 1057 |
| 438 | Ga0495638_0226256 | 3300046460 | Bacteria | 1043 |
| 439 | Ga0495638_0330955 | 3300046460 | Bacteria | 810 |
| 440 | Ga0495653_0000002 | 3300046463 | Bacteria | 507262 |
| 441 | Ga0495650_0001827 | 3300046471 | Bacteria | 19067 |
| 442 | Ga0495650_0045347 | 3300046471 | Bacteria | 1851 |
| 443 | Ga0495650_0048377 | 3300046471 | Bacteria | 1772 |
| 444 | Ga0495650_0194304 | 3300046471 | Bacteria | 708 |
| 445 | Ga0495605_0012973 | 3300046474 | Bacteria | 4607 |
| 446 | Ga0495605_0068505 | 3300046474 | Bacteria | 1681 |
| 447 | Ga0495584_0001126 | 3300046491 | Bacteria | 16567 |
| 448 | Ga0495584_0007670 | 3300046491 | Bacteria | 5619 |
| 449 | Ga0495584_0011807 | 3300046491 | Bacteria | 4466 |
| 450 | Ga0495584_0174600 | 3300046491 | Bacteria | 1092 |
| 451 | Ga0495584_0198640 | 3300046491 | Bacteria | 1019 |
| 452 | Ga0495584_0288602 | 3300046491 | Bacteria | 833 |
| 453 | Ga0495585_0010752 | 3300046492 | Bacteria | 5437 |
| 454 | Ga0495585_0049349 | 3300046492 | Bacteria | 2337 |
| 455 | Ga0495585_0184055 | 3300046492 | Bacteria | 1073 |
| 456 | Ga0495585_0231133 | 3300046492 | Bacteria | 929 |
| 457 | Ga0495607_0006943 | 3300046501 | Bacteria | 7893 |
| 458 | Ga0495607_0016609 | 3300046501 | Bacteria | 4748 |
| 459 | Ga0495607_0038674 | 3300046501 | Bacteria | 2856 |
| 460 | Ga0495607_0058021 | 3300046501 | Bacteria | 2215 |
| 461 | Ga0495607_0070545 | 3300046501 | Bacteria | 1952 |
| 462 | Ga0495607_0076441 | 3300046501 | Bacteria | 1852 |
| 463 | Ga0495607_0135233 | 3300046501 | Bacteria | 1277 |
| 464 | Ga0495607_0200079 | 3300046501 | Bacteria | 989 |
| 465 | Ga0495607_0336958 | 3300046501 | Bacteria | 699 |
| 466 | Ga0495583_0012627 | 3300046506 | Bacteria | 4764 |
| 467 | Ga0495583_0079955 | 3300046506 | Bacteria | 1421 |
| 468 | Ga0495606_0000030 | 3300046507 | Bacteria | 249484 |
| 469 | Ga0495606_0044498 | 3300046507 | Bacteria | 2951 |
| 470 | Ga0495606_0147132 | 3300046507 | Bacteria | 1386 |
| 471 | Ga0495606_0263774 | 3300046507 | Bacteria | 949 |
| 472 | Ga0495610_0046596 | 3300046512 | Bacteria | 2138 |
| 473 | Ga0495610_0057847 | 3300046512 | Bacteria | 1857 |
| 474 | Ga0495610_0140347 | 3300046512 | Bacteria | 1040 |
| 475 | Ga0495610_0180453 | 3300046512 | Bacteria | 878 |
| 476 | Ga0495610_0183170 | 3300046512 | Bacteria | 869 |
| 477 | Ga0495616_0047259 | 3300046513 | Bacteria | 2168 |
| 478 | Ga0495616_0075085 | 3300046513 | Bacteria | 1627 |
| 479 | Ga0495620_0011042 | 3300046515 | Bacteria | 4730 |
| 480 | Ga0495620_0037582 | 3300046515 | Bacteria | 2155 |
| 481 | Ga0495630_0307968 | 3300046517 | Bacteria | 1210 |
| 482 | Ga0495631_0219270 | 3300046518 | Bacteria | 812 |
| 483 | Ga0495631_0349253 | 3300046518 | Bacteria | 629 |
| 484 | Ga0495632_0000049 | 3300046519 | Bacteria | 134597 |
| 485 | Ga0495632_0001609 | 3300046519 | Bacteria | 18580 |
| 486 | Ga0495632_0003183 | 3300046519 | Bacteria | 11830 |
| 487 | Ga0495632_0008656 | 3300046519 | Bacteria | 6214 |
| 488 | Ga0495632_0021306 | 3300046519 | Bacteria | 3494 |
| 489 | Ga0495632_0057376 | 3300046519 | Bacteria | 1900 |
| 490 | Ga0495632_0096956 | 3300046519 | Bacteria | 1392 |
| 491 | Ga0495632_0273459 | 3300046519 | Bacteria | 753 |
| 492 | Ga0495632_0318396 | 3300046519 | Bacteria | 687 |
| 493 | Ga0495637_0003277 | 3300046520 | Bacteria | 8615 |
| 494 | Ga0495637_0004271 | 3300046520 | Bacteria | 7420 |
| 495 | Ga0495637_0005172 | 3300046520 | Bacteria | 6683 |
| 496 | Ga0495637_0022273 | 3300046520 | Bacteria | 2891 |
| 497 | Ga0495637_0056987 | 3300046520 | Bacteria | 1615 |
| 498 | Ga0495637_0075001 | 3300046520 | Bacteria | 1357 |
| 499 | Ga0495637_0099281 | 3300046520 | Bacteria | 1139 |
| 500 | Ga0495637_0110098 | 3300046520 | Bacteria | 1068 |
| 501 | Ga0495643_0000047 | 3300046522 | Bacteria | 217914 |
| 502 | Ga0495643_0020755 | 3300046522 | Bacteria | 3781 |
| 503 | Ga0495643_0103929 | 3300046522 | Bacteria | 1452 |
| 504 | Ga0495643_0114878 | 3300046522 | Bacteria | 1365 |
| 505 | Ga0495643_0131869 | 3300046522 | Bacteria | 1254 |
| 506 | Ga0495643_0263596 | 3300046522 | Bacteria | 799 |
| 507 | Ga0495643_0329233 | 3300046522 | Bacteria | 689 |
| 508 | Ga0495643_0383264 | 3300046522 | Bacteria | 623 |
| 509 | Ga0495644_0001046 | 3300046523 | Bacteria | 11535 |
| 510 | Ga0495648_0003342 | 3300046524 | Bacteria | 14150 |
| 511 | Ga0495648_0035719 | 3300046524 | Bacteria | 3218 |
| 512 | Ga0495648_0160862 | 3300046524 | Bacteria | 1161 |
| 513 | Ga0495648_0229872 | 3300046524 | Bacteria | 909 |
| 514 | Ga0495648_0241593 | 3300046524 | Bacteria | 877 |
| 515 | Ga0495663_0000009 | 3300046525 | Bacteria | 256308 |
| 516 | Ga0495642_0001171 | 3300046528 | Bacteria | 12049 |
| 517 | Ga0495654_0026985 | 3300046530 | Bacteria | 2947 |
| 518 | Ga0495654_0044804 | 3300046530 | Bacteria | 2185 |
| 519 | Ga0495654_0088465 | 3300046530 | Bacteria | 1440 |
| 520 | Ga0495654_0103363 | 3300046530 | Bacteria | 1308 |
| 521 | Ga0495654_0201057 | 3300046530 | Bacteria | 852 |
| 522 | Ga0495609_0000149 | 3300046538 | Bacteria | 72309 |
| 523 | Ga0495609_0029481 | 3300046538 | Bacteria | 2498 |
| 524 | Ga0495597_0005474 | 3300046542 | Bacteria | 6717 |
| 525 | Ga0495597_0019740 | 3300046542 | Bacteria | 3148 |
| 526 | Ga0495597_0044582 | 3300046542 | Bacteria | 1971 |
| 527 | Ga0495597_0052307 | 3300046542 | Bacteria | 1798 |
| 528 | Ga0495622_0141025 | 3300046557 | Bacteria | 1094 |
| 529 | Ga0495633_0000402 | 3300046558 | Bacteria | 45246 |
| 530 | Ga0495633_0000434 | 3300046558 | Bacteria | 43286 |
| 531 | Ga0495633_0004035 | 3300046558 | Bacteria | 9497 |
| 532 | Ga0495633_0004360 | 3300046558 | Bacteria | 9035 |
| 533 | Ga0495656_0194998 | 3300046615 | Bacteria | 1002 |
| 534 | Ga0495668_0042326 | 3300046616 | Bacteria | 2536 |
| 535 | Ga0495611_0041298 | 3300046648 | Bacteria | 2057 |
| 536 | Ga0495611_0186037 | 3300046648 | Bacteria | 970 |
| 537 | Ga0495611_0423089 | 3300046648 | Bacteria | 608 |
| 538 | Ga0495625_0108601 | 3300046660 | Bacteria | 1898 |
| 539 | Ga0495625_0133767 | 3300046660 | Bacteria | 1678 |
| 540 | Ga0495625_0159878 | 3300046660 | Bacteria | 1510 |
| 541 | Ga0495625_0194017 | 3300046660 | Bacteria | 1344 |
| 542 | Ga0495659_0001130 | 3300046664 | Bacteria | 9275 |
| 543 | Ga0495659_0001680 | 3300046664 | Bacteria | 7418 |
| 544 | Ga0495659_0056101 | 3300046664 | Bacteria | 1445 |
| 545 | Ga0495661_0010223 | 3300046665 | Bacteria | 6412 |
| 546 | Ga0495661_0041195 | 3300046665 | Bacteria | 2859 |
| 547 | Ga0495661_0078637 | 3300046665 | Bacteria | 1907 |
| 548 | Ga0495661_0248906 | 3300046665 | Bacteria | 908 |
| 549 | Ga0495669_0000275 | 3300046684 | Bacteria | 29419 |
| 550 | Ga0495670_0002606 | 3300046691 | Bacteria | 8907 |
| 551 | Ga0495670_0024396 | 3300046691 | Bacteria | 2988 |
| 552 | Ga0495670_0092817 | 3300046691 | Bacteria | 1546 |
| 553 | Ga0495670_0295589 | 3300046691 | Bacteria | 867 |
| 554 | Ga0495670_0785792 | 3300046691 | Bacteria | 519 |
| 555 | Ga0495671_0000038 | 3300046692 | Bacteria | 173693 |
| 556 | Ga0495671_0000260 | 3300046692 | Bacteria | 44754 |
| 557 | Ga0495671_0026849 | 3300046692 | Bacteria | 2980 |
| 558 | Ga0495671_0075028 | 3300046692 | Bacteria | 1659 |
| 559 | Ga0495671_0076788 | 3300046692 | Bacteria | 1637 |
| 560 | Ga0495671_0079974 | 3300046692 | Bacteria | 1601 |
| 561 | Ga0495671_0195474 | 3300046692 | Bacteria | 981 |
| 562 | Ga0495649_0023742 | 3300046694 | Bacteria | 3425 |
| 563 | Ga0495649_0026244 | 3300046694 | Bacteria | 3241 |
| 564 | Ga0495649_0138218 | 3300046694 | Bacteria | 1283 |
| 565 | Ga0495649_0223118 | 3300046694 | Bacteria | 974 |
| 566 | Ga0495649_0264858 | 3300046694 | Bacteria | 880 |
| 567 | Ga0495589_0046821 | 3300046794 | Bacteria | 2145 |
| 568 | Ga0495589_0076146 | 3300046794 | Bacteria | 1636 |
| 569 | Ga0495589_0197770 | 3300046794 | Bacteria | 949 |
| 570 | Ga0495660_0000049 | 3300046810 | Bacteria | 142727 |
| 571 | Ga0495660_0000715 | 3300046810 | Bacteria | 25390 |
| 572 | Ga0495660_0087100 | 3300046810 | Bacteria | 1629 |
| 573 | Ga0495660_0098444 | 3300046810 | Bacteria | 1508 |
| 574 | Ga0495660_0151269 | 3300046810 | Bacteria | 1145 |
| 575 | Ga0495636_0075725 | 3300047318 | Bacteria | 1442 |
| 576 | Ga0495672_0000184 | 3300047320 | Bacteria | 91103 |
| 577 | Ga0495672_0014058 | 3300047320 | Bacteria | 5496 |
| 578 | Ga0495672_0022104 | 3300047320 | Bacteria | 4139 |
| 579 | Ga0495672_0033995 | 3300047320 | Bacteria | 3154 |
| 580 | Ga0495672_0118564 | 3300047320 | Bacteria | 1410 |
| 581 | Ga0495672_0119672 | 3300047320 | Bacteria | 1401 |
| 582 | Ga0495680_0005487 | 3300047322 | Bacteria | 11923 |
| 583 | Ga0495683_0084569 | 3300047323 | Bacteria | 1543 |
| 584 | Ga0495687_037674 | 3300047443 | Bacteria | 2152 |
| 585 | Ga0495687_120242 | 3300047443 | Bacteria | 949 |
| 586 | Ga0495687_128256 | 3300047443 | Bacteria | 903 |
| 587 | Ga0495677_0007520 | 3300047445 | Bacteria | 4067 |
| 588 | Ga0495679_004730 | 3300047446 | Bacteria | 6181 |
| 589 | Ga0495685_001865 | 3300047447 | Bacteria | 6511 |
| 590 | Ga0495673_0015870 | 3300047469 | Bacteria | 3867 |
| 591 | Ga0495673_0061895 | 3300047469 | Bacteria | 1600 |
| 592 | Ga0495673_0066371 | 3300047469 | Bacteria | 1530 |
| 593 | Ga0495673_0117662 | 3300047469 | Bacteria | 1055 |
| 594 | Ga0495681_0002988 | 3300047470 | Bacteria | 11907 |
| 595 | Ga0495681_0040661 | 3300047470 | Bacteria | 2262 |
| 596 | Ga0495681_0041400 | 3300047470 | Bacteria | 2236 |
| 597 | Ga0495681_0065823 | 3300047470 | Bacteria | 1655 |
