F481672

General Info

Members Datasets Scaffolds Average Seq Length
807 419 709 134

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100859380|Ga0070673_1008593802
Length 135
Sequence MLKYLLDTNLCIRVLRDRPQGLREKFNAEASSLCISSVVLYELLYRAAKSSRPVENRHAVEAFAAHMEVIDFDADAAAHAGEIRADLERQGTPIGSYNLLIAGHARSRGLIVITGNLGEFRRVDGLRCDDWELPN

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231014 Pseudomonas sp. GM48 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231017 Pseudomonas sp. GM55 Isolate Nodule
10 2511231019 Pseudomonas sp. GM67 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
13 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
14 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
15 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
16 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
17 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
18 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
19 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
20 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
21 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
22 2643221557 Ensifer sp. Root558 Isolate Unclassified
23 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
24 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
25 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
26 2643221607 Rhizobium sp. Root73 Isolate Unclassified
27 2643221618 Ensifer sp. Root231 Isolate Unclassified
28 2643221626 Ensifer sp. Root31 Isolate Unclassified
29 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
30 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
31 2643221655 Ensifer sp. Root1252 Isolate Unclassified
32 2643221659 Ensifer sp. Root127 Isolate Unclassified
33 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
34 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
35 2643221698 Ensifer sp. Root142 Isolate Unclassified
36 2643221712 Ensifer sp. Root258 Isolate Unclassified
37 2643221723 Ensifer sp. Root278 Isolate Unclassified
38 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
39 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
40 2738541280 Massilia sp. GV090 Isolate Unclassified
41 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
42 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
43 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
44 2751185800 Brucella pituitosa AA2 Isolate Unclassified
45 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
46 2765235841 Pseudomonas putida AA7 Isolate Unclassified
47 2773857670 Pseudomonas sp. 478 Isolate Unclassified
48 2784132072 Pseudomonas sp. 460 Isolate Unclassified
49 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
50 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
51 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
52 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
53 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
54 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
55 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
56 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
57 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
58 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
59 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
60 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
61 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
62 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
63 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
64 2844163670 Ensifer sp. 1H6 Isolate Unclassified
65 2849560528 Caulobacter zeae 410 Isolate Unclassified
66 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
67 2851153111 Caulobacter radicis 736 Isolate Unclassified
68 2854911287 Brucella lupini LUP21 Isolate Unclassified
69 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
70 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
71 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
72 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
73 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
74 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
75 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
76 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
77 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
78 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
79 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
80 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
81 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
82 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
83 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
84 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
85 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
86 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
87 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
88 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
89 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
90 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
91 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
92 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
93 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
94 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
95 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
96 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
97 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
98 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
99 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
100 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
101 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
102 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
103 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
104 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
105 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
106 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
107 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
108 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
109 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
112 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
113 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
114 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
115 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
116 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
117 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
118 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
127 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
128 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
129 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
130 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
131 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
132 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
133 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
134 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
135 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
136 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
137 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
138 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
139 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
140 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
141 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
142 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
143 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
144 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
145 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
146 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
147 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
148 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
149 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
150 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
151 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
152 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
159 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
160 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
161 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
162 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
163 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
164 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
165 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
166 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
167 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
193 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
221 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
223 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
228 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
229 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
230 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
231 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
232 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
233 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
234 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
235 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
236 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
237 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
238 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
241 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
242 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
243 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
244 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
245 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
246 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
247 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
248 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
262 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
263 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
264 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
265 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
268 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
269 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
270 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
271 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
272 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
273 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
274 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
275 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
276 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
277 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
278 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
279 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
280 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
281 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
282 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
283 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
284 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
285 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
286 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
287 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
288 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
289 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
294 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
300 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
303 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
306 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
307 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
308 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
318 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
319 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
320 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
321 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
324 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
325 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
328 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
329 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
330 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
331 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
335 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
