F481658

General Info

Members Datasets Scaffolds Average Seq Length
806 260 1612 225

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0062301|Ga0466963_0062301_1626_2414
Length 262
Sequence VDDGRAVREPPVGRHPAQPLGLILDCASRLAGHRCVYTIAAVPVRAFLFDFDGLILDTETASRAGWQWLYRQHGHELPPEKWALMVGTIEGWDPWTHLEGLLGEPLDRPTWNERRYAHELSLLDAEELRPGIAEYLAYAERHGLKRAIVSSASRRWIDMHLERLERVVGWDAIVTADHDAGRAKPRPTLYLEALEEVGVAAEDAVAFEDSPNGASAAKAAGIYVVGIPNAVTADLGLAEHADLVLDSLADLPPEELLARRAA

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 1.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 10.3
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 9.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0062301 3300044694 Bacteria 2495
2 Ga0070658_10023144 3300005327 Bacteria 4988
3 Ga0070658_10052039 3300005327 Bacteria 3320
4 Ga0070658_10069945 3300005327 Bacteria 2872
5 Ga0070683_100144770 3300005329 Bacteria 2251
6 Ga0070680_100007611 3300005336 Bacteria 8262
7 Ga0070680_100052968 3300005336 Bacteria 3312
8 Ga0070680_100077028 3300005336 Bacteria 2746
9 Ga0070680_100128504 3300005336 Bacteria 2118
10 Ga0070682_100095477 3300005337 Bacteria 1952
11 Ga0070682_100195407 3300005337 Unclassified 1423
12 Ga0070682_100246459 3300005337 Bacteria 1286
13 Ga0070682_100346033 3300005337 Unclassified 1107
14 Ga0070660_100004010 3300005339 Bacteria 10165
15 Ga0070660_100008337 3300005339 Bacteria 7245
16 Ga0070660_100112159 3300005339 Unclassified 2170
17 Ga0070660_100119240 3300005339 Bacteria 2104
18 Ga0070691_10038504 3300005341 Bacteria 2258
19 Ga0070661_100020278 3300005344 Bacteria 4738
20 Ga0070661_100107728 3300005344 Bacteria 2078
21 Ga0070661_100222123 3300005344 Bacteria 1449
22 Ga0070671_100109490 3300005355 Bacteria 2320
23 Ga0070659_100004651 3300005366 Bacteria 9804
24 Ga0070659_100241657 3300005366 Bacteria 1494
25 Ga0070709_10015614 3300005434 Bacteria 4324
26 Ga0070709_10039205 3300005434 Bacteria 2906
27 Ga0070709_10388193 3300005434 Bacteria 1040
28 Ga0070714_100043179 3300005435 Bacteria 3811
29 Ga0070714_100045291 3300005435 Bacteria 3728
30 Ga0070714_100049668 3300005435 Bacteria 3571
31 Ga0070714_100055409 3300005435 Archaea 3388
32 Ga0070714_100082110 3300005435 Bacteria 2807
33 Ga0070714_100145507 3300005435 Bacteria 2131
34 Ga0070714_100180757 3300005435 Bacteria 1919
35 Ga0070713_100008162 3300005436 Bacteria 7414
36 Ga0070713_100167501 3300005436 Bacteria 1966
37 Ga0070710_10020558 3300005437 Archaea 3427
38 Ga0070710_10135065 3300005437 Bacteria 1507
39 Ga0070710_10228944 3300005437 Unclassified 1186
40 Ga0070711_100021578 3300005439 Bacteria 4166
41 Ga0070711_100129317 3300005439 Bacteria 1879
42 Ga0070711_100338386 3300005439 Bacteria 1207
43 Ga0070681_10014602 3300005458 Bacteria 7815
44 Ga0070681_10030783 3300005458 Bacteria 5386
45 Ga0070681_10092816 3300005458 Bacteria 2967
46 Ga0070681_10094224 3300005458 Bacteria 2943
47 Ga0070681_10116935 3300005458 Bacteria 2603
48 Ga0070681_10138921 3300005458 Bacteria 2359
49 Ga0070681_10152619 3300005458 Bacteria 2236
50 Ga0070681_10159286 3300005458 Bacteria 2181
51 Ga0070681_10185870 3300005458 Bacteria 1998
52 Ga0070681_10251638 3300005458 Bacteria 1679
53 Ga0070681_10284121 3300005458 Unclassified 1565
54 Ga0070681_10349031 3300005458 Bacteria 1390
55 Ga0070681_10510842 3300005458 Bacteria 1115
56 Ga0070707_100013157 3300005468 Bacteria 7734
57 Ga0070707_100064661 3300005468 Bacteria 3513
58 Ga0070707_100180899 3300005468 Bacteria 2055
59 Ga0070679_100004023 3300005530 Bacteria 13548
60 Ga0070679_100037286 3300005530 Bacteria 4828
61 Ga0070679_100064377 3300005530 Bacteria 3655
62 Ga0070679_100143142 3300005530 Unclassified 2370
63 Ga0070679_100181709 3300005530 Bacteria 2075
64 Ga0070679_100221711 3300005530 Bacteria 1852
65 Ga0070679_100293531 3300005530 Bacteria 1577
66 Ga0070679_100329904 3300005530 Bacteria 1474
67 Ga0070684_100031251 3300005535 Bacteria 4531
68 Ga0070684_100069598 3300005535 Bacteria 3095
69 Ga0070684_100308587 3300005535 Bacteria 1453
70 Ga0070695_100000209 3300005545 Bacteria 28514
71 Ga0070695_100477561 3300005545 Unclassified 960
72 Ga0070693_100278810 3300005547 Unclassified 1119
73 Ga0070665_100008828 3300005548 Bacteria 10204
74 Ga0068855_100003360 3300005563 Bacteria 19591
75 Ga0068855_100026961 3300005563 Bacteria 6875
76 Ga0068855_100069489 3300005563 Bacteria 4099
77 Ga0068855_100305368 3300005563 Bacteria 1761
78 Ga0068855_100326884 3300005563 Bacteria 1693
79 Ga0070664_100099309 3300005564 Bacteria 2529
80 Ga0068857_100010310 3300005577 Bacteria 8117
81 Ga0068857_100980121 3300005577 Bacteria 813
82 Ga0068856_100064851 3300005614 Bacteria 3609
83 Ga0068856_100102593 3300005614 Bacteria 2854
84 Ga0068856_100192546 3300005614 Bacteria 2053
85 Ga0068856_100581065 3300005614 Bacteria 1142
86 Ga0068852_100141014 3300005616 Bacteria 2230
87 Ga0068852_100371317 3300005616 Bacteria 1401
88 Ga0068852_100890370 3300005616 Bacteria 907
89 Ga0068851_10218828 3300005834 Bacteria 1069
90 Ga0068863_100493577 3300005841 Archaea 1205
91 Ga0081538_10002526 3300005981 Bacteria 17829
92 Ga0070717_10017583 3300006028 Bacteria 5567
93 Ga0070717_10042668 3300006028 Bacteria 3700
94 Ga0070717_10117772 3300006028 Bacteria 2272
95 Ga0070717_10384477 3300006028 Unclassified 1259
96 Ga0075365_10010117 3300006038 Bacteria 5473
97 Ga0075364_10023663 3300006051 Bacteria 3890
98 Ga0070716_100220682 3300006173 Bacteria 1273
99 Ga0070712_100042216 3300006175 Bacteria 3136
100 Ga0070712_100131166 3300006175 Unclassified 1899
101 Ga0070712_100150785 3300006175 Bacteria 1785
102 Ga0070712_100305997 3300006175 Unclassified 1288
103 Ga0070712_100697232 3300006175 Bacteria 865
104 Ga0075362_10009981 3300006177 Bacteria 3692
105 Ga0075366_10304450 3300006195 Bacteria 975
106 Ga0068871_100337525 3300006358 Bacteria 1330
107 Ga0075430_100083529 3300006846 Bacteria 2675
108 Ga0075434_100058417 3300006871 Bacteria 3834
109 Ga0075436_100127152 3300006914 Unclassified 1786
110 Ga0075436_100360591 3300006914 Bacteria 1049
111 Ga0105240_10040263 3300009093 Archaea 5978
112 Ga0105240_10073124 3300009093 Bacteria 4234
113 Ga0105240_10143995 3300009093 Bacteria 2846
114 Ga0105240_10349550 3300009093 Bacteria 1678
115 Ga0105240_10532323 3300009093 Unclassified 1302
116 Ga0105240_10654383 3300009093 Bacteria 1151
117 Ga0111539_10141578 3300009094 Bacteria 2816
118 Ga0105245_10058677 3300009098 Bacteria 3464
119 Ga0105245_10506601 3300009098 Bacteria 1224
120 Ga0105247_10070534 3300009101 Bacteria 2183
121 Ga0105241_10316610 3300009174 Bacteria 1344
122 Ga0105241_10336045 3300009174 Bacteria 1307
123 Ga0105248_10705008 3300009177 Unclassified 1139
124 Ga0105237_10016380 3300009545 Bacteria 7705
125 Ga0105237_10022957 3300009545 Bacteria 6398
126 Ga0105237_10039515 3300009545 Bacteria 4763
127 Ga0105237_10351501 3300009545 Bacteria 1478
128 Ga0105237_10436008 3300009545 Bacteria 1316
129 Ga0105237_10816298 3300009545 Bacteria 939
130 Ga0105238_10082873 3300009551 Bacteria 3197
131 Ga0105238_10264996 3300009551 Bacteria 1698
132 Ga0105238_10331617 3300009551 Unclassified 1508
133 Ga0105239_10967962 3300010375 Bacteria 978
134 Ga0157371_10141324 3300013102 Bacteria 1714
135 Ga0157370_10040631 3300013104 Bacteria 4490
136 Ga0157370_10150393 3300013104 Bacteria 2166
137 Ga0157369_10003497 3300013105 Bacteria 18655
138 Ga0157369_10069215 3300013105 Bacteria 3792
139 Ga0157369_10092028 3300013105 Bacteria 3236
140 Ga0157369_10116962 3300013105 Bacteria 2830