| 598 | Ga0495681_0110354 | 3300047470 | Bacteria | 1192 |
| 599 | Ga0495686_0000624 | 3300047472 | Bacteria | 48658 |
| 600 | Ga0495686_0008888 | 3300047472 | Bacteria | 7306 |
| 601 | Ga0495686_0094687 | 3300047472 | Bacteria | 1809 |
| 602 | Ga0495686_0098273 | 3300047472 | Bacteria | 1769 |
| 603 | Ga0495686_0197160 | 3300047472 | Bacteria | 1157 |
| 604 | Ga0495686_0312935 | 3300047472 | Bacteria | 863 |
| 605 | Ga0495686_0379009 | 3300047472 | Bacteria | 763 |
| 606 | Ga0495593_0191954 | 3300047673 | Bacteria | 1027 |
| 607 | Ga0495615_0004325 | 3300048090 | Bacteria | 2472 |
| 608 | Ga0495626_0002902 | 3300048091 | Bacteria | 11418 |
| 609 | Ga0495626_0010145 | 3300048091 | Bacteria | 5053 |
| 610 | Ga0495626_0155775 | 3300048091 | Bacteria | 960 |
| 611 | Ga0495626_0421924 | 3300048091 | Bacteria | 514 |
| 612 | Ga0496101_0319322 | 3300048904 | Bacteria | 1218 |
| 613 | Ga0496102_0114691 | 3300048905 | Bacteria | 2514 |
| 614 | Ga0496102_0174812 | 3300048905 | Bacteria | 2022 |
| 615 | Ga0496107_0165459 | 3300048910 | Bacteria | 1640 |
| 616 | Ga0496108_0065617 | 3300048911 | Bacteria | 3060 |
| 617 | Ga0496109_0195701 | 3300048912 | Bacteria | 1900 |
| 618 | Ga0496109_1147341 | 3300048912 | Bacteria | 714 |
| 619 | Ga0496110_0088186 | 3300048913 | Bacteria | 2771 |
| 620 | Ga0496110_0347135 | 3300048913 | Bacteria | 1352 |
| 621 | Ga0496111_1020051 | 3300048914 | Unclassified | 592 |
| 622 | Ga0496112_0130016 | 3300048915 | Bacteria | 2489 |
| 623 | Ga0496112_0358674 | 3300048915 | Bacteria | 1400 |
| 624 | Ga0496116_0044785 | 3300048919 | Bacteria | 3002 |
| 625 | Ga0496117_0020723 | 3300048920 | Bacteria | 5350 |
| 626 | Ga0496117_0080759 | 3300048920 | Bacteria | 2137 |
| 627 | Ga0496117_0089952 | 3300048920 | Bacteria | 1980 |
| 628 | Ga0496117_0142596 | 3300048920 | Bacteria | 1432 |
| 629 | Ga0496118_0002611 | 3300048921 | Bacteria | 23930 |
| 630 | Ga0496118_0026316 | 3300048921 | Bacteria | 4959 |
| 631 | Ga0496118_0080846 | 3300048921 | Bacteria | 2285 |
| 632 | Ga0496118_0196829 | 3300048921 | Bacteria | 1198 |
| 633 | Ga0496118_0494061 | 3300048921 | Bacteria | 610 |
| 634 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 635 | Ga0496121_0245350 | 3300048924 | Bacteria | 1245 |
| 636 | Ga0496121_0276913 | 3300048924 | Bacteria | 1150 |
| 637 | Ga0496121_0482982 | 3300048924 | Bacteria | 791 |
| 638 | Ga0496121_0654822 | 3300048924 | Bacteria | 639 |
| 639 | Ga0496122_0002889 | 3300048925 | Bacteria | 23500 |
| 640 | Ga0496122_0049685 | 3300048925 | Bacteria | 3207 |
| 641 | Ga0496122_0055864 | 3300048925 | Bacteria | 2949 |
| 642 | Ga0496123_0085631 | 3300048926 | Bacteria | 1895 |
| 643 | Ga0496123_0138664 | 3300048926 | Bacteria | 1334 |
| 644 | Ga0496124_0000672 | 3300048927 | Bacteria | 56291 |
| 645 | Ga0496124_0002578 | 3300048927 | Bacteria | 23487 |
| 646 | Ga0496124_0053423 | 3300048927 | Bacteria | 3424 |
| 647 | Ga0496124_0077797 | 3300048927 | Bacteria | 2735 |
| 648 | Ga0496124_0128318 | 3300048927 | Bacteria | 2018 |
| 649 | Ga0496124_0155165 | 3300048927 | Bacteria | 1791 |
| 650 | Ga0496124_0310924 | 3300048927 | Bacteria | 1133 |
| 651 | Ga0496124_0382424 | 3300048927 | Bacteria | 984 |
| 652 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 653 | Ga0496125_0001126 | 3300048928 | Bacteria | 40818 |
| 654 | Ga0496125_0012345 | 3300048928 | Bacteria | 8488 |
| 655 | Ga0496125_0019176 | 3300048928 | Bacteria | 6462 |
| 656 | Ga0496126_0032169 | 3300048929 | Bacteria | 4945 |
| 657 | Ga0496126_0037146 | 3300048929 | Bacteria | 4548 |
| 658 | Ga0496126_0397206 | 3300048929 | Bacteria | 1119 |
| 659 | Ga0495678_008089 | 3300049459 | Bacteria | 5357 |
| 660 | Ga0495678_013524 | 3300049459 | Bacteria | 3829 |
| 661 | Ga0495678_050725 | 3300049459 | Bacteria | 1607 |
| 662 | Ga0495678_076574 | 3300049459 | Bacteria | 1211 |
| 663 | Ga0495678_087635 | 3300049459 | Bacteria | 1103 |
| 664 | Ga0495678_107749 | 3300049459 | Bacteria | 955 |
| 665 | Ga0495682_0000589 | 3300049460 | Bacteria | 24714 |
| 666 | Ga0495682_0048705 | 3300049460 | Bacteria | 1544 |
| 667 | Ga0501300_056562 | 3300049523 | Unclassified | 614 |
| 668 | Ga0501315_045870 | 3300049531 | Bacteria | 674 |
| 669 | Ga0501033_0044625 | 3300049570 | Bacteria | 3300 |
| 670 | Ga0501043_0049267 | 3300049579 | Bacteria | 3312 |
| 671 | Ga0501043_0078395 | 3300049579 | Bacteria | 2596 |
| 672 | Ga0501048_1002740 | 3300049582 | Unclassified | 601 |
| 673 | Ga0501067_0039776 | 3300049583 | Bacteria | 2611 |
| 674 | Ga0501067_0110703 | 3300049583 | Bacteria | 1527 |
| 675 | Ga0501216_133387 | 3300049660 | Unclassified | 578 |
| 676 | Ga0501227_023905 | 3300049665 | Bacteria | 1422 |
| 677 | Ga0501235_034249 | 3300049669 | Bacteria | 1152 |
| 678 | Ga0501240_004834 | 3300049673 | Bacteria | 1583 |
| 679 | Ga0501252_008582 | 3300049682 | Bacteria | 1176 |
| 680 | Ga0501221_172479 | 3300049704 | Unclassified | 586 |
| 681 | Ga0501083_0088400 | 3300049744 | Bacteria | 2049 |
| 682 | Ga0501241_035562 | 3300049758 | Bacteria | 953 |
| 683 | Ga0501269_010422 | 3300049766 | Bacteria | 1131 |
| 684 | Ga0501226_006893 | 3300049853 | Bacteria | 1279 |
| 685 | nmdc:mga03683_199085_c1 | 3300050489 | Bacteria | 919 |
| 686 | nmdc:mga03683_273524_c1 | 3300050489 | Unclassified | 788 |
| 687 | nmdc:mga03683_35391_c1 | 3300050489 | Bacteria | 2026 |
| 688 | nmdc:mga00v17_108894_c1 | 3300050491 | Bacteria | 1756 |
| 689 | nmdc:mga00v17_40621_c1 | 3300050491 | Bacteria | 2791 |
| 690 | nmdc:mga00v17_9237_c1 | 3300050491 | Bacteria | 5328 |
| 691 | nmdc:mga0yw44_782711_c1 | 3300050492 | Bacteria | 648 |
| 692 | nmdc:mga0yw44_96578_c1 | 3300050492 | Bacteria | 1876 |
| 693 | nmdc:mga07m45_74270_c1 | 3300050496 | Bacteria | 1937 |
| 694 | nmdc:mga0qj67_1474047_c1 | 3300050509 | Unclassified | 524 |
| 695 | nmdc:mga08x19_171509_c1 | 3300050514 | Bacteria | 1478 |
| 696 | nmdc:mga08x19_615911_c1 | 3300050514 | Bacteria | 769 |
| 697 | nmdc:mga0sz30_34988_c1 | 3300050516 | Bacteria | 2094 |
| 698 | nmdc:mga0sz30_49060_c2 | 3300050516 | Bacteria | 1195 |
| 699 | Ga0500644_0284158 | 3300053088 | Bacteria | 705 |
| 700 | Ga0500572_206079 | 3300053111 | Bacteria | 644 |
| 701 | Ga0500594_0001502 | 3300053118 | Bacteria | 5077 |
| 702 | Ga0500618_000070 | 3300053125 | Bacteria | 86080 |
| 703 | Ga0500618_000344 | 3300053125 | Bacteria | 33227 |
| 704 | Ga0500559_0042345 | 3300053136 | Bacteria | 1986 |
| 705 | Ga0500559_0100952 | 3300053136 | Bacteria | 1330 |
| 706 | Ga0500622_0402689 | 3300053156 | Bacteria | 555 |
| 707 | Ga0500634_0021243 | 3300053161 | Bacteria | 3516 |
| 708 | Ga0500645_184440 | 3300053730 | Unclassified | 567 |
| 709 | Ga0587088_013908 | 3300059508 | Bacteria | 1244 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025893 | Ga0207682_10139640 | Ga0207682_101396402 | 109 |
| 2 | 3300039450 | Ga0436363_0398739 | Ga0436363_0398739_47_376 | 109 |
| 3 | 3300044694 | Ga0466963_0097683 | Ga0466963_0097683_1652_1990 | 111 |
| 4 | iso_pu_bacteria | 2884960567 | 2884960624 | 127 |
| 5 | 3300009093 | Ga0105240_10549366 | Ga0105240_105493662 | 128 |
| 6 | 3300021361 | Ga0213872_10000747 | Ga0213872_1000074726 | 128 |
| 7 | 3300021361 | Ga0213872_10003934 | Ga0213872_100039345 | 128 |
| 8 | 3300021361 | Ga0213872_10030473 | Ga0213872_100304732 | 128 |
| 9 | 3300021388 | Ga0213875_10012055 | Ga0213875_100120554 | 128 |
| 10 | 3300025906 | Ga0207699_10713177 | Ga0207699_107131771 | 128 |
| 11 | 3300031995 | Ga0307409_101802802 | Ga0307409_1018028022 | 128 |
| 12 | 3300037312 | Ga0395899_0798720 | Ga0395899_0798720_11_409 | 128 |
| 13 | 3300037471 | Ga0395905_0077250 | Ga0395905_0077250_918_1322 | 128 |
| 14 | 3300037853 | Ga0436364_0524095 | Ga0436364_0524095_3024_3446 | 128 |
| 15 | 3300039447 | Ga0436361_0060925 | Ga0436361_0060925_1765_2154 | 128 |
| 16 | 3300039447 | Ga0436361_0422046 | Ga0436361_0422046_1394_1789 | 128 |
| 17 | 3300039447 | Ga0436361_1057455 | Ga0436361_1057455_19071_19463 | 128 |
| 18 | 3300041405 | Ga0439438_017263 | Ga0439438_017263_1148_1546 | 128 |
| 19 | 3300046501 | Ga0495607_0038674 | Ga0495607_0038674_378_776 | 128 |
| 20 | 3300046501 | Ga0495607_0336958 | Ga0495607_0336958_146_544 | 128 |
| 21 | 3300046538 | Ga0495609_0000149 | Ga0495609_0000149_43130_43528 | 128 |
| 22 | 3300046648 | Ga0495611_0186037 | Ga0495611_0186037_330_776 | 128 |
| 23 | 3300047469 | Ga0495673_0066371 | Ga0495673_0066371_12_398 | 128 |
| 24 | 3300047472 | Ga0495686_0379009 | Ga0495686_0379009_51_443 | 128 |
| 25 | 3300048912 | Ga0496109_1147341 | Ga0496109_1147341_13_408 | 128 |
| 26 | 3300048913 | Ga0496110_0088186 | Ga0496110_0088186_1109_1516 | 128 |
| 27 | 3300048914 | Ga0496111_1020051 | Ga0496111_1020051_88_483 | 128 |
| 28 | 3300048920 | Ga0496117_0142596 | Ga0496117_0142596_883_1275 | 128 |
| 29 | 3300048921 | Ga0496118_0080846 | Ga0496118_0080846_584_976 | 128 |
| 30 | 3300048927 | Ga0496124_0002578 | Ga0496124_0002578_12181_12588 | 128 |
| 31 | 3300048928 | Ga0496125_0019176 | Ga0496125_0019176_2632_3039 | 128 |
| 32 | 3300048929 | Ga0496126_0032169 | Ga0496126_0032169_2394_2801 | 128 |
| 33 | 3300049523 | Ga0501300_056562 | Ga0501300_056562_37_438 | 128 |
| 34 | 3300049660 | Ga0501216_133387 | Ga0501216_133387_111_512 | 128 |
| 35 | 3300049704 | Ga0501221_172479 | Ga0501221_172479_13_414 | 128 |
| 36 | 3300053118 | Ga0500594_0001502 | Ga0500594_0001502_2732_3127 | 128 |
| 37 | 3300053730 | Ga0500645_184440 | Ga0500645_184440_105_500 | 128 |
| 38 | iso_pu_bacteria | 2510917026 | 2511175111 | 128 |