336 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
337 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
338 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
339 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
340 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
341 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
342 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
343 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
347 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
348 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
349 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
350 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
354 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
355 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
375 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
376 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
381 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
382 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
383 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
384 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
385 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
386 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
389 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
390 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
391 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
392 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
393 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
397 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
398 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
399 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
400 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
401 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
402 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
405 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
406 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
408 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
409 8005258706 Rhizobium sp. R693 Isolate Nodule
410 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
411 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
412 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
413 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
414 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
415 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
416 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
417 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
418 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
419 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.48
Metatranscriptomes 0.37
Isolates 12.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.78
Nodule 2.85
Rhizoplane 2.48
Rhizosphere 71.62
Stem 0
Stem Tuber 0.12
Unclassified 12.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C7519 2010549000 Bacteria 4197
2 MRS2a_Contig_11594 2124908027 Bacteria 815
3 SwRhRL2b_contig_30749 2162886007 Bacteria 1418
4 SwRhRL2b_contig_519226 2162886007 Bacteria 1658
5 JGI25162J39368_1001056 3300002737 Bacteria 16862
6 JGI25158J39367_1002355 3300002739 Bacteria 3092
7 JGI25163J39215_1003290 3300002771 Bacteria 1344
8 JGI25164J39214_1000563 3300002772 Bacteria 16855
9 JGI25159J45721_1000083 3300002987 Bacteria 44911
10 JGI25159J45721_1000466 3300002987 Bacteria 18688
11 JGI25151J46595_10036444 3300003187 Bacteria 1856
12 JGI25165J46597_1001123 3300003214 Bacteria 16862
13 rootH1_10044342 3300003316 Bacteria 20524
14 rootH1_10130566 3300003316 Bacteria 1494
15 rootH2_10081916 3300003320 Bacteria 2517
16 rootH1_10328791 3300003323 Unclassified 1006
17 JGI25160J50197_1000005 3300003354 Bacteria 417280
18 JGI25161J50226_1000349 3300003374 Bacteria 24501
19 Ga0006562J51391_1008015 3300003578 Bacteria 4010
20 Ga0055526_1002592 3300003771 Bacteria 12087
21 Ga0055524_1033754 3300003775 Bacteria 1427
22 Ga0055536_1004642 3300003781 Bacteria 6949
23 Ga0055536_1016156 3300003781 Bacteria 2510
24 Ga0055536_1016300 3300003781 Bacteria 2491
25 Ga0055530_10008853 3300003791 Bacteria 3962
26 Ga0055530_10012947 3300003791 Bacteria 2878
27 Ga0055530_10032239 3300003791 Bacteria 1365
28 Ga0055540_1012563 3300003792 Bacteria 2648
29 Ga0055540_1068700 3300003792 Bacteria 695
30 Ga0055531_10001364 3300003794 Bacteria 18136
31 Ga0055531_10004249 3300003794 Bacteria 8812
32 Ga0055531_10073595 3300003794 Bacteria 778
33 Ga0058692_1015795 3300003856 Bacteria 1692
34 Ga0058692_1018212 3300003856 Bacteria 1523
35 Ga0055543_1000324 3300004625 Bacteria 33093
36 Ga0065165_1000002 3300005262 Bacteria 444192
37 Ga0065165_1000264 3300005262 Bacteria 90435
38 Ga0065714_10009236 3300005288 Bacteria 3678
39 Ga0065714_10020005 3300005288 Bacteria 1716
40 Ga0065714_10112802 3300005288 Bacteria 1450
41 Ga0065714_10233113 3300005288 Bacteria 812
42 Ga0065714_10308760 3300005288 Bacteria 682
43 Ga0065714_10316355 3300005288 Bacteria 674
44 Ga0065704_10085495 3300005289 Bacteria 3216
45 Ga0065704_10098219 3300005289 Bacteria 2361
46 Ga0065704_10148567 3300005289 Bacteria 1448
47 Ga0065704_10357297 3300005289 Bacteria 791
48 Ga0065712_10079004 3300005290 Bacteria 3270
49 Ga0065715_10887876 3300005293 Bacteria 579
50 Ga0070676_11025332 3300005328 Unclassified 620
51 Ga0070660_100047978 3300005339 Unclassified 3279
52 Ga0070660_100734940 3300005339 Bacteria 828
53 Ga0070669_100168990 3300005353 Bacteria 1704
54 Ga0070671_100042696 3300005355 Bacteria 3769
55 Ga0070673_100859380 3300005364 Unclassified 840
56 Ga0070659_100095774 3300005366 Bacteria 2384
57 Ga0070667_100726123 3300005367 Bacteria 920
58 Ga0070709_10929164 3300005434 Bacteria 689
59 Ga0070713_101026596 3300005436 Unclassified 796
60 Ga0070710_11375397 3300005437 Unclassified 527
61 Ga0070662_100203815 3300005457 Bacteria 1571
62 Ga0070665_100293480 3300005548 Bacteria 1628
63 Ga0070665_100473519 3300005548 Bacteria 1263
64 Ga0068855_100788564 3300005563 Bacteria 1011
65 Ga0070664_101156832 3300005564 Bacteria 729
66 Ga0068854_100649812 3300005578 Bacteria 905
67 Ga0068854_101751431 3300005578 Unclassified 569
68 Ga0068856_101674170 3300005614 Bacteria 649
69 Ga0068864_100000218 3300005618 Bacteria 51909
70 Ga0068864_100211383 3300005618 Bacteria 1786
71 Ga0068866_10484335 3300005718 Unclassified 815
72 Ga0068861_100166465 3300005719 Bacteria 1823
73 Ga0068851_10947323 3300005834 Unclassified 541
74 Ga0068858_100000352 3300005842 Bacteria 48455
75 Ga0068858_100001656 3300005842 Bacteria 22765
76 Ga0068862_101091742 3300005844 Unclassified 793
77 Ga0081455_10404061 3300005937 Bacteria 947
78 Ga0075365_10011682 3300006038 Bacteria 5174
79 Ga0075365_10017919 3300006038 Bacteria 4345
80 Ga0075365_10831908 3300006038 Bacteria 651
81 Ga0075364_10010433 3300006051 Bacteria 5611
82 Ga0075364_10104148 3300006051 Bacteria 1890
83 Ga0075364_10110610 3300006051 Bacteria 1833
84 Ga0075432_10055925 3300006058 Bacteria 1398
85 Ga0075432_10096218 3300006058 Bacteria 1089
86 Ga0075432_10113606 3300006058 Bacteria 1011
87 Ga0075432_10278232 3300006058 Bacteria 688
88 Ga0075432_10602777 3300006058 Bacteria 502
89 Ga0075362_10056386 3300006177 Bacteria 1768
90 Ga0075362_10444025 3300006177 Bacteria 658
91 Ga0075369_10004738 3300006186 Bacteria 5048
92 Ga0075369_10143099 3300006186 Bacteria 1091
93 Ga0097621_100903195 3300006237 Unclassified 823
94 Ga0075370_10065222 3300006353 Bacteria 2077
95 Ga0068871_100789896 3300006358 Unclassified 874
96 Ga0075430_100468458 3300006846 Unclassified 1040
97 Ga0075436_100110011 3300006914 Bacteria 1922
98 Ga0075436_100343702 3300006914 Bacteria 1074
99 Ga0079104_1000104 3300006946 Bacteria 123967
100 Ga0079104_1001328 3300006946 Bacteria 16967
101 Ga0079104_1073514 3300006946 Bacteria 713
102 Ga0099826_10004152 3300006948 Bacteria 10078
103 Ga0105251_10000466 3300009011 Bacteria 38664
104 Ga0105251_10034510 3300009011 Bacteria 2502
105 Ga0105251_10157004 3300009011 Bacteria 1026
106 Ga0105251_10372385 3300009011 Bacteria 654
107 Ga0105251_10519238 3300009011 Bacteria 558
108 Ga0105244_10027860 3300009036 Bacteria 3038
109 Ga0105244_10028008 3300009036 Bacteria 3028
110 Ga0105244_10147147 3300009036 Bacteria 1130
111 Ga0105244_10156728 3300009036 Bacteria 1089
112 Ga0105244_10170343 3300009036 Bacteria 1036
113 Ga0105244_10180080 3300009036 Bacteria 1003
114 Ga0105250_10034265 3300009092 Bacteria 2038
115 Ga0105250_10035115 3300009092 Bacteria 2011
116 Ga0105250_10060380 3300009092 Bacteria 1524
117 Ga0105250_10132132 3300009092 Bacteria 1031
118 Ga0105250_10210668 3300009092 Bacteria 822
119 Ga0105250_10227803 3300009092 Bacteria 792
120 Ga0105250_10303352 3300009092 Bacteria 691
121 Ga0105240_10549366 3300009093 Bacteria 1278
122 Ga0105245_10001436 3300009098 Bacteria 21598
123 Ga0105243_10049280 3300009148 Bacteria 3322
124 Ga0105243_10096200 3300009148 Bacteria 2449
125 Ga0105243_10736276 3300009148 Bacteria 965
126 Ga0105242_11572672 3300009176 Bacteria 690
127 Ga0105248_10007725 3300009177 Bacteria 11809
128 Ga0105238_11554376 3300009551 Bacteria 691
129 Ga0105249_10157648 3300009553 Bacteria 2191
130 Ga0157345_1000879 3300012498 Bacteria 2247
131 Ga0157373_10000160 3300013100 Bacteria 54531
132 Ga0157373_10009880 3300013100 Bacteria 7031
133 Ga0157373_10875215 3300013100 Bacteria 665
134 Ga0157373_11159517 3300013100 Bacteria 581
135 Ga0157371_10071919 3300013102 Bacteria 2449
136 Ga0157371_10175867 3300013102 Bacteria 1530
137 Ga0157371_10257754 3300013102 Bacteria 1257
138 Ga0157370_10086690 3300013104 Bacteria 2941
139 Ga0157370_10386681 3300013104 Bacteria 1288
140 Ga0157370_10630297 3300013104 Bacteria 981
141 Ga0157369_10039023 3300013105 Bacteria 5191
142 Ga0157378_10059990 3300013297 Bacteria 3395
143 Ga0163162_10015191 3300013306 Bacteria 7521
144 Ga0163162_10156336 3300013306 Bacteria 2400
145 Ga0163162_10183183 3300013306 Bacteria 2221
146 Ga0163162_10299871 3300013306 Bacteria 1739
147 Ga0163162_10386341 3300013306 Bacteria 1533
148 Ga0157375_10175495 3300013308 Bacteria 2292
149 Ga0157375_11178675 3300013308 Bacteria 898
150 Ga0157375_11300329 3300013308 Bacteria 855
151 Ga0157375_12375899 3300013308 Bacteria 632
152 Ga0182008_10007709 3300014497 Bacteria 5926
153 Ga0182008_10013620 3300014497 Bacteria 4273
154 Ga0182008_10027370 3300014497 Bacteria 2889
155 Ga0182008_10068729 3300014497 Bacteria 1743
156 Ga0182008_10117058 3300014497 Bacteria 1323
157 Ga0182008_10195381 3300014497 Bacteria 1028
158 Ga0157379_10724279 3300014968 Unclassified 935
159 Ga0157376_11382100 3300014969 Unclassified 735
160 Ga0182006_1012939 3300015261 Bacteria 3639
161 Ga0182006_1096870 3300015261 Bacteria 1053
162 Ga0182007_10003173 3300015262 Bacteria 7866
163 Ga0182007_10053020 3300015262 Bacteria 1336
164 Ga0182007_10137833 3300015262 Bacteria 824
165 Ga0182005_1046895 3300015265 Bacteria 1174
166 Ga0182005_1052573 3300015265 Bacteria 1109
167 Ga0182005_1052661 3300015265 Bacteria 1108
168 Ga0182005_1120672 3300015265 Bacteria 746
169 Ga0182005_1193945 3300015265 Bacteria 608
170 Ga0163161_10120991 3300017792 Bacteria 1967
171 Ga0163161_10161158 3300017792 Bacteria 1710
172 Ga0163161_10228308 3300017792 Bacteria 1444
173 Ga0163161_10410367 3300017792 Bacteria 1088
174 Ga0163161_11295858 3300017792 Unclassified 633
175 Ga0213872_10000747 3300021361 Bacteria 24034
176 Ga0213872_10003934 3300021361 Bacteria 8043
177 Ga0213872_10030473 3300021361 Unclassified 2472
178 Ga0213872_10032524 3300021361 Unclassified 2390
179 Ga0213872_10163047 3300021361 Unclassified 969
180 Ga0213872_10317277 3300021361 Unclassified 644
181 Ga0213875_10012055 3300021388 Bacteria 4281
182 Ga0209760_100140 3300025207 Bacteria 45356
183 Ga0209436_100162 3300025208 Bacteria 32237
184 Ga0209147_103422 3300025229 Bacteria 3098
185 Ga0207427_100016 3300025231 Bacteria 538697
186 Ga0209437_100011 3300025233 Bacteria 818520
187 Ga0209759_1001860 3300025256 Bacteria 10499
188 Ga0209233_1000019 3300025261 Bacteria 818520
189 Ga0209565_1010830 3300025263 Bacteria 2248
190 Ga0209130_1000010 3300025284 Bacteria 444920
191 Ga0209676_1000308 3300025292 Bacteria 95847
192 Ga0209676_1000320 3300025292 Bacteria 93515
193 Ga0209676_1004904 3300025292 Bacteria 7212
194 Ga0209676_1058390 3300025292 Bacteria 974
195 Ga0209025_1000687 3300025294 Bacteria 58005