141 Ga0157369_10142872 3300013105 Bacteria 2532
142 Ga0157369_10197170 3300013105 Viruses 2114
143 Ga0157369_10559104 3300013105 Bacteria 1182
144 Ga0157374_10270067 3300013296 Unclassified 1677
145 Ga0157378_10275723 3300013297 Unclassified 1619
146 Ga0163162_10142685 3300013306 Bacteria 2509
147 Ga0157372_10077896 3300013307 Unclassified 3745
148 Ga0157372_10092439 3300013307 Bacteria 3442
149 Ga0157372_10096294 3300013307 Bacteria 3373
150 Ga0157372_10330764 3300013307 Unclassified 1774
151 Ga0157372_10554509 3300013307 Bacteria 1340
152 Ga0182008_10030636 3300014497 Archaea 2711
153 Ga0182008_10048084 3300014497 Unclassified 2119
154 Ga0157376_10052312 3300014969 Bacteria 3395
155 Ga0182006_1042604 3300015261 Bacteria 1778
156 Ga0182007_10011026 3300015262 Bacteria 3539
157 Ga0197907_10437748 3300020069 Bacteria 1126
158 Ga0206356_11766374 3300020070 Bacteria 1513
159 Ga0206354_10892643 3300020081 Bacteria 1890
160 Ga0206354_11476353 3300020081 Bacteria 1073
161 Ga0206354_11660076 3300020081 Bacteria 1994
162 Ga0206353_10436155 3300020082 Bacteria 1694
163 Ga0206353_10664051 3300020082 Unclassified 1837
164 Ga0206353_10793924 3300020082 Bacteria 1759
165 Ga0206353_11825549 3300020082 Bacteria 3213
166 Ga0206353_11838159 3300020082 Bacteria 10518
167 Ga0206353_11887398 3300020082 Bacteria 1570
168 Ga0207692_10081443 3300025898 Bacteria 1732
169 Ga0207692_10540908 3300025898 Bacteria 743
170 Ga0207699_10031962 3300025906 Bacteria 2961
171 Ga0207699_10288657 3300025906 Bacteria 1142
172 Ga0207705_10043796 3300025909 Bacteria 3215
173 Ga0207705_10230652 3300025909 Bacteria 1408
174 Ga0207705_10274057 3300025909 Bacteria 1290
175 Ga0207705_10424893 3300025909 Bacteria 1029
176 Ga0207707_10001354 3300025912 Bacteria 22790
177 Ga0207707_10024189 3300025912 Bacteria 5313
178 Ga0207707_10029791 3300025912 Bacteria 4774
179 Ga0207707_10043812 3300025912 Bacteria 3902
180 Ga0207707_10149015 3300025912 Bacteria 2046
181 Ga0207707_10164927 3300025912 Bacteria 1936
182 Ga0207707_10200088 3300025912 Bacteria 1742
183 Ga0207707_10310157 3300025912 Unclassified 1363
184 Ga0207707_10429853 3300025912 Unclassified 1131
185 Ga0207695_10037681 3300025913 Bacteria 5215
186 Ga0207695_10084211 3300025913 Bacteria 3211
187 Ga0207695_10271197 3300025913 Bacteria 1592
188 Ga0207695_10402216 3300025913 Bacteria 1254
189 Ga0207671_10062625 3300025914 Bacteria 2763
190 Ga0207671_10203613 3300025914 Bacteria 1546
191 Ga0207693_10001707 3300025915 Bacteria 19335
192 Ga0207693_10011495 3300025915 Bacteria 7161
193 Ga0207693_10019163 3300025915 Bacteria 5446
194 Ga0207693_10023979 3300025915 Bacteria 4843
195 Ga0207693_10119738 3300025915 Bacteria 2067
196 Ga0207693_10127806 3300025915 Bacteria 1998
197 Ga0207693_10249853 3300025915 Unclassified 1392
198 Ga0207663_10084539 3300025916 Bacteria 2087
199 Ga0207663_10230747 3300025916 Unclassified 1352
200 Ga0207660_10004499 3300025917 Bacteria 9091
201 Ga0207660_10075932 3300025917 Bacteria 2456
202 Ga0207660_10098775 3300025917 Bacteria 2178
203 Ga0207657_10000184 3300025919 Bacteria 64813
204 Ga0207657_10006239 3300025919 Bacteria 12392
205 Ga0207657_10029035 3300025919 Bacteria 5040
206 Ga0207657_10063338 3300025919 Bacteria 3162
207 Ga0207657_10364866 3300025919 Unclassified 1138
208 Ga0207649_10025080 3300025920 Bacteria 3472
209 Ga0207649_10114834 3300025920 Unclassified 1805
210 Ga0207649_10163291 3300025920 Bacteria 1545
211 Ga0207649_10262615 3300025920 Bacteria 1248
212 Ga0207652_10003340 3300025921 Bacteria 13271
213 Ga0207652_10048976 3300025921 Bacteria 3615
214 Ga0207652_10098149 3300025921 Bacteria 2583
215 Ga0207652_10099735 3300025921 Bacteria 2563
216 Ga0207652_10147970 3300025921 Bacteria 2102
217 Ga0207652_10483942 3300025921 Bacteria 1115
218 Ga0207652_10492524 3300025921 Archaea 1104
219 Ga0207652_10631041 3300025921 Unclassified 959
220 Ga0207646_10001064 3300025922 Bacteria 34921
221 Ga0207646_10172179 3300025922 Bacteria 1955
222 Ga0207646_10251052 3300025922 Bacteria 1598
223 Ga0207694_10035395 3300025924 Bacteria 3830
224 Ga0207694_10110622 3300025924 Bacteria 2185
225 Ga0207694_10134689 3300025924 Bacteria 1983
226 Ga0207687_10198992 3300025927 Bacteria 1564
227 Ga0207700_10042141 3300025928 Bacteria 3345
228 Ga0207700_10077359 3300025928 Bacteria 2584
229 Ga0207700_10108666 3300025928 Bacteria 2227
230 Ga0207700_10177969 3300025928 Bacteria 1779
231 Ga0207700_10393232 3300025928 Bacteria 1214
232 Ga0207664_10003905 3300025929 Bacteria 10016
233 Ga0207664_10014445 3300025929 Bacteria 5702
234 Ga0207664_10030357 3300025929 Bacteria 4128
235 Ga0207664_10046731 3300025929 Archaea 3399
236 Ga0207664_10078806 3300025929 Bacteria 2673
237 Ga0207664_10109643 3300025929 Bacteria 2294
238 Ga0207664_10248860 3300025929 Bacteria 1550
239 Ga0207664_10273269 3300025929 Bacteria 1481
240 Ga0207664_10329584 3300025929 Bacteria 1348
241 Ga0207664_10475062 3300025929 Unclassified 1118
242 Ga0207690_10195554 3300025932 Bacteria 1532
243 Ga0207690_10276106 3300025932 Bacteria 1307
244 Ga0207665_10000359 3300025939 Bacteria 31672
245 Ga0207665_10102158 3300025939 Bacteria 2003
246 Ga0207661_10001055 3300025944 Bacteria 18320
247 Ga0207661_10566227 3300025944 Bacteria 1041
248 Ga0207679_10097784 3300025945 Bacteria 2287
249 Ga0207667_10057570 3300025949 Bacteria 4080
250 Ga0207667_10127997 3300025949 Bacteria 2615
251 Ga0207667_10185113 3300025949 Bacteria 2138
252 Ga0207640_10806380 3300025981 Unclassified 814
253 Ga0207678_10345915 3300026067 Bacteria 1282
254 Ga0207702_10076792 3300026078 Bacteria 2888
255 Ga0207702_10106090 3300026078 Bacteria 2489
256 Ga0207702_10219373 3300026078 Bacteria 1772
257 Ga0207702_10586174 3300026078 Bacteria 1093
258 Ga0207674_10015785 3300026116 Bacteria 8283
259 Ga0207674_10226055 3300026116 Bacteria 1820
260 Ga0207675_100708543 3300026118 Bacteria 1016
261 Ga0207698_10074684 3300026142 Bacteria 2706
262 Ga0207698_10119952 3300026142 Bacteria 2224
263 Ga0207428_10030531 3300027907 Bacteria 4455
264 Ga0265319_1020830 3300028563 Bacteria 2419
265 Ga0265318_10003454 3300028577 Bacteria 7930
266 Ga0265323_10060336 3300028653 Unclassified 1321
267 Ga0265322_10059565 3300028654 Unclassified 1083
268 Ga0265336_10001745 3300028666 Bacteria 9535
269 Ga0265338_10001085 3300028800 Bacteria 45201
270 Ga0265338_10004329 3300028800 Bacteria 19254
271 Ga0265338_10031718 3300028800 Bacteria 5173
272 Ga0265338_10069615 3300028800 Bacteria 3021
273 Ga0265338_10138017 3300028800 Bacteria 1913
274 Ga0265330_10012111 3300031235 Bacteria 4033
275 Ga0265332_10082576 3300031238 Unclassified 1362
276 Ga0265328_10005579 3300031239 Bacteria 5381
277 Ga0265320_10043067 3300031240 Unclassified 2234
278 Ga0265339_10010275 3300031249 Bacteria 5822
279 Ga0265339_10064427 3300031249 Bacteria 1966
280 Ga0265331_10005519 3300031250 Bacteria 7626
281 Ga0265327_10084610 3300031251 Bacteria 1558
282 Ga0265313_10062434 3300031595 Bacteria 1740
283 Ga0265314_10020273 3300031711 Bacteria 5134
284 Ga0373926_0056554 3300035083 Unclassified 1424
285 Ga0373926_0070424 3300035083 Bacteria 1284
286 Ga0373945_0026187 3300035116 Bacteria 2031
287 Ga0373945_0032462 3300035116 Bacteria 1850
288 Ga0373956_0130744 3300035119 Bacteria 1175
289 Ga0373943_0003742 3300035170 Bacteria 6917
290 Ga0373943_0021062 3300035170 Bacteria 3010
291 Ga0373955_0028993 3300035172 Bacteria 2875
292 Ga0373955_0172969 3300035172 Bacteria 1279
293 Ga0373955_0187473 3300035172 Bacteria 1229