| 39 | iso_pu_bacteria | 2510917028 | 2511181548 | 128 |
| 40 | iso_pu_bacteria | 2511231008 | 2511280638 | 128 |
| 41 | iso_pu_bacteria | 2511231014 | 2511312149 | 128 |
| 42 | iso_pu_bacteria | 2511231015 | 2511318583 | 128 |
| 43 | iso_pu_bacteria | 2511231017 | 2511332774 | 128 |
| 44 | iso_pu_bacteria | 2511231019 | 2511345142 | 128 |
| 45 | iso_pu_bacteria | 2513237138 | 2513868261 | 128 |
| 46 | iso_pu_bacteria | 2534681796 | 2535518464 | 128 |
| 47 | iso_pu_bacteria | 2537561728 | 2538427591 | 128 |
| 48 | iso_pu_bacteria | 2585427591 | 2585827323 | 128 |
| 49 | iso_pu_bacteria | 2599185185 | 2599482844 | 128 |
| 50 | iso_pu_bacteria | 2599185316 | 2600026692 | 128 |
| 51 | iso_pu_bacteria | 2599185317 | 2600029919 | 128 |
| 52 | iso_pu_bacteria | 2599185325 | 2600080367 | 128 |
| 53 | iso_pu_bacteria | 2599185352 | 2600197961 | 128 |
| 54 | iso_pu_bacteria | 2600254930 | 2600359228 | 128 |
| 55 | iso_pu_bacteria | 2600254931 | 2600365284 | 128 |
| 56 | iso_pu_bacteria | 2643221557 | 2643809434 | 128 |
| 57 | iso_pu_bacteria | 2643221565 | 2643840860 | 128 |
| 58 | iso_pu_bacteria | 2643221589 | 2643955044 | 128 |
| 59 | iso_pu_bacteria | 2643221602 | 2644024678 | 128 |
| 60 | iso_pu_bacteria | 2643221607 | 2644049976 | 128 |
| 61 | iso_pu_bacteria | 2643221618 | 2644107086 | 128 |
| 62 | iso_pu_bacteria | 2643221626 | 2644147817 | 128 |
| 63 | iso_pu_bacteria | 2643221633 | 2644189583 | 128 |
| 64 | iso_pu_bacteria | 2643221636 | 2644203069 | 128 |
| 65 | iso_pu_bacteria | 2643221655 | 2644311391 | 128 |
| 66 | iso_pu_bacteria | 2643221659 | 2644335100 | 128 |
| 67 | iso_pu_bacteria | 2643221686 | 2644482891 | 128 |
| 68 | iso_pu_bacteria | 2643221689 | 2644497834 | 128 |
| 69 | iso_pu_bacteria | 2643221698 | 2644543961 | 128 |
| 70 | iso_pu_bacteria | 2643221712 | 2644617066 | 128 |
| 71 | iso_pu_bacteria | 2643221723 | 2644674737 | 128 |
| 72 | iso_pu_bacteria | 2651869719 | 2652543648 | 128 |
| 73 | iso_pu_bacteria | 2713897148 | 2715749087 | 128 |
| 74 | iso_pu_bacteria | 2738541280 | 2738738963 | 128 |
| 75 | iso_pu_bacteria | 2738541317 | 2738945128 | 128 |
| 76 | iso_pu_bacteria | 2738543015 | 2739260436 | 128 |
| 77 | iso_pu_bacteria | 2739367756 | 2739792922 | 128 |
| 78 | iso_pu_bacteria | 2751185800 | 2753360758 | 128 |
| 79 | iso_pu_bacteria | 2758568016 | 2758638173 | 128 |
| 80 | iso_pu_bacteria | 2765235841 | 2765581760 | 128 |
| 81 | iso_pu_bacteria | 2773857670 | 2774119684 | 128 |
| 82 | iso_pu_bacteria | 2784132072 | 2784316243 | 128 |
| 83 | iso_pu_bacteria | 2791355010 | 2792310953 | 128 |
| 84 | iso_pu_bacteria | 2808606377 | 2808931276 | 128 |
| 85 | iso_pu_bacteria | 2808606381 | 2808953234 | 128 |
| 86 | iso_pu_bacteria | 2808606387 | 2808989952 | 128 |
| 87 | iso_pu_bacteria | 2808606445 | 2809217859 | 128 |
| 88 | iso_pu_bacteria | 2821123053 | 2821131055 | 128 |
| 89 | iso_pu_bacteria | 2838714209 | 2838719462 | 128 |
| 90 | iso_pu_bacteria | 2838719591 | 2838724825 | 128 |
| 91 | iso_pu_bacteria | 2841846520 | 2841851312 | 128 |
| 92 | iso_pu_bacteria | 2842124991 | 2842129287 | 128 |
| 93 | iso_pu_bacteria | 2842170452 | 2842175707 | 128 |
| 94 | iso_pu_bacteria | 2842187318 | 2842192551 | 128 |
| 95 | iso_pu_bacteria | 2842224351 | 2842229600 | 128 |
| 96 | iso_pu_bacteria | 2842832357 | 2842834042 | 128 |
| 97 | iso_pu_bacteria | 2842854478 | 2842859430 | 128 |
| 98 | iso_pu_bacteria | 2844163670 | 2844164369 | 128 |
| 99 | iso_pu_bacteria | 2849560528 | 2849564278 | 128 |
| 100 | iso_pu_bacteria | 2849573788 | 2849575483 | 128 |
| 101 | iso_pu_bacteria | 2851153111 | 2851155020 | 128 |
| 102 | iso_pu_bacteria | 2854911287 | 2854915391 | 128 |
| 103 | iso_pu_bacteria | 2857542790 | 2857544905 | 128 |
| 104 | iso_pu_bacteria | 2858466076 | 2858469123 | 128 |
| 105 | iso_pu_bacteria | 2898329390 | 2898334132 | 128 |
| 106 | iso_pu_bacteria | 2913308742 | 2913309754 | 128 |
| 107 | iso_pu_bacteria | 2919100787 | 2919104783 | 128 |
| 108 | iso_pu_bacteria | 2919114240 | 2919119617 | 128 |
| 109 | iso_pu_bacteria | 2919385768 | 2919389901 | 128 |
| 110 | iso_pu_bacteria | 2920822456 | 2920828011 | 128 |
| 111 | iso_pu_bacteria | 2926754445 | 2926759764 | 128 |
| 112 | iso_pu_bacteria | 2929138655 | 2929142876 | 128 |
| 113 | iso_pu_bacteria | 2978969890 | 2978969890 | 128 |
| 114 | iso_pu_bacteria | 2979089926 | 2979095450 | 128 |
| 115 | iso_pu_bacteria | 2979095461 | 2979097703 | 128 |
| 116 | iso_pu_bacteria | 2984286254 | 2984287549 | 128 |
| 117 | iso_pu_bacteria | 2988728565 | 2988732074 | 128 |
| 118 | iso_pu_bacteria | 2998139840 | 2998140335 | 128 |
| 119 | iso_pu_bacteria | 3007855910 | 3007857212 | 128 |
| 120 | iso_pu_bacteria | 3007861166 | 3007864458 | 128 |
| 121 | iso_pu_bacteria | 3007872151 | 3007875201 | 128 |
| 122 | iso_pu_bacteria | 641228493 | 641334028 | 128 |
| 123 | iso_pu_bacteria | 643348555 | 643391163 | 128 |
| 124 | iso_pu_bacteria | 8005258706 | 8005258790 | 128 |
| 125 | iso_pu_bacteria | 8029995093 | 8030000400 | 128 |
| 126 | iso_pu_bacteria | 8046767195 | 8046768015 | 128 |
| 127 | iso_pu_bacteria | 8054929484 | 8054930224 | 128 |
| 128 | iso_pu_bacteria | 8055431914 | 8055434813 | 128 |
| 129 | iso_pu_bacteria | 8056115690 | 8056116880 | 128 |
| 130 | iso_pu_bacteria | 8056143049 | 8056143604 | 128 |
| 131 | iso_pu_bacteria | 8056155041 | 8056158392 | 128 |
| 132 | iso_pu_bacteria | 8056166840 | 8056170708 | 128 |
| 133 | iso_pu_bacteria | 8056569372 | 8056572199 | 128 |
| 134 | 3300048925 | Ga0496122_0055864 | Ga0496122_0055864_556_945 | 129 |
| 135 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_139574_139963 | 129 |
| 136 | iso_pu_bacteria | 8005542996 | 8005549383 | 129 |
| 137 | 3300039437 | Ga0436365_0118027 | Ga0436365_0118027_77_469 | 130 |
| 138 | 2010549000 | RicEn_C7519 | RicEn_132240 | 132 |
| 139 | 2124908027 | MRS2a_Contig_11594 | MRS2a_00464100 | 132 |
| 140 | 2162886007 | SwRhRL2b_contig_30749 | SwRhRL2b_0685.00004780 | 132 |
| 141 | 2162886007 | SwRhRL2b_contig_519226 | SwRhRL2b_0084.00006340 | 132 |
| 142 | 3300002737 | JGI25162J39368_1001056 | JGI25162J39368_10010567 | 132 |
| 143 | 3300002739 | JGI25158J39367_1002355 | JGI25158J39367_10023553 | 132 |
| 144 | 3300002771 | JGI25163J39215_1003290 | JGI25163J39215_10032902 | 132 |
| 145 | 3300002772 | JGI25164J39214_1000563 | JGI25164J39214_10005637 | 132 |
| 146 | 3300002987 | JGI25159J45721_1000083 | JGI25159J45721_100008332 | 132 |
| 147 | 3300002987 | JGI25159J45721_1000466 | JGI25159J45721_10004663 | 132 |
| 148 | 3300003187 | JGI25151J46595_10036444 | JGI25151J46595_100364442 | 132 |
| 149 | 3300003214 | JGI25165J46597_1001123 | JGI25165J46597_10011237 | 132 |
| 150 | 3300003316 | rootH1_10044342 | rootH1_1004434214 | 132 |
| 151 | 3300003316 | rootH1_10130566 | rootH1_101305662 | 132 |
| 152 | 3300003320 | rootH2_10081916 | rootH2_100819163 | 132 |
| 153 | 3300003323 | rootH1_10328791 | rootH1_103287913 | 132 |
| 154 | 3300003354 | JGI25160J50197_1000005 | JGI25160J50197_100000554 | 132 |
| 155 | 3300003374 | JGI25161J50226_1000349 | JGI25161J50226_100034921 | 132 |
| 156 | 3300003578 | Ga0006562J51391_1008015 | Ga0006562J51391_10080153 | 132 |
| 157 | 3300003771 | Ga0055526_1002592 | Ga0055526_10025923 | 132 |
| 158 | 3300003775 | Ga0055524_1033754 | Ga0055524_10337541 | 132 |
| 159 | 3300003781 | Ga0055536_1004642 | Ga0055536_10046425 | 132 |
| 160 | 3300003781 | Ga0055536_1016156 | Ga0055536_10161564 | 132 |
| 161 | 3300003781 | Ga0055536_1016300 | Ga0055536_10163003 | 132 |
| 162 | 3300003791 | Ga0055530_10008853 | Ga0055530_100088535 | 132 |
| 163 | 3300003791 | Ga0055530_10012947 | Ga0055530_100129473 | 132 |
| 164 | 3300003791 | Ga0055530_10032239 | Ga0055530_100322392 | 132 |
| 165 | 3300003792 | Ga0055540_1012563 | Ga0055540_10125631 | 132 |
| 166 | 3300003792 | Ga0055540_1068700 | Ga0055540_10687001 | 132 |
| 167 | 3300003794 | Ga0055531_10001364 | Ga0055531_1000136420 | 132 |
| 168 | 3300003794 | Ga0055531_10004249 | Ga0055531_1000424910 | 132 |
| 169 | 3300003794 | Ga0055531_10073595 | Ga0055531_100735952 | 132 |
| 170 | 3300003856 | Ga0058692_1015795 | Ga0058692_10157952 | 132 |
| 171 | 3300003856 | Ga0058692_1018212 | Ga0058692_10182124 | 132 |
| 172 | 3300004625 | Ga0055543_1000324 | Ga0055543_100032434 | 132 |
| 173 | 3300005262 | Ga0065165_1000002 | Ga0065165_1000002336 | 132 |
| 174 | 3300005262 | Ga0065165_1000264 | Ga0065165_100026449 | 132 |
| 175 | 3300005288 | Ga0065714_10009236 | Ga0065714_100092363 | 132 |
| 176 | 3300005288 | Ga0065714_10020005 | Ga0065714_100200052 | 132 |
| 177 | 3300005288 | Ga0065714_10112802 | Ga0065714_101128022 | 132 |
| 178 | 3300005288 | Ga0065714_10233113 | Ga0065714_102331132 | 132 |
| 179 | 3300005288 | Ga0065714_10308760 | Ga0065714_103087602 | 132 |
| 180 | 3300005288 | Ga0065714_10316355 | Ga0065714_103163552 | 132 |
| 181 | 3300005289 | Ga0065704_10085495 | Ga0065704_100854953 | 132 |
| 182 | 3300005289 | Ga0065704_10098219 | Ga0065704_100982193 | 132 |
| 183 | 3300005289 | Ga0065704_10148567 | Ga0065704_101485672 | 132 |
| 184 | 3300005289 | Ga0065704_10357297 | Ga0065704_103572972 | 132 |
| 185 | 3300005290 | Ga0065712_10079004 | Ga0065712_100790044 | 132 |
| 186 | 3300005293 | Ga0065715_10887876 | Ga0065715_108878761 | 132 |
| 187 | 3300005328 | Ga0070676_11025332 | Ga0070676_110253321 | 132 |
| 188 | 3300005339 | Ga0070660_100047978 | Ga0070660_1000479784 | 132 |
| 189 | 3300005339 | Ga0070660_100734940 | Ga0070660_1007349401 | 132 |