196 Ga0209025_1012644 3300025294 Bacteria 5389
197 Ga0209564_1000025 3300025295 Bacteria 520535
198 Ga0209758_1046347 3300025297 Bacteria 1569
199 Ga0209050_1000466 3300025298 Bacteria 71734
200 Ga0209050_1000911 3300025298 Bacteria 39103
201 Ga0209050_1011196 3300025298 Bacteria 4292
202 Ga0209050_1016963 3300025298 Bacteria 2939
203 Ga0209256_1002250 3300025299 Bacteria 16402
204 Ga0209256_1059132 3300025299 Bacteria 899
205 Ga0207426_1000036 3300025302 Bacteria 444920
206 Ga0209051_1001718 3300025303 Bacteria 17480
207 Ga0209051_1023299 3300025303 Bacteria 2579
208 Ga0209257_1000338 3300025304 Bacteria 97721
209 Ga0209257_1005664 3300025304 Bacteria 8624
210 Ga0209257_1006123 3300025304 Bacteria 7978
211 Ga0207656_10675497 3300025321 Unclassified 528
212 Ga0207696_1000065 3300025711 Bacteria 231818
213 Ga0207696_1024123 3300025711 Bacteria 1910
214 Ga0207696_1053180 3300025711 Bacteria 1153
215 Ga0207696_1121838 3300025711 Bacteria 703
216 Ga0207655_1001270 3300025728 Bacteria 24082
217 Ga0207655_1053490 3300025728 Bacteria 1613
218 Ga0207655_1058326 3300025728 Bacteria 1510
219 Ga0207713_1000269 3300025735 Bacteria 63990
220 Ga0207713_1031081 3300025735 Bacteria 2367
221 Ga0207713_1059262 3300025735 Bacteria 1470
222 Ga0207713_1096087 3300025735 Bacteria 1032
223 Ga0207682_10139640 3300025893 Unclassified 1087
224 Ga0207699_10713177 3300025906 Bacteria 735
225 Ga0207671_10031074 3300025914 Bacteria 3981
226 Ga0207693_10152945 3300025915 Unclassified 1815
227 Ga0207657_10237338 3300025919 Bacteria 1457
228 Ga0207681_10129611 3300025923 Bacteria 1863
229 Ga0207687_10006357 3300025927 Bacteria 7807
230 Ga0207644_11244799 3300025931 Unclassified 625
231 Ga0207690_10184943 3300025932 Bacteria 1572
232 Ga0207706_10113871 3300025933 Bacteria 2379
233 Ga0207709_10138897 3300025935 Bacteria 1668
234 Ga0207709_11136771 3300025935 Bacteria 642
235 Ga0207711_10012751 3300025941 Bacteria 6981
236 Ga0207679_11101425 3300025945 Bacteria 729
237 Ga0207667_10164706 3300025949 Bacteria 2280
238 Ga0207651_10860459 3300025960 Unclassified 806
239 Ga0207712_10075390 3300025961 Bacteria 2438
240 Ga0207658_10662785 3300025986 Bacteria 941
241 Ga0207703_10001551 3300026035 Bacteria 20833
242 Ga0207703_10001574 3300026035 Bacteria 20688
243 Ga0207703_10727604 3300026035 Bacteria 945
244 Ga0207676_10000169 3300026095 Bacteria 57208
245 Ga0207676_10016717 3300026095 Bacteria 5312
246 Ga0207675_100088146 3300026118 Bacteria 2915
247 Ga0207683_10150499 3300026121 Bacteria 2100
248 Ga0209281_1000026 3300027111 Bacteria 465877
249 Ga0209281_1000717 3300027111 Bacteria 33033
250 Ga0209281_1004352 3300027111 Bacteria 4262
251 Ga0209371_1015214 3300027312 Bacteria 2077
252 Ga0209282_1008607 3300027666 Bacteria 6443
253 Ga0207428_10049800 3300027907 Bacteria 3355
254 Ga0207428_10092593 3300027907 Bacteria 2346
255 Ga0207428_10231474 3300027907 Bacteria 1383
256 Ga0207428_10506715 3300027907 Bacteria 876
257 Ga0268266_10204833 3300028379 Bacteria 1807
258 Ga0268266_10723832 3300028379 Bacteria 960
259 Ga0307517_10281107 3300028786 Bacteria 949
260 Ga0307515_10024017 3300028794 Bacteria 10646
261 Ga0316177_1190406 3300030731 Bacteria 3184
262 Ga0316179_1092971 3300030734 Bacteria 1341
263 Ga0316178_1122809 3300030735 Bacteria 6550
264 Ga0316183_1049590 3300030742 Bacteria 752
265 Ga0316181_1086264 3300030744 Bacteria 1443
266 Ga0265332_10053652 3300031238 Bacteria 1730
267 Ga0265320_10003123 3300031240 Bacteria 11245
268 Ga0307513_10906385 3300031456 Bacteria 589
269 Ga0307408_100191072 3300031548 Bacteria 1649
270 Ga0307408_100231849 3300031548 Bacteria 1512
271 Ga0307408_100233888 3300031548 Bacteria 1506
272 Ga0265313_10024553 3300031595 Bacteria 3217
273 Ga0307508_10019520 3300031616 Bacteria 6161
274 Ga0265314_10016259 3300031711 Bacteria 5886
275 Ga0307405_10018767 3300031731 Bacteria 3823
276 Ga0307405_10613597 3300031731 Bacteria 889
277 Ga0307405_10816243 3300031731 Bacteria 782
278 Ga0307405_11148512 3300031731 Bacteria 669
279 Ga0307413_10038575 3300031824 Bacteria 2770
280 Ga0307410_10427034 3300031852 Bacteria 1076
281 Ga0307406_10149843 3300031901 Bacteria 1663
282 Ga0307406_10940704 3300031901 Unclassified 738
283 Ga0307407_10559516 3300031903 Bacteria 846
284 Ga0307407_10587893 3300031903 Bacteria 827
285 Ga0307407_11380459 3300031903 Unclassified 555
286 Ga0307412_10005974 3300031911 Bacteria 6858
287 Ga0307412_10130162 3300031911 Bacteria 1826
288 Ga0307412_10756137 3300031911 Bacteria 839
289 Ga0307409_101213218 3300031995 Bacteria 778
290 Ga0307409_101524136 3300031995 Bacteria 696
291 Ga0307409_101802802 3300031995 Unclassified 641
292 Ga0307416_100138423 3300032002 Bacteria 2207
293 Ga0307416_100347869 3300032002 Bacteria 1498
294 Ga0307416_101227973 3300032002 Bacteria 855
295 Ga0307414_10011896 3300032004 Bacteria 5126
296 Ga0307414_10084898 3300032004 Bacteria 2330
297 Ga0307414_10161278 3300032004 Bacteria 1781
298 Ga0307414_10163398 3300032004 Bacteria 1771
299 Ga0307414_10402729 3300032004 Bacteria 1189
300 Ga0307414_10701448 3300032004 Bacteria 916
301 Ga0307414_11078803 3300032004 Unclassified 741
302 Ga0307411_10116667 3300032005 Bacteria 1922
303 Ga0307411_11153981 3300032005 Bacteria 701
304 Ga0307415_100927767 3300032126 Bacteria 804
305 Ga0307415_100968663 3300032126 Unclassified 789
306 Ga0316574_0171125 3300035398 Bacteria 1398
307 Ga0373933_0456734 3300035724 Bacteria 836
308 Ga0395899_0001089 3300037312 Bacteria 24380
309 Ga0395899_0335206 3300037312 Bacteria 1015
310 Ga0395899_0798720 3300037312 Bacteria 583
311 Ga0395900_0000108 3300037418 Bacteria 147706
312 Ga0395900_0007617 3300037418 Bacteria 11180
313 Ga0395900_0222737 3300037418 Bacteria 1900
314 Ga0395900_0670367 3300037418 Bacteria 972
315 Ga0395898_0009141 3300037466 Bacteria 10441
316 Ga0395898_0060019 3300037466 Unclassified 3697
317 Ga0395898_0185182 3300037466 Bacteria 1989
318 Ga0395905_0026339 3300037471 Bacteria 5483
319 Ga0395905_0077250 3300037471 Bacteria 3120
320 Ga0395905_1411360 3300037471 Unclassified 600
321 Ga0395905_1701214 3300037471 Unclassified 536
322 Ga0436364_0051522 3300037853 Bacteria 3570
323 Ga0436364_0061348 3300037853 Unclassified 1758
324 Ga0436364_0524095 3300037853 Bacteria 8185
325 Ga0395901_0000023 3300038443 Bacteria 283968
326 Ga0395901_0000050 3300038443 Bacteria 171046
327 Ga0395901_0000183 3300038443 Bacteria 81275
328 Ga0395901_0003967 3300038443 Bacteria 14881
329 Ga0395901_0237761 3300038443 Bacteria 1900
330 Ga0395901_0473364 3300038443 Bacteria 1278
331 Ga0436365_0118027 3300039437 Bacteria 1568
332 Ga0436361_0060925 3300039447 Bacteria 6643
333 Ga0436361_0422046 3300039447 Bacteria 2754
334 Ga0436361_0513574 3300039447 Bacteria 1182
335 Ga0436361_0576973 3300039447 Bacteria 5287
336 Ga0436361_0821550 3300039447 Unclassified 1368
337 Ga0436361_1057455 3300039447 Bacteria 40673
338 Ga0436361_1103751 3300039447 Unclassified 1271
339 Ga0436363_0398739 3300039450 Bacteria 2009
340 Ga0436363_0741000 3300039450 Bacteria 1470
341 Ga0436362_0250573 3300039453 Bacteria 1639
342 Ga0439438_000385 3300041405 Bacteria 19779
343 Ga0439438_001237 3300041405 Bacteria 11324
344 Ga0439438_002736 3300041405 Bacteria 7403
345 Ga0439438_009887 3300041405 Bacteria 3058
346 Ga0439438_017263 3300041405 Bacteria 2081
347 Ga0439438_046412 3300041405 Bacteria 1115
348 Ga0439438_064997 3300041405 Bacteria 909
349 Ga0439447_019572 3300041407 Bacteria 1803
350 Ga0439447_032890 3300041407 Bacteria 1294
351 Ga0439447_037780 3300041407 Bacteria 1188
352 Ga0439466_0003407 3300041411 Bacteria 6169
353 Ga0439466_0004719 3300041411 Bacteria 5236
354 Ga0439466_0014078 3300041411 Bacteria 2918
355 Ga0439466_0079893 3300041411 Bacteria 1032
356 Ga0439445_0044591 3300042004 Bacteria 1185
357 Ga0439445_0048139 3300042004 Bacteria 1146
358 Ga0439445_0210972 3300042004 Bacteria 575
359 Ga0439432_000116 3300042006 Bacteria 25928
360 Ga0439432_002197 3300042006 Bacteria 7369
361 Ga0439432_008638 3300042006 Bacteria 3574
362 Ga0439432_058708 3300042006 Bacteria 1189
363 Ga0439432_061222 3300042006 Bacteria 1160
364 Ga0439432_067791 3300042006 Bacteria 1091
365 Ga0439451_000777 3300042009 Bacteria 6068
366 Ga0439451_001521 3300042009 Bacteria 4586
367 Ga0439451_005945 3300042009 Bacteria 2493
368 Ga0439451_032790 3300042009 Bacteria 1044
369 Ga0439452_000530 3300042010 Bacteria 20404
370 Ga0439452_003840 3300042010 Bacteria 5159
371 Ga0439452_051112 3300042010 Bacteria 946
372 Ga0439456_003572 3300042013 Bacteria 3155
373 Ga0439456_008683 3300042013 Bacteria 2097
374 Ga0439456_008846 3300042013 Bacteria 2080
375 Ga0439456_013705 3300042013 Bacteria 1688
376 Ga0439463_005539 3300042016 Bacteria 3139
377 Ga0439463_014377 3300042016 Bacteria 1951
378 Ga0439463_030225 3300042016 Bacteria 1365
379 Ga0439463_098875 3300042016 Bacteria 752
380 Ga0450911_000394 3300042115 Bacteria 14425
381 Ga0450911_008569 3300042115 Bacteria 1452
382 Ga0450911_014078 3300042115 Bacteria 1066
383 Ga0450900_001734 3300042136 Bacteria 2194
384 Ga0450902_013760 3300042137 Bacteria 1304
385 Ga0450902_015032 3300042137 Bacteria 1254
386 Ga0450902_015424 3300042137 Bacteria 1239
387 Ga0450903_013304 3300042138 Bacteria 1309
388 Ga0450904_005957 3300042139 Bacteria 1223
389 Ga0450905_010235 3300042142 Bacteria 1296
390 Ga0450905_016590 3300042142 Bacteria 1063
391 Ga0450905_023307 3300042142 Bacteria 923
392 Ga0450906_000140 3300042145 Bacteria 13120
393 Ga0450907_001261 3300042146 Bacteria 5673
394 Ga0450907_033870 3300042146 Bacteria 870
395 Ga0439446_0001111 3300042156 Bacteria 5953
396 Ga0450909_001851 3300042185 Bacteria 2976
397 Ga0450909_007526 3300042185 Bacteria 1577
398 Ga0439434_0001029 3300042435 Bacteria 8072
399 Ga0439435_0019100 3300042436 Bacteria 1752
400 Ga0439460_0007980 3300042461 Bacteria 2664
401 Ga0439460_0338570 3300042461 Bacteria 529
402 Ga0450918_013240 3300042531 Bacteria 1435
403 Ga0450893_0028057 3300042532 Bacteria 994
404 Ga0450901_003932 3300042533 Bacteria 1540
405 Ga0439440_0003458 3300042993 Bacteria 3042
406 Ga0466969_0045482 3300044656 Bacteria 2179
407 Ga0466969_0154463 3300044656 Bacteria 1056
408 Ga0466965_0012519 3300044683 Bacteria 3991
409 Ga0466966_0028921 3300044684 Bacteria 3608
410 Ga0466961_0000467 3300044693 Bacteria 25598
411 Ga0466961_0093771 3300044693 Bacteria 1894
412 Ga0466961_0117619 3300044693 Unclassified 1670
413 Ga0466963_0097683 3300044694 Bacteria 2007
414 Ga0466963_0117680 3300044694 Bacteria 1827
415 Ga0466971_0291496 3300044719 Bacteria 782
416 Ga0466970_0658095 3300044765 Bacteria 609
417 Ga0466957_0148978 3300044842 Bacteria 1512
418 Ga0466959_0055078 3300045049 Bacteria 2904
419 Ga0466959_0385630 3300045049 Unclassified 953
420 Ga0466958_0180722 3300045836 Bacteria 1338
421 Ga0466967_0531768 3300045976 Bacteria 1156
422 Ga0466967_0687015 3300045976 Bacteria 1013
423 Ga0495617_003151 3300046452 Bacteria 6279
424 Ga0495617_037873 3300046452 Bacteria 1614
425 Ga0495617_129350 3300046452 Bacteria 810
426 Ga0495627_000084 3300046453 Bacteria 112950
427 Ga0495627_002251 3300046453 Bacteria 9551
428 Ga0495603_0492377 3300046455 Bacteria 702
429 Ga0495590_0055542 3300046457 Bacteria 1383
430 Ga0495590_0206280 3300046457 Bacteria 723
431 Ga0495591_026286 3300046458 Bacteria 1811
432 Ga0495591_032156 3300046458 Bacteria 1565
433 Ga0495591_037994 3300046458 Bacteria 1389
434 Ga0495638_0012479 3300046460 Bacteria 5821
435 Ga0495638_0035413 3300046460 Bacteria 3182
436 Ga0495638_0143926 3300046460 Bacteria 1388
437 Ga0495638_0221501 3300046460 Bacteria 1057
438 Ga0495638_0226256 3300046460 Bacteria 1043
439 Ga0495638_0330955 3300046460 Bacteria 810
440 Ga0495653_0000002 3300046463 Bacteria 507262
441 Ga0495650_0001827 3300046471 Bacteria 19067
442 Ga0495650_0045347 3300046471 Bacteria 1851
443 Ga0495650_0048377 3300046471 Bacteria 1772
444 Ga0495650_0194304 3300046471 Bacteria 708
445 Ga0495605_0012973 3300046474 Bacteria 4607
446 Ga0495605_0068505 3300046474 Bacteria 1681
447 Ga0495584_0001126 3300046491 Bacteria 16567
448 Ga0495584_0007670 3300046491 Bacteria 5619
449 Ga0495584_0011807 3300046491 Bacteria 4466
450 Ga0495584_0174600 3300046491 Bacteria 1092
451 Ga0495584_0198640 3300046491 Bacteria 1019
452 Ga0495584_0288602 3300046491 Bacteria 833
453 Ga0495585_0010752 3300046492 Bacteria 5437
454 Ga0495585_0049349 3300046492 Bacteria 2337
455 Ga0495585_0184055 3300046492 Bacteria 1073