294 Ga0373942_0024582 3300035207 Bacteria 1546
295 Ga0373924_0066248 3300035410 Bacteria 1518
296 Ga0373931_0016041 3300035691 Bacteria 3683
297 Ga0373935_0014109 3300035692 Archaea 4825
298 Ga0373935_0144303 3300035692 Unclassified 1610
299 Ga0373927_0387905 3300035695 Bacteria 921
300 Ga0373947_0013551 3300035725 Bacteria 4672
301 Ga0373947_0079592 3300035725 Bacteria 2025
302 Ga0373947_0141415 3300035725 Bacteria 1544
303 Ga0373937_0004201 3300036401 Bacteria 12219
304 Ga0373937_0087942 3300036401 Bacteria 2876
305 Ga0373937_0095211 3300036401 Bacteria 2761
306 Ga0373925_0001570 3300037068 Bacteria 19317
307 Ga0373925_0004988 3300037068 Bacteria 9968
308 Ga0395899_0026852 3300037312 Bacteria 4343
309 Ga0395900_0023098 3300037418 Bacteria 6365
310 Ga0395900_0023449 3300037418 Bacteria 6316
311 Ga0395900_0074000 3300037418 Bacteria 3503
312 Ga0395900_0074684 3300037418 Bacteria 3485
313 Ga0395900_0298437 3300037418 Unclassified 1598
314 Ga0395900_0463098 3300037418 Unclassified 1222
315 Ga0395900_0720753 3300037418 Bacteria 930
316 Ga0395898_0003505 3300037466 Bacteria 17509
317 Ga0395898_0050830 3300037466 Bacteria 4055
318 Ga0395898_0104059 3300037466 Bacteria 2723
319 Ga0395898_0254753 3300037466 Bacteria 1674
320 Ga0395905_0365554 3300037471 Bacteria 1336
321 Ga0436364_0828763 3300037853 Bacteria 1581
322 Ga0395901_0001441 3300038443 Bacteria 24821
323 Ga0395901_0002561 3300038443 Bacteria 18423
324 Ga0395901_0007588 3300038443 Bacteria 10957
325 Ga0395901_0058497 3300038443 Bacteria 4008
326 Ga0395901_0073925 3300038443 Bacteria 3556
327 Ga0395901_0116304 3300038443 Bacteria 2809
328 Ga0395901_0187413 3300038443 Bacteria 2170
329 Ga0395901_0310364 3300038443 Bacteria 1634
330 Ga0436365_0275742 3300039437 Bacteria 1067
331 Ga0451577_0593015 3300042876 Bacteria 1006
332 Ga0466972_0060611 3300044658 Bacteria 1815
333 Ga0466965_0025618 3300044683 Unclassified 2855
334 Ga0466965_0322125 3300044683 Bacteria 842
335 Ga0466966_0013803 3300044684 Bacteria 5346
336 Ga0466966_0031572 3300044684 Bacteria 3434
337 Ga0466966_0035288 3300044684 Bacteria 3231
338 Ga0466966_0055033 3300044684 Bacteria 2520
339 Ga0466966_0071150 3300044684 Unclassified 2179
340 Ga0466966_0092157 3300044684 Bacteria 1880
341 Ga0466966_0100186 3300044684 Bacteria 1792
342 Ga0466966_0101581 3300044684 Unclassified 1778
343 Ga0466961_0006475 3300044693 Bacteria 7439
344 Ga0466961_0052672 3300044693 Unclassified 2597
345 Ga0466961_0083951 3300044693 Bacteria 2014
346 Ga0466961_0112764 3300044693 Unclassified 1710
347 Ga0466961_0141227 3300044693 Bacteria 1508
348 Ga0466961_0147454 3300044693 Unclassified 1471
349 Ga0466961_0374905 3300044693 Bacteria 864
350 Ga0466963_0000048 3300044694 Bacteria 39958
351 Ga0466963_0000539 3300044694 Bacteria 17813
352 Ga0466963_0002866 3300044694 Bacteria 9738
353 Ga0466963_0004599 3300044694 Bacteria 8035
354 Ga0466963_0005870 3300044694 Bacteria 7235
355 Ga0466963_0006827 3300044694 Bacteria 6791
356 Ga0466963_0013485 3300044694 Bacteria 5018
357 Ga0466963_0019731 3300044694 Bacteria 4234
358 Ga0466963_0023051 3300044694 Bacteria 3948
359 Ga0466963_0024512 3300044694 Bacteria 3841
360 Ga0466963_0027233 3300044694 Bacteria 3658
361 Ga0466963_0030488 3300044694 Bacteria 3480
362 Ga0466963_0053017 3300044694 Bacteria 2692
363 Ga0466963_0056513 3300044694 Bacteria 2611
364 Ga0466963_0059095 3300044694 Bacteria 2558
365 Ga0466963_0069894 3300044694 Bacteria 2361
366 Ga0466963_0129060 3300044694 Bacteria 1745
367 Ga0466963_0165858 3300044694 Bacteria 1538
368 Ga0466963_0547315 3300044694 Bacteria 817
369 Ga0466964_0000795 3300044706 Bacteria 10278
370 Ga0466964_0001317 3300044706 Bacteria 8460
371 Ga0466964_0001566 3300044706 Bacteria 7876
372 Ga0466964_0003905 3300044706 Bacteria 5477
373 Ga0466964_0008240 3300044706 Bacteria 3910
374 Ga0466964_0015104 3300044706 Bacteria 2940
375 Ga0466964_0023922 3300044706 Bacteria 2377
376 Ga0466964_0055758 3300044706 Bacteria 1632
377 Ga0466964_0078280 3300044706 Bacteria 1413
378 Ga0466971_0000533 3300044719 Bacteria 15074
379 Ga0466971_0006417 3300044719 Bacteria 5109
380 Ga0466971_0008025 3300044719 Bacteria 4603
381 Ga0466971_0011104 3300044719 Bacteria 3943
382 Ga0466971_0014729 3300044719 Bacteria 3442
383 Ga0466971_0040437 3300044719 Bacteria 2094
384 Ga0466971_0048848 3300044719 Bacteria 1903
385 Ga0466971_0110863 3300044719 Unclassified 1266
386 Ga0466971_0174142 3300044719 Unclassified 1010
387 Ga0466971_0191840 3300044719 Bacteria 963
388 Ga0466971_0363867 3300044719 Bacteria 701
389 Ga0466968_0005164 3300044735 Bacteria 4884
390 Ga0466968_0007840 3300044735 Bacteria 4074
391 Ga0466968_0015456 3300044735 Bacteria 3025
392 Ga0466968_0114057 3300044735 Bacteria 1217
393 Ga0466970_0009268 3300044765 Bacteria 4969
394 Ga0466970_0192384 3300044765 Bacteria 1134
395 Ga0466957_0000628 3300044842 Bacteria 17883
396 Ga0466957_0009517 3300044842 Bacteria 5548
397 Ga0466957_0015848 3300044842 Bacteria 4404
398 Ga0466957_0019838 3300044842 Bacteria 3957
399 Ga0466957_0025692 3300044842 Bacteria 3492
400 Ga0466957_0026020 3300044842 Bacteria 3470
401 Ga0466957_0049658 3300044842 Bacteria 2551
402 Ga0466957_0060242 3300044842 Bacteria 2327
403 Ga0466957_0065162 3300044842 Bacteria 2243
404 Ga0466957_0072542 3300044842 Bacteria 2132
405 Ga0466957_0135056 3300044842 Unclassified 1584
406 Ga0466957_0149399 3300044842 Bacteria 1510
407 Ga0466957_0149478 3300044842 Bacteria 1509
408 Ga0466957_0318860 3300044842 Bacteria 1048
409 Ga0466957_0469002 3300044842 Bacteria 869
410 Ga0466960_0002833 3300044901 Bacteria 6573
411 Ga0466960_0008110 3300044901 Bacteria 4291
412 Ga0466960_0101889 3300044901 Bacteria 1480
413 Ga0466960_0132325 3300044901 Bacteria 1318
414 Ga0466960_0204354 3300044901 Bacteria 1081
415 Ga0466960_0406566 3300044901 Bacteria 785
416 Ga0466959_0002307 3300045049 Bacteria 12174
417 Ga0466959_0010353 3300045049 Bacteria 6661
418 Ga0466959_0022590 3300045049 Bacteria 4651
419 Ga0466959_0043510 3300045049 Bacteria 3310
420 Ga0466959_0070266 3300045049 Bacteria 2536
421 Ga0466959_0093018 3300045049 Bacteria 2164
422 Ga0466959_0109423 3300045049 Bacteria 1973
423 Ga0466959_0151977 3300045049 Unclassified 1631
424 Ga0466959_0217081 3300045049 Bacteria 1327
425 Ga0466958_0000693 3300045836 Bacteria 14666
426 Ga0466958_0001432 3300045836 Bacteria 11305
427 Ga0466958_0002882 3300045836 Bacteria 8768
428 Ga0466958_0005505 3300045836 Bacteria 6829
429 Ga0466958_0013897 3300045836 Archaea 4592
430 Ga0466958_0025875 3300045836 Bacteria 3463
431 Ga0466958_0050745 3300045836 Bacteria 2511
432 Ga0466958_0063546 3300045836 Bacteria 2251
433 Ga0466958_0071978 3300045836 Bacteria 2117
434 Ga0466958_0083032 3300045836 Bacteria 1974
435 Ga0466958_0127645 3300045836 Bacteria 1595
436 Ga0466958_0194885 3300045836 Bacteria 1288
437 Ga0466967_0000041 3300045976 Bacteria 46227
438 Ga0466967_0000654 3300045976 Bacteria 17408
439 Ga0466967_0002550 3300045976 Bacteria 11415
440 Ga0466967_0004103 3300045976 Bacteria 9733
441 Ga0466967_0007005 3300045976 Bacteria 8070
442 Ga0466967_0007603 3300045976 Bacteria 7837
443 Ga0466967_0013839 3300045976 Bacteria 6255
444 Ga0466967_0021511 3300045976 Bacteria 5242
445 Ga0466967_0021854 3300045976 Bacteria 5207
446 Ga0466967_0026525 3300045976 Bacteria 4801
447 Ga0466967_0039456 3300045976 Bacteria 4060
448 Ga0466967_0041341 3300045976 Bacteria 3974
449 Ga0466967_0054140 3300045976 Bacteria 3529
450 Ga0466967_0054253 3300045976 Bacteria 3526