| 190 | 3300005353 | Ga0070669_100168990 | Ga0070669_1001689904 | 132 |
| 191 | 3300005355 | Ga0070671_100042696 | Ga0070671_1000426964 | 132 |
| 192 | 3300005364 | Ga0070673_100859380 | Ga0070673_1008593802 | 132 |
| 193 | 3300005366 | Ga0070659_100095774 | Ga0070659_1000957742 | 132 |
| 194 | 3300005367 | Ga0070667_100726123 | Ga0070667_1007261232 | 132 |
| 195 | 3300005434 | Ga0070709_10929164 | Ga0070709_109291642 | 132 |
| 196 | 3300005436 | Ga0070713_101026596 | Ga0070713_1010265961 | 132 |
| 197 | 3300005437 | Ga0070710_11375397 | Ga0070710_113753971 | 132 |
| 198 | 3300005457 | Ga0070662_100203815 | Ga0070662_1002038151 | 132 |
| 199 | 3300005548 | Ga0070665_100293480 | Ga0070665_1002934802 | 132 |
| 200 | 3300005548 | Ga0070665_100473519 | Ga0070665_1004735193 | 132 |
| 201 | 3300005563 | Ga0068855_100788564 | Ga0068855_1007885641 | 132 |
| 202 | 3300005564 | Ga0070664_101156832 | Ga0070664_1011568321 | 132 |
| 203 | 3300005578 | Ga0068854_100649812 | Ga0068854_1006498122 | 132 |
| 204 | 3300005578 | Ga0068854_101751431 | Ga0068854_1017514311 | 132 |
| 205 | 3300005614 | Ga0068856_101674170 | Ga0068856_1016741702 | 132 |
| 206 | 3300005618 | Ga0068864_100000218 | Ga0068864_10000021829 | 132 |
| 207 | 3300005618 | Ga0068864_100211383 | Ga0068864_1002113834 | 132 |
| 208 | 3300005718 | Ga0068866_10484335 | Ga0068866_104843352 | 132 |
| 209 | 3300005719 | Ga0068861_100166465 | Ga0068861_1001664652 | 132 |
| 210 | 3300005834 | Ga0068851_10947323 | Ga0068851_109473232 | 132 |
| 211 | 3300005842 | Ga0068858_100000352 | Ga0068858_10000035243 | 132 |
| 212 | 3300005842 | Ga0068858_100001656 | Ga0068858_10000165614 | 132 |
| 213 | 3300005844 | Ga0068862_101091742 | Ga0068862_1010917422 | 132 |
| 214 | 3300005937 | Ga0081455_10404061 | Ga0081455_104040612 | 132 |
| 215 | 3300006038 | Ga0075365_10011682 | Ga0075365_100116824 | 132 |
| 216 | 3300006038 | Ga0075365_10017919 | Ga0075365_100179197 | 132 |
| 217 | 3300006038 | Ga0075365_10831908 | Ga0075365_108319081 | 132 |
| 218 | 3300006051 | Ga0075364_10010433 | Ga0075364_100104332 | 132 |
| 219 | 3300006051 | Ga0075364_10104148 | Ga0075364_101041482 | 132 |
| 220 | 3300006051 | Ga0075364_10110610 | Ga0075364_101106102 | 132 |
| 221 | 3300006058 | Ga0075432_10055925 | Ga0075432_100559253 | 132 |
| 222 | 3300006058 | Ga0075432_10096218 | Ga0075432_100962183 | 132 |
| 223 | 3300006058 | Ga0075432_10113606 | Ga0075432_101136062 | 132 |
| 224 | 3300006058 | Ga0075432_10278232 | Ga0075432_102782321 | 132 |
| 225 | 3300006058 | Ga0075432_10602777 | Ga0075432_106027771 | 132 |
| 226 | 3300006177 | Ga0075362_10056386 | Ga0075362_100563862 | 132 |
| 227 | 3300006177 | Ga0075362_10444025 | Ga0075362_104440251 | 132 |
| 228 | 3300006186 | Ga0075369_10004738 | Ga0075369_100047385 | 132 |
| 229 | 3300006186 | Ga0075369_10143099 | Ga0075369_101430993 | 132 |
| 230 | 3300006237 | Ga0097621_100903195 | Ga0097621_1009031952 | 132 |
| 231 | 3300006353 | Ga0075370_10065222 | Ga0075370_100652222 | 132 |
| 232 | 3300006358 | Ga0068871_100789896 | Ga0068871_1007898962 | 132 |
| 233 | 3300006846 | Ga0075430_100468458 | Ga0075430_1004684583 | 132 |
| 234 | 3300006914 | Ga0075436_100110011 | Ga0075436_1001100112 | 132 |
| 235 | 3300006914 | Ga0075436_100343702 | Ga0075436_1003437022 | 132 |
| 236 | 3300006946 | Ga0079104_1000104 | Ga0079104_10001047 | 132 |
| 237 | 3300006946 | Ga0079104_1001328 | Ga0079104_100132813 | 132 |
| 238 | 3300006946 | Ga0079104_1073514 | Ga0079104_10735142 | 132 |
| 239 | 3300006948 | Ga0099826_10004152 | Ga0099826_100041523 | 132 |
| 240 | 3300009011 | Ga0105251_10000466 | Ga0105251_1000046636 | 132 |
| 241 | 3300009011 | Ga0105251_10034510 | Ga0105251_100345102 | 132 |
| 242 | 3300009011 | Ga0105251_10157004 | Ga0105251_101570041 | 132 |
| 243 | 3300009011 | Ga0105251_10372385 | Ga0105251_103723851 | 132 |
| 244 | 3300009011 | Ga0105251_10519238 | Ga0105251_105192382 | 132 |
| 245 | 3300009036 | Ga0105244_10027860 | Ga0105244_100278602 | 132 |
| 246 | 3300009036 | Ga0105244_10028008 | Ga0105244_100280082 | 132 |
| 247 | 3300009036 | Ga0105244_10147147 | Ga0105244_101471473 | 132 |
| 248 | 3300009036 | Ga0105244_10156728 | Ga0105244_101567282 | 132 |
| 249 | 3300009036 | Ga0105244_10170343 | Ga0105244_101703432 | 132 |
| 250 | 3300009036 | Ga0105244_10180080 | Ga0105244_101800802 | 132 |
| 251 | 3300009092 | Ga0105250_10034265 | Ga0105250_100342652 | 132 |
| 252 | 3300009092 | Ga0105250_10035115 | Ga0105250_100351154 | 132 |
| 253 | 3300009092 | Ga0105250_10060380 | Ga0105250_100603801 | 132 |
| 254 | 3300009092 | Ga0105250_10132132 | Ga0105250_101321322 | 132 |
| 255 | 3300009092 | Ga0105250_10210668 | Ga0105250_102106682 | 132 |
| 256 | 3300009092 | Ga0105250_10227803 | Ga0105250_102278032 | 132 |
| 257 | 3300009092 | Ga0105250_10303352 | Ga0105250_103033522 | 132 |
| 258 | 3300009098 | Ga0105245_10001436 | Ga0105245_100014367 | 132 |
| 259 | 3300009148 | Ga0105243_10049280 | Ga0105243_100492804 | 132 |
| 260 | 3300009148 | Ga0105243_10096200 | Ga0105243_100962004 | 132 |
| 261 | 3300009148 | Ga0105243_10736276 | Ga0105243_107362762 | 132 |
| 262 | 3300009176 | Ga0105242_11572672 | Ga0105242_115726722 | 132 |
| 263 | 3300009177 | Ga0105248_10007725 | Ga0105248_1000772515 | 132 |
| 264 | 3300009551 | Ga0105238_11554376 | Ga0105238_115543762 | 132 |
| 265 | 3300009553 | Ga0105249_10157648 | Ga0105249_101576483 | 132 |
| 266 | 3300012498 | Ga0157345_1000879 | Ga0157345_10008794 | 132 |
| 267 | 3300013100 | Ga0157373_10000160 | Ga0157373_100001608 | 132 |
| 268 | 3300013100 | Ga0157373_10009880 | Ga0157373_100098803 | 132 |
| 269 | 3300013100 | Ga0157373_10875215 | Ga0157373_108752152 | 132 |
| 270 | 3300013100 | Ga0157373_11159517 | Ga0157373_111595171 | 132 |
| 271 | 3300013102 | Ga0157371_10071919 | Ga0157371_100719192 | 132 |
| 272 | 3300013102 | Ga0157371_10175867 | Ga0157371_101758673 | 132 |
| 273 | 3300013102 | Ga0157371_10257754 | Ga0157371_102577542 | 132 |
| 274 | 3300013104 | Ga0157370_10086690 | Ga0157370_100866902 | 132 |
| 275 | 3300013104 | Ga0157370_10386681 | Ga0157370_103866813 | 132 |
| 276 | 3300013104 | Ga0157370_10630297 | Ga0157370_106302972 | 132 |
| 277 | 3300013105 | Ga0157369_10039023 | Ga0157369_100390233 | 132 |
| 278 | 3300013297 | Ga0157378_10059990 | Ga0157378_100599904 | 132 |
| 279 | 3300013306 | Ga0163162_10015191 | Ga0163162_100151913 | 132 |
| 280 | 3300013306 | Ga0163162_10156336 | Ga0163162_101563363 | 132 |
| 281 | 3300013306 | Ga0163162_10183183 | Ga0163162_101831834 | 132 |
| 282 | 3300013306 | Ga0163162_10299871 | Ga0163162_102998714 | 132 |
| 283 | 3300013306 | Ga0163162_10386341 | Ga0163162_103863412 | 132 |
| 284 | 3300013308 | Ga0157375_10175495 | Ga0157375_101754953 | 132 |
| 285 | 3300013308 | Ga0157375_11178675 | Ga0157375_111786752 | 132 |
| 286 | 3300013308 | Ga0157375_11300329 | Ga0157375_113003292 | 132 |
| 287 | 3300013308 | Ga0157375_12375899 | Ga0157375_123758992 | 132 |
| 288 | 3300014497 | Ga0182008_10007709 | Ga0182008_100077097 | 132 |
| 289 | 3300014497 | Ga0182008_10013620 | Ga0182008_100136207 | 132 |
| 290 | 3300014497 | Ga0182008_10027370 | Ga0182008_100273702 | 132 |
| 291 | 3300014497 | Ga0182008_10068729 | Ga0182008_100687292 | 132 |
| 292 | 3300014497 | Ga0182008_10117058 | Ga0182008_101170582 | 132 |
| 293 | 3300014497 | Ga0182008_10195381 | Ga0182008_101953811 | 132 |
| 294 | 3300014968 | Ga0157379_10724279 | Ga0157379_107242792 | 132 |
| 295 | 3300014969 | Ga0157376_11382100 | Ga0157376_113821001 | 132 |
| 296 | 3300015261 | Ga0182006_1012939 | Ga0182006_10129394 | 132 |
| 297 | 3300015261 | Ga0182006_1096870 | Ga0182006_10968702 | 132 |
| 298 | 3300015262 | Ga0182007_10003173 | Ga0182007_100031733 | 132 |
| 299 | 3300015262 | Ga0182007_10053020 | Ga0182007_100530203 | 132 |
| 300 | 3300015262 | Ga0182007_10137833 | Ga0182007_101378332 | 132 |
| 301 | 3300015265 | Ga0182005_1046895 | Ga0182005_10468952 | 132 |
| 302 | 3300015265 | Ga0182005_1052573 | Ga0182005_10525731 | 132 |
| 303 | 3300015265 | Ga0182005_1052661 | Ga0182005_10526612 | 132 |
| 304 | 3300015265 | Ga0182005_1120672 | Ga0182005_11206721 | 132 |
| 305 | 3300015265 | Ga0182005_1193945 | Ga0182005_11939451 | 132 |
| 306 | 3300017792 | Ga0163161_10120991 | Ga0163161_101209912 | 132 |
| 307 | 3300017792 | Ga0163161_10161158 | Ga0163161_101611582 | 132 |
| 308 | 3300017792 | Ga0163161_10228308 | Ga0163161_102283082 | 132 |
| 309 | 3300017792 | Ga0163161_10410367 | Ga0163161_104103672 | 132 |
| 310 | 3300017792 | Ga0163161_11295858 | Ga0163161_112958582 | 132 |
| 311 | 3300021361 | Ga0213872_10032524 | Ga0213872_100325243 | 132 |
| 312 | 3300021361 | Ga0213872_10163047 | Ga0213872_101630472 | 132 |
| 313 | 3300021361 | Ga0213872_10317277 | Ga0213872_103172772 | 132 |
| 314 | 3300025207 | Ga0209760_100140 | Ga0209760_10014017 | 132 |
| 315 | 3300025208 | Ga0209436_100162 | Ga0209436_1001628 | 132 |
| 316 | 3300025229 | Ga0209147_103422 | Ga0209147_1034225 | 132 |
| 317 | 3300025231 | Ga0207427_100016 | Ga0207427_10001617 | 132 |
| 318 | 3300025233 | Ga0209437_100011 | Ga0209437_100011206 | 132 |
| 319 | 3300025256 | Ga0209759_1001860 | Ga0209759_10018604 | 132 |
| 320 | 3300025261 | Ga0209233_1000019 | Ga0209233_1000019206 | 132 |
| 321 | 3300025263 | Ga0209565_1010830 | Ga0209565_10108303 | 132 |
| 322 | 3300025284 | Ga0209130_1000010 | Ga0209130_1000010332 | 132 |
| 323 | 3300025292 | Ga0209676_1000308 | Ga0209676_100030854 | 132 |
| 324 | 3300025292 | Ga0209676_1000320 | Ga0209676_100032053 | 132 |