456 Ga0495585_0231133 3300046492 Bacteria 929
457 Ga0495607_0006943 3300046501 Bacteria 7893
458 Ga0495607_0016609 3300046501 Bacteria 4748
459 Ga0495607_0038674 3300046501 Bacteria 2856
460 Ga0495607_0058021 3300046501 Bacteria 2215
461 Ga0495607_0070545 3300046501 Bacteria 1952
462 Ga0495607_0076441 3300046501 Bacteria 1852
463 Ga0495607_0135233 3300046501 Bacteria 1277
464 Ga0495607_0200079 3300046501 Bacteria 989
465 Ga0495607_0336958 3300046501 Bacteria 699
466 Ga0495583_0012627 3300046506 Bacteria 4764
467 Ga0495583_0079955 3300046506 Bacteria 1421
468 Ga0495606_0000030 3300046507 Bacteria 249484
469 Ga0495606_0044498 3300046507 Bacteria 2951
470 Ga0495606_0147132 3300046507 Bacteria 1386
471 Ga0495606_0263774 3300046507 Bacteria 949
472 Ga0495610_0046596 3300046512 Bacteria 2138
473 Ga0495610_0057847 3300046512 Bacteria 1857
474 Ga0495610_0140347 3300046512 Bacteria 1040
475 Ga0495610_0180453 3300046512 Bacteria 878
476 Ga0495610_0183170 3300046512 Bacteria 869
477 Ga0495616_0047259 3300046513 Bacteria 2168
478 Ga0495616_0075085 3300046513 Bacteria 1627
479 Ga0495620_0011042 3300046515 Bacteria 4730
480 Ga0495620_0037582 3300046515 Bacteria 2155
481 Ga0495630_0307968 3300046517 Bacteria 1210
482 Ga0495631_0219270 3300046518 Bacteria 812
483 Ga0495631_0349253 3300046518 Bacteria 629
484 Ga0495632_0000049 3300046519 Bacteria 134597
485 Ga0495632_0001609 3300046519 Bacteria 18580
486 Ga0495632_0003183 3300046519 Bacteria 11830
487 Ga0495632_0008656 3300046519 Bacteria 6214
488 Ga0495632_0021306 3300046519 Bacteria 3494
489 Ga0495632_0057376 3300046519 Bacteria 1900
490 Ga0495632_0096956 3300046519 Bacteria 1392
491 Ga0495632_0273459 3300046519 Bacteria 753
492 Ga0495632_0318396 3300046519 Bacteria 687
493 Ga0495637_0003277 3300046520 Bacteria 8615
494 Ga0495637_0004271 3300046520 Bacteria 7420
495 Ga0495637_0005172 3300046520 Bacteria 6683
496 Ga0495637_0022273 3300046520 Bacteria 2891
497 Ga0495637_0056987 3300046520 Bacteria 1615
498 Ga0495637_0075001 3300046520 Bacteria 1357
499 Ga0495637_0099281 3300046520 Bacteria 1139
500 Ga0495637_0110098 3300046520 Bacteria 1068
501 Ga0495643_0000047 3300046522 Bacteria 217914
502 Ga0495643_0020755 3300046522 Bacteria 3781
503 Ga0495643_0103929 3300046522 Bacteria 1452
504 Ga0495643_0114878 3300046522 Bacteria 1365
505 Ga0495643_0131869 3300046522 Bacteria 1254
506 Ga0495643_0263596 3300046522 Bacteria 799
507 Ga0495643_0329233 3300046522 Bacteria 689
508 Ga0495643_0383264 3300046522 Bacteria 623
509 Ga0495644_0001046 3300046523 Bacteria 11535
510 Ga0495648_0003342 3300046524 Bacteria 14150
511 Ga0495648_0035719 3300046524 Bacteria 3218
512 Ga0495648_0160862 3300046524 Bacteria 1161
513 Ga0495648_0229872 3300046524 Bacteria 909
514 Ga0495648_0241593 3300046524 Bacteria 877
515 Ga0495663_0000009 3300046525 Bacteria 256308
516 Ga0495642_0001171 3300046528 Bacteria 12049
517 Ga0495654_0026985 3300046530 Bacteria 2947
518 Ga0495654_0044804 3300046530 Bacteria 2185
519 Ga0495654_0088465 3300046530 Bacteria 1440
520 Ga0495654_0103363 3300046530 Bacteria 1308
521 Ga0495654_0201057 3300046530 Bacteria 852
522 Ga0495609_0000149 3300046538 Bacteria 72309
523 Ga0495609_0029481 3300046538 Bacteria 2498
524 Ga0495597_0005474 3300046542 Bacteria 6717
525 Ga0495597_0019740 3300046542 Bacteria 3148
526 Ga0495597_0044582 3300046542 Bacteria 1971
527 Ga0495597_0052307 3300046542 Bacteria 1798
528 Ga0495622_0141025 3300046557 Bacteria 1094
529 Ga0495633_0000402 3300046558 Bacteria 45246
530 Ga0495633_0000434 3300046558 Bacteria 43286
531 Ga0495633_0004035 3300046558 Bacteria 9497
532 Ga0495633_0004360 3300046558 Bacteria 9035
533 Ga0495656_0194998 3300046615 Bacteria 1002
534 Ga0495668_0042326 3300046616 Bacteria 2536
535 Ga0495611_0041298 3300046648 Bacteria 2057
536 Ga0495611_0186037 3300046648 Bacteria 970
537 Ga0495611_0423089 3300046648 Bacteria 608
538 Ga0495625_0108601 3300046660 Bacteria 1898
539 Ga0495625_0133767 3300046660 Bacteria 1678
540 Ga0495625_0159878 3300046660 Bacteria 1510
541 Ga0495625_0194017 3300046660 Bacteria 1344
542 Ga0495659_0001130 3300046664 Bacteria 9275
543 Ga0495659_0001680 3300046664 Bacteria 7418
544 Ga0495659_0056101 3300046664 Bacteria 1445
545 Ga0495661_0010223 3300046665 Bacteria 6412
546 Ga0495661_0041195 3300046665 Bacteria 2859
547 Ga0495661_0078637 3300046665 Bacteria 1907
548 Ga0495661_0248906 3300046665 Bacteria 908
549 Ga0495669_0000275 3300046684 Bacteria 29419
550 Ga0495670_0002606 3300046691 Bacteria 8907
551 Ga0495670_0024396 3300046691 Bacteria 2988
552 Ga0495670_0092817 3300046691 Bacteria 1546
553 Ga0495670_0295589 3300046691 Bacteria 867
554 Ga0495670_0785792 3300046691 Bacteria 519
555 Ga0495671_0000038 3300046692 Bacteria 173693
556 Ga0495671_0000260 3300046692 Bacteria 44754
557 Ga0495671_0026849 3300046692 Bacteria 2980
558 Ga0495671_0075028 3300046692 Bacteria 1659
559 Ga0495671_0076788 3300046692 Bacteria 1637
560 Ga0495671_0079974 3300046692 Bacteria 1601
561 Ga0495671_0195474 3300046692 Bacteria 981
562 Ga0495649_0023742 3300046694 Bacteria 3425
563 Ga0495649_0026244 3300046694 Bacteria 3241
564 Ga0495649_0138218 3300046694 Bacteria 1283
565 Ga0495649_0223118 3300046694 Bacteria 974
566 Ga0495649_0264858 3300046694 Bacteria 880
567 Ga0495589_0046821 3300046794 Bacteria 2145
568 Ga0495589_0076146 3300046794 Bacteria 1636
569 Ga0495589_0197770 3300046794 Bacteria 949
570 Ga0495660_0000049 3300046810 Bacteria 142727
571 Ga0495660_0000715 3300046810 Bacteria 25390
572 Ga0495660_0087100 3300046810 Bacteria 1629
573 Ga0495660_0098444 3300046810 Bacteria 1508
574 Ga0495660_0151269 3300046810 Bacteria 1145
575 Ga0495636_0075725 3300047318 Bacteria 1442
576 Ga0495672_0000184 3300047320 Bacteria 91103
577 Ga0495672_0014058 3300047320 Bacteria 5496
578 Ga0495672_0022104 3300047320 Bacteria 4139
579 Ga0495672_0033995 3300047320 Bacteria 3154
580 Ga0495672_0118564 3300047320 Bacteria 1410
581 Ga0495672_0119672 3300047320 Bacteria 1401
582 Ga0495680_0005487 3300047322 Bacteria 11923
583 Ga0495683_0084569 3300047323 Bacteria 1543
584 Ga0495687_037674 3300047443 Bacteria 2152
585 Ga0495687_120242 3300047443 Bacteria 949
586 Ga0495687_128256 3300047443 Bacteria 903
587 Ga0495677_0007520 3300047445 Bacteria 4067
588 Ga0495679_004730 3300047446 Bacteria 6181
589 Ga0495685_001865 3300047447 Bacteria 6511
590 Ga0495673_0015870 3300047469 Bacteria 3867
591 Ga0495673_0061895 3300047469 Bacteria 1600
592 Ga0495673_0066371 3300047469 Bacteria 1530
593 Ga0495673_0117662 3300047469 Bacteria 1055
594 Ga0495681_0002988 3300047470 Bacteria 11907
595 Ga0495681_0040661 3300047470 Bacteria 2262
596 Ga0495681_0041400 3300047470 Bacteria 2236
597 Ga0495681_0065823 3300047470 Bacteria 1655
598 Ga0495681_0110354 3300047470 Bacteria 1192
599 Ga0495686_0000624 3300047472 Bacteria 48658
600 Ga0495686_0008888 3300047472 Bacteria 7306
601 Ga0495686_0094687 3300047472 Bacteria 1809
602 Ga0495686_0098273 3300047472 Bacteria 1769
603 Ga0495686_0197160 3300047472 Bacteria 1157
604 Ga0495686_0312935 3300047472 Bacteria 863
605 Ga0495686_0379009 3300047472 Bacteria 763
606 Ga0495593_0191954 3300047673 Bacteria 1027
607 Ga0495615_0004325 3300048090 Bacteria 2472
608 Ga0495626_0002902 3300048091 Bacteria 11418
609 Ga0495626_0010145 3300048091 Bacteria 5053
610 Ga0495626_0155775 3300048091 Bacteria 960
611 Ga0495626_0421924 3300048091 Bacteria 514
612 Ga0496101_0319322 3300048904 Bacteria 1218
613 Ga0496102_0114691 3300048905 Bacteria 2514
614 Ga0496102_0174812 3300048905 Bacteria 2022
615 Ga0496107_0165459 3300048910 Bacteria 1640
616 Ga0496108_0065617 3300048911 Bacteria 3060
617 Ga0496109_0195701 3300048912 Bacteria 1900
618 Ga0496109_1147341 3300048912 Bacteria 714
619 Ga0496110_0088186 3300048913 Bacteria 2771
620 Ga0496110_0347135 3300048913 Bacteria 1352
621 Ga0496111_1020051 3300048914 Unclassified 592
622 Ga0496112_0130016 3300048915 Bacteria 2489
623 Ga0496112_0358674 3300048915 Bacteria 1400
624 Ga0496116_0044785 3300048919 Bacteria 3002
625 Ga0496117_0020723 3300048920 Bacteria 5350
626 Ga0496117_0080759 3300048920 Bacteria 2137
627 Ga0496117_0089952 3300048920 Bacteria 1980
628 Ga0496117_0142596 3300048920 Bacteria 1432
629 Ga0496118_0002611 3300048921 Bacteria 23930
630 Ga0496118_0026316 3300048921 Bacteria 4959
631 Ga0496118_0080846 3300048921 Bacteria 2285
632 Ga0496118_0196829 3300048921 Bacteria 1198
633 Ga0496118_0494061 3300048921 Bacteria 610
634 Ga0496121_0000005 3300048924 Bacteria 1034486
635 Ga0496121_0245350 3300048924 Bacteria 1245
636 Ga0496121_0276913 3300048924 Bacteria 1150
637 Ga0496121_0482982 3300048924 Bacteria 791
638 Ga0496121_0654822 3300048924 Bacteria 639
639 Ga0496122_0002889 3300048925 Bacteria 23500
640 Ga0496122_0049685 3300048925 Bacteria 3207
641 Ga0496122_0055864 3300048925 Bacteria 2949
642 Ga0496123_0085631 3300048926 Bacteria 1895
643 Ga0496123_0138664 3300048926 Bacteria 1334
644 Ga0496124_0000672 3300048927 Bacteria 56291
645 Ga0496124_0002578 3300048927 Bacteria 23487
646 Ga0496124_0053423 3300048927 Bacteria 3424
647 Ga0496124_0077797 3300048927 Bacteria 2735
648 Ga0496124_0128318 3300048927 Bacteria 2018
649 Ga0496124_0155165 3300048927 Bacteria 1791
650 Ga0496124_0310924 3300048927 Bacteria 1133
651 Ga0496124_0382424 3300048927 Bacteria 984
652 Ga0496125_0000159 3300048928 Bacteria 151205
653 Ga0496125_0001126 3300048928 Bacteria 40818
654 Ga0496125_0012345 3300048928 Bacteria 8488
655 Ga0496125_0019176 3300048928 Bacteria 6462
656 Ga0496126_0032169 3300048929 Bacteria 4945
657 Ga0496126_0037146 3300048929 Bacteria 4548
658 Ga0496126_0397206 3300048929 Bacteria 1119
659 Ga0495678_008089 3300049459 Bacteria 5357
660 Ga0495678_013524 3300049459 Bacteria 3829
661 Ga0495678_050725 3300049459 Bacteria 1607
662 Ga0495678_076574 3300049459 Bacteria 1211
663 Ga0495678_087635 3300049459 Bacteria 1103
664 Ga0495678_107749 3300049459 Bacteria 955
665 Ga0495682_0000589 3300049460 Bacteria 24714
666 Ga0495682_0048705 3300049460 Bacteria 1544
667 Ga0501300_056562 3300049523 Unclassified 614
668 Ga0501315_045870 3300049531 Bacteria 674
669 Ga0501033_0044625 3300049570 Bacteria 3300
670 Ga0501043_0049267 3300049579 Bacteria 3312
671 Ga0501043_0078395 3300049579 Bacteria 2596
672 Ga0501048_1002740 3300049582 Unclassified 601
673 Ga0501067_0039776 3300049583 Bacteria 2611
674 Ga0501067_0110703 3300049583 Bacteria 1527
675 Ga0501216_133387 3300049660 Unclassified 578
676 Ga0501227_023905 3300049665 Bacteria 1422
677 Ga0501235_034249 3300049669 Bacteria 1152
678 Ga0501240_004834 3300049673 Bacteria 1583
679 Ga0501252_008582 3300049682 Bacteria 1176
680 Ga0501221_172479 3300049704 Unclassified 586
681 Ga0501083_0088400 3300049744 Bacteria 2049
682 Ga0501241_035562 3300049758 Bacteria 953
683 Ga0501269_010422 3300049766 Bacteria 1131
684 Ga0501226_006893 3300049853 Bacteria 1279
685 nmdc:mga03683_199085_c1 3300050489 Bacteria 919
686 nmdc:mga03683_273524_c1 3300050489 Unclassified 788
687 nmdc:mga03683_35391_c1 3300050489 Bacteria 2026
688 nmdc:mga00v17_108894_c1 3300050491 Bacteria 1756
689 nmdc:mga00v17_40621_c1 3300050491 Bacteria 2791
690 nmdc:mga00v17_9237_c1 3300050491 Bacteria 5328
691 nmdc:mga0yw44_782711_c1 3300050492 Bacteria 648
692 nmdc:mga0yw44_96578_c1 3300050492 Bacteria 1876
693 nmdc:mga07m45_74270_c1 3300050496 Bacteria 1937
694 nmdc:mga0qj67_1474047_c1 3300050509 Unclassified 524
695 nmdc:mga08x19_171509_c1 3300050514 Bacteria 1478
696 nmdc:mga08x19_615911_c1 3300050514 Bacteria 769
697 nmdc:mga0sz30_34988_c1 3300050516 Bacteria 2094
698 nmdc:mga0sz30_49060_c2 3300050516 Bacteria 1195
699 Ga0500644_0284158 3300053088 Bacteria 705
700 Ga0500572_206079 3300053111 Bacteria 644
701 Ga0500594_0001502 3300053118 Bacteria 5077
702 Ga0500618_000070 3300053125 Bacteria 86080
703 Ga0500618_000344 3300053125 Bacteria 33227
704 Ga0500559_0042345 3300053136 Bacteria 1986
705 Ga0500559_0100952 3300053136 Bacteria 1330
706 Ga0500622_0402689 3300053156 Bacteria 555
707 Ga0500634_0021243 3300053161 Bacteria 3516
708 Ga0500645_184440 3300053730 Unclassified 567
709 Ga0587088_013908 3300059508 Bacteria 1244

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10139640 Ga0207682_101396402 109
2 3300039450 Ga0436363_0398739 Ga0436363_0398739_47_376 109
3 3300044694 Ga0466963_0097683 Ga0466963_0097683_1652_1990 111
4 iso_pu_bacteria 2884960567 2884960624 127
5 3300009093 Ga0105240_10549366 Ga0105240_105493662 128