451 Ga0466967_0062652 3300045976 Bacteria 3302
452 Ga0466967_0063430 3300045976 Bacteria 3283
453 Ga0466967_0069963 3300045976 Bacteria 3138
454 Ga0466967_0086947 3300045976 Bacteria 2833
455 Ga0466967_0088428 3300045976 Archaea 2811
456 Ga0466967_0108933 3300045976 Bacteria 2542
457 Ga0466967_0112517 3300045976 Bacteria 2503
458 Ga0466967_0112591 3300045976 Unclassified 2502
459 Ga0466967_0161635 3300045976 Bacteria 2102
460 Ga0466967_0175532 3300045976 Bacteria 2018
461 Ga0466967_0196915 3300045976 Bacteria 1906
462 Ga0466967_0390502 3300045976 Bacteria 1353
463 Ga0466967_0605961 3300045976 Unclassified 1081
464 Ga0466967_0743732 3300045976 Archaea 972
465 Ga0495592_0001213 3300046454 Bacteria 17898
466 Ga0495592_0002353 3300046454 Bacteria 13351
467 Ga0495592_0011072 3300046454 Bacteria 6809
468 Ga0495603_0011147 3300046455 Bacteria 5448
469 Ga0495629_0031754 3300046459 Bacteria 3738
470 Ga0495629_0059281 3300046459 Bacteria 2676
471 Ga0495629_0079552 3300046459 Bacteria 2289
472 Ga0495629_0299974 3300046459 Bacteria 1100
473 Ga0495641_0047044 3300046461 Bacteria 1981
474 Ga0495641_0097653 3300046461 Bacteria 1311
475 Ga0495641_0103216 3300046461 Bacteria 1272
476 Ga0495641_0103332 3300046461 Bacteria 1271
477 Ga0495651_0002881 3300046462 Bacteria 13324
478 Ga0495651_0006880 3300046462 Bacteria 8690
479 Ga0495651_0131574 3300046462 Bacteria 1826
480 Ga0495651_0311254 3300046462 Unclassified 1053
481 Ga0495653_0011970 3300046463 Bacteria 7084
482 Ga0495653_0028480 3300046463 Bacteria 4466
483 Ga0495653_0047045 3300046463 Bacteria 3338
484 Ga0495653_0057606 3300046463 Bacteria 2956
485 Ga0495653_0068096 3300046463 Bacteria 2671
486 Ga0495653_0070918 3300046463 Bacteria 2606
487 Ga0495653_0093598 3300046463 Bacteria 2191
488 Ga0495653_0106659 3300046463 Bacteria 2020
489 Ga0495653_0193146 3300046463 Archaea 1387
490 Ga0495582_0050311 3300046473 Bacteria 2296
491 Ga0495582_0059005 3300046473 Bacteria 2116
492 Ga0495582_0100497 3300046473 Bacteria 1619
493 Ga0495582_0217659 3300046473 Bacteria 1092
494 Ga0495639_0002130 3300046475 Bacteria 8726
495 Ga0495662_0172573 3300046476 Bacteria 1065
496 Ga0495664_0036849 3300046477 Bacteria 2884
497 Ga0495664_0093262 3300046477 Bacteria 1811
498 Ga0495664_0330217 3300046477 Bacteria 919
499 Ga0495584_0028912 3300046491 Bacteria 2810
500 Ga0495585_0072772 3300046492 Bacteria 1872
501 Ga0495596_0139241 3300046500 Bacteria 942
502 Ga0495607_0066468 3300046501 Bacteria 2029
503 Ga0495608_0001698 3300046511 Bacteria 15798
504 Ga0495608_0003297 3300046511 Bacteria 11540
505 Ga0495608_0007749 3300046511 Bacteria 7561
506 Ga0495608_0043952 3300046511 Bacteria 2984
507 Ga0495618_0008123 3300046514 Archaea 6355
508 Ga0495618_0024876 3300046514 Bacteria 3712
509 Ga0495618_0061099 3300046514 Bacteria 2390
510 Ga0495618_0089019 3300046514 Bacteria 1974
511 Ga0495618_0113111 3300046514 Bacteria 1738
512 Ga0495618_0206899 3300046514 Unclassified 1241
513 Ga0495618_0403534 3300046514 Unclassified 835
514 Ga0495628_0003868 3300046516 Bacteria 13338
515 Ga0495628_0014698 3300046516 Bacteria 6555
516 Ga0495630_0019726 3300046517 Bacteria 4960
517 Ga0495630_0029802 3300046517 Bacteria 4057
518 Ga0495630_0304319 3300046517 Bacteria 1218
519 Ga0495630_0512721 3300046517 Bacteria 919
520 Ga0495630_0570634 3300046517 Bacteria 867
521 Ga0495630_0598511 3300046517 Unclassified 845
522 Ga0495666_0002953 3300046526 Bacteria 8519
523 Ga0495652_0004471 3300046529 Bacteria 13351
524 Ga0495652_0030129 3300046529 Bacteria 4761
525 Ga0495652_0082140 3300046529 Bacteria 2657
526 Ga0495652_0086179 3300046529 Bacteria 2580
527 Ga0495652_0250456 3300046529 Bacteria 1313
528 Ga0495665_0171731 3300046531 Bacteria 1129
529 Ga0495640_0037587 3300046533 Unclassified 3414
530 Ga0495640_0080523 3300046533 Bacteria 2165
531 Ga0495640_0093108 3300046533 Bacteria 1986
532 Ga0495640_0125052 3300046533 Bacteria 1668
533 Ga0495640_0250239 3300046533 Bacteria 1110
534 Ga0495586_0010283 3300046535 Archaea 4976
535 Ga0495586_0224808 3300046535 Bacteria 1067
536 Ga0495587_0002085 3300046536 Bacteria 13351
537 Ga0495587_0075266 3300046536 Bacteria 1960
538 Ga0495587_0248213 3300046536 Bacteria 1001
539 Ga0495598_0029737 3300046537 Bacteria 1526
540 Ga0495609_0066336 3300046538 Bacteria 1590
541 Ga0495621_0093783 3300046539 Bacteria 1135
542 Ga0495645_0002158 3300046543 Bacteria 13352
543 Ga0495645_0010720 3300046543 Bacteria 6437
544 Ga0495645_0093962 3300046543 Bacteria 2139
545 Ga0495645_0477999 3300046543 Bacteria 782
546 Ga0495667_0022496 3300046559 Bacteria 4246
547 Ga0495667_0027924 3300046559 Bacteria 3799
548 Ga0495667_0059597 3300046559 Bacteria 2505
549 Ga0495667_0087518 3300046559 Bacteria 2020
550 Ga0495667_0176693 3300046559 Bacteria 1371
551 Ga0495667_0393396 3300046559 Unclassified 873
552 Ga0495634_0019155 3300046642 Bacteria 4864
553 Ga0495634_0120641 3300046642 Bacteria 1679
554 Ga0495634_0129368 3300046642 Bacteria 1611
555 Ga0495634_0255898 3300046642 Archaea 1069
556 Ga0495634_0298205 3300046642 Bacteria 975
557 Ga0495611_0026211 3300046648 Bacteria 2543
558 Ga0495635_0009680 3300046663 Bacteria 6737
559 Ga0495635_0045496 3300046663 Bacteria 3029
560 Ga0495635_0052256 3300046663 Bacteria 2815
561 Ga0495635_0067173 3300046663 Bacteria 2459
562 Ga0495588_0277163 3300046674 Bacteria 884
563 Ga0495657_0010733 3300046675 Bacteria 6885
564 Ga0495657_0039259 3300046675 Bacteria 3254
565 Ga0495657_0287585 3300046675 Bacteria 982
566 Ga0495599_0001519 3300046678 Bacteria 13351
567 Ga0495599_0004995 3300046678 Bacteria 7890
568 Ga0495623_0000030 3300046679 Bacteria 85003
569 Ga0495623_0046878 3300046679 Bacteria 2743
570 Ga0495646_0006707 3300046680 Bacteria 7302
571 Ga0495646_0036355 3300046680 Bacteria 3051
572 Ga0495646_0176612 3300046680 Unclassified 1174
573 Ga0495647_0000373 3300046681 Bacteria 12661
574 Ga0495647_0083774 3300046681 Unclassified 1297
575 Ga0495647_0154883 3300046681 Bacteria 984
576 Ga0495658_0027860 3300046683 Bacteria 3044
577 Ga0495658_0040135 3300046683 Bacteria 2601
578 Ga0495658_0088548 3300046683 Bacteria 1830
579 Ga0495658_0106405 3300046683 Unclassified 1681
580 Ga0495613_0001141 3300046689 Bacteria 20239
581 Ga0495613_0041936 3300046689 Bacteria 3387
582 Ga0495613_0066064 3300046689 Bacteria 2642
583 Ga0495613_0082837 3300046689 Bacteria 2329
584 Ga0495613_0096188 3300046689 Bacteria 2141
585 Ga0495624_0074224 3300046690 Bacteria 2113
586 Ga0495624_0080314 3300046690 Bacteria 2021
587 Ga0495589_0070893 3300046794 Bacteria 1704
588 Ga0495600_0007090 3300046809 Bacteria 6849
589 Ga0495600_0231861 3300046809 Bacteria 1178
590 Ga0495581_0003607 3300047315 Bacteria 8910
591 Ga0495581_0242176 3300047315 Bacteria 1055
592 Ga0495604_0003068 3300047317 Bacteria 13351
593 Ga0495604_0019930 3300047317 Bacteria 5362
594 Ga0495604_0489362 3300047317 Bacteria 799
595 Ga0495636_0014712 3300047318 Bacteria 3114
596 Ga0495674_0019490 3300047319 Bacteria 6294
597 Ga0495674_0083773 3300047319 Bacteria 2733
598 Ga0495674_0100715 3300047319 Bacteria 2458
599 Ga0495674_0119851 3300047319 Bacteria 2224
600 Ga0495674_0499070 3300047319 Unclassified 973
601 Ga0495676_0063402 3300047321 Bacteria 2880
602 Ga0495676_0388080 3300047321 Bacteria 928
603 Ga0495676_0492368 3300047321 Bacteria 805
604 Ga0495680_0004424 3300047322 Bacteria 13428
605 Ga0495680_0045724 3300047322 Bacteria 3456
606 Ga0495680_0059585 3300047322 Bacteria 2946
607 Ga0495680_0072036 3300047322 Unclassified 2629