| 325 | 3300025292 | Ga0209676_1004904 | Ga0209676_10049047 | 132 |
| 326 | 3300025292 | Ga0209676_1058390 | Ga0209676_10583902 | 132 |
| 327 | 3300025294 | Ga0209025_1000687 | Ga0209025_100068753 | 132 |
| 328 | 3300025294 | Ga0209025_1012644 | Ga0209025_10126446 | 132 |
| 329 | 3300025295 | Ga0209564_1000025 | Ga0209564_100002513 | 132 |
| 330 | 3300025297 | Ga0209758_1046347 | Ga0209758_10463472 | 132 |
| 331 | 3300025298 | Ga0209050_1000466 | Ga0209050_100046642 | 132 |
| 332 | 3300025298 | Ga0209050_1000911 | Ga0209050_100091117 | 132 |
| 333 | 3300025298 | Ga0209050_1011196 | Ga0209050_10111964 | 132 |
| 334 | 3300025298 | Ga0209050_1016963 | Ga0209050_10169632 | 132 |
| 335 | 3300025299 | Ga0209256_1002250 | Ga0209256_10022502 | 132 |
| 336 | 3300025299 | Ga0209256_1059132 | Ga0209256_10591322 | 132 |
| 337 | 3300025302 | Ga0207426_1000036 | Ga0207426_1000036332 | 132 |
| 338 | 3300025303 | Ga0209051_1001718 | Ga0209051_100171817 | 132 |
| 339 | 3300025303 | Ga0209051_1023299 | Ga0209051_10232993 | 132 |
| 340 | 3300025304 | Ga0209257_1000338 | Ga0209257_100033853 | 132 |
| 341 | 3300025304 | Ga0209257_1005664 | Ga0209257_100566411 | 132 |
| 342 | 3300025304 | Ga0209257_1006123 | Ga0209257_10061239 | 132 |
| 343 | 3300025321 | Ga0207656_10675497 | Ga0207656_106754971 | 132 |
| 344 | 3300025711 | Ga0207696_1000065 | Ga0207696_1000065176 | 132 |
| 345 | 3300025711 | Ga0207696_1024123 | Ga0207696_10241233 | 132 |
| 346 | 3300025711 | Ga0207696_1053180 | Ga0207696_10531802 | 132 |
| 347 | 3300025711 | Ga0207696_1121838 | Ga0207696_11218382 | 132 |
| 348 | 3300025728 | Ga0207655_1001270 | Ga0207655_100127022 | 132 |
| 349 | 3300025728 | Ga0207655_1053490 | Ga0207655_10534903 | 132 |
| 350 | 3300025728 | Ga0207655_1058326 | Ga0207655_10583263 | 132 |
| 351 | 3300025735 | Ga0207713_1000269 | Ga0207713_100026922 | 132 |
| 352 | 3300025735 | Ga0207713_1031081 | Ga0207713_10310814 | 132 |
| 353 | 3300025735 | Ga0207713_1059262 | Ga0207713_10592622 | 132 |
| 354 | 3300025735 | Ga0207713_1096087 | Ga0207713_10960871 | 132 |
| 355 | 3300025914 | Ga0207671_10031074 | Ga0207671_100310745 | 132 |
| 356 | 3300025915 | Ga0207693_10152945 | Ga0207693_101529452 | 132 |
| 357 | 3300025919 | Ga0207657_10237338 | Ga0207657_102373383 | 132 |
| 358 | 3300025923 | Ga0207681_10129611 | Ga0207681_101296114 | 132 |
| 359 | 3300025927 | Ga0207687_10006357 | Ga0207687_100063575 | 132 |
| 360 | 3300025931 | Ga0207644_11244799 | Ga0207644_112447991 | 132 |
| 361 | 3300025932 | Ga0207690_10184943 | Ga0207690_101849433 | 132 |
| 362 | 3300025933 | Ga0207706_10113871 | Ga0207706_101138712 | 132 |
| 363 | 3300025935 | Ga0207709_10138897 | Ga0207709_101388971 | 132 |
| 364 | 3300025935 | Ga0207709_11136771 | Ga0207709_111367711 | 132 |
| 365 | 3300025941 | Ga0207711_10012751 | Ga0207711_100127516 | 132 |
| 366 | 3300025945 | Ga0207679_11101425 | Ga0207679_111014252 | 132 |
| 367 | 3300025949 | Ga0207667_10164706 | Ga0207667_101647064 | 132 |
| 368 | 3300025960 | Ga0207651_10860459 | Ga0207651_108604592 | 132 |
| 369 | 3300025961 | Ga0207712_10075390 | Ga0207712_100753902 | 132 |
| 370 | 3300025986 | Ga0207658_10662785 | Ga0207658_106627852 | 132 |
| 371 | 3300026035 | Ga0207703_10001551 | Ga0207703_100015519 | 132 |
| 372 | 3300026035 | Ga0207703_10001574 | Ga0207703_1000157413 | 132 |
| 373 | 3300026035 | Ga0207703_10727604 | Ga0207703_107276042 | 132 |
| 374 | 3300026095 | Ga0207676_10000169 | Ga0207676_1000016929 | 132 |
| 375 | 3300026095 | Ga0207676_10016717 | Ga0207676_100167176 | 132 |
| 376 | 3300026118 | Ga0207675_100088146 | Ga0207675_1000881462 | 132 |
| 377 | 3300026121 | Ga0207683_10150499 | Ga0207683_101504992 | 132 |
| 378 | 3300027111 | Ga0209281_1000026 | Ga0209281_1000026167 | 132 |
| 379 | 3300027111 | Ga0209281_1000717 | Ga0209281_10007179 | 132 |
| 380 | 3300027111 | Ga0209281_1004352 | Ga0209281_10043527 | 132 |
| 381 | 3300027312 | Ga0209371_1015214 | Ga0209371_10152142 | 132 |
| 382 | 3300027666 | Ga0209282_1008607 | Ga0209282_10086074 | 132 |
| 383 | 3300027907 | Ga0207428_10049800 | Ga0207428_100498004 | 132 |
| 384 | 3300027907 | Ga0207428_10092593 | Ga0207428_100925933 | 132 |
| 385 | 3300027907 | Ga0207428_10231474 | Ga0207428_102314742 | 132 |
| 386 | 3300027907 | Ga0207428_10506715 | Ga0207428_105067152 | 132 |
| 387 | 3300028379 | Ga0268266_10204833 | Ga0268266_102048332 | 132 |
| 388 | 3300028379 | Ga0268266_10723832 | Ga0268266_107238323 | 132 |
| 389 | 3300028786 | Ga0307517_10281107 | Ga0307517_102811072 | 132 |
| 390 | 3300028794 | Ga0307515_10024017 | Ga0307515_100240179 | 132 |
| 391 | 3300030731 | Ga0316177_1190406 | Ga0316177_11904065 | 132 |
| 392 | 3300030734 | Ga0316179_1092971 | Ga0316179_10929713 | 132 |
| 393 | 3300030735 | Ga0316178_1122809 | Ga0316178_11228095 | 132 |
| 394 | 3300030742 | Ga0316183_1049590 | Ga0316183_10495902 | 132 |
| 395 | 3300030744 | Ga0316181_1086264 | Ga0316181_10862642 | 132 |
| 396 | 3300031238 | Ga0265332_10053652 | Ga0265332_100536523 | 132 |
| 397 | 3300031240 | Ga0265320_10003123 | Ga0265320_100031239 | 132 |
| 398 | 3300031456 | Ga0307513_10906385 | Ga0307513_109063851 | 132 |
| 399 | 3300031548 | Ga0307408_100191072 | Ga0307408_1001910721 | 132 |
| 400 | 3300031548 | Ga0307408_100231849 | Ga0307408_1002318492 | 132 |
| 401 | 3300031548 | Ga0307408_100233888 | Ga0307408_1002338883 | 132 |
| 402 | 3300031595 | Ga0265313_10024553 | Ga0265313_100245534 | 132 |
| 403 | 3300031616 | Ga0307508_10019520 | Ga0307508_100195205 | 132 |
| 404 | 3300031711 | Ga0265314_10016259 | Ga0265314_100162596 | 132 |
| 405 | 3300031731 | Ga0307405_10018767 | Ga0307405_100187674 | 132 |
| 406 | 3300031731 | Ga0307405_10613597 | Ga0307405_106135972 | 132 |
| 407 | 3300031731 | Ga0307405_10816243 | Ga0307405_108162431 | 132 |
| 408 | 3300031731 | Ga0307405_11148512 | Ga0307405_111485121 | 132 |
| 409 | 3300031824 | Ga0307413_10038575 | Ga0307413_100385756 | 132 |
| 410 | 3300031852 | Ga0307410_10427034 | Ga0307410_104270342 | 132 |
| 411 | 3300031901 | Ga0307406_10149843 | Ga0307406_101498432 | 132 |
| 412 | 3300031901 | Ga0307406_10940704 | Ga0307406_109407042 | 132 |
| 413 | 3300031903 | Ga0307407_10559516 | Ga0307407_105595161 | 132 |
| 414 | 3300031903 | Ga0307407_10587893 | Ga0307407_105878932 | 132 |
| 415 | 3300031903 | Ga0307407_11380459 | Ga0307407_113804591 | 132 |
| 416 | 3300031911 | Ga0307412_10005974 | Ga0307412_100059748 | 132 |
| 417 | 3300031911 | Ga0307412_10130162 | Ga0307412_101301622 | 132 |
| 418 | 3300031911 | Ga0307412_10756137 | Ga0307412_107561372 | 132 |
| 419 | 3300031995 | Ga0307409_101213218 | Ga0307409_1012132182 | 132 |
| 420 | 3300031995 | Ga0307409_101524136 | Ga0307409_1015241362 | 132 |
| 421 | 3300032002 | Ga0307416_100138423 | Ga0307416_1001384232 | 132 |
| 422 | 3300032002 | Ga0307416_100347869 | Ga0307416_1003478693 | 132 |
| 423 | 3300032002 | Ga0307416_101227973 | Ga0307416_1012279733 | 132 |
| 424 | 3300032004 | Ga0307414_10011896 | Ga0307414_100118967 | 132 |
| 425 | 3300032004 | Ga0307414_10084898 | Ga0307414_100848984 | 132 |
| 426 | 3300032004 | Ga0307414_10161278 | Ga0307414_101612784 | 132 |
| 427 | 3300032004 | Ga0307414_10163398 | Ga0307414_101633984 | 132 |
| 428 | 3300032004 | Ga0307414_10402729 | Ga0307414_104027293 | 132 |
| 429 | 3300032004 | Ga0307414_10701448 | Ga0307414_107014482 | 132 |
| 430 | 3300032004 | Ga0307414_11078803 | Ga0307414_110788032 | 132 |
| 431 | 3300032005 | Ga0307411_10116667 | Ga0307411_101166673 | 132 |
| 432 | 3300032005 | Ga0307411_11153981 | Ga0307411_111539812 | 132 |
| 433 | 3300032126 | Ga0307415_100927767 | Ga0307415_1009277672 | 132 |
| 434 | 3300032126 | Ga0307415_100968663 | Ga0307415_1009686632 | 132 |
| 435 | 3300035398 | Ga0316574_0171125 | Ga0316574_0171125_946_1347 | 132 |
| 436 | 3300035724 | Ga0373933_0456734 | Ga0373933_0456734_246_647 | 132 |
| 437 | 3300037312 | Ga0395899_0001089 | Ga0395899_0001089_22257_22664 | 132 |
| 438 | 3300037312 | Ga0395899_0335206 | Ga0395899_0335206_147_557 | 132 |
| 439 | 3300037418 | Ga0395900_0000108 | Ga0395900_0000108_144518_144925 | 132 |
| 440 | 3300037418 | Ga0395900_0007617 | Ga0395900_0007617_8989_9399 | 132 |
| 441 | 3300037418 | Ga0395900_0222737 | Ga0395900_0222737_882_1292 | 132 |
| 442 | 3300037418 | Ga0395900_0670367 | Ga0395900_0670367_376_786 | 132 |
| 443 | 3300037466 | Ga0395898_0009141 | Ga0395898_0009141_9877_10287 | 132 |
| 444 | 3300037466 | Ga0395898_0060019 | Ga0395898_0060019_1717_2124 | 132 |
| 445 | 3300037466 | Ga0395898_0185182 | Ga0395898_0185182_914_1324 | 132 |
| 446 | 3300037471 | Ga0395905_0026339 | Ga0395905_0026339_2946_3353 | 132 |
| 447 | 3300037471 | Ga0395905_1411360 | Ga0395905_1411360_126_533 | 132 |
| 448 | 3300037471 | Ga0395905_1701214 | Ga0395905_1701214_40_447 | 132 |
| 449 | 3300037853 | Ga0436364_0051522 | Ga0436364_0051522_1660_2070 | 132 |
| 450 | 3300037853 | Ga0436364_0061348 | Ga0436364_0061348_593_1009 | 132 |
| 451 | 3300038443 | Ga0395901_0000023 | Ga0395901_0000023_90954_91364 | 132 |
| 452 | 3300038443 | Ga0395901_0000050 | Ga0395901_0000050_165375_165782 | 132 |
| 453 | 3300038443 | Ga0395901_0000183 | Ga0395901_0000183_79079_79489 | 132 |
| 454 | 3300038443 | Ga0395901_0003967 | Ga0395901_0003967_633_1043 | 132 |
| 455 | 3300038443 | Ga0395901_0237761 | Ga0395901_0237761_1200_1610 | 132 |
| 456 | 3300038443 | Ga0395901_0473364 | Ga0395901_0473364_451_861 | 132 |
| 457 | 3300039447 | Ga0436361_0513574 | Ga0436361_0513574_93_491 | 132 |