6 3300021361 Ga0213872_10000747 Ga0213872_1000074726 128
7 3300021361 Ga0213872_10003934 Ga0213872_100039345 128
8 3300021361 Ga0213872_10030473 Ga0213872_100304732 128
9 3300021388 Ga0213875_10012055 Ga0213875_100120554 128
10 3300025906 Ga0207699_10713177 Ga0207699_107131771 128
11 3300031995 Ga0307409_101802802 Ga0307409_1018028022 128
12 3300037312 Ga0395899_0798720 Ga0395899_0798720_11_409 128
13 3300037471 Ga0395905_0077250 Ga0395905_0077250_918_1322 128
14 3300037853 Ga0436364_0524095 Ga0436364_0524095_3024_3446 128
15 3300039447 Ga0436361_0060925 Ga0436361_0060925_1765_2154 128
16 3300039447 Ga0436361_0422046 Ga0436361_0422046_1394_1789 128
17 3300039447 Ga0436361_1057455 Ga0436361_1057455_19071_19463 128
18 3300041405 Ga0439438_017263 Ga0439438_017263_1148_1546 128
19 3300046501 Ga0495607_0038674 Ga0495607_0038674_378_776 128
20 3300046501 Ga0495607_0336958 Ga0495607_0336958_146_544 128
21 3300046538 Ga0495609_0000149 Ga0495609_0000149_43130_43528 128
22 3300046648 Ga0495611_0186037 Ga0495611_0186037_330_776 128
23 3300047469 Ga0495673_0066371 Ga0495673_0066371_12_398 128
24 3300047472 Ga0495686_0379009 Ga0495686_0379009_51_443 128
25 3300048912 Ga0496109_1147341 Ga0496109_1147341_13_408 128
26 3300048913 Ga0496110_0088186 Ga0496110_0088186_1109_1516 128
27 3300048914 Ga0496111_1020051 Ga0496111_1020051_88_483 128
28 3300048920 Ga0496117_0142596 Ga0496117_0142596_883_1275 128
29 3300048921 Ga0496118_0080846 Ga0496118_0080846_584_976 128
30 3300048927 Ga0496124_0002578 Ga0496124_0002578_12181_12588 128
31 3300048928 Ga0496125_0019176 Ga0496125_0019176_2632_3039 128
32 3300048929 Ga0496126_0032169 Ga0496126_0032169_2394_2801 128
33 3300049523 Ga0501300_056562 Ga0501300_056562_37_438 128
34 3300049660 Ga0501216_133387 Ga0501216_133387_111_512 128
35 3300049704 Ga0501221_172479 Ga0501221_172479_13_414 128
36 3300053118 Ga0500594_0001502 Ga0500594_0001502_2732_3127 128
37 3300053730 Ga0500645_184440 Ga0500645_184440_105_500 128
38 iso_pu_bacteria 2510917026 2511175111 128
39 iso_pu_bacteria 2510917028 2511181548 128
40 iso_pu_bacteria 2511231008 2511280638 128
41 iso_pu_bacteria 2511231014 2511312149 128
42 iso_pu_bacteria 2511231015 2511318583 128
43 iso_pu_bacteria 2511231017 2511332774 128
44 iso_pu_bacteria 2511231019 2511345142 128
45 iso_pu_bacteria 2513237138 2513868261 128
46 iso_pu_bacteria 2534681796 2535518464 128
47 iso_pu_bacteria 2537561728 2538427591 128
48 iso_pu_bacteria 2585427591 2585827323 128
49 iso_pu_bacteria 2599185185 2599482844 128
50 iso_pu_bacteria 2599185316 2600026692 128
51 iso_pu_bacteria 2599185317 2600029919 128
52 iso_pu_bacteria 2599185325 2600080367 128
53 iso_pu_bacteria 2599185352 2600197961 128
54 iso_pu_bacteria 2600254930 2600359228 128
55 iso_pu_bacteria 2600254931 2600365284 128
56 iso_pu_bacteria 2643221557 2643809434 128
57 iso_pu_bacteria 2643221565 2643840860 128
58 iso_pu_bacteria 2643221589 2643955044 128
59 iso_pu_bacteria 2643221602 2644024678 128
60 iso_pu_bacteria 2643221607 2644049976 128
61 iso_pu_bacteria 2643221618 2644107086 128
62 iso_pu_bacteria 2643221626 2644147817 128
63 iso_pu_bacteria 2643221633 2644189583 128
64 iso_pu_bacteria 2643221636 2644203069 128
65 iso_pu_bacteria 2643221655 2644311391 128
66 iso_pu_bacteria 2643221659 2644335100 128
67 iso_pu_bacteria 2643221686 2644482891 128
68 iso_pu_bacteria 2643221689 2644497834 128
69 iso_pu_bacteria 2643221698 2644543961 128
70 iso_pu_bacteria 2643221712 2644617066 128
71 iso_pu_bacteria 2643221723 2644674737 128
72 iso_pu_bacteria 2651869719 2652543648 128
73 iso_pu_bacteria 2713897148 2715749087 128
74 iso_pu_bacteria 2738541280 2738738963 128
75 iso_pu_bacteria 2738541317 2738945128 128
76 iso_pu_bacteria 2738543015 2739260436 128
77 iso_pu_bacteria 2739367756 2739792922 128
78 iso_pu_bacteria 2751185800 2753360758 128
79 iso_pu_bacteria 2758568016 2758638173 128
80 iso_pu_bacteria 2765235841 2765581760 128
81 iso_pu_bacteria 2773857670 2774119684 128
82 iso_pu_bacteria 2784132072 2784316243 128
83 iso_pu_bacteria 2791355010 2792310953 128
84 iso_pu_bacteria 2808606377 2808931276 128
85 iso_pu_bacteria 2808606381 2808953234 128
86 iso_pu_bacteria 2808606387 2808989952 128
87 iso_pu_bacteria 2808606445 2809217859 128
88 iso_pu_bacteria 2821123053 2821131055 128
89 iso_pu_bacteria 2838714209 2838719462 128
90 iso_pu_bacteria 2838719591 2838724825 128
91 iso_pu_bacteria 2841846520 2841851312 128
92 iso_pu_bacteria 2842124991 2842129287 128
93 iso_pu_bacteria 2842170452 2842175707 128
94 iso_pu_bacteria 2842187318 2842192551 128
95 iso_pu_bacteria 2842224351 2842229600 128
96 iso_pu_bacteria 2842832357 2842834042 128
97 iso_pu_bacteria 2842854478 2842859430 128
98 iso_pu_bacteria 2844163670 2844164369 128
99 iso_pu_bacteria 2849560528 2849564278 128
100 iso_pu_bacteria 2849573788 2849575483 128
101 iso_pu_bacteria 2851153111 2851155020 128
102 iso_pu_bacteria 2854911287 2854915391 128
103 iso_pu_bacteria 2857542790 2857544905 128
104 iso_pu_bacteria 2858466076 2858469123 128
105 iso_pu_bacteria 2898329390 2898334132 128
106 iso_pu_bacteria 2913308742 2913309754 128
107 iso_pu_bacteria 2919100787 2919104783 128
108 iso_pu_bacteria 2919114240 2919119617 128
109 iso_pu_bacteria 2919385768 2919389901 128
110 iso_pu_bacteria 2920822456 2920828011 128
111 iso_pu_bacteria 2926754445 2926759764 128
112 iso_pu_bacteria 2929138655 2929142876 128
113 iso_pu_bacteria 2978969890 2978969890 128
114 iso_pu_bacteria 2979089926 2979095450 128
115 iso_pu_bacteria 2979095461 2979097703 128
116 iso_pu_bacteria 2984286254 2984287549 128
117 iso_pu_bacteria 2988728565 2988732074 128
118 iso_pu_bacteria 2998139840 2998140335 128
119 iso_pu_bacteria 3007855910 3007857212 128
120 iso_pu_bacteria 3007861166 3007864458 128
121 iso_pu_bacteria 3007872151 3007875201 128
122 iso_pu_bacteria 641228493 641334028 128
123 iso_pu_bacteria 643348555 643391163 128
124 iso_pu_bacteria 8005258706 8005258790 128
125 iso_pu_bacteria 8029995093 8030000400 128
126 iso_pu_bacteria 8046767195 8046768015 128
127 iso_pu_bacteria 8054929484 8054930224 128
128 iso_pu_bacteria 8055431914 8055434813 128
129 iso_pu_bacteria 8056115690 8056116880 128
130 iso_pu_bacteria 8056143049 8056143604 128
131 iso_pu_bacteria 8056155041 8056158392 128
132 iso_pu_bacteria 8056166840 8056170708 128
133 iso_pu_bacteria 8056569372 8056572199 128
134 3300048925 Ga0496122_0055864 Ga0496122_0055864_556_945 129
135 3300048928 Ga0496125_0000159 Ga0496125_0000159_139574_139963 129
136 iso_pu_bacteria 8005542996 8005549383 129
137 3300039437 Ga0436365_0118027 Ga0436365_0118027_77_469 130
138 2010549000 RicEn_C7519 RicEn_132240 132
139 2124908027 MRS2a_Contig_11594 MRS2a_00464100 132
140 2162886007 SwRhRL2b_contig_30749 SwRhRL2b_0685.00004780 132
141 2162886007 SwRhRL2b_contig_519226 SwRhRL2b_0084.00006340 132
142 3300002737 JGI25162J39368_1001056 JGI25162J39368_10010567 132
143 3300002739 JGI25158J39367_1002355 JGI25158J39367_10023553 132
144 3300002771 JGI25163J39215_1003290 JGI25163J39215_10032902 132
145 3300002772 JGI25164J39214_1000563 JGI25164J39214_10005637 132
146 3300002987 JGI25159J45721_1000083 JGI25159J45721_100008332 132
147 3300002987 JGI25159J45721_1000466 JGI25159J45721_10004663 132
148 3300003187 JGI25151J46595_10036444 JGI25151J46595_100364442 132
149 3300003214 JGI25165J46597_1001123 JGI25165J46597_10011237 132
150 3300003316 rootH1_10044342 rootH1_1004434214 132
151 3300003316 rootH1_10130566 rootH1_101305662 132
152 3300003320 rootH2_10081916 rootH2_100819163 132
153 3300003323 rootH1_10328791 rootH1_103287913 132
154 3300003354 JGI25160J50197_1000005 JGI25160J50197_100000554 132
155 3300003374 JGI25161J50226_1000349 JGI25161J50226_100034921 132
156 3300003578 Ga0006562J51391_1008015 Ga0006562J51391_10080153 132
157 3300003771 Ga0055526_1002592 Ga0055526_10025923 132
158 3300003775 Ga0055524_1033754 Ga0055524_10337541 132
159 3300003781 Ga0055536_1004642 Ga0055536_10046425 132
160 3300003781 Ga0055536_1016156 Ga0055536_10161564 132
161 3300003781 Ga0055536_1016300 Ga0055536_10163003 132
162 3300003791 Ga0055530_10008853 Ga0055530_100088535 132
163 3300003791 Ga0055530_10012947 Ga0055530_100129473 132
164 3300003791 Ga0055530_10032239 Ga0055530_100322392 132
165 3300003792 Ga0055540_1012563 Ga0055540_10125631 132
166 3300003792 Ga0055540_1068700 Ga0055540_10687001 132
167 3300003794 Ga0055531_10001364 Ga0055531_1000136420 132
168 3300003794 Ga0055531_10004249 Ga0055531_1000424910 132
169 3300003794 Ga0055531_10073595 Ga0055531_100735952 132
170 3300003856 Ga0058692_1015795 Ga0058692_10157952 132
171 3300003856 Ga0058692_1018212 Ga0058692_10182124 132
172 3300004625 Ga0055543_1000324 Ga0055543_100032434 132
173 3300005262 Ga0065165_1000002 Ga0065165_1000002336 132
174 3300005262 Ga0065165_1000264 Ga0065165_100026449 132
175 3300005288 Ga0065714_10009236 Ga0065714_100092363 132
176 3300005288 Ga0065714_10020005 Ga0065714_100200052 132
177 3300005288 Ga0065714_10112802 Ga0065714_101128022 132
178 3300005288 Ga0065714_10233113 Ga0065714_102331132 132
179 3300005288 Ga0065714_10308760 Ga0065714_103087602 132
180 3300005288 Ga0065714_10316355 Ga0065714_103163552 132
181 3300005289 Ga0065704_10085495 Ga0065704_100854953 132
182 3300005289 Ga0065704_10098219 Ga0065704_100982193 132
183 3300005289 Ga0065704_10148567 Ga0065704_101485672 132
184 3300005289 Ga0065704_10357297 Ga0065704_103572972 132
185 3300005290 Ga0065712_10079004 Ga0065712_100790044 132
186 3300005293 Ga0065715_10887876 Ga0065715_108878761 132
187 3300005328 Ga0070676_11025332 Ga0070676_110253321 132
188 3300005339 Ga0070660_100047978 Ga0070660_1000479784 132
189 3300005339 Ga0070660_100734940 Ga0070660_1007349401 132
190 3300005353 Ga0070669_100168990 Ga0070669_1001689904 132
191 3300005355 Ga0070671_100042696 Ga0070671_1000426964 132
192 3300005364 Ga0070673_100859380 Ga0070673_1008593802 132
193 3300005366 Ga0070659_100095774 Ga0070659_1000957742 132
194 3300005367 Ga0070667_100726123 Ga0070667_1007261232 132
195 3300005434 Ga0070709_10929164 Ga0070709_109291642 132
196 3300005436 Ga0070713_101026596 Ga0070713_1010265961 132
197 3300005437 Ga0070710_11375397 Ga0070710_113753971 132
198 3300005457 Ga0070662_100203815 Ga0070662_1002038151 132
199 3300005548 Ga0070665_100293480 Ga0070665_1002934802 132
200 3300005548 Ga0070665_100473519 Ga0070665_1004735193 132
201 3300005563 Ga0068855_100788564 Ga0068855_1007885641 132
202 3300005564 Ga0070664_101156832 Ga0070664_1011568321 132
203 3300005578 Ga0068854_100649812 Ga0068854_1006498122 132
204 3300005578 Ga0068854_101751431 Ga0068854_1017514311 132
205 3300005614 Ga0068856_101674170 Ga0068856_1016741702 132
206 3300005618 Ga0068864_100000218 Ga0068864_10000021829 132
207 3300005618 Ga0068864_100211383 Ga0068864_1002113834 132
208 3300005718 Ga0068866_10484335 Ga0068866_104843352 132
209 3300005719 Ga0068861_100166465 Ga0068861_1001664652 132
210 3300005834 Ga0068851_10947323 Ga0068851_109473232 132
211 3300005842 Ga0068858_100000352 Ga0068858_10000035243 132
212 3300005842 Ga0068858_100001656 Ga0068858_10000165614 132
213 3300005844 Ga0068862_101091742 Ga0068862_1010917422 132
214 3300005937 Ga0081455_10404061 Ga0081455_104040612 132
215 3300006038 Ga0075365_10011682 Ga0075365_100116824 132
216 3300006038 Ga0075365_10017919 Ga0075365_100179197 132
217 3300006038 Ga0075365_10831908 Ga0075365_108319081 132
218 3300006051 Ga0075364_10010433 Ga0075364_100104332 132
219 3300006051 Ga0075364_10104148 Ga0075364_101041482 132
220 3300006051 Ga0075364_10110610 Ga0075364_101106102 132
221 3300006058 Ga0075432_10055925 Ga0075432_100559253 132
222 3300006058 Ga0075432_10096218 Ga0075432_100962183 132
223 3300006058 Ga0075432_10113606 Ga0075432_101136062 132
224 3300006058 Ga0075432_10278232 Ga0075432_102782321 132
225 3300006058 Ga0075432_10602777 Ga0075432_106027771 132
226 3300006177 Ga0075362_10056386 Ga0075362_100563862 132
227 3300006177 Ga0075362_10444025 Ga0075362_104440251 132
228 3300006186 Ga0075369_10004738 Ga0075369_100047385 132
229 3300006186 Ga0075369_10143099 Ga0075369_101430993 132
230 3300006237 Ga0097621_100903195 Ga0097621_1009031952 132
231 3300006353 Ga0075370_10065222 Ga0075370_100652222 132
232 3300006358 Ga0068871_100789896 Ga0068871_1007898962 132
233 3300006846 Ga0075430_100468458 Ga0075430_1004684583 132
234 3300006914 Ga0075436_100110011 Ga0075436_1001100112 132