608 Ga0495680_0076309 3300047322 Bacteria 2541
609 Ga0495680_0202805 3300047322 Bacteria 1422
610 Ga0495680_0281468 3300047322 Bacteria 1172
611 Ga0495680_0317201 3300047322 Bacteria 1091
612 Ga0495683_0169655 3300047323 Bacteria 1004
613 Ga0495675_0001663 3300047444 Bacteria 13319
614 Ga0495675_0043313 3300047444 Bacteria 2868
615 Ga0495675_0311489 3300047444 Unclassified 933
616 Ga0495675_0319160 3300047444 Bacteria 919
617 Ga0495684_0021275 3300047471 Bacteria 4997
618 Ga0495684_0053738 3300047471 Bacteria 3073
619 Ga0495684_0165990 3300047471 Archaea 1644
620 Ga0495684_0211856 3300047471 Bacteria 1424
621 Ga0495684_0312935 3300047471 Bacteria 1124
622 Ga0495684_0350902 3300047471 Bacteria 1047
623 Ga0495593_0005681 3300047673 Bacteria 7359
624 Ga0495602_0005668 3300048088 Bacteria 13098
625 Ga0495602_0097753 3300048088 Bacteria 2418
626 Ga0495614_0003371 3300048089 Bacteria 7141
627 Ga0496100_0001055 3300048903 Bacteria 13288
628 Ga0496100_0005613 3300048903 Bacteria 6776
629 Ga0496100_0035402 3300048903 Bacteria 3139
630 Ga0496100_0063676 3300048903 Bacteria 2438
631 Ga0496100_0108797 3300048903 Bacteria 1923
632 Ga0496100_0263010 3300048903 Bacteria 1280
633 Ga0496101_0006784 3300048904 Bacteria 7383
634 Ga0496101_0040049 3300048904 Bacteria 3336
635 Ga0496101_0044675 3300048904 Bacteria 3170
636 Ga0496101_0075248 3300048904 Archaea 2485
637 Ga0496101_0235705 3300048904 Bacteria 1423
638 Ga0496102_0004720 3300048905 Bacteria 11537
639 Ga0496102_0006676 3300048905 Bacteria 9856
640 Ga0496102_0033899 3300048905 Bacteria 4591
641 Ga0496104_0002384 3300048907 Bacteria 16190
642 Ga0496104_0005229 3300048907 Bacteria 11353
643 Ga0496104_0076655 3300048907 Bacteria 3184
644 Ga0496104_0114404 3300048907 Bacteria 2587
645 Ga0496104_0122355 3300048907 Bacteria 2498
646 Ga0496104_0244043 3300048907 Bacteria 1708
647 Ga0496105_0000406 3300048908 Bacteria 28366
648 Ga0496105_0007590 3300048908 Bacteria 8406
649 Ga0496105_0020580 3300048908 Bacteria 5333
650 Ga0496105_0051035 3300048908 Bacteria 3418
651 Ga0496105_0101058 3300048908 Bacteria 2381
652 Ga0496105_0260043 3300048908 Bacteria 1404
653 Ga0496105_0270771 3300048908 Bacteria 1371
654 Ga0496105_0328038 3300048908 Bacteria 1225
655 Ga0496106_0000263 3300048909 Bacteria 36905
656 Ga0496106_0003160 3300048909 Bacteria 12295
657 Ga0496106_0039454 3300048909 Bacteria 3536
658 Ga0496106_0461409 3300048909 Bacteria 1020
659 Ga0496107_0000712 3300048910 Bacteria 18973
660 Ga0496107_0003838 3300048910 Bacteria 10099
661 Ga0496107_0020318 3300048910 Bacteria 4689
662 Ga0496107_0153269 3300048910 Unclassified 1705
663 Ga0496107_0505335 3300048910 Bacteria 896
664 Ga0496108_0007285 3300048911 Bacteria 8969
665 Ga0496108_0023585 3300048911 Bacteria 5064
666 Ga0496108_0065217 3300048911 Bacteria 3069
667 Ga0496108_0103168 3300048911 Bacteria 2433
668 Ga0496108_0251240 3300048911 Unclassified 1538
669 Ga0496108_0749559 3300048911 Bacteria 845
670 Ga0496108_0888721 3300048911 Bacteria 765
671 Ga0496109_0001107 3300048912 Bacteria 22340
672 Ga0496109_0029773 3300048912 Bacteria 4891
673 Ga0496109_0070652 3300048912 Bacteria 3204
674 Ga0496109_0111049 3300048912 Bacteria 2549
675 Ga0496109_0187479 3300048912 Bacteria 1943
676 Ga0496109_0258485 3300048912 Unclassified 1640
677 Ga0496109_0346111 3300048912 Unclassified 1404
678 Ga0496109_0456490 3300048912 Bacteria 1207
679 Ga0496110_0001849 3300048913 Bacteria 15623
680 Ga0496110_0030017 3300048913 Bacteria 4684
681 Ga0496110_0566455 3300048913 Bacteria 1032
682 Ga0496110_0596145 3300048913 Bacteria 1003
683 Ga0496110_0744579 3300048913 Bacteria 883
684 Ga0496111_0006168 3300048914 Bacteria 7760
685 Ga0496111_0013375 3300048914 Bacteria 5582
686 Ga0496111_0032855 3300048914 Bacteria 3700
687 Ga0496111_0377587 3300048914 Unclassified 1048
688 Ga0496112_0041605 3300048915 Bacteria 4496
689 Ga0496112_0047557 3300048915 Bacteria 4209
690 Ga0496112_0054615 3300048915 Bacteria 3925
691 Ga0496112_0078461 3300048915 Bacteria 3266
692 Ga0496112_0129020 3300048915 Bacteria 2499
693 Ga0496112_0159275 3300048915 Bacteria 2224
694 Ga0496112_0186648 3300048915 Bacteria 2036
695 Ga0496112_0327886 3300048915 Bacteria 1475
696 Ga0496112_0341244 3300048915 Bacteria 1441
697 Ga0496113_0011248 3300048916 Bacteria 5960
698 Ga0496113_0172548 3300048916 Bacteria 1713
699 Ga0496113_0183168 3300048916 Unclassified 1660
700 Ga0496113_0230843 3300048916 Bacteria 1475
701 Ga0496114_0000444 3300048917 Bacteria 30383
702 Ga0496114_0021194 3300048917 Archaea 5285
703 Ga0496114_0035397 3300048917 Bacteria 4123
704 Ga0496114_0725065 3300048917 Bacteria 870
705 Ga0496115_0000415 3300048918 Bacteria 34771
706 Ga0496115_0014475 3300048918 Bacteria 5972
707 Ga0496115_0032107 3300048918 Bacteria 4142
708 Ga0496115_0368531 3300048918 Bacteria 1169
709 Ga0496115_0543249 3300048918 Bacteria 929
710 Ga0501031_0142830 3300049568 Unclassified 1564
711 Ga0501032_0028359 3300049569 Bacteria 3847
712 Ga0501033_0012589 3300049570 Bacteria 6455
713 Ga0501036_0012780 3300049572 Bacteria 6964
714 Ga0501037_0022411 3300049573 Bacteria 4672
715 Ga0501038_0622973 3300049574 Unclassified 814
716 Ga0501039_0010101 3300049575 Bacteria 7189
717 Ga0501040_0031459 3300049576 Bacteria 3586
718 Ga0501041_0020896 3300049577 Bacteria 3919
719 Ga0501042_0034520 3300049578 Bacteria 3587
720 Ga0501043_0004631 3300049579 Bacteria 11150
721 Ga0501047_0056675 3300049581 Bacteria 3790
722 Ga0501048_0402441 3300049582 Bacteria 978
723 Ga0501067_0007172 3300049583 Bacteria 6192
724 Ga0501067_0012311 3300049583 Archaea 4743
725 Ga0501068_0027574 3300049584 Bacteria 3354
726 Ga0501068_0069797 3300049584 Bacteria 2143
727 Ga0501068_0290350 3300049584 Bacteria 1046
728 Ga0501068_0369691 3300049584 Bacteria 923
729 Ga0501069_0003977 3300049585 Bacteria 7626
730 Ga0501069_0097011 3300049585 Bacteria 1670
731 Ga0501069_0133061 3300049585 Bacteria 1425
732 Ga0501069_0156382 3300049585 Bacteria 1312
733 Ga0501070_0017997 3300049586 Bacteria 5929
734 Ga0501070_0048643 3300049586 Bacteria 3521
735 Ga0501070_0061713 3300049586 Bacteria 3106
736 Ga0501070_0290710 3300049586 Bacteria 1332
737 Ga0501070_0544700 3300049586 Bacteria 929
738 Ga0501072_0062680 3300049588 Bacteria 2932
739 Ga0501073_0010789 3300049589 Bacteria 6691
740 Ga0501073_0011468 3300049589 Bacteria 6483
741 Ga0501074_0040728 3300049590 Bacteria 3363
742 Ga0501074_0071720 3300049590 Unclassified 2489
743 Ga0501074_0108961 3300049590 Bacteria 1982
744 Ga0501074_0196079 3300049590 Bacteria 1439
745 Ga0501075_0020523 3300049591 Bacteria 4808
746 Ga0501076_0029468 3300049592 Bacteria 4268
747 Ga0501077_0013125 3300049593 Bacteria 5191
748 Ga0501079_0025056 3300049741 Bacteria 4577
749 Ga0501079_0073494 3300049741 Bacteria 2642
750 Ga0501080_0017302 3300049742 Bacteria 6663
751 Ga0501080_0030527 3300049742 Bacteria 5021
752 Ga0501080_0189370 3300049742 Bacteria 1891
753 Ga0501080_0199451 3300049742 Bacteria 1837
754 Ga0501081_0012861 3300049743 Bacteria 5503
755 Ga0501083_0003468 3300049744 Bacteria 11026
756 Ga0501083_0394355 3300049744 Bacteria 900
757 Ga0501035_0011854 3300049822 Bacteria 8071
758 Ga0501035_0066500 3300049822 Bacteria 3199
759 Ga0501044_0249771 3300049823 Unclassified 1715
760 Ga0501044_0474985 3300049823 Bacteria 1154
761 Ga0501044_0539353 3300049823 Bacteria 1065
762 Ga0501045_0003958 3300049824 Bacteria 10193
763 nmdc:mga00v17_40688_c1 3300050491 Bacteria 2789
764 nmdc:mga0yw44_12817_c1 3300050492 Bacteria 4386