| 458 | 3300039447 | Ga0436361_0576973 | Ga0436361_0576973_2491_2898 | 132 |
| 459 | 3300039447 | Ga0436361_0821550 | Ga0436361_0821550_596_1003 | 132 |
| 460 | 3300039447 | Ga0436361_1103751 | Ga0436361_1103751_365_766 | 132 |
| 461 | 3300039450 | Ga0436363_0741000 | Ga0436363_0741000_843_1259 | 132 |
| 462 | 3300039453 | Ga0436362_0250573 | Ga0436362_0250573_426_842 | 132 |
| 463 | 3300041405 | Ga0439438_000385 | Ga0439438_000385_13552_13965 | 132 |
| 464 | 3300041405 | Ga0439438_001237 | Ga0439438_001237_9867_10265 | 132 |
| 465 | 3300041405 | Ga0439438_002736 | Ga0439438_002736_6273_6689 | 132 |
| 466 | 3300041405 | Ga0439438_009887 | Ga0439438_009887_1986_2384 | 132 |
| 467 | 3300041405 | Ga0439438_046412 | Ga0439438_046412_374_781 | 132 |
| 468 | 3300041405 | Ga0439438_064997 | Ga0439438_064997_192_599 | 132 |
| 469 | 3300041407 | Ga0439447_019572 | Ga0439447_019572_607_1023 | 132 |
| 470 | 3300041407 | Ga0439447_032890 | Ga0439447_032890_408_806 | 132 |
| 471 | 3300041407 | Ga0439447_037780 | Ga0439447_037780_60_467 | 132 |
| 472 | 3300041411 | Ga0439466_0003407 | Ga0439466_0003407_402_800 | 132 |
| 473 | 3300041411 | Ga0439466_0004719 | Ga0439466_0004719_4302_4709 | 132 |
| 474 | 3300041411 | Ga0439466_0014078 | Ga0439466_0014078_1757_2155 | 132 |
| 475 | 3300041411 | Ga0439466_0079893 | Ga0439466_0079893_423_830 | 132 |
| 476 | 3300042004 | Ga0439445_0044591 | Ga0439445_0044591_569_985 | 132 |
| 477 | 3300042004 | Ga0439445_0048139 | Ga0439445_0048139_548_946 | 132 |
| 478 | 3300042004 | Ga0439445_0210972 | Ga0439445_0210972_14_427 | 132 |
| 479 | 3300042006 | Ga0439432_000116 | Ga0439432_000116_8081_8479 | 132 |
| 480 | 3300042006 | Ga0439432_002197 | Ga0439432_002197_921_1337 | 132 |
| 481 | 3300042006 | Ga0439432_008638 | Ga0439432_008638_1695_2102 | 132 |
| 482 | 3300042006 | Ga0439432_058708 | Ga0439432_058708_218_625 | 132 |
| 483 | 3300042006 | Ga0439432_061222 | Ga0439432_061222_80_478 | 132 |
| 484 | 3300042006 | Ga0439432_067791 | Ga0439432_067791_682_1080 | 132 |
| 485 | 3300042009 | Ga0439451_000777 | Ga0439451_000777_3699_4106 | 132 |
| 486 | 3300042009 | Ga0439451_001521 | Ga0439451_001521_2532_2939 | 132 |
| 487 | 3300042009 | Ga0439451_005945 | Ga0439451_005945_1051_1449 | 132 |
| 488 | 3300042009 | Ga0439451_032790 | Ga0439451_032790_127_534 | 132 |
| 489 | 3300042010 | Ga0439452_000530 | Ga0439452_000530_18046_18444 | 132 |
| 490 | 3300042010 | Ga0439452_003840 | Ga0439452_003840_28_435 | 132 |
| 491 | 3300042010 | Ga0439452_051112 | Ga0439452_051112_483_899 | 132 |
| 492 | 3300042013 | Ga0439456_003572 | Ga0439456_003572_2073_2480 | 132 |
| 493 | 3300042013 | Ga0439456_008683 | Ga0439456_008683_1574_1972 | 132 |
| 494 | 3300042013 | Ga0439456_008846 | Ga0439456_008846_663_1070 | 132 |
| 495 | 3300042013 | Ga0439456_013705 | Ga0439456_013705_1058_1465 | 132 |
| 496 | 3300042016 | Ga0439463_005539 | Ga0439463_005539_1103_1510 | 132 |
| 497 | 3300042016 | Ga0439463_014377 | Ga0439463_014377_687_1106 | 132 |
| 498 | 3300042016 | Ga0439463_030225 | Ga0439463_030225_205_603 | 132 |
| 499 | 3300042016 | Ga0439463_098875 | Ga0439463_098875_274_681 | 132 |
| 500 | 3300042115 | Ga0450911_000394 | Ga0450911_000394_1994_2392 | 132 |
| 501 | 3300042115 | Ga0450911_008569 | Ga0450911_008569_407_814 | 132 |
| 502 | 3300042115 | Ga0450911_014078 | Ga0450911_014078_291_698 | 132 |
| 503 | 3300042136 | Ga0450900_001734 | Ga0450900_001734_1339_1737 | 132 |
| 504 | 3300042137 | Ga0450902_013760 | Ga0450902_013760_238_636 | 132 |
| 505 | 3300042137 | Ga0450902_015032 | Ga0450902_015032_634_1041 | 132 |
| 506 | 3300042137 | Ga0450902_015424 | Ga0450902_015424_626_1033 | 132 |
| 507 | 3300042138 | Ga0450903_013304 | Ga0450903_013304_454_861 | 132 |
| 508 | 3300042139 | Ga0450904_005957 | Ga0450904_005957_779_1177 | 132 |
| 509 | 3300042142 | Ga0450905_010235 | Ga0450905_010235_231_638 | 132 |
| 510 | 3300042142 | Ga0450905_016590 | Ga0450905_016590_215_622 | 132 |
| 511 | 3300042142 | Ga0450905_023307 | Ga0450905_023307_446_844 | 132 |
| 512 | 3300042145 | Ga0450906_000140 | Ga0450906_000140_1779_2177 | 132 |
| 513 | 3300042146 | Ga0450907_001261 | Ga0450907_001261_2523_2930 | 132 |
| 514 | 3300042146 | Ga0450907_033870 | Ga0450907_033870_37_444 | 132 |
| 515 | 3300042156 | Ga0439446_0001111 | Ga0439446_0001111_832_1239 | 132 |
| 516 | 3300042185 | Ga0450909_001851 | Ga0450909_001851_752_1159 | 132 |
| 517 | 3300042185 | Ga0450909_007526 | Ga0450909_007526_395_811 | 132 |
| 518 | 3300042435 | Ga0439434_0001029 | Ga0439434_0001029_5203_5610 | 132 |
| 519 | 3300042436 | Ga0439435_0019100 | Ga0439435_0019100_318_725 | 132 |
| 520 | 3300042461 | Ga0439460_0007980 | Ga0439460_0007980_531_938 | 132 |
| 521 | 3300042461 | Ga0439460_0338570 | Ga0439460_0338570_29_436 | 132 |
| 522 | 3300042531 | Ga0450918_013240 | Ga0450918_013240_786_1184 | 132 |
| 523 | 3300042532 | Ga0450893_0028057 | Ga0450893_0028057_481_888 | 132 |
| 524 | 3300042533 | Ga0450901_003932 | Ga0450901_003932_1025_1432 | 132 |
| 525 | 3300042993 | Ga0439440_0003458 | Ga0439440_0003458_531_938 | 132 |
| 526 | 3300044656 | Ga0466969_0045482 | Ga0466969_0045482_1593_2003 | 132 |
| 527 | 3300044656 | Ga0466969_0154463 | Ga0466969_0154463_371_778 | 132 |
| 528 | 3300044683 | Ga0466965_0012519 | Ga0466965_0012519_799_1209 | 132 |
| 529 | 3300044684 | Ga0466966_0028921 | Ga0466966_0028921_3019_3429 | 132 |
| 530 | 3300044693 | Ga0466961_0000467 | Ga0466961_0000467_20778_21206 | 132 |
| 531 | 3300044693 | Ga0466961_0093771 | Ga0466961_0093771_637_1047 | 132 |
| 532 | 3300044693 | Ga0466961_0117619 | Ga0466961_0117619_440_853 | 132 |
| 533 | 3300044694 | Ga0466963_0117680 | Ga0466963_0117680_1348_1776 | 132 |
| 534 | 3300044719 | Ga0466971_0291496 | Ga0466971_0291496_114_524 | 132 |
| 535 | 3300044765 | Ga0466970_0658095 | Ga0466970_0658095_100_501 | 132 |
| 536 | 3300044842 | Ga0466957_0148978 | Ga0466957_0148978_909_1319 | 132 |
| 537 | 3300045049 | Ga0466959_0055078 | Ga0466959_0055078_309_719 | 132 |
| 538 | 3300045049 | Ga0466959_0385630 | Ga0466959_0385630_55_462 | 132 |
| 539 | 3300045836 | Ga0466958_0180722 | Ga0466958_0180722_528_956 | 132 |
| 540 | 3300045976 | Ga0466967_0531768 | Ga0466967_0531768_307_708 | 132 |
| 541 | 3300045976 | Ga0466967_0687015 | Ga0466967_0687015_465_866 | 132 |
| 542 | 3300046452 | Ga0495617_003151 | Ga0495617_003151_1651_2058 | 132 |
| 543 | 3300046452 | Ga0495617_037873 | Ga0495617_037873_593_1000 | 132 |
| 544 | 3300046452 | Ga0495617_129350 | Ga0495617_129350_83_487 | 132 |
| 545 | 3300046453 | Ga0495627_000084 | Ga0495627_000084_27170_27580 | 132 |
| 546 | 3300046453 | Ga0495627_002251 | Ga0495627_002251_8593_9000 | 132 |
| 547 | 3300046455 | Ga0495603_0492377 | Ga0495603_0492377_210_611 | 132 |
| 548 | 3300046457 | Ga0495590_0055542 | Ga0495590_0055542_646_1053 | 132 |
| 549 | 3300046457 | Ga0495590_0206280 | Ga0495590_0206280_73_480 | 132 |
| 550 | 3300046458 | Ga0495591_026286 | Ga0495591_026286_649_1056 | 132 |
| 551 | 3300046458 | Ga0495591_032156 | Ga0495591_032156_752_1159 | 132 |
| 552 | 3300046458 | Ga0495591_037994 | Ga0495591_037994_428_835 | 132 |
| 553 | 3300046460 | Ga0495638_0012479 | Ga0495638_0012479_3965_4372 | 132 |
| 554 | 3300046460 | Ga0495638_0035413 | Ga0495638_0035413_2152_2559 | 132 |
| 555 | 3300046460 | Ga0495638_0143926 | Ga0495638_0143926_527_934 | 132 |
| 556 | 3300046460 | Ga0495638_0221501 | Ga0495638_0221501_38_445 | 132 |
| 557 | 3300046460 | Ga0495638_0226256 | Ga0495638_0226256_259_666 | 132 |
| 558 | 3300046460 | Ga0495638_0330955 | Ga0495638_0330955_251_658 | 132 |
| 559 | 3300046463 | Ga0495653_0000002 | Ga0495653_0000002_256197_256598 | 132 |
| 560 | 3300046471 | Ga0495650_0001827 | Ga0495650_0001827_17165_17572 | 132 |
| 561 | 3300046471 | Ga0495650_0045347 | Ga0495650_0045347_826_1233 | 132 |
| 562 | 3300046471 | Ga0495650_0048377 | Ga0495650_0048377_920_1327 | 132 |
| 563 | 3300046471 | Ga0495650_0194304 | Ga0495650_0194304_101_508 | 132 |
| 564 | 3300046474 | Ga0495605_0012973 | Ga0495605_0012973_3267_3674 | 132 |
| 565 | 3300046474 | Ga0495605_0068505 | Ga0495605_0068505_1168_1575 | 132 |
| 566 | 3300046491 | Ga0495584_0001126 | Ga0495584_0001126_14249_14656 | 132 |
| 567 | 3300046491 | Ga0495584_0007670 | Ga0495584_0007670_4296_4703 | 132 |
| 568 | 3300046491 | Ga0495584_0011807 | Ga0495584_0011807_2747_3157 | 132 |
| 569 | 3300046491 | Ga0495584_0174600 | Ga0495584_0174600_249_656 | 132 |
| 570 | 3300046491 | Ga0495584_0198640 | Ga0495584_0198640_10_417 | 132 |
| 571 | 3300046491 | Ga0495584_0288602 | Ga0495584_0288602_149_556 | 132 |
| 572 | 3300046492 | Ga0495585_0010752 | Ga0495585_0010752_1335_1736 | 132 |
| 573 | 3300046492 | Ga0495585_0049349 | Ga0495585_0049349_1582_1989 | 132 |
| 574 | 3300046492 | Ga0495585_0184055 | Ga0495585_0184055_367_771 | 132 |
| 575 | 3300046492 | Ga0495585_0231133 | Ga0495585_0231133_418_825 | 132 |
| 576 | 3300046501 | Ga0495607_0006943 | Ga0495607_0006943_5977_6384 | 132 |
| 577 | 3300046501 | Ga0495607_0016609 | Ga0495607_0016609_2601_3008 | 132 |
| 578 | 3300046501 | Ga0495607_0058021 | Ga0495607_0058021_915_1322 | 132 |
| 579 | 3300046501 | Ga0495607_0070545 | Ga0495607_0070545_136_549 | 132 |
| 580 | 3300046501 | Ga0495607_0076441 | Ga0495607_0076441_40_453 | 132 |
| 581 | 3300046501 | Ga0495607_0135233 | Ga0495607_0135233_440_847 | 132 |
| 582 | 3300046501 | Ga0495607_0200079 | Ga0495607_0200079_512_919 | 132 |
| 583 | 3300046506 | Ga0495583_0012627 | Ga0495583_0012627_3296_3703 | 132 |