235 3300006914 Ga0075436_100343702 Ga0075436_1003437022 132
236 3300006946 Ga0079104_1000104 Ga0079104_10001047 132
237 3300006946 Ga0079104_1001328 Ga0079104_100132813 132
238 3300006946 Ga0079104_1073514 Ga0079104_10735142 132
239 3300006948 Ga0099826_10004152 Ga0099826_100041523 132
240 3300009011 Ga0105251_10000466 Ga0105251_1000046636 132
241 3300009011 Ga0105251_10034510 Ga0105251_100345102 132
242 3300009011 Ga0105251_10157004 Ga0105251_101570041 132
243 3300009011 Ga0105251_10372385 Ga0105251_103723851 132
244 3300009011 Ga0105251_10519238 Ga0105251_105192382 132
245 3300009036 Ga0105244_10027860 Ga0105244_100278602 132
246 3300009036 Ga0105244_10028008 Ga0105244_100280082 132
247 3300009036 Ga0105244_10147147 Ga0105244_101471473 132
248 3300009036 Ga0105244_10156728 Ga0105244_101567282 132
249 3300009036 Ga0105244_10170343 Ga0105244_101703432 132
250 3300009036 Ga0105244_10180080 Ga0105244_101800802 132
251 3300009092 Ga0105250_10034265 Ga0105250_100342652 132
252 3300009092 Ga0105250_10035115 Ga0105250_100351154 132
253 3300009092 Ga0105250_10060380 Ga0105250_100603801 132
254 3300009092 Ga0105250_10132132 Ga0105250_101321322 132
255 3300009092 Ga0105250_10210668 Ga0105250_102106682 132
256 3300009092 Ga0105250_10227803 Ga0105250_102278032 132
257 3300009092 Ga0105250_10303352 Ga0105250_103033522 132
258 3300009098 Ga0105245_10001436 Ga0105245_100014367 132
259 3300009148 Ga0105243_10049280 Ga0105243_100492804 132
260 3300009148 Ga0105243_10096200 Ga0105243_100962004 132
261 3300009148 Ga0105243_10736276 Ga0105243_107362762 132
262 3300009176 Ga0105242_11572672 Ga0105242_115726722 132
263 3300009177 Ga0105248_10007725 Ga0105248_1000772515 132
264 3300009551 Ga0105238_11554376 Ga0105238_115543762 132
265 3300009553 Ga0105249_10157648 Ga0105249_101576483 132
266 3300012498 Ga0157345_1000879 Ga0157345_10008794 132
267 3300013100 Ga0157373_10000160 Ga0157373_100001608 132
268 3300013100 Ga0157373_10009880 Ga0157373_100098803 132
269 3300013100 Ga0157373_10875215 Ga0157373_108752152 132
270 3300013100 Ga0157373_11159517 Ga0157373_111595171 132
271 3300013102 Ga0157371_10071919 Ga0157371_100719192 132
272 3300013102 Ga0157371_10175867 Ga0157371_101758673 132
273 3300013102 Ga0157371_10257754 Ga0157371_102577542 132
274 3300013104 Ga0157370_10086690 Ga0157370_100866902 132
275 3300013104 Ga0157370_10386681 Ga0157370_103866813 132
276 3300013104 Ga0157370_10630297 Ga0157370_106302972 132
277 3300013105 Ga0157369_10039023 Ga0157369_100390233 132
278 3300013297 Ga0157378_10059990 Ga0157378_100599904 132
279 3300013306 Ga0163162_10015191 Ga0163162_100151913 132
280 3300013306 Ga0163162_10156336 Ga0163162_101563363 132
281 3300013306 Ga0163162_10183183 Ga0163162_101831834 132
282 3300013306 Ga0163162_10299871 Ga0163162_102998714 132
283 3300013306 Ga0163162_10386341 Ga0163162_103863412 132
284 3300013308 Ga0157375_10175495 Ga0157375_101754953 132
285 3300013308 Ga0157375_11178675 Ga0157375_111786752 132
286 3300013308 Ga0157375_11300329 Ga0157375_113003292 132
287 3300013308 Ga0157375_12375899 Ga0157375_123758992 132
288 3300014497 Ga0182008_10007709 Ga0182008_100077097 132
289 3300014497 Ga0182008_10013620 Ga0182008_100136207 132
290 3300014497 Ga0182008_10027370 Ga0182008_100273702 132
291 3300014497 Ga0182008_10068729 Ga0182008_100687292 132
292 3300014497 Ga0182008_10117058 Ga0182008_101170582 132
293 3300014497 Ga0182008_10195381 Ga0182008_101953811 132
294 3300014968 Ga0157379_10724279 Ga0157379_107242792 132
295 3300014969 Ga0157376_11382100 Ga0157376_113821001 132
296 3300015261 Ga0182006_1012939 Ga0182006_10129394 132
297 3300015261 Ga0182006_1096870 Ga0182006_10968702 132
298 3300015262 Ga0182007_10003173 Ga0182007_100031733 132
299 3300015262 Ga0182007_10053020 Ga0182007_100530203 132
300 3300015262 Ga0182007_10137833 Ga0182007_101378332 132
301 3300015265 Ga0182005_1046895 Ga0182005_10468952 132
302 3300015265 Ga0182005_1052573 Ga0182005_10525731 132
303 3300015265 Ga0182005_1052661 Ga0182005_10526612 132
304 3300015265 Ga0182005_1120672 Ga0182005_11206721 132
305 3300015265 Ga0182005_1193945 Ga0182005_11939451 132
306 3300017792 Ga0163161_10120991 Ga0163161_101209912 132
307 3300017792 Ga0163161_10161158 Ga0163161_101611582 132
308 3300017792 Ga0163161_10228308 Ga0163161_102283082 132
309 3300017792 Ga0163161_10410367 Ga0163161_104103672 132
310 3300017792 Ga0163161_11295858 Ga0163161_112958582 132
311 3300021361 Ga0213872_10032524 Ga0213872_100325243 132
312 3300021361 Ga0213872_10163047 Ga0213872_101630472 132
313 3300021361 Ga0213872_10317277 Ga0213872_103172772 132
314 3300025207 Ga0209760_100140 Ga0209760_10014017 132
315 3300025208 Ga0209436_100162 Ga0209436_1001628 132
316 3300025229 Ga0209147_103422 Ga0209147_1034225 132
317 3300025231 Ga0207427_100016 Ga0207427_10001617 132
318 3300025233 Ga0209437_100011 Ga0209437_100011206 132
319 3300025256 Ga0209759_1001860 Ga0209759_10018604 132
320 3300025261 Ga0209233_1000019 Ga0209233_1000019206 132
321 3300025263 Ga0209565_1010830 Ga0209565_10108303 132
322 3300025284 Ga0209130_1000010 Ga0209130_1000010332 132
323 3300025292 Ga0209676_1000308 Ga0209676_100030854 132
324 3300025292 Ga0209676_1000320 Ga0209676_100032053 132
325 3300025292 Ga0209676_1004904 Ga0209676_10049047 132
326 3300025292 Ga0209676_1058390 Ga0209676_10583902 132
327 3300025294 Ga0209025_1000687 Ga0209025_100068753 132
328 3300025294 Ga0209025_1012644 Ga0209025_10126446 132
329 3300025295 Ga0209564_1000025 Ga0209564_100002513 132
330 3300025297 Ga0209758_1046347 Ga0209758_10463472 132
331 3300025298 Ga0209050_1000466 Ga0209050_100046642 132
332 3300025298 Ga0209050_1000911 Ga0209050_100091117 132
333 3300025298 Ga0209050_1011196 Ga0209050_10111964 132
334 3300025298 Ga0209050_1016963 Ga0209050_10169632 132
335 3300025299 Ga0209256_1002250 Ga0209256_10022502 132
336 3300025299 Ga0209256_1059132 Ga0209256_10591322 132
337 3300025302 Ga0207426_1000036 Ga0207426_1000036332 132
338 3300025303 Ga0209051_1001718 Ga0209051_100171817 132
339 3300025303 Ga0209051_1023299 Ga0209051_10232993 132
340 3300025304 Ga0209257_1000338 Ga0209257_100033853 132
341 3300025304 Ga0209257_1005664 Ga0209257_100566411 132
342 3300025304 Ga0209257_1006123 Ga0209257_10061239 132
343 3300025321 Ga0207656_10675497 Ga0207656_106754971 132
344 3300025711 Ga0207696_1000065 Ga0207696_1000065176 132
345 3300025711 Ga0207696_1024123 Ga0207696_10241233 132
346 3300025711 Ga0207696_1053180 Ga0207696_10531802 132
347 3300025711 Ga0207696_1121838 Ga0207696_11218382 132
348 3300025728 Ga0207655_1001270 Ga0207655_100127022 132
349 3300025728 Ga0207655_1053490 Ga0207655_10534903 132
350 3300025728 Ga0207655_1058326 Ga0207655_10583263 132
351 3300025735 Ga0207713_1000269 Ga0207713_100026922 132
352 3300025735 Ga0207713_1031081 Ga0207713_10310814 132
353 3300025735 Ga0207713_1059262 Ga0207713_10592622 132
354 3300025735 Ga0207713_1096087 Ga0207713_10960871 132
355 3300025914 Ga0207671_10031074 Ga0207671_100310745 132
356 3300025915 Ga0207693_10152945 Ga0207693_101529452 132
357 3300025919 Ga0207657_10237338 Ga0207657_102373383 132
358 3300025923 Ga0207681_10129611 Ga0207681_101296114 132
359 3300025927 Ga0207687_10006357 Ga0207687_100063575 132
360 3300025931 Ga0207644_11244799 Ga0207644_112447991 132
361 3300025932 Ga0207690_10184943 Ga0207690_101849433 132
362 3300025933 Ga0207706_10113871 Ga0207706_101138712 132
363 3300025935 Ga0207709_10138897 Ga0207709_101388971 132
364 3300025935 Ga0207709_11136771 Ga0207709_111367711 132
365 3300025941 Ga0207711_10012751 Ga0207711_100127516 132
366 3300025945 Ga0207679_11101425 Ga0207679_111014252 132
367 3300025949 Ga0207667_10164706 Ga0207667_101647064 132
368 3300025960 Ga0207651_10860459 Ga0207651_108604592 132
369 3300025961 Ga0207712_10075390 Ga0207712_100753902 132
370 3300025986 Ga0207658_10662785 Ga0207658_106627852 132
371 3300026035 Ga0207703_10001551 Ga0207703_100015519 132
372 3300026035 Ga0207703_10001574 Ga0207703_1000157413 132
373 3300026035 Ga0207703_10727604 Ga0207703_107276042 132
374 3300026095 Ga0207676_10000169 Ga0207676_1000016929 132
375 3300026095 Ga0207676_10016717 Ga0207676_100167176 132
376 3300026118 Ga0207675_100088146 Ga0207675_1000881462 132
377 3300026121 Ga0207683_10150499 Ga0207683_101504992 132
378 3300027111 Ga0209281_1000026 Ga0209281_1000026167 132
379 3300027111 Ga0209281_1000717 Ga0209281_10007179 132
380 3300027111 Ga0209281_1004352 Ga0209281_10043527 132
381 3300027312 Ga0209371_1015214 Ga0209371_10152142 132
382 3300027666 Ga0209282_1008607 Ga0209282_10086074 132
383 3300027907 Ga0207428_10049800 Ga0207428_100498004 132
384 3300027907 Ga0207428_10092593 Ga0207428_100925933 132
385 3300027907 Ga0207428_10231474 Ga0207428_102314742 132
386 3300027907 Ga0207428_10506715 Ga0207428_105067152 132
387 3300028379 Ga0268266_10204833 Ga0268266_102048332 132
388 3300028379 Ga0268266_10723832 Ga0268266_107238323 132
389 3300028786 Ga0307517_10281107 Ga0307517_102811072 132
390 3300028794 Ga0307515_10024017 Ga0307515_100240179 132
391 3300030731 Ga0316177_1190406 Ga0316177_11904065 132
392 3300030734 Ga0316179_1092971 Ga0316179_10929713 132
393 3300030735 Ga0316178_1122809 Ga0316178_11228095 132
394 3300030742 Ga0316183_1049590 Ga0316183_10495902 132
395 3300030744 Ga0316181_1086264 Ga0316181_10862642 132
396 3300031238 Ga0265332_10053652 Ga0265332_100536523 132
397 3300031240 Ga0265320_10003123 Ga0265320_100031239 132
398 3300031456 Ga0307513_10906385 Ga0307513_109063851 132
399 3300031548 Ga0307408_100191072 Ga0307408_1001910721 132
400 3300031548 Ga0307408_100231849 Ga0307408_1002318492 132
401 3300031548 Ga0307408_100233888 Ga0307408_1002338883 132
402 3300031595 Ga0265313_10024553 Ga0265313_100245534 132
403 3300031616 Ga0307508_10019520 Ga0307508_100195205 132
404 3300031711 Ga0265314_10016259 Ga0265314_100162596 132
405 3300031731 Ga0307405_10018767 Ga0307405_100187674 132
406 3300031731 Ga0307405_10613597 Ga0307405_106135972 132
407 3300031731 Ga0307405_10816243 Ga0307405_108162431 132
408 3300031731 Ga0307405_11148512 Ga0307405_111485121 132
409 3300031824 Ga0307413_10038575 Ga0307413_100385756 132
410 3300031852 Ga0307410_10427034 Ga0307410_104270342 132
411 3300031901 Ga0307406_10149843 Ga0307406_101498432 132
412 3300031901 Ga0307406_10940704 Ga0307406_109407042 132
413 3300031903 Ga0307407_10559516 Ga0307407_105595161 132
414 3300031903 Ga0307407_10587893 Ga0307407_105878932 132
415 3300031903 Ga0307407_11380459 Ga0307407_113804591 132
416 3300031911 Ga0307412_10005974 Ga0307412_100059748 132
417 3300031911 Ga0307412_10130162 Ga0307412_101301622 132
418 3300031911 Ga0307412_10756137 Ga0307412_107561372 132
419 3300031995 Ga0307409_101213218 Ga0307409_1012132182 132
420 3300031995 Ga0307409_101524136 Ga0307409_1015241362 132
421 3300032002 Ga0307416_100138423 Ga0307416_1001384232 132
422 3300032002 Ga0307416_100347869 Ga0307416_1003478693 132
423 3300032002 Ga0307416_101227973 Ga0307416_1012279733 132
424 3300032004 Ga0307414_10011896 Ga0307414_100118967 132
425 3300032004 Ga0307414_10084898 Ga0307414_100848984 132
426 3300032004 Ga0307414_10161278 Ga0307414_101612784 132
427 3300032004 Ga0307414_10163398 Ga0307414_101633984 132
428 3300032004 Ga0307414_10402729 Ga0307414_104027293 132
429 3300032004 Ga0307414_10701448 Ga0307414_107014482 132
430 3300032004 Ga0307414_11078803 Ga0307414_110788032 132
431 3300032005 Ga0307411_10116667 Ga0307411_101166673 132
432 3300032005 Ga0307411_11153981 Ga0307411_111539812 132
433 3300032126 Ga0307415_100927767 Ga0307415_1009277672 132
434 3300032126 Ga0307415_100968663 Ga0307415_1009686632 132
435 3300035398 Ga0316574_0171125 Ga0316574_0171125_946_1347 132
436 3300035724 Ga0373933_0456734 Ga0373933_0456734_246_647 132
437 3300037312 Ga0395899_0001089 Ga0395899_0001089_22257_22664 132
438 3300037312 Ga0395899_0335206 Ga0395899_0335206_147_557 132
439 3300037418 Ga0395900_0000108 Ga0395900_0000108_144518_144925 132
440 3300037418 Ga0395900_0007617 Ga0395900_0007617_8989_9399 132
441 3300037418 Ga0395900_0222737 Ga0395900_0222737_882_1292 132
442 3300037418 Ga0395900_0670367 Ga0395900_0670367_376_786 132
443 3300037466 Ga0395898_0009141 Ga0395898_0009141_9877_10287 132
444 3300037466 Ga0395898_0060019 Ga0395898_0060019_1717_2124 132
445 3300037466 Ga0395898_0185182 Ga0395898_0185182_914_1324 132
446 3300037471 Ga0395905_0026339 Ga0395905_0026339_2946_3353 132