765 nmdc:mga06r32_21395_c1 3300050510 Bacteria 5972
766 nmdc:mga08y16_134989_c1 3300050511 Bacteria 2565
767 nmdc:mga0n895_47264_c1 3300050512 Bacteria 4208
768 nmdc:mga0rr50_13085_c1 3300050513 Bacteria 5388
769 nmdc:mga0rr50_54601_c1 3300050513 Bacteria 2977
770 nmdc:mga08x19_137974_c1 3300050514 Unclassified 1645
771 nmdc:mga0a205_168028_c1 3300050515 Bacteria 2089
772 Ga0495601_0001383 3300053077 Bacteria 13345
773 Ga0495601_0012130 3300053077 Bacteria 5166
774 Ga0495601_0079745 3300053077 Bacteria 2099
775 Ga0495601_0103136 3300053077 Bacteria 1843
776 Ga0495601_0163961 3300053077 Bacteria 1452
777 Ga0495612_0048272 3300053078 Bacteria 1745
778 Ga0495612_0060374 3300053078 Bacteria 1569
779 Ga0495612_0097652 3300053078 Bacteria 1248
780 Ga0495612_0194326 3300053078 Bacteria 894
781 Ga0495595_0001006 3300053084 Bacteria 10860
782 Ga0495595_0033723 3300053084 Bacteria 2312
783 Ga0495595_0041927 3300053084 Bacteria 2096
784 Ga0495619_0002076 3300053085 Bacteria 13320
785 Ga0495619_0012085 3300053085 Bacteria 5439
786 Ga0495619_0051724 3300053085 Bacteria 2715
787 Ga0495619_0063399 3300053085 Bacteria 2462
788 Ga0495619_0065010 3300053085 Bacteria 2433
789 Ga0495619_0188808 3300053085 Bacteria 1426
790 Ga0500566_0270515 3300053094 Bacteria 815
791 Ga0501084_0047995 3300054114 Bacteria 3575
792 Ga0501084_0578109 3300054114 Bacteria 949
793 Ga0501082_0049100 3300060353 Bacteria 3638
794 Ga0501082_0229877 3300060353 Bacteria 1614
795 Ga0501082_0777027 3300060353 Bacteria 838
796 Ga0466962_0000686 3300061719 Bacteria 15058
797 Ga0466962_0000731 3300061719 Bacteria 14723
798 Ga0466962_0001101 3300061719 Bacteria 12437
799 Ga0466962_0001681 3300061719 Bacteria 10380
800 Ga0466962_0033796 3300061719 Bacteria 2447
801 Ga0466962_0044941 3300061719 Bacteria 2112
802 Ga0466962_0063561 3300061719 Bacteria 1762
803 Ga0466962_0246723 3300061719 Bacteria 877
804 Ga0466962_0273169 3300061719 Bacteria 833
805 Ga0530510_0014794 3300061734 Bacteria 5510
806 Ga0530510_0370289 3300061734 Archaea 1077
807 Ga0466963_0062301
808 Ga0070658_10023144
809 Ga0070658_10052039
810 Ga0070658_10069945
811 Ga0070683_100144770
812 Ga0070680_100007611
813 Ga0070680_100052968
814 Ga0070680_100077028
815 Ga0070680_100128504
816 Ga0070682_100095477
817 Ga0070682_100195407
818 Ga0070682_100246459
819 Ga0070682_100346033
820 Ga0070660_100004010
821 Ga0070660_100008337
822 Ga0070660_100112159
823 Ga0070660_100119240
824 Ga0070691_10038504
825 Ga0070661_100020278
826 Ga0070661_100107728
827 Ga0070661_100222123
828 Ga0070671_100109490
829 Ga0070659_100004651
830 Ga0070659_100241657
831 Ga0070709_10015614
832 Ga0070709_10039205
833 Ga0070709_10388193
834 Ga0070714_100043179
835 Ga0070714_100045291
836 Ga0070714_100049668
837 Ga0070714_100055409
838 Ga0070714_100082110
839 Ga0070714_100145507
840 Ga0070714_100180757
841 Ga0070713_100008162
842 Ga0070713_100167501
843 Ga0070710_10020558
844 Ga0070710_10135065
845 Ga0070710_10228944
846 Ga0070711_100021578
847 Ga0070711_100129317
848 Ga0070711_100338386
849 Ga0070681_10014602
850 Ga0070681_10030783
851 Ga0070681_10092816
852 Ga0070681_10094224
853 Ga0070681_10116935
854 Ga0070681_10138921
855 Ga0070681_10152619
856 Ga0070681_10159286
857 Ga0070681_10185870
858 Ga0070681_10251638
859 Ga0070681_10284121
860 Ga0070681_10349031
861 Ga0070681_10510842
862 Ga0070707_100013157
863 Ga0070707_100064661
864 Ga0070707_100180899
865 Ga0070679_100004023
866 Ga0070679_100037286
867 Ga0070679_100064377
868 Ga0070679_100143142
869 Ga0070679_100181709
870 Ga0070679_100221711
871 Ga0070679_100293531
872 Ga0070679_100329904
873 Ga0070684_100031251
874 Ga0070684_100069598
875 Ga0070684_100308587
876 Ga0070695_100000209
877 Ga0070695_100477561
878 Ga0070693_100278810
879 Ga0070665_100008828
880 Ga0068855_100003360
881 Ga0068855_100026961
882 Ga0068855_100069489
883 Ga0068855_100305368
884 Ga0068855_100326884
885 Ga0070664_100099309
886 Ga0068857_100010310
887 Ga0068857_100980121
888 Ga0068856_100064851
889 Ga0068856_100102593
890 Ga0068856_100192546
891 Ga0068856_100581065
892 Ga0068852_100141014
893 Ga0068852_100371317
894 Ga0068852_100890370
895 Ga0068851_10218828
896 Ga0068863_100493577
897 Ga0081538_10002526
898 Ga0070717_10017583
899 Ga0070717_10042668
900 Ga0070717_10117772
901 Ga0070717_10384477
902 Ga0075365_10010117
903 Ga0075364_10023663
904 Ga0070716_100220682
905 Ga0070712_100042216
906 Ga0070712_100131166
907 Ga0070712_100150785
908 Ga0070712_100305997
909 Ga0070712_100697232
910 Ga0075362_10009981
911 Ga0075366_10304450
912 Ga0068871_100337525
913 Ga0075430_100083529
914 Ga0075434_100058417
915 Ga0075436_100127152
916 Ga0075436_100360591
917 Ga0105240_10040263
918 Ga0105240_10073124
919 Ga0105240_10143995
920 Ga0105240_10349550
921 Ga0105240_10532323
922 Ga0105240_10654383
923 Ga0111539_10141578
924 Ga0105245_10058677
925 Ga0105245_10506601
926 Ga0105247_10070534
927 Ga0105241_10316610
928 Ga0105241_10336045
929 Ga0105248_10705008
930 Ga0105237_10016380
931 Ga0105237_10022957
932 Ga0105237_10039515
933 Ga0105237_10351501
934 Ga0105237_10436008
935 Ga0105237_10816298
936 Ga0105238_10082873
937 Ga0105238_10264996
938 Ga0105238_10331617
939 Ga0105239_10967962
940 Ga0157371_10141324
941 Ga0157370_10040631
942 Ga0157370_10150393
943 Ga0157369_10003497
944 Ga0157369_10069215
945 Ga0157369_10092028
946 Ga0157369_10116962
947 Ga0157369_10142872
948 Ga0157369_10197170
949 Ga0157369_10559104
950 Ga0157374_10270067
951 Ga0157378_10275723
952 Ga0163162_10142685
953 Ga0157372_10077896
954 Ga0157372_10092439
955 Ga0157372_10096294
956 Ga0157372_10330764
957 Ga0157372_10554509
958 Ga0182008_10030636
959 Ga0182008_10048084
960 Ga0157376_10052312
961 Ga0182006_1042604
962 Ga0182007_10011026
963 Ga0197907_10437748
964 Ga0206356_11766374
965 Ga0206354_10892643
966 Ga0206354_11476353
967 Ga0206354_11660076
968 Ga0206353_10436155
969 Ga0206353_10664051
970 Ga0206353_10793924
971 Ga0206353_11825549
972 Ga0206353_11838159
973 Ga0206353_11887398
974 Ga0207692_10081443
975 Ga0207692_10540908
976 Ga0207699_10031962
977 Ga0207699_10288657
978 Ga0207705_10043796
979 Ga0207705_10230652
980 Ga0207705_10274057
981 Ga0207705_10424893
982 Ga0207707_10001354
983 Ga0207707_10024189
984 Ga0207707_10029791
985 Ga0207707_10043812
986 Ga0207707_10149015
987 Ga0207707_10164927
988 Ga0207707_10200088
989 Ga0207707_10310157
990 Ga0207707_10429853
991 Ga0207695_10037681
992 Ga0207695_10084211
993 Ga0207695_10271197
994 Ga0207695_10402216
995 Ga0207671_10062625
996 Ga0207671_10203613
997 Ga0207693_10001707
998 Ga0207693_10011495
999 Ga0207693_10019163
1000 Ga0207693_10023979
1001 Ga0207693_10119738
1002 Ga0207693_10127806
1003 Ga0207693_10249853
1004 Ga0207663_10084539
1005 Ga0207663_10230747
1006 Ga0207660_10004499
1007 Ga0207660_10075932
1008 Ga0207660_10098775
1009 Ga0207657_10000184
1010 Ga0207657_10006239
1011 Ga0207657_10029035
1012 Ga0207657_10063338
1013 Ga0207657_10364866
1014 Ga0207649_10025080
1015 Ga0207649_10114834
1016 Ga0207649_10163291
1017 Ga0207649_10262615
1018 Ga0207652_10003340
1019 Ga0207652_10048976
1020 Ga0207652_10098149
1021 Ga0207652_10099735
1022 Ga0207652_10147970
1023 Ga0207652_10483942
1024 Ga0207652_10492524
1025 Ga0207652_10631041
1026 Ga0207646_10001064
1027 Ga0207646_10172179
1028 Ga0207646_10251052
1029 Ga0207694_10035395
1030 Ga0207694_10110622
1031 Ga0207694_10134689
1032 Ga0207687_10198992
1033 Ga0207700_10042141
1034 Ga0207700_10077359
1035 Ga0207700_10108666
1036 Ga0207700_10177969