| 584 | 3300046506 | Ga0495583_0079955 | Ga0495583_0079955_570_977 | 132 |
| 585 | 3300046507 | Ga0495606_0000030 | Ga0495606_0000030_220412_220813 | 132 |
| 586 | 3300046507 | Ga0495606_0044498 | Ga0495606_0044498_2229_2636 | 132 |
| 587 | 3300046507 | Ga0495606_0147132 | Ga0495606_0147132_551_958 | 132 |
| 588 | 3300046507 | Ga0495606_0263774 | Ga0495606_0263774_207_620 | 132 |
| 589 | 3300046512 | Ga0495610_0046596 | Ga0495610_0046596_716_1123 | 132 |
| 590 | 3300046512 | Ga0495610_0057847 | Ga0495610_0057847_379_786 | 132 |
| 591 | 3300046512 | Ga0495610_0140347 | Ga0495610_0140347_229_630 | 132 |
| 592 | 3300046512 | Ga0495610_0180453 | Ga0495610_0180453_85_492 | 132 |
| 593 | 3300046512 | Ga0495610_0183170 | Ga0495610_0183170_24_431 | 132 |
| 594 | 3300046513 | Ga0495616_0047259 | Ga0495616_0047259_847_1254 | 132 |
| 595 | 3300046513 | Ga0495616_0075085 | Ga0495616_0075085_587_994 | 132 |
| 596 | 3300046515 | Ga0495620_0011042 | Ga0495620_0011042_148_555 | 132 |
| 597 | 3300046515 | Ga0495620_0037582 | Ga0495620_0037582_442_849 | 132 |
| 598 | 3300046517 | Ga0495630_0307968 | Ga0495630_0307968_145_552 | 132 |
| 599 | 3300046518 | Ga0495631_0219270 | Ga0495631_0219270_217_618 | 132 |
| 600 | 3300046518 | Ga0495631_0349253 | Ga0495631_0349253_134_544 | 132 |
| 601 | 3300046519 | Ga0495632_0000049 | Ga0495632_0000049_54267_54677 | 132 |
| 602 | 3300046519 | Ga0495632_0001609 | Ga0495632_0001609_14972_15379 | 132 |
| 603 | 3300046519 | Ga0495632_0003183 | Ga0495632_0003183_7897_8298 | 132 |
| 604 | 3300046519 | Ga0495632_0008656 | Ga0495632_0008656_4758_5165 | 132 |
| 605 | 3300046519 | Ga0495632_0021306 | Ga0495632_0021306_572_979 | 132 |
| 606 | 3300046519 | Ga0495632_0057376 | Ga0495632_0057376_1137_1544 | 132 |
| 607 | 3300046519 | Ga0495632_0096956 | Ga0495632_0096956_269_682 | 132 |
| 608 | 3300046519 | Ga0495632_0273459 | Ga0495632_0273459_137_544 | 132 |
| 609 | 3300046519 | Ga0495632_0318396 | Ga0495632_0318396_48_455 | 132 |
| 610 | 3300046520 | Ga0495637_0003277 | Ga0495637_0003277_6103_6510 | 132 |
| 611 | 3300046520 | Ga0495637_0004271 | Ga0495637_0004271_3746_4156 | 132 |
| 612 | 3300046520 | Ga0495637_0005172 | Ga0495637_0005172_698_1105 | 132 |
| 613 | 3300046520 | Ga0495637_0022273 | Ga0495637_0022273_102_509 | 132 |
| 614 | 3300046520 | Ga0495637_0056987 | Ga0495637_0056987_818_1225 | 132 |
| 615 | 3300046520 | Ga0495637_0075001 | Ga0495637_0075001_503_910 | 132 |
| 616 | 3300046520 | Ga0495637_0099281 | Ga0495637_0099281_345_752 | 132 |
| 617 | 3300046520 | Ga0495637_0110098 | Ga0495637_0110098_156_560 | 132 |
| 618 | 3300046522 | Ga0495643_0000047 | Ga0495643_0000047_32539_32949 | 132 |
| 619 | 3300046522 | Ga0495643_0020755 | Ga0495643_0020755_2601_3008 | 132 |
| 620 | 3300046522 | Ga0495643_0103929 | Ga0495643_0103929_530_937 | 132 |
| 621 | 3300046522 | Ga0495643_0114878 | Ga0495643_0114878_525_929 | 132 |
| 622 | 3300046522 | Ga0495643_0131869 | Ga0495643_0131869_610_1017 | 132 |
| 623 | 3300046522 | Ga0495643_0263596 | Ga0495643_0263596_220_621 | 132 |
| 624 | 3300046522 | Ga0495643_0329233 | Ga0495643_0329233_273_671 | 132 |
| 625 | 3300046522 | Ga0495643_0383264 | Ga0495643_0383264_13_420 | 132 |
| 626 | 3300046523 | Ga0495644_0001046 | Ga0495644_0001046_10278_10685 | 132 |
| 627 | 3300046524 | Ga0495648_0003342 | Ga0495648_0003342_4398_4808 | 132 |
| 628 | 3300046524 | Ga0495648_0035719 | Ga0495648_0035719_2451_2858 | 132 |
| 629 | 3300046524 | Ga0495648_0160862 | Ga0495648_0160862_364_765 | 132 |
| 630 | 3300046524 | Ga0495648_0229872 | Ga0495648_0229872_462_869 | 132 |
| 631 | 3300046524 | Ga0495648_0241593 | Ga0495648_0241593_42_452 | 132 |
| 632 | 3300046525 | Ga0495663_0000009 | Ga0495663_0000009_109907_110317 | 132 |
| 633 | 3300046528 | Ga0495642_0001171 | Ga0495642_0001171_3001_3408 | 132 |
| 634 | 3300046530 | Ga0495654_0026985 | Ga0495654_0026985_1688_2095 | 132 |
| 635 | 3300046530 | Ga0495654_0044804 | Ga0495654_0044804_915_1322 | 132 |
| 636 | 3300046530 | Ga0495654_0088465 | Ga0495654_0088465_610_1017 | 132 |
| 637 | 3300046530 | Ga0495654_0103363 | Ga0495654_0103363_387_794 | 132 |
| 638 | 3300046530 | Ga0495654_0201057 | Ga0495654_0201057_195_602 | 132 |
| 639 | 3300046538 | Ga0495609_0029481 | Ga0495609_0029481_598_1005 | 132 |
| 640 | 3300046542 | Ga0495597_0005474 | Ga0495597_0005474_1301_1708 | 132 |
| 641 | 3300046542 | Ga0495597_0019740 | Ga0495597_0019740_2041_2448 | 132 |
| 642 | 3300046542 | Ga0495597_0044582 | Ga0495597_0044582_806_1213 | 132 |
| 643 | 3300046542 | Ga0495597_0052307 | Ga0495597_0052307_1378_1785 | 132 |
| 644 | 3300046557 | Ga0495622_0141025 | Ga0495622_0141025_675_1082 | 132 |
| 645 | 3300046558 | Ga0495633_0000402 | Ga0495633_0000402_44270_44680 | 132 |
| 646 | 3300046558 | Ga0495633_0000434 | Ga0495633_0000434_18090_18500 | 132 |
| 647 | 3300046558 | Ga0495633_0004035 | Ga0495633_0004035_1516_1923 | 132 |
| 648 | 3300046558 | Ga0495633_0004360 | Ga0495633_0004360_3394_3795 | 132 |
| 649 | 3300046615 | Ga0495656_0194998 | Ga0495656_0194998_490_897 | 132 |
| 650 | 3300046616 | Ga0495668_0042326 | Ga0495668_0042326_649_1056 | 132 |
| 651 | 3300046648 | Ga0495611_0041298 | Ga0495611_0041298_916_1323 | 132 |
| 652 | 3300046648 | Ga0495611_0423089 | Ga0495611_0423089_139_546 | 132 |
| 653 | 3300046660 | Ga0495625_0108601 | Ga0495625_0108601_697_1104 | 132 |
| 654 | 3300046660 | Ga0495625_0133767 | Ga0495625_0133767_18_431 | 132 |
| 655 | 3300046660 | Ga0495625_0159878 | Ga0495625_0159878_187_588 | 132 |
| 656 | 3300046660 | Ga0495625_0194017 | Ga0495625_0194017_780_1181 | 132 |
| 657 | 3300046664 | Ga0495659_0001130 | Ga0495659_0001130_5029_5460 | 132 |
| 658 | 3300046664 | Ga0495659_0001680 | Ga0495659_0001680_1963_2370 | 132 |
| 659 | 3300046664 | Ga0495659_0056101 | Ga0495659_0056101_182_589 | 132 |
| 660 | 3300046665 | Ga0495661_0010223 | Ga0495661_0010223_1487_1894 | 132 |
| 661 | 3300046665 | Ga0495661_0041195 | Ga0495661_0041195_1682_2089 | 132 |
| 662 | 3300046665 | Ga0495661_0078637 | Ga0495661_0078637_613_1020 | 132 |
| 663 | 3300046665 | Ga0495661_0248906 | Ga0495661_0248906_67_471 | 132 |
| 664 | 3300046684 | Ga0495669_0000275 | Ga0495669_0000275_26228_26635 | 132 |
| 665 | 3300046691 | Ga0495670_0002606 | Ga0495670_0002606_2140_2547 | 132 |
| 666 | 3300046691 | Ga0495670_0024396 | Ga0495670_0024396_2175_2582 | 132 |
| 667 | 3300046691 | Ga0495670_0092817 | Ga0495670_0092817_696_1103 | 132 |
| 668 | 3300046691 | Ga0495670_0295589 | Ga0495670_0295589_386_793 | 132 |
| 669 | 3300046691 | Ga0495670_0785792 | Ga0495670_0785792_51_458 | 132 |
| 670 | 3300046692 | Ga0495671_0000038 | Ga0495671_0000038_140745_141155 | 132 |
| 671 | 3300046692 | Ga0495671_0000260 | Ga0495671_0000260_5038_5469 | 132 |
| 672 | 3300046692 | Ga0495671_0026849 | Ga0495671_0026849_2118_2534 | 132 |
| 673 | 3300046692 | Ga0495671_0075028 | Ga0495671_0075028_656_1063 | 132 |
| 674 | 3300046692 | Ga0495671_0076788 | Ga0495671_0076788_1043_1450 | 132 |
| 675 | 3300046692 | Ga0495671_0079974 | Ga0495671_0079974_90_497 | 132 |
| 676 | 3300046692 | Ga0495671_0195474 | Ga0495671_0195474_15_422 | 132 |
| 677 | 3300046694 | Ga0495649_0023742 | Ga0495649_0023742_1284_1691 | 132 |
| 678 | 3300046694 | Ga0495649_0026244 | Ga0495649_0026244_2509_2916 | 132 |
| 679 | 3300046694 | Ga0495649_0138218 | Ga0495649_0138218_297_704 | 132 |
| 680 | 3300046694 | Ga0495649_0223118 | Ga0495649_0223118_282_689 | 132 |
| 681 | 3300046694 | Ga0495649_0264858 | Ga0495649_0264858_177_584 | 132 |
| 682 | 3300046794 | Ga0495589_0046821 | Ga0495589_0046821_1496_1897 | 132 |
| 683 | 3300046794 | Ga0495589_0076146 | Ga0495589_0076146_32_439 | 132 |
| 684 | 3300046794 | Ga0495589_0197770 | Ga0495589_0197770_411_818 | 132 |
| 685 | 3300046810 | Ga0495660_0000049 | Ga0495660_0000049_74589_74993 | 132 |
| 686 | 3300046810 | Ga0495660_0000715 | Ga0495660_0000715_12111_12524 | 132 |
| 687 | 3300046810 | Ga0495660_0087100 | Ga0495660_0087100_612_1019 | 132 |
| 688 | 3300046810 | Ga0495660_0098444 | Ga0495660_0098444_86_493 | 132 |
| 689 | 3300046810 | Ga0495660_0151269 | Ga0495660_0151269_349_756 | 132 |
| 690 | 3300047318 | Ga0495636_0075725 | Ga0495636_0075725_759_1166 | 132 |
| 691 | 3300047320 | Ga0495672_0000184 | Ga0495672_0000184_23504_23935 | 132 |
| 692 | 3300047320 | Ga0495672_0014058 | Ga0495672_0014058_4492_4899 | 132 |
| 693 | 3300047320 | Ga0495672_0022104 | Ga0495672_0022104_2628_3035 | 132 |
| 694 | 3300047320 | Ga0495672_0033995 | Ga0495672_0033995_369_776 | 132 |
| 695 | 3300047320 | Ga0495672_0118564 | Ga0495672_0118564_583_990 | 132 |
| 696 | 3300047320 | Ga0495672_0119672 | Ga0495672_0119672_607_1014 | 132 |
| 697 | 3300047322 | Ga0495680_0005487 | Ga0495680_0005487_846_1253 | 132 |
| 698 | 3300047323 | Ga0495683_0084569 | Ga0495683_0084569_615_1022 | 132 |
| 699 | 3300047443 | Ga0495687_037674 | Ga0495687_037674_593_1000 | 132 |
| 700 | 3300047443 | Ga0495687_120242 | Ga0495687_120242_424_831 | 132 |
| 701 | 3300047443 | Ga0495687_128256 | Ga0495687_128256_63_470 | 132 |
| 702 | 3300047445 | Ga0495677_0007520 | Ga0495677_0007520_530_937 | 132 |
| 703 | 3300047446 | Ga0495679_004730 | Ga0495679_004730_1580_1987 | 132 |
| 704 | 3300047447 | Ga0495685_001865 | Ga0495685_001865_4341_4748 | 132 |
| 705 | 3300047469 | Ga0495673_0015870 | Ga0495673_0015870_2846_3253 | 132 |
| 706 | 3300047469 | Ga0495673_0061895 | Ga0495673_0061895_750_1157 | 132 |
| 707 | 3300047469 | Ga0495673_0117662 | Ga0495673_0117662_149_556 | 132 |