447 3300037471 Ga0395905_1411360 Ga0395905_1411360_126_533 132
448 3300037471 Ga0395905_1701214 Ga0395905_1701214_40_447 132
449 3300037853 Ga0436364_0051522 Ga0436364_0051522_1660_2070 132
450 3300037853 Ga0436364_0061348 Ga0436364_0061348_593_1009 132
451 3300038443 Ga0395901_0000023 Ga0395901_0000023_90954_91364 132
452 3300038443 Ga0395901_0000050 Ga0395901_0000050_165375_165782 132
453 3300038443 Ga0395901_0000183 Ga0395901_0000183_79079_79489 132
454 3300038443 Ga0395901_0003967 Ga0395901_0003967_633_1043 132
455 3300038443 Ga0395901_0237761 Ga0395901_0237761_1200_1610 132
456 3300038443 Ga0395901_0473364 Ga0395901_0473364_451_861 132
457 3300039447 Ga0436361_0513574 Ga0436361_0513574_93_491 132
458 3300039447 Ga0436361_0576973 Ga0436361_0576973_2491_2898 132
459 3300039447 Ga0436361_0821550 Ga0436361_0821550_596_1003 132
460 3300039447 Ga0436361_1103751 Ga0436361_1103751_365_766 132
461 3300039450 Ga0436363_0741000 Ga0436363_0741000_843_1259 132
462 3300039453 Ga0436362_0250573 Ga0436362_0250573_426_842 132
463 3300041405 Ga0439438_000385 Ga0439438_000385_13552_13965 132
464 3300041405 Ga0439438_001237 Ga0439438_001237_9867_10265 132
465 3300041405 Ga0439438_002736 Ga0439438_002736_6273_6689 132
466 3300041405 Ga0439438_009887 Ga0439438_009887_1986_2384 132
467 3300041405 Ga0439438_046412 Ga0439438_046412_374_781 132
468 3300041405 Ga0439438_064997 Ga0439438_064997_192_599 132
469 3300041407 Ga0439447_019572 Ga0439447_019572_607_1023 132
470 3300041407 Ga0439447_032890 Ga0439447_032890_408_806 132
471 3300041407 Ga0439447_037780 Ga0439447_037780_60_467 132
472 3300041411 Ga0439466_0003407 Ga0439466_0003407_402_800 132
473 3300041411 Ga0439466_0004719 Ga0439466_0004719_4302_4709 132
474 3300041411 Ga0439466_0014078 Ga0439466_0014078_1757_2155 132
475 3300041411 Ga0439466_0079893 Ga0439466_0079893_423_830 132
476 3300042004 Ga0439445_0044591 Ga0439445_0044591_569_985 132
477 3300042004 Ga0439445_0048139 Ga0439445_0048139_548_946 132
478 3300042004 Ga0439445_0210972 Ga0439445_0210972_14_427 132
479 3300042006 Ga0439432_000116 Ga0439432_000116_8081_8479 132
480 3300042006 Ga0439432_002197 Ga0439432_002197_921_1337 132
481 3300042006 Ga0439432_008638 Ga0439432_008638_1695_2102 132
482 3300042006 Ga0439432_058708 Ga0439432_058708_218_625 132
483 3300042006 Ga0439432_061222 Ga0439432_061222_80_478 132
484 3300042006 Ga0439432_067791 Ga0439432_067791_682_1080 132
485 3300042009 Ga0439451_000777 Ga0439451_000777_3699_4106 132
486 3300042009 Ga0439451_001521 Ga0439451_001521_2532_2939 132
487 3300042009 Ga0439451_005945 Ga0439451_005945_1051_1449 132
488 3300042009 Ga0439451_032790 Ga0439451_032790_127_534 132
489 3300042010 Ga0439452_000530 Ga0439452_000530_18046_18444 132
490 3300042010 Ga0439452_003840 Ga0439452_003840_28_435 132
491 3300042010 Ga0439452_051112 Ga0439452_051112_483_899 132
492 3300042013 Ga0439456_003572 Ga0439456_003572_2073_2480 132
493 3300042013 Ga0439456_008683 Ga0439456_008683_1574_1972 132
494 3300042013 Ga0439456_008846 Ga0439456_008846_663_1070 132
495 3300042013 Ga0439456_013705 Ga0439456_013705_1058_1465 132
496 3300042016 Ga0439463_005539 Ga0439463_005539_1103_1510 132
497 3300042016 Ga0439463_014377 Ga0439463_014377_687_1106 132
498 3300042016 Ga0439463_030225 Ga0439463_030225_205_603 132
499 3300042016 Ga0439463_098875 Ga0439463_098875_274_681 132
500 3300042115 Ga0450911_000394 Ga0450911_000394_1994_2392 132
501 3300042115 Ga0450911_008569 Ga0450911_008569_407_814 132
502 3300042115 Ga0450911_014078 Ga0450911_014078_291_698 132
503 3300042136 Ga0450900_001734 Ga0450900_001734_1339_1737 132
504 3300042137 Ga0450902_013760 Ga0450902_013760_238_636 132
505 3300042137 Ga0450902_015032 Ga0450902_015032_634_1041 132
506 3300042137 Ga0450902_015424 Ga0450902_015424_626_1033 132
507 3300042138 Ga0450903_013304 Ga0450903_013304_454_861 132
508 3300042139 Ga0450904_005957 Ga0450904_005957_779_1177 132
509 3300042142 Ga0450905_010235 Ga0450905_010235_231_638 132
510 3300042142 Ga0450905_016590 Ga0450905_016590_215_622 132
511 3300042142 Ga0450905_023307 Ga0450905_023307_446_844 132
512 3300042145 Ga0450906_000140 Ga0450906_000140_1779_2177 132
513 3300042146 Ga0450907_001261 Ga0450907_001261_2523_2930 132
514 3300042146 Ga0450907_033870 Ga0450907_033870_37_444 132
515 3300042156 Ga0439446_0001111 Ga0439446_0001111_832_1239 132
516 3300042185 Ga0450909_001851 Ga0450909_001851_752_1159 132
517 3300042185 Ga0450909_007526 Ga0450909_007526_395_811 132
518 3300042435 Ga0439434_0001029 Ga0439434_0001029_5203_5610 132
519 3300042436 Ga0439435_0019100 Ga0439435_0019100_318_725 132
520 3300042461 Ga0439460_0007980 Ga0439460_0007980_531_938 132
521 3300042461 Ga0439460_0338570 Ga0439460_0338570_29_436 132
522 3300042531 Ga0450918_013240 Ga0450918_013240_786_1184 132
523 3300042532 Ga0450893_0028057 Ga0450893_0028057_481_888 132
524 3300042533 Ga0450901_003932 Ga0450901_003932_1025_1432 132
525 3300042993 Ga0439440_0003458 Ga0439440_0003458_531_938 132
526 3300044656 Ga0466969_0045482 Ga0466969_0045482_1593_2003 132
527 3300044656 Ga0466969_0154463 Ga0466969_0154463_371_778 132
528 3300044683 Ga0466965_0012519 Ga0466965_0012519_799_1209 132
529 3300044684 Ga0466966_0028921 Ga0466966_0028921_3019_3429 132
530 3300044693 Ga0466961_0000467 Ga0466961_0000467_20778_21206 132
531 3300044693 Ga0466961_0093771 Ga0466961_0093771_637_1047 132
532 3300044693 Ga0466961_0117619 Ga0466961_0117619_440_853 132
533 3300044694 Ga0466963_0117680 Ga0466963_0117680_1348_1776 132
534 3300044719 Ga0466971_0291496 Ga0466971_0291496_114_524 132
535 3300044765 Ga0466970_0658095 Ga0466970_0658095_100_501 132
536 3300044842 Ga0466957_0148978 Ga0466957_0148978_909_1319 132
537 3300045049 Ga0466959_0055078 Ga0466959_0055078_309_719 132
538 3300045049 Ga0466959_0385630 Ga0466959_0385630_55_462 132
539 3300045836 Ga0466958_0180722 Ga0466958_0180722_528_956 132
540 3300045976 Ga0466967_0531768 Ga0466967_0531768_307_708 132
541 3300045976 Ga0466967_0687015 Ga0466967_0687015_465_866 132
542 3300046452 Ga0495617_003151 Ga0495617_003151_1651_2058 132
543 3300046452 Ga0495617_037873 Ga0495617_037873_593_1000 132
544 3300046452 Ga0495617_129350 Ga0495617_129350_83_487 132
545 3300046453 Ga0495627_000084 Ga0495627_000084_27170_27580 132
546 3300046453 Ga0495627_002251 Ga0495627_002251_8593_9000 132
547 3300046455 Ga0495603_0492377 Ga0495603_0492377_210_611 132
548 3300046457 Ga0495590_0055542 Ga0495590_0055542_646_1053 132
549 3300046457 Ga0495590_0206280 Ga0495590_0206280_73_480 132
550 3300046458 Ga0495591_026286 Ga0495591_026286_649_1056 132
551 3300046458 Ga0495591_032156 Ga0495591_032156_752_1159 132
552 3300046458 Ga0495591_037994 Ga0495591_037994_428_835 132
553 3300046460 Ga0495638_0012479 Ga0495638_0012479_3965_4372 132
554 3300046460 Ga0495638_0035413 Ga0495638_0035413_2152_2559 132
555 3300046460 Ga0495638_0143926 Ga0495638_0143926_527_934 132
556 3300046460 Ga0495638_0221501 Ga0495638_0221501_38_445 132
557 3300046460 Ga0495638_0226256 Ga0495638_0226256_259_666 132
558 3300046460 Ga0495638_0330955 Ga0495638_0330955_251_658 132
559 3300046463 Ga0495653_0000002 Ga0495653_0000002_256197_256598 132
560 3300046471 Ga0495650_0001827 Ga0495650_0001827_17165_17572 132
561 3300046471 Ga0495650_0045347 Ga0495650_0045347_826_1233 132
562 3300046471 Ga0495650_0048377 Ga0495650_0048377_920_1327 132
563 3300046471 Ga0495650_0194304 Ga0495650_0194304_101_508 132
564 3300046474 Ga0495605_0012973 Ga0495605_0012973_3267_3674 132
565 3300046474 Ga0495605_0068505 Ga0495605_0068505_1168_1575 132
566 3300046491 Ga0495584_0001126 Ga0495584_0001126_14249_14656 132
567 3300046491 Ga0495584_0007670 Ga0495584_0007670_4296_4703 132
568 3300046491 Ga0495584_0011807 Ga0495584_0011807_2747_3157 132
569 3300046491 Ga0495584_0174600 Ga0495584_0174600_249_656 132
570 3300046491 Ga0495584_0198640 Ga0495584_0198640_10_417 132
571 3300046491 Ga0495584_0288602 Ga0495584_0288602_149_556 132
572 3300046492 Ga0495585_0010752 Ga0495585_0010752_1335_1736 132
573 3300046492 Ga0495585_0049349 Ga0495585_0049349_1582_1989 132
574 3300046492 Ga0495585_0184055 Ga0495585_0184055_367_771 132
575 3300046492 Ga0495585_0231133 Ga0495585_0231133_418_825 132
576 3300046501 Ga0495607_0006943 Ga0495607_0006943_5977_6384 132
577 3300046501 Ga0495607_0016609 Ga0495607_0016609_2601_3008 132
578 3300046501 Ga0495607_0058021 Ga0495607_0058021_915_1322 132
579 3300046501 Ga0495607_0070545 Ga0495607_0070545_136_549 132
580 3300046501 Ga0495607_0076441 Ga0495607_0076441_40_453 132
581 3300046501 Ga0495607_0135233 Ga0495607_0135233_440_847 132
582 3300046501 Ga0495607_0200079 Ga0495607_0200079_512_919 132
583 3300046506 Ga0495583_0012627 Ga0495583_0012627_3296_3703 132
584 3300046506 Ga0495583_0079955 Ga0495583_0079955_570_977 132
585 3300046507 Ga0495606_0000030 Ga0495606_0000030_220412_220813 132
586 3300046507 Ga0495606_0044498 Ga0495606_0044498_2229_2636 132
587 3300046507 Ga0495606_0147132 Ga0495606_0147132_551_958 132
588 3300046507 Ga0495606_0263774 Ga0495606_0263774_207_620 132
589 3300046512 Ga0495610_0046596 Ga0495610_0046596_716_1123 132
590 3300046512 Ga0495610_0057847 Ga0495610_0057847_379_786 132
591 3300046512 Ga0495610_0140347 Ga0495610_0140347_229_630 132
592 3300046512 Ga0495610_0180453 Ga0495610_0180453_85_492 132
593 3300046512 Ga0495610_0183170 Ga0495610_0183170_24_431 132
594 3300046513 Ga0495616_0047259 Ga0495616_0047259_847_1254 132
595 3300046513 Ga0495616_0075085 Ga0495616_0075085_587_994 132
596 3300046515 Ga0495620_0011042 Ga0495620_0011042_148_555 132
597 3300046515 Ga0495620_0037582 Ga0495620_0037582_442_849 132
598 3300046517 Ga0495630_0307968 Ga0495630_0307968_145_552 132
599 3300046518 Ga0495631_0219270 Ga0495631_0219270_217_618 132
600 3300046518 Ga0495631_0349253 Ga0495631_0349253_134_544 132
601 3300046519 Ga0495632_0000049 Ga0495632_0000049_54267_54677 132
602 3300046519 Ga0495632_0001609 Ga0495632_0001609_14972_15379 132
603 3300046519 Ga0495632_0003183 Ga0495632_0003183_7897_8298 132
604 3300046519 Ga0495632_0008656 Ga0495632_0008656_4758_5165 132
605 3300046519 Ga0495632_0021306 Ga0495632_0021306_572_979 132
606 3300046519 Ga0495632_0057376 Ga0495632_0057376_1137_1544 132
607 3300046519 Ga0495632_0096956 Ga0495632_0096956_269_682 132
608 3300046519 Ga0495632_0273459 Ga0495632_0273459_137_544 132
609 3300046519 Ga0495632_0318396 Ga0495632_0318396_48_455 132
610 3300046520 Ga0495637_0003277 Ga0495637_0003277_6103_6510 132
611 3300046520 Ga0495637_0004271 Ga0495637_0004271_3746_4156 132
612 3300046520 Ga0495637_0005172 Ga0495637_0005172_698_1105 132
613 3300046520 Ga0495637_0022273 Ga0495637_0022273_102_509 132
614 3300046520 Ga0495637_0056987 Ga0495637_0056987_818_1225 132
615 3300046520 Ga0495637_0075001 Ga0495637_0075001_503_910 132
616 3300046520 Ga0495637_0099281 Ga0495637_0099281_345_752 132
617 3300046520 Ga0495637_0110098 Ga0495637_0110098_156_560 132
618 3300046522 Ga0495643_0000047 Ga0495643_0000047_32539_32949 132
619 3300046522 Ga0495643_0020755 Ga0495643_0020755_2601_3008 132
620 3300046522 Ga0495643_0103929 Ga0495643_0103929_530_937 132
621 3300046522 Ga0495643_0114878 Ga0495643_0114878_525_929 132
622 3300046522 Ga0495643_0131869 Ga0495643_0131869_610_1017 132
623 3300046522 Ga0495643_0263596 Ga0495643_0263596_220_621 132
624 3300046522 Ga0495643_0329233 Ga0495643_0329233_273_671 132
625 3300046522 Ga0495643_0383264 Ga0495643_0383264_13_420 132
626 3300046523 Ga0495644_0001046 Ga0495644_0001046_10278_10685 132
627 3300046524 Ga0495648_0003342 Ga0495648_0003342_4398_4808 132
628 3300046524 Ga0495648_0035719 Ga0495648_0035719_2451_2858 132
629 3300046524 Ga0495648_0160862 Ga0495648_0160862_364_765 132
630 3300046524 Ga0495648_0229872 Ga0495648_0229872_462_869 132
631 3300046524 Ga0495648_0241593 Ga0495648_0241593_42_452 132
632 3300046525 Ga0495663_0000009 Ga0495663_0000009_109907_110317 132
633 3300046528 Ga0495642_0001171 Ga0495642_0001171_3001_3408 132
634 3300046530 Ga0495654_0026985 Ga0495654_0026985_1688_2095 132
635 3300046530 Ga0495654_0044804 Ga0495654_0044804_915_1322 132
636 3300046530 Ga0495654_0088465 Ga0495654_0088465_610_1017 132
637 3300046530 Ga0495654_0103363 Ga0495654_0103363_387_794 132
638 3300046530 Ga0495654_0201057 Ga0495654_0201057_195_602 132
639 3300046538 Ga0495609_0029481 Ga0495609_0029481_598_1005 132
640 3300046542 Ga0495597_0005474 Ga0495597_0005474_1301_1708 132
641 3300046542 Ga0495597_0019740 Ga0495597_0019740_2041_2448 132
642 3300046542 Ga0495597_0044582 Ga0495597_0044582_806_1213 132
643 3300046542 Ga0495597_0052307 Ga0495597_0052307_1378_1785 132
644 3300046557 Ga0495622_0141025 Ga0495622_0141025_675_1082 132
645 3300046558 Ga0495633_0000402 Ga0495633_0000402_44270_44680 132
646 3300046558 Ga0495633_0000434 Ga0495633_0000434_18090_18500 132
647 3300046558 Ga0495633_0004035 Ga0495633_0004035_1516_1923 132
648 3300046558 Ga0495633_0004360 Ga0495633_0004360_3394_3795 132
649 3300046615 Ga0495656_0194998 Ga0495656_0194998_490_897 132
650 3300046616 Ga0495668_0042326 Ga0495668_0042326_649_1056 132
651 3300046648 Ga0495611_0041298 Ga0495611_0041298_916_1323 132
652 3300046648 Ga0495611_0423089 Ga0495611_0423089_139_546 132
653 3300046660 Ga0495625_0108601 Ga0495625_0108601_697_1104 132
654 3300046660 Ga0495625_0133767 Ga0495625_0133767_18_431 132
655 3300046660 Ga0495625_0159878 Ga0495625_0159878_187_588 132
656 3300046660 Ga0495625_0194017 Ga0495625_0194017_780_1181 132
657 3300046664 Ga0495659_0001130 Ga0495659_0001130_5029_5460 132
658 3300046664 Ga0495659_0001680 Ga0495659_0001680_1963_2370 132
659 3300046664 Ga0495659_0056101 Ga0495659_0056101_182_589 132
660 3300046665 Ga0495661_0010223 Ga0495661_0010223_1487_1894 132
661 3300046665 Ga0495661_0041195 Ga0495661_0041195_1682_2089 132
662 3300046665 Ga0495661_0078637 Ga0495661_0078637_613_1020 132
663 3300046665 Ga0495661_0248906 Ga0495661_0248906_67_471 132
664 3300046684 Ga0495669_0000275 Ga0495669_0000275_26228_26635 132
665 3300046691 Ga0495670_0002606 Ga0495670_0002606_2140_2547 132
666 3300046691 Ga0495670_0024396 Ga0495670_0024396_2175_2582 132
667 3300046691 Ga0495670_0092817 Ga0495670_0092817_696_1103 132
668 3300046691 Ga0495670_0295589 Ga0495670_0295589_386_793 132
669 3300046691 Ga0495670_0785792 Ga0495670_0785792_51_458 132
670 3300046692 Ga0495671_0000038 Ga0495671_0000038_140745_141155 132
671 3300046692 Ga0495671_0000260 Ga0495671_0000260_5038_5469 132
672 3300046692 Ga0495671_0026849 Ga0495671_0026849_2118_2534 132
673 3300046692 Ga0495671_0075028 Ga0495671_0075028_656_1063 132
674 3300046692 Ga0495671_0076788 Ga0495671_0076788_1043_1450 132
675 3300046692 Ga0495671_0079974 Ga0495671_0079974_90_497 132
676 3300046692 Ga0495671_0195474 Ga0495671_0195474_15_422 132
677 3300046694 Ga0495649_0023742 Ga0495649_0023742_1284_1691 132
678 3300046694 Ga0495649_0026244 Ga0495649_0026244_2509_2916 132
679 3300046694 Ga0495649_0138218 Ga0495649_0138218_297_704 132
680 3300046694 Ga0495649_0223118 Ga0495649_0223118_282_689 132
681 3300046694 Ga0495649_0264858 Ga0495649_0264858_177_584 132
682 3300046794 Ga0495589_0046821 Ga0495589_0046821_1496_1897 132
683 3300046794 Ga0495589_0076146 Ga0495589_0076146_32_439 132
684 3300046794 Ga0495589_0197770 Ga0495589_0197770_411_818 132
685 3300046810 Ga0495660_0000049 Ga0495660_0000049_74589_74993 132
686 3300046810 Ga0495660_0000715 Ga0495660_0000715_12111_12524 132
687 3300046810 Ga0495660_0087100 Ga0495660_0087100_612_1019 132
688 3300046810 Ga0495660_0098444 Ga0495660_0098444_86_493 132
689 3300046810 Ga0495660_0151269 Ga0495660_0151269_349_756 132
690 3300047318 Ga0495636_0075725 Ga0495636_0075725_759_1166 132
691 3300047320 Ga0495672_0000184 Ga0495672_0000184_23504_23935 132
692 3300047320 Ga0495672_0014058 Ga0495672_0014058_4492_4899 132
693 3300047320 Ga0495672_0022104 Ga0495672_0022104_2628_3035 132
694 3300047320 Ga0495672_0033995 Ga0495672_0033995_369_776 132
695 3300047320 Ga0495672_0118564 Ga0495672_0118564_583_990 132
696 3300047320 Ga0495672_0119672 Ga0495672_0119672_607_1014 132
697 3300047322 Ga0495680_0005487 Ga0495680_0005487_846_1253 132
698 3300047323 Ga0495683_0084569 Ga0495683_0084569_615_1022 132
699 3300047443 Ga0495687_037674 Ga0495687_037674_593_1000 132
700 3300047443 Ga0495687_120242 Ga0495687_120242_424_831 132
701 3300047443 Ga0495687_128256 Ga0495687_128256_63_470 132
702 3300047445 Ga0495677_0007520 Ga0495677_0007520_530_937 132
703 3300047446 Ga0495679_004730 Ga0495679_004730_1580_1987 132
704 3300047447 Ga0495685_001865 Ga0495685_001865_4341_4748 132
705 3300047469 Ga0495673_0015870 Ga0495673_0015870_2846_3253 132
706 3300047469 Ga0495673_0061895 Ga0495673_0061895_750_1157 132
707 3300047469 Ga0495673_0117662 Ga0495673_0117662_149_556 132
708 3300047470 Ga0495681_0002988 Ga0495681_0002988_8590_9000 132
709 3300047470 Ga0495681_0040661 Ga0495681_0040661_248_655 132
710 3300047470 Ga0495681_0041400 Ga0495681_0041400_955_1362 132
711 3300047470 Ga0495681_0065823 Ga0495681_0065823_257_664 132
712 3300047470 Ga0495681_0110354 Ga0495681_0110354_718_1119 132
713 3300047472 Ga0495686_0000624 Ga0495686_0000624_37872_38279 132
714 3300047472 Ga0495686_0008888 Ga0495686_0008888_1116_1529 132
715 3300047472 Ga0495686_0094687 Ga0495686_0094687_1229_1639 132
716 3300047472 Ga0495686_0098273 Ga0495686_0098273_1117_1518 132
717 3300047472 Ga0495686_0197160 Ga0495686_0197160_180_587 132
718 3300047472 Ga0495686_0312935 Ga0495686_0312935_391_798 132
719 3300047673 Ga0495593_0191954 Ga0495593_0191954_300_707 132
720 3300048090 Ga0495615_0004325 Ga0495615_0004325_382_783 132
721 3300048091 Ga0495626_0002902 Ga0495626_0002902_2610_3017 132
722 3300048091 Ga0495626_0010145 Ga0495626_0010145_2879_3286 132
723 3300048091 Ga0495626_0155775 Ga0495626_0155775_288_695 132
724 3300048091 Ga0495626_0421924 Ga0495626_0421924_44_448 132
725 3300048904 Ga0496101_0319322 Ga0496101_0319322_744_1175 132
726 3300048905 Ga0496102_0114691 Ga0496102_0114691_401_811 132
727 3300048905 Ga0496102_0174812 Ga0496102_0174812_442_873 132
728 3300048910 Ga0496107_0165459 Ga0496107_0165459_212_622 132
729 3300048911 Ga0496108_0065617 Ga0496108_0065617_2609_3040 132
730 3300048912 Ga0496109_0195701 Ga0496109_0195701_545_976 132
731 3300048913 Ga0496110_0347135 Ga0496110_0347135_815_1246 132
732 3300048915 Ga0496112_0130016 Ga0496112_0130016_951_1382 132
733 3300048915 Ga0496112_0358674 Ga0496112_0358674_422_829 132
734 3300048919 Ga0496116_0044785 Ga0496116_0044785_1741_2142 132
735 3300048920 Ga0496117_0020723 Ga0496117_0020723_3430_3837 132
736 3300048920 Ga0496117_0080759 Ga0496117_0080759_937_1338 132
737 3300048920 Ga0496117_0089952 Ga0496117_0089952_389_796 132
738 3300048921 Ga0496118_0002611 Ga0496118_0002611_8788_9195 132
739 3300048921 Ga0496118_0026316 Ga0496118_0026316_4209_4616 132
740 3300048921 Ga0496118_0196829 Ga0496118_0196829_95_499 132
741 3300048921 Ga0496118_0494061 Ga0496118_0494061_130_531 132
742 3300048924 Ga0496121_0000005 Ga0496121_0000005_1015432_1015833 132
743 3300048924 Ga0496121_0245350 Ga0496121_0245350_448_849 132
744 3300048924 Ga0496121_0276913 Ga0496121_0276913_682_1086 132
745 3300048924 Ga0496121_0482982 Ga0496121_0482982_332_739 132
746 3300048924 Ga0496121_0654822 Ga0496121_0654822_50_451 132
747 3300048925 Ga0496122_0002889 Ga0496122_0002889_21798_22199 132
748 3300048925 Ga0496122_0049685 Ga0496122_0049685_2042_2443 132
749 3300048926 Ga0496123_0085631 Ga0496123_0085631_1333_1734 132
750 3300048926 Ga0496123_0138664 Ga0496123_0138664_730_1131 132
751 3300048927 Ga0496124_0000672 Ga0496124_0000672_28211_28615 132
752 3300048927 Ga0496124_0053423 Ga0496124_0053423_2405_2812 132
753 3300048927 Ga0496124_0077797 Ga0496124_0077797_118_528 132
754 3300048927 Ga0496124_0128318 Ga0496124_0128318_599_1000 132
755 3300048927 Ga0496124_0155165 Ga0496124_0155165_1328_1735 132
756 3300048927 Ga0496124_0310924 Ga0496124_0310924_364_765 132
757 3300048927 Ga0496124_0382424 Ga0496124_0382424_239_649 132
758 3300048928 Ga0496125_0001126 Ga0496125_0001126_1294_1695 132
759 3300048928 Ga0496125_0012345 Ga0496125_0012345_6657_7064 132
760 3300048929 Ga0496126_0037146 Ga0496126_0037146_2078_2479 132
761 3300048929 Ga0496126_0397206 Ga0496126_0397206_543_950 132
762 3300049459 Ga0495678_008089 Ga0495678_008089_767_1174 132
763 3300049459 Ga0495678_013524 Ga0495678_013524_818_1225 132
764 3300049459 Ga0495678_050725 Ga0495678_050725_1034_1435 132
765 3300049459 Ga0495678_076574 Ga0495678_076574_123_530 132
766 3300049459 Ga0495678_087635 Ga0495678_087635_577_984 132
767 3300049459 Ga0495678_107749 Ga0495678_107749_118_519 132
768 3300049460 Ga0495682_0000589 Ga0495682_0000589_23855_24262 132
769 3300049460 Ga0495682_0048705 Ga0495682_0048705_360_767 132
770 3300049531 Ga0501315_045870 Ga0501315_045870_97_513 132
771 3300049570 Ga0501033_0044625 Ga0501033_0044625_12_413 132
772 3300049579 Ga0501043_0049267 Ga0501043_0049267_2183_2584 132
773 3300049579 Ga0501043_0078395 Ga0501043_0078395_679_1080 132
774 3300049582 Ga0501048_1002740 Ga0501048_1002740_185_586 132
775 3300049583 Ga0501067_0039776 Ga0501067_0039776_1908_2324 132
776 3300049583 Ga0501067_0110703 Ga0501067_0110703_942_1343 132
777 3300049665 Ga0501227_023905 Ga0501227_023905_857_1273 132
778 3300049669 Ga0501235_034249 Ga0501235_034249_35_433 132
779 3300049673 Ga0501240_004834 Ga0501240_004834_458_856 132
780 3300049682 Ga0501252_008582 Ga0501252_008582_471_878 132
781 3300049744 Ga0501083_0088400 Ga0501083_0088400_1431_1832 132
782 3300049758 Ga0501241_035562 Ga0501241_035562_109_525 132
783 3300049766 Ga0501269_010422 Ga0501269_010422_273_689 132
784 3300049853 Ga0501226_006893 Ga0501226_006893_754_1170 132
785 3300050489 nmdc:mga03683_199085_c1 nmdc:mga03683_199085_c1_215_616 132
786 3300050489 nmdc:mga03683_273524_c1 nmdc:mga03683_273524_c1_371_772 132
787 3300050489 nmdc:mga03683_35391_c1 nmdc:mga03683_35391_c1_84_491 132
788 3300050491 nmdc:mga00v17_108894_c1 nmdc:mga00v17_108894_c1_866_1273 132
789 3300050491 nmdc:mga00v17_40621_c1 nmdc:mga00v17_40621_c1_1733_2140 132
790 3300050491 nmdc:mga00v17_9237_c1 nmdc:mga00v17_9237_c1_210_611 132
791 3300050492 nmdc:mga0yw44_782711_c1 nmdc:mga0yw44_782711_c1_119_532 132
792 3300050492 nmdc:mga0yw44_96578_c1 nmdc:mga0yw44_96578_c1_1444_1845 132
793 3300050496 nmdc:mga07m45_74270_c1 nmdc:mga07m45_74270_c1_1186_1596 132
794 3300050509 nmdc:mga0qj67_1474047_c1 nmdc:mga0qj67_1474047_c1_94_498 132
795 3300050514 nmdc:mga08x19_171509_c1 nmdc:mga08x19_171509_c1_64_471 132
796 3300050514 nmdc:mga08x19_615911_c1 nmdc:mga08x19_615911_c1_103_510 132
797 3300050516 nmdc:mga0sz30_34988_c1 nmdc:mga0sz30_34988_c1_157_558 132
798 3300050516 nmdc:mga0sz30_49060_c2 nmdc:mga0sz30_49060_c2_149_556 132
799 3300053088 Ga0500644_0284158 Ga0500644_0284158_134_535 132
800 3300053111 Ga0500572_206079 Ga0500572_206079_139_540 132
801 3300053125 Ga0500618_000070 Ga0500618_000070_46241_46642 132
802 3300053125 Ga0500618_000344 Ga0500618_000344_30652_31053 132
803 3300053136 Ga0500559_0042345 Ga0500559_0042345_802_1206 132
804 3300053136 Ga0500559_0100952 Ga0500559_0100952_190_597 132
805 3300053156 Ga0500622_0402689 Ga0500622_0402689_62_463 132
806 3300053161 Ga0500634_0021243 Ga0500634_0021243_2724_3134 132
807 3300059508 Ga0587088_013908 Ga0587088_013908_796_1197 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

4

126

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.9951 1 132
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9899 2 132
6ifm-assembly1.cif.gz_C crystal structure of dna bound vapbc from salmonella typhimurium 0.9867 1 132
6sd6-assembly1.cif.gz_C structure of vapbc from shigella sonnei 0.9751 2 132
5ecw-assembly1.cif.gz_B structure of the shigella flexneri vapc mutant d7a 0.9709 1 132
ID Description Score Start End Superfamily
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9709 1 132 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9635 2 132 3.40.50.1010
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9632 1 132 3.40.50.1010
3zvkB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9494 2 132 3.40.50.1010
6nklA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9123 2 131 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A3B0Y3S4-F1-model_v4 VapC toxin protein 0.9968 1 116 GO:0004518
GO:0046872
AF-A0A1I4GVS0-F1-model_v4 tRNA(fMet)-specific endonuclease VapC 0.9927 33 129 GO:0004519
GO:0046872
AF-A0A7Z8QV22-F1-model_v4 PIN domain-containing protein 0.9919 33 132 GO:0004518
GO:0046872
AF-A0A7Y9FNL6-F1-model_v4 tRNA(fMet)-specific endonuclease VapC (EC 3.1.-.-) 0.9891 40 131 GO:0004519
GO:0046872
AF-A0A7W6DCM2-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9881 21 131 GO:0000287
GO:0004540
GO:0090729

Feature Viewer

pLDDT pTM Quality
95.6 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map