1037 Ga0207700_10393232
1038 Ga0207664_10003905
1039 Ga0207664_10014445
1040 Ga0207664_10030357
1041 Ga0207664_10046731
1042 Ga0207664_10078806
1043 Ga0207664_10109643
1044 Ga0207664_10248860
1045 Ga0207664_10273269
1046 Ga0207664_10329584
1047 Ga0207664_10475062
1048 Ga0207690_10195554
1049 Ga0207690_10276106
1050 Ga0207665_10000359
1051 Ga0207665_10102158
1052 Ga0207661_10001055
1053 Ga0207661_10566227
1054 Ga0207679_10097784
1055 Ga0207667_10057570
1056 Ga0207667_10127997
1057 Ga0207667_10185113
1058 Ga0207640_10806380
1059 Ga0207678_10345915
1060 Ga0207702_10076792
1061 Ga0207702_10106090
1062 Ga0207702_10219373
1063 Ga0207702_10586174
1064 Ga0207674_10015785
1065 Ga0207674_10226055
1066 Ga0207675_100708543
1067 Ga0207698_10074684
1068 Ga0207698_10119952
1069 Ga0207428_10030531
1070 Ga0265319_1020830
1071 Ga0265318_10003454
1072 Ga0265323_10060336
1073 Ga0265322_10059565
1074 Ga0265336_10001745
1075 Ga0265338_10001085
1076 Ga0265338_10004329
1077 Ga0265338_10031718
1078 Ga0265338_10069615
1079 Ga0265338_10138017
1080 Ga0265330_10012111
1081 Ga0265332_10082576
1082 Ga0265328_10005579
1083 Ga0265320_10043067
1084 Ga0265339_10010275
1085 Ga0265339_10064427
1086 Ga0265331_10005519
1087 Ga0265327_10084610
1088 Ga0265313_10062434
1089 Ga0265314_10020273
1090 Ga0373926_0056554
1091 Ga0373926_0070424
1092 Ga0373945_0026187
1093 Ga0373945_0032462
1094 Ga0373956_0130744
1095 Ga0373943_0003742
1096 Ga0373943_0021062
1097 Ga0373955_0028993
1098 Ga0373955_0172969
1099 Ga0373955_0187473
1100 Ga0373942_0024582
1101 Ga0373924_0066248
1102 Ga0373931_0016041
1103 Ga0373935_0014109
1104 Ga0373935_0144303
1105 Ga0373927_0387905
1106 Ga0373947_0013551
1107 Ga0373947_0079592
1108 Ga0373947_0141415
1109 Ga0373937_0004201
1110 Ga0373937_0087942
1111 Ga0373937_0095211
1112 Ga0373925_0001570
1113 Ga0373925_0004988
1114 Ga0395899_0026852
1115 Ga0395900_0023098
1116 Ga0395900_0023449
1117 Ga0395900_0074000
1118 Ga0395900_0074684
1119 Ga0395900_0298437
1120 Ga0395900_0463098
1121 Ga0395900_0720753
1122 Ga0395898_0003505
1123 Ga0395898_0050830
1124 Ga0395898_0104059
1125 Ga0395898_0254753
1126 Ga0395905_0365554
1127 Ga0436364_0828763
1128 Ga0395901_0001441
1129 Ga0395901_0002561
1130 Ga0395901_0007588
1131 Ga0395901_0058497
1132 Ga0395901_0073925
1133 Ga0395901_0116304
1134 Ga0395901_0187413
1135 Ga0395901_0310364
1136 Ga0436365_0275742
1137 Ga0451577_0593015
1138 Ga0466972_0060611
1139 Ga0466965_0025618
1140 Ga0466965_0322125
1141 Ga0466966_0013803
1142 Ga0466966_0031572
1143 Ga0466966_0035288
1144 Ga0466966_0055033
1145 Ga0466966_0071150
1146 Ga0466966_0092157
1147 Ga0466966_0100186
1148 Ga0466966_0101581
1149 Ga0466961_0006475
1150 Ga0466961_0052672
1151 Ga0466961_0083951
1152 Ga0466961_0112764
1153 Ga0466961_0141227
1154 Ga0466961_0147454
1155 Ga0466961_0374905
1156 Ga0466963_0000048
1157 Ga0466963_0000539
1158 Ga0466963_0002866
1159 Ga0466963_0004599
1160 Ga0466963_0005870
1161 Ga0466963_0006827
1162 Ga0466963_0013485
1163 Ga0466963_0019731
1164 Ga0466963_0023051
1165 Ga0466963_0024512
1166 Ga0466963_0027233
1167 Ga0466963_0030488
1168 Ga0466963_0053017
1169 Ga0466963_0056513
1170 Ga0466963_0059095
1171 Ga0466963_0069894
1172 Ga0466963_0129060
1173 Ga0466963_0165858
1174 Ga0466963_0547315
1175 Ga0466964_0000795
1176 Ga0466964_0001317
1177 Ga0466964_0001566
1178 Ga0466964_0003905
1179 Ga0466964_0008240
1180 Ga0466964_0015104
1181 Ga0466964_0023922
1182 Ga0466964_0055758
1183 Ga0466964_0078280
1184 Ga0466971_0000533
1185 Ga0466971_0006417
1186 Ga0466971_0008025
1187 Ga0466971_0011104
1188 Ga0466971_0014729
1189 Ga0466971_0040437
1190 Ga0466971_0048848
1191 Ga0466971_0110863
1192 Ga0466971_0174142
1193 Ga0466971_0191840
1194 Ga0466971_0363867
1195 Ga0466968_0005164
1196 Ga0466968_0007840
1197 Ga0466968_0015456
1198 Ga0466968_0114057
1199 Ga0466970_0009268
1200 Ga0466970_0192384
1201 Ga0466957_0000628
1202 Ga0466957_0009517
1203 Ga0466957_0015848
1204 Ga0466957_0019838
1205 Ga0466957_0025692
1206 Ga0466957_0026020
1207 Ga0466957_0049658
1208 Ga0466957_0060242
1209 Ga0466957_0065162
1210 Ga0466957_0072542
1211 Ga0466957_0135056
1212 Ga0466957_0149399
1213 Ga0466957_0149478
1214 Ga0466957_0318860
1215 Ga0466957_0469002
1216 Ga0466960_0002833
1217 Ga0466960_0008110
1218 Ga0466960_0101889
1219 Ga0466960_0132325
1220 Ga0466960_0204354
1221 Ga0466960_0406566
1222 Ga0466959_0002307
1223 Ga0466959_0010353
1224 Ga0466959_0022590
1225 Ga0466959_0043510
1226 Ga0466959_0070266
1227 Ga0466959_0093018
1228 Ga0466959_0109423
1229 Ga0466959_0151977
1230 Ga0466959_0217081
1231 Ga0466958_0000693
1232 Ga0466958_0001432
1233 Ga0466958_0002882
1234 Ga0466958_0005505
1235 Ga0466958_0013897
1236 Ga0466958_0025875
1237 Ga0466958_0050745
1238 Ga0466958_0063546
1239 Ga0466958_0071978
1240 Ga0466958_0083032
1241 Ga0466958_0127645
1242 Ga0466958_0194885
1243 Ga0466967_0000041
1244 Ga0466967_0000654
1245 Ga0466967_0002550
1246 Ga0466967_0004103
1247 Ga0466967_0007005
1248 Ga0466967_0007603
1249 Ga0466967_0013839
1250 Ga0466967_0021511
1251 Ga0466967_0021854
1252 Ga0466967_0026525
1253 Ga0466967_0039456
1254 Ga0466967_0041341
1255 Ga0466967_0054140
1256 Ga0466967_0054253
1257 Ga0466967_0062652
1258 Ga0466967_0063430
1259 Ga0466967_0069963
1260 Ga0466967_0086947
1261 Ga0466967_0088428
1262 Ga0466967_0108933
1263 Ga0466967_0112517
1264 Ga0466967_0112591
1265 Ga0466967_0161635
1266 Ga0466967_0175532
1267 Ga0466967_0196915
1268 Ga0466967_0390502
1269 Ga0466967_0605961
1270 Ga0466967_0743732
1271 Ga0495592_0001213
1272 Ga0495592_0002353
1273 Ga0495592_0011072
1274 Ga0495603_0011147
1275 Ga0495629_0031754
1276 Ga0495629_0059281
1277 Ga0495629_0079552
1278 Ga0495629_0299974
1279 Ga0495641_0047044
1280 Ga0495641_0097653
1281 Ga0495641_0103216
1282 Ga0495641_0103332
1283 Ga0495651_0002881
1284 Ga0495651_0006880
1285 Ga0495651_0131574
1286 Ga0495651_0311254
1287 Ga0495653_0011970
1288 Ga0495653_0028480
1289 Ga0495653_0047045
1290 Ga0495653_0057606
1291 Ga0495653_0068096
1292 Ga0495653_0070918
1293 Ga0495653_0093598
1294 Ga0495653_0106659
1295 Ga0495653_0193146
1296 Ga0495582_0050311
1297 Ga0495582_0059005
1298 Ga0495582_0100497
1299 Ga0495582_0217659
1300 Ga0495639_0002130
1301 Ga0495662_0172573
1302 Ga0495664_0036849
1303 Ga0495664_0093262
1304 Ga0495664_0330217
1305 Ga0495584_0028912
1306 Ga0495585_0072772
1307 Ga0495596_0139241
1308 Ga0495607_0066468
1309 Ga0495608_0001698
1310 Ga0495608_0003297
1311 Ga0495608_0007749
1312 Ga0495608_0043952
1313 Ga0495618_0008123
1314 Ga0495618_0024876
1315 Ga0495618_0061099
1316 Ga0495618_0089019
1317 Ga0495618_0113111
1318 Ga0495618_0206899
1319 Ga0495618_0403534
1320 Ga0495628_0003868
1321 Ga0495628_0014698
1322 Ga0495630_0019726
1323 Ga0495630_0029802
1324 Ga0495630_0304319
1325 Ga0495630_0512721
1326 Ga0495630_0570634
1327 Ga0495630_0598511
1328 Ga0495666_0002953
1329 Ga0495652_0004471
1330 Ga0495652_0030129
1331 Ga0495652_0082140
1332 Ga0495652_0086179
1333 Ga0495652_0250456
1334 Ga0495665_0171731
1335 Ga0495640_0037587
1336 Ga0495640_0080523
1337 Ga0495640_0093108
1338 Ga0495640_0125052
1339 Ga0495640_0250239
1340 Ga0495586_0010283
1341 Ga0495586_0224808
1342 Ga0495587_0002085
1343 Ga0495587_0075266
1344 Ga0495587_0248213
1345 Ga0495598_0029737
1346 Ga0495609_0066336
1347 Ga0495621_0093783
1348 Ga0495645_0002158
1349 Ga0495645_0010720
1350 Ga0495645_0093962
1351 Ga0495645_0477999
1352 Ga0495667_0022496
1353 Ga0495667_0027924
1354 Ga0495667_0059597
1355 Ga0495667_0087518
1356 Ga0495667_0176693
1357 Ga0495667_0393396
1358 Ga0495634_0019155
1359 Ga0495634_0120641
1360 Ga0495634_0129368
1361 Ga0495634_0255898
1362 Ga0495634_0298205
1363 Ga0495611_0026211
1364 Ga0495635_0009680
1365 Ga0495635_0045496
1366 Ga0495635_0052256
1367 Ga0495635_0067173
1368 Ga0495588_0277163
1369 Ga0495657_0010733
1370 Ga0495657_0039259
1371 Ga0495657_0287585
1372 Ga0495599_0001519
1373 Ga0495599_0004995
1374 Ga0495623_0000030
1375 Ga0495623_0046878
1376 Ga0495646_0006707
1377 Ga0495646_0036355
1378 Ga0495646_0176612
1379 Ga0495647_0000373
1380 Ga0495647_0083774
1381 Ga0495647_0154883
1382 Ga0495658_0027860
1383 Ga0495658_0040135
1384 Ga0495658_0088548
1385 Ga0495658_0106405
1386 Ga0495613_0001141
1387 Ga0495613_0041936
1388 Ga0495613_0066064
1389 Ga0495613_0082837
1390 Ga0495613_0096188
1391 Ga0495624_0074224
1392 Ga0495624_0080314
1393 Ga0495589_0070893
1394 Ga0495600_0007090
1395 Ga0495600_0231861
1396 Ga0495581_0003607
1397 Ga0495581_0242176
1398 Ga0495604_0003068
1399 Ga0495604_0019930
1400 Ga0495604_0489362
1401 Ga0495636_0014712
1402 Ga0495674_0019490
1403 Ga0495674_0083773
1404 Ga0495674_0100715
1405 Ga0495674_0119851
1406 Ga0495674_0499070
1407 Ga0495676_0063402
1408 Ga0495676_0388080
1409 Ga0495676_0492368
1410 Ga0495680_0004424
1411 Ga0495680_0045724
1412 Ga0495680_0059585
1413 Ga0495680_0072036
1414 Ga0495680_0076309
1415 Ga0495680_0202805
1416 Ga0495680_0281468
1417 Ga0495680_0317201
1418 Ga0495683_0169655
1419 Ga0495675_0001663
1420 Ga0495675_0043313
1421 Ga0495675_0311489
1422 Ga0495675_0319160
1423 Ga0495684_0021275
1424 Ga0495684_0053738
1425 Ga0495684_0165990
1426 Ga0495684_0211856
1427 Ga0495684_0312935
1428 Ga0495684_0350902
1429 Ga0495593_0005681
1430 Ga0495602_0005668
1431 Ga0495602_0097753
1432 Ga0495614_0003371
1433 Ga0496100_0001055
1434 Ga0496100_0005613
1435 Ga0496100_0035402
1436 Ga0496100_0063676
1437 Ga0496100_0108797
1438 Ga0496100_0263010
1439 Ga0496101_0006784
1440 Ga0496101_0040049
1441 Ga0496101_0044675
1442 Ga0496101_0075248
1443 Ga0496101_0235705
1444 Ga0496102_0004720
1445 Ga0496102_0006676
1446 Ga0496102_0033899
1447 Ga0496104_0002384
1448 Ga0496104_0005229
1449 Ga0496104_0076655
1450 Ga0496104_0114404
1451 Ga0496104_0122355
1452 Ga0496104_0244043
1453 Ga0496105_0000406
1454 Ga0496105_0007590
1455 Ga0496105_0020580
1456 Ga0496105_0051035
1457 Ga0496105_0101058
1458 Ga0496105_0260043
1459 Ga0496105_0270771
1460 Ga0496105_0328038
1461 Ga0496106_0000263
1462 Ga0496106_0003160
1463 Ga0496106_0039454
1464 Ga0496106_0461409
1465 Ga0496107_0000712
1466 Ga0496107_0003838
1467 Ga0496107_0020318
1468 Ga0496107_0153269
1469 Ga0496107_0505335
1470 Ga0496108_0007285
1471 Ga0496108_0023585
1472 Ga0496108_0065217
1473 Ga0496108_0103168
1474 Ga0496108_0251240
1475 Ga0496108_0749559
1476 Ga0496108_0888721
1477 Ga0496109_0001107
1478 Ga0496109_0029773
1479 Ga0496109_0070652
1480 Ga0496109_0111049
1481 Ga0496109_0187479
1482 Ga0496109_0258485
1483 Ga0496109_0346111
1484 Ga0496109_0456490
1485 Ga0496110_0001849
1486 Ga0496110_0030017
1487 Ga0496110_0566455
1488 Ga0496110_0596145
1489 Ga0496110_0744579
1490 Ga0496111_0006168
1491 Ga0496111_0013375
1492 Ga0496111_0032855
1493 Ga0496111_0377587
1494 Ga0496112_0041605
1495 Ga0496112_0047557
1496 Ga0496112_0054615
1497 Ga0496112_0078461
1498 Ga0496112_0129020
1499 Ga0496112_0159275
1500 Ga0496112_0186648
1501 Ga0496112_0327886
1502 Ga0496112_0341244
1503 Ga0496113_0011248
1504 Ga0496113_0172548
1505 Ga0496113_0183168
1506 Ga0496113_0230843
1507 Ga0496114_0000444
1508 Ga0496114_0021194
1509 Ga0496114_0035397
1510 Ga0496114_0725065
1511 Ga0496115_0000415
1512 Ga0496115_0014475
1513 Ga0496115_0032107
1514 Ga0496115_0368531
1515 Ga0496115_0543249
1516 Ga0501031_0142830
1517 Ga0501032_0028359
1518 Ga0501033_0012589
1519 Ga0501036_0012780
1520 Ga0501037_0022411
1521 Ga0501038_0622973
1522 Ga0501039_0010101
1523 Ga0501040_0031459
1524 Ga0501041_0020896
1525 Ga0501042_0034520
1526 Ga0501043_0004631
1527 Ga0501047_0056675
1528 Ga0501048_0402441
1529 Ga0501067_0007172
1530 Ga0501067_0012311
1531 Ga0501068_0027574
1532 Ga0501068_0069797
1533 Ga0501068_0290350
1534 Ga0501068_0369691
1535 Ga0501069_0003977
1536 Ga0501069_0097011
1537 Ga0501069_0133061
1538 Ga0501069_0156382
1539 Ga0501070_0017997
1540 Ga0501070_0048643
1541 Ga0501070_0061713
1542 Ga0501070_0290710
1543 Ga0501070_0544700
1544 Ga0501072_0062680
1545 Ga0501073_0010789
1546 Ga0501073_0011468
1547 Ga0501074_0040728
1548 Ga0501074_0071720
1549 Ga0501074_0108961
1550 Ga0501074_0196079
1551 Ga0501075_0020523
1552 Ga0501076_0029468
1553 Ga0501077_0013125
1554 Ga0501079_0025056
1555 Ga0501079_0073494
1556 Ga0501080_0017302
1557 Ga0501080_0030527
1558 Ga0501080_0189370
1559 Ga0501080_0199451
1560 Ga0501081_0012861
1561 Ga0501083_0003468
1562 Ga0501083_0394355
1563 Ga0501035_0011854
1564 Ga0501035_0066500
1565 Ga0501044_0249771
1566 Ga0501044_0474985
1567 Ga0501044_0539353
1568 Ga0501045_0003958
1569 nmdc:mga00v17_40688_c1
1570 nmdc:mga0yw44_12817_c1
1571 nmdc:mga06r32_21395_c1
1572 nmdc:mga08y16_134989_c1
1573 nmdc:mga0n895_47264_c1
1574 nmdc:mga0rr50_13085_c1
1575 nmdc:mga0rr50_54601_c1
1576 nmdc:mga08x19_137974_c1
1577 nmdc:mga0a205_168028_c1
1578 Ga0495601_0001383
1579 Ga0495601_0012130
1580 Ga0495601_0079745
1581 Ga0495601_0103136
1582 Ga0495601_0163961
1583 Ga0495612_0048272
1584 Ga0495612_0060374
1585 Ga0495612_0097652
1586 Ga0495612_0194326
1587 Ga0495595_0001006
1588 Ga0495595_0033723
1589 Ga0495595_0041927
1590 Ga0495619_0002076
1591 Ga0495619_0012085
1592 Ga0495619_0051724
1593 Ga0495619_0063399
1594 Ga0495619_0065010
1595 Ga0495619_0188808
1596 Ga0500566_0270515
1597 Ga0501084_0047995
1598 Ga0501084_0578109
1599 Ga0501082_0049100
1600 Ga0501082_0229877
1601 Ga0501082_0777027
1602 Ga0466962_0000686
1603 Ga0466962_0000731
1604 Ga0466962_0001101
1605 Ga0466962_0001681
1606 Ga0466962_0033796
1607 Ga0466962_0044941
1608 Ga0466962_0063561
1609 Ga0466962_0246723
1610 Ga0466962_0273169
1611 Ga0530510_0014794
1612 Ga0530510_0370289

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

47

227

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

44

221

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l5k-assembly1.cif.gz_A the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a) 0.8315 2 212
8i8b-assembly1.cif.gz_J outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) 0.811 83 134
3e58-assembly1.cif.gz_B crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus 0.8026 1 208
7ocs-assembly1.cif.gz_D mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii 0.7869 2 216
2fdr-assembly1.cif.gz_A crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58 0.7833 3 217
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9273 89 186 3.40.50.1000
4uatA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9258 87 209 3.40.50.1000
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9244 88 202 3.40.50.1000
af_Q6ZDS0_185_318_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9234 88 218 3.40.50.1000
af_Q652P6_229_339_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9105 99 209 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1Q7UE20-F1-model_v4 Haloacid dehalogenase 0.9898 88 222 GO:0003824
AF-A0A537W1K3-F1-model_v4 HAD family hydrolase 0.9742 1 218 GO:0016787
AF-A0A538LBW9-F1-model_v4 HAD family hydrolase 0.9699 1 219 GO:0016787
AF-A0A1Q7UE20-F1-model_v4 Haloacid dehalogenase 0.9684 88 222 GO:0003824
AF-A0A0Q9QKT9-F1-model_v4 HAD family hydrolase 0.9667 3 220 GO:0003824

Map