| 708 | 3300047470 | Ga0495681_0002988 | Ga0495681_0002988_8590_9000 | 132 |
| 709 | 3300047470 | Ga0495681_0040661 | Ga0495681_0040661_248_655 | 132 |
| 710 | 3300047470 | Ga0495681_0041400 | Ga0495681_0041400_955_1362 | 132 |
| 711 | 3300047470 | Ga0495681_0065823 | Ga0495681_0065823_257_664 | 132 |
| 712 | 3300047470 | Ga0495681_0110354 | Ga0495681_0110354_718_1119 | 132 |
| 713 | 3300047472 | Ga0495686_0000624 | Ga0495686_0000624_37872_38279 | 132 |
| 714 | 3300047472 | Ga0495686_0008888 | Ga0495686_0008888_1116_1529 | 132 |
| 715 | 3300047472 | Ga0495686_0094687 | Ga0495686_0094687_1229_1639 | 132 |
| 716 | 3300047472 | Ga0495686_0098273 | Ga0495686_0098273_1117_1518 | 132 |
| 717 | 3300047472 | Ga0495686_0197160 | Ga0495686_0197160_180_587 | 132 |
| 718 | 3300047472 | Ga0495686_0312935 | Ga0495686_0312935_391_798 | 132 |
| 719 | 3300047673 | Ga0495593_0191954 | Ga0495593_0191954_300_707 | 132 |
| 720 | 3300048090 | Ga0495615_0004325 | Ga0495615_0004325_382_783 | 132 |
| 721 | 3300048091 | Ga0495626_0002902 | Ga0495626_0002902_2610_3017 | 132 |
| 722 | 3300048091 | Ga0495626_0010145 | Ga0495626_0010145_2879_3286 | 132 |
| 723 | 3300048091 | Ga0495626_0155775 | Ga0495626_0155775_288_695 | 132 |
| 724 | 3300048091 | Ga0495626_0421924 | Ga0495626_0421924_44_448 | 132 |
| 725 | 3300048904 | Ga0496101_0319322 | Ga0496101_0319322_744_1175 | 132 |
| 726 | 3300048905 | Ga0496102_0114691 | Ga0496102_0114691_401_811 | 132 |
| 727 | 3300048905 | Ga0496102_0174812 | Ga0496102_0174812_442_873 | 132 |
| 728 | 3300048910 | Ga0496107_0165459 | Ga0496107_0165459_212_622 | 132 |
| 729 | 3300048911 | Ga0496108_0065617 | Ga0496108_0065617_2609_3040 | 132 |
| 730 | 3300048912 | Ga0496109_0195701 | Ga0496109_0195701_545_976 | 132 |
| 731 | 3300048913 | Ga0496110_0347135 | Ga0496110_0347135_815_1246 | 132 |
| 732 | 3300048915 | Ga0496112_0130016 | Ga0496112_0130016_951_1382 | 132 |
| 733 | 3300048915 | Ga0496112_0358674 | Ga0496112_0358674_422_829 | 132 |
| 734 | 3300048919 | Ga0496116_0044785 | Ga0496116_0044785_1741_2142 | 132 |
| 735 | 3300048920 | Ga0496117_0020723 | Ga0496117_0020723_3430_3837 | 132 |
| 736 | 3300048920 | Ga0496117_0080759 | Ga0496117_0080759_937_1338 | 132 |
| 737 | 3300048920 | Ga0496117_0089952 | Ga0496117_0089952_389_796 | 132 |
| 738 | 3300048921 | Ga0496118_0002611 | Ga0496118_0002611_8788_9195 | 132 |
| 739 | 3300048921 | Ga0496118_0026316 | Ga0496118_0026316_4209_4616 | 132 |
| 740 | 3300048921 | Ga0496118_0196829 | Ga0496118_0196829_95_499 | 132 |
| 741 | 3300048921 | Ga0496118_0494061 | Ga0496118_0494061_130_531 | 132 |
| 742 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_1015432_1015833 | 132 |
| 743 | 3300048924 | Ga0496121_0245350 | Ga0496121_0245350_448_849 | 132 |
| 744 | 3300048924 | Ga0496121_0276913 | Ga0496121_0276913_682_1086 | 132 |
| 745 | 3300048924 | Ga0496121_0482982 | Ga0496121_0482982_332_739 | 132 |
| 746 | 3300048924 | Ga0496121_0654822 | Ga0496121_0654822_50_451 | 132 |
| 747 | 3300048925 | Ga0496122_0002889 | Ga0496122_0002889_21798_22199 | 132 |
| 748 | 3300048925 | Ga0496122_0049685 | Ga0496122_0049685_2042_2443 | 132 |
| 749 | 3300048926 | Ga0496123_0085631 | Ga0496123_0085631_1333_1734 | 132 |
| 750 | 3300048926 | Ga0496123_0138664 | Ga0496123_0138664_730_1131 | 132 |
| 751 | 3300048927 | Ga0496124_0000672 | Ga0496124_0000672_28211_28615 | 132 |
| 752 | 3300048927 | Ga0496124_0053423 | Ga0496124_0053423_2405_2812 | 132 |
| 753 | 3300048927 | Ga0496124_0077797 | Ga0496124_0077797_118_528 | 132 |
| 754 | 3300048927 | Ga0496124_0128318 | Ga0496124_0128318_599_1000 | 132 |
| 755 | 3300048927 | Ga0496124_0155165 | Ga0496124_0155165_1328_1735 | 132 |
| 756 | 3300048927 | Ga0496124_0310924 | Ga0496124_0310924_364_765 | 132 |
| 757 | 3300048927 | Ga0496124_0382424 | Ga0496124_0382424_239_649 | 132 |
| 758 | 3300048928 | Ga0496125_0001126 | Ga0496125_0001126_1294_1695 | 132 |
| 759 | 3300048928 | Ga0496125_0012345 | Ga0496125_0012345_6657_7064 | 132 |
| 760 | 3300048929 | Ga0496126_0037146 | Ga0496126_0037146_2078_2479 | 132 |
| 761 | 3300048929 | Ga0496126_0397206 | Ga0496126_0397206_543_950 | 132 |
| 762 | 3300049459 | Ga0495678_008089 | Ga0495678_008089_767_1174 | 132 |
| 763 | 3300049459 | Ga0495678_013524 | Ga0495678_013524_818_1225 | 132 |
| 764 | 3300049459 | Ga0495678_050725 | Ga0495678_050725_1034_1435 | 132 |
| 765 | 3300049459 | Ga0495678_076574 | Ga0495678_076574_123_530 | 132 |
| 766 | 3300049459 | Ga0495678_087635 | Ga0495678_087635_577_984 | 132 |
| 767 | 3300049459 | Ga0495678_107749 | Ga0495678_107749_118_519 | 132 |
| 768 | 3300049460 | Ga0495682_0000589 | Ga0495682_0000589_23855_24262 | 132 |
| 769 | 3300049460 | Ga0495682_0048705 | Ga0495682_0048705_360_767 | 132 |
| 770 | 3300049531 | Ga0501315_045870 | Ga0501315_045870_97_513 | 132 |
| 771 | 3300049570 | Ga0501033_0044625 | Ga0501033_0044625_12_413 | 132 |
| 772 | 3300049579 | Ga0501043_0049267 | Ga0501043_0049267_2183_2584 | 132 |
| 773 | 3300049579 | Ga0501043_0078395 | Ga0501043_0078395_679_1080 | 132 |
| 774 | 3300049582 | Ga0501048_1002740 | Ga0501048_1002740_185_586 | 132 |
| 775 | 3300049583 | Ga0501067_0039776 | Ga0501067_0039776_1908_2324 | 132 |
| 776 | 3300049583 | Ga0501067_0110703 | Ga0501067_0110703_942_1343 | 132 |
| 777 | 3300049665 | Ga0501227_023905 | Ga0501227_023905_857_1273 | 132 |
| 778 | 3300049669 | Ga0501235_034249 | Ga0501235_034249_35_433 | 132 |
| 779 | 3300049673 | Ga0501240_004834 | Ga0501240_004834_458_856 | 132 |
| 780 | 3300049682 | Ga0501252_008582 | Ga0501252_008582_471_878 | 132 |
| 781 | 3300049744 | Ga0501083_0088400 | Ga0501083_0088400_1431_1832 | 132 |
| 782 | 3300049758 | Ga0501241_035562 | Ga0501241_035562_109_525 | 132 |
| 783 | 3300049766 | Ga0501269_010422 | Ga0501269_010422_273_689 | 132 |
| 784 | 3300049853 | Ga0501226_006893 | Ga0501226_006893_754_1170 | 132 |
| 785 | 3300050489 | nmdc:mga03683_199085_c1 | nmdc:mga03683_199085_c1_215_616 | 132 |
| 786 | 3300050489 | nmdc:mga03683_273524_c1 | nmdc:mga03683_273524_c1_371_772 | 132 |
| 787 | 3300050489 | nmdc:mga03683_35391_c1 | nmdc:mga03683_35391_c1_84_491 | 132 |
| 788 | 3300050491 | nmdc:mga00v17_108894_c1 | nmdc:mga00v17_108894_c1_866_1273 | 132 |
| 789 | 3300050491 | nmdc:mga00v17_40621_c1 | nmdc:mga00v17_40621_c1_1733_2140 | 132 |
| 790 | 3300050491 | nmdc:mga00v17_9237_c1 | nmdc:mga00v17_9237_c1_210_611 | 132 |
| 791 | 3300050492 | nmdc:mga0yw44_782711_c1 | nmdc:mga0yw44_782711_c1_119_532 | 132 |
| 792 | 3300050492 | nmdc:mga0yw44_96578_c1 | nmdc:mga0yw44_96578_c1_1444_1845 | 132 |
| 793 | 3300050496 | nmdc:mga07m45_74270_c1 | nmdc:mga07m45_74270_c1_1186_1596 | 132 |
| 794 | 3300050509 | nmdc:mga0qj67_1474047_c1 | nmdc:mga0qj67_1474047_c1_94_498 | 132 |
| 795 | 3300050514 | nmdc:mga08x19_171509_c1 | nmdc:mga08x19_171509_c1_64_471 | 132 |
| 796 | 3300050514 | nmdc:mga08x19_615911_c1 | nmdc:mga08x19_615911_c1_103_510 | 132 |
| 797 | 3300050516 | nmdc:mga0sz30_34988_c1 | nmdc:mga0sz30_34988_c1_157_558 | 132 |
| 798 | 3300050516 | nmdc:mga0sz30_49060_c2 | nmdc:mga0sz30_49060_c2_149_556 | 132 |
| 799 | 3300053088 | Ga0500644_0284158 | Ga0500644_0284158_134_535 | 132 |
| 800 | 3300053111 | Ga0500572_206079 | Ga0500572_206079_139_540 | 132 |
| 801 | 3300053125 | Ga0500618_000070 | Ga0500618_000070_46241_46642 | 132 |
| 802 | 3300053125 | Ga0500618_000344 | Ga0500618_000344_30652_31053 | 132 |
| 803 | 3300053136 | Ga0500559_0042345 | Ga0500559_0042345_802_1206 | 132 |
| 804 | 3300053136 | Ga0500559_0100952 | Ga0500559_0100952_190_597 | 132 |
| 805 | 3300053156 | Ga0500622_0402689 | Ga0500622_0402689_62_463 | 132 |
| 806 | 3300053161 | Ga0500634_0021243 | Ga0500634_0021243_2724_3134 | 132 |
| 807 | 3300059508 | Ga0587088_013908 | Ga0587088_013908_796_1197 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tnd-assembly1.cif.gz_G | crystal structure of shigella flexneri vapbc toxin-antitoxin complex | 0.9951 | 1 | 132 |
| 6sd6-assembly1.cif.gz_C | structure of vapbc from shigella sonnei | 0.9899 | 2 | 132 |
| 6ifm-assembly1.cif.gz_C | crystal structure of dna bound vapbc from salmonella typhimurium | 0.9867 | 1 | 132 |
| 6sd6-assembly1.cif.gz_C | structure of vapbc from shigella sonnei | 0.9751 | 2 | 132 |
| 5ecw-assembly1.cif.gz_B | structure of the shigella flexneri vapc mutant d7a | 0.9709 | 1 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ecwB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9709 | 1 | 132 | 3.40.50.1010 |
| 3zvkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9635 | 2 | 132 | 3.40.50.1010 |
| 5ecwB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9632 | 1 | 132 | 3.40.50.1010 |
| 3zvkB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9494 | 2 | 132 | 3.40.50.1010 |
| 6nklA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease | 0.9123 | 2 | 131 | 3.40.50.1010 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0Y3S4-F1-model_v4 | VapC toxin protein | 0.9968 | 1 | 116 |
GO:0004518
GO:0046872 |
| AF-A0A1I4GVS0-F1-model_v4 | tRNA(fMet)-specific endonuclease VapC | 0.9927 | 33 | 129 |
GO:0004519
GO:0046872 |
| AF-A0A7Z8QV22-F1-model_v4 | PIN domain-containing protein | 0.9919 | 33 | 132 |
GO:0004518
GO:0046872 |
| AF-A0A7Y9FNL6-F1-model_v4 | tRNA(fMet)-specific endonuclease VapC (EC 3.1.-.-) | 0.9891 | 40 | 131 |
GO:0004519
GO:0046872 |
| AF-A0A7W6DCM2-F1-model_v4 | Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) | 0.9881 | 21 | 131 |
GO:0000287
GO:0004540 GO:0090729 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar