F481658
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 806 | 260 | 1612 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0062301|Ga0466963_0062301_1626_2414 |
| Length | 262 |
| Sequence | VDDGRAVREPPVGRHPAQPLGLILDCASRLAGHRCVYTIAAVPVRAFLFDFDGLILDTETASRAGWQWLYRQHGHELPPEKWALMVGTIEGWDPWTHLEGLLGEPLDRPTWNERRYAHELSLLDAEELRPGIAEYLAYAERHGLKRAIVSSASRRWIDMHLERLERVVGWDAIVTADHDAGRAKPRPTLYLEALEEVGVAAEDAVAFEDSPNGASAAKAAGIYVVGIPNAVTADLGLAEHADLVLDSLADLPPEELLARRAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 31 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 95 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 96 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 98 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 111 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 112 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 113 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 114 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 115 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 124 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 125 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 126 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 127 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 130 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 131 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 132 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 133 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 134 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 135 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 136 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 137 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 138 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 139 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 140 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 141 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 142 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 143 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 144 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 202 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 203 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 204 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 213 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 214 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 245 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 246 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 257 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 260 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 1.36 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.87 |
| Nodule | 0 |
| Rhizoplane | 10.3 |
| Rhizosphere | 88.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.06 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0062301 | 3300044694 | Bacteria | 2495 |
| 2 | Ga0070658_10023144 | 3300005327 | Bacteria | 4988 |
| 3 | Ga0070658_10052039 | 3300005327 | Bacteria | 3320 |
| 4 | Ga0070658_10069945 | 3300005327 | Bacteria | 2872 |
| 5 | Ga0070683_100144770 | 3300005329 | Bacteria | 2251 |
| 6 | Ga0070680_100007611 | 3300005336 | Bacteria | 8262 |
| 7 | Ga0070680_100052968 | 3300005336 | Bacteria | 3312 |
| 8 | Ga0070680_100077028 | 3300005336 | Bacteria | 2746 |
| 9 | Ga0070680_100128504 | 3300005336 | Bacteria | 2118 |
| 10 | Ga0070682_100095477 | 3300005337 | Bacteria | 1952 |
| 11 | Ga0070682_100195407 | 3300005337 | Unclassified | 1423 |
| 12 | Ga0070682_100246459 | 3300005337 | Bacteria | 1286 |
| 13 | Ga0070682_100346033 | 3300005337 | Unclassified | 1107 |
| 14 | Ga0070660_100004010 | 3300005339 | Bacteria | 10165 |
| 15 | Ga0070660_100008337 | 3300005339 | Bacteria | 7245 |
| 16 | Ga0070660_100112159 | 3300005339 | Unclassified | 2170 |
| 17 | Ga0070660_100119240 | 3300005339 | Bacteria | 2104 |
| 18 | Ga0070691_10038504 | 3300005341 | Bacteria | 2258 |
| 19 | Ga0070661_100020278 | 3300005344 | Bacteria | 4738 |
| 20 | Ga0070661_100107728 | 3300005344 | Bacteria | 2078 |
| 21 | Ga0070661_100222123 | 3300005344 | Bacteria | 1449 |
| 22 | Ga0070671_100109490 | 3300005355 | Bacteria | 2320 |
| 23 | Ga0070659_100004651 | 3300005366 | Bacteria | 9804 |
| 24 | Ga0070659_100241657 | 3300005366 | Bacteria | 1494 |
| 25 | Ga0070709_10015614 | 3300005434 | Bacteria | 4324 |
| 26 | Ga0070709_10039205 | 3300005434 | Bacteria | 2906 |
| 27 | Ga0070709_10388193 | 3300005434 | Bacteria | 1040 |
| 28 | Ga0070714_100043179 | 3300005435 | Bacteria | 3811 |
| 29 | Ga0070714_100045291 | 3300005435 | Bacteria | 3728 |
| 30 | Ga0070714_100049668 | 3300005435 | Bacteria | 3571 |
| 31 | Ga0070714_100055409 | 3300005435 | Archaea | 3388 |
| 32 | Ga0070714_100082110 | 3300005435 | Bacteria | 2807 |
| 33 | Ga0070714_100145507 | 3300005435 | Bacteria | 2131 |
| 34 | Ga0070714_100180757 | 3300005435 | Bacteria | 1919 |
| 35 | Ga0070713_100008162 | 3300005436 | Bacteria | 7414 |
| 36 | Ga0070713_100167501 | 3300005436 | Bacteria | 1966 |
| 37 | Ga0070710_10020558 | 3300005437 | Archaea | 3427 |
| 38 | Ga0070710_10135065 | 3300005437 | Bacteria | 1507 |
| 39 | Ga0070710_10228944 | 3300005437 | Unclassified | 1186 |
| 40 | Ga0070711_100021578 | 3300005439 | Bacteria | 4166 |
| 41 | Ga0070711_100129317 | 3300005439 | Bacteria | 1879 |
| 42 | Ga0070711_100338386 | 3300005439 | Bacteria | 1207 |
| 43 | Ga0070681_10014602 | 3300005458 | Bacteria | 7815 |
| 44 | Ga0070681_10030783 | 3300005458 | Bacteria | 5386 |
| 45 | Ga0070681_10092816 | 3300005458 | Bacteria | 2967 |
| 46 | Ga0070681_10094224 | 3300005458 | Bacteria | 2943 |
| 47 | Ga0070681_10116935 | 3300005458 | Bacteria | 2603 |
| 48 | Ga0070681_10138921 | 3300005458 | Bacteria | 2359 |
| 49 | Ga0070681_10152619 | 3300005458 | Bacteria | 2236 |
| 50 | Ga0070681_10159286 | 3300005458 | Bacteria | 2181 |
| 51 | Ga0070681_10185870 | 3300005458 | Bacteria | 1998 |
| 52 | Ga0070681_10251638 | 3300005458 | Bacteria | 1679 |
| 53 | Ga0070681_10284121 | 3300005458 | Unclassified | 1565 |
| 54 | Ga0070681_10349031 | 3300005458 | Bacteria | 1390 |
| 55 | Ga0070681_10510842 | 3300005458 | Bacteria | 1115 |
| 56 | Ga0070707_100013157 | 3300005468 | Bacteria | 7734 |
| 57 | Ga0070707_100064661 | 3300005468 | Bacteria | 3513 |
| 58 | Ga0070707_100180899 | 3300005468 | Bacteria | 2055 |
| 59 | Ga0070679_100004023 | 3300005530 | Bacteria | 13548 |
| 60 | Ga0070679_100037286 | 3300005530 | Bacteria | 4828 |
| 61 | Ga0070679_100064377 | 3300005530 | Bacteria | 3655 |
| 62 | Ga0070679_100143142 | 3300005530 | Unclassified | 2370 |
| 63 | Ga0070679_100181709 | 3300005530 | Bacteria | 2075 |
| 64 | Ga0070679_100221711 | 3300005530 | Bacteria | 1852 |
| 65 | Ga0070679_100293531 | 3300005530 | Bacteria | 1577 |
| 66 | Ga0070679_100329904 | 3300005530 | Bacteria | 1474 |
| 67 | Ga0070684_100031251 | 3300005535 | Bacteria | 4531 |
| 68 | Ga0070684_100069598 | 3300005535 | Bacteria | 3095 |
| 69 | Ga0070684_100308587 | 3300005535 | Bacteria | 1453 |
| 70 | Ga0070695_100000209 | 3300005545 | Bacteria | 28514 |
| 71 | Ga0070695_100477561 | 3300005545 | Unclassified | 960 |
| 72 | Ga0070693_100278810 | 3300005547 | Unclassified | 1119 |
| 73 | Ga0070665_100008828 | 3300005548 | Bacteria | 10204 |
| 74 | Ga0068855_100003360 | 3300005563 | Bacteria | 19591 |
| 75 | Ga0068855_100026961 | 3300005563 | Bacteria | 6875 |
| 76 | Ga0068855_100069489 | 3300005563 | Bacteria | 4099 |
| 77 | Ga0068855_100305368 | 3300005563 | Bacteria | 1761 |
| 78 | Ga0068855_100326884 | 3300005563 | Bacteria | 1693 |
| 79 | Ga0070664_100099309 | 3300005564 | Bacteria | 2529 |
| 80 | Ga0068857_100010310 | 3300005577 | Bacteria | 8117 |
| 81 | Ga0068857_100980121 | 3300005577 | Bacteria | 813 |
| 82 | Ga0068856_100064851 | 3300005614 | Bacteria | 3609 |
| 83 | Ga0068856_100102593 | 3300005614 | Bacteria | 2854 |
| 84 | Ga0068856_100192546 | 3300005614 | Bacteria | 2053 |
| 85 | Ga0068856_100581065 | 3300005614 | Bacteria | 1142 |
| 86 | Ga0068852_100141014 | 3300005616 | Bacteria | 2230 |
| 87 | Ga0068852_100371317 | 3300005616 | Bacteria | 1401 |
| 88 | Ga0068852_100890370 | 3300005616 | Bacteria | 907 |
| 89 | Ga0068851_10218828 | 3300005834 | Bacteria | 1069 |
| 90 | Ga0068863_100493577 | 3300005841 | Archaea | 1205 |
| 91 | Ga0081538_10002526 | 3300005981 | Bacteria | 17829 |
| 92 | Ga0070717_10017583 | 3300006028 | Bacteria | 5567 |
| 93 | Ga0070717_10042668 | 3300006028 | Bacteria | 3700 |
| 94 | Ga0070717_10117772 | 3300006028 | Bacteria | 2272 |
| 95 | Ga0070717_10384477 | 3300006028 | Unclassified | 1259 |
| 96 | Ga0075365_10010117 | 3300006038 | Bacteria | 5473 |
| 97 | Ga0075364_10023663 | 3300006051 | Bacteria | 3890 |
| 98 | Ga0070716_100220682 | 3300006173 | Bacteria | 1273 |
| 99 | Ga0070712_100042216 | 3300006175 | Bacteria | 3136 |
| 100 | Ga0070712_100131166 | 3300006175 | Unclassified | 1899 |
| 101 | Ga0070712_100150785 | 3300006175 | Bacteria | 1785 |
| 102 | Ga0070712_100305997 | 3300006175 | Unclassified | 1288 |
| 103 | Ga0070712_100697232 | 3300006175 | Bacteria | 865 |
| 104 | Ga0075362_10009981 | 3300006177 | Bacteria | 3692 |
| 105 | Ga0075366_10304450 | 3300006195 | Bacteria | 975 |
| 106 | Ga0068871_100337525 | 3300006358 | Bacteria | 1330 |
| 107 | Ga0075430_100083529 | 3300006846 | Bacteria | 2675 |
| 108 | Ga0075434_100058417 | 3300006871 | Bacteria | 3834 |
| 109 | Ga0075436_100127152 | 3300006914 | Unclassified | 1786 |
| 110 | Ga0075436_100360591 | 3300006914 | Bacteria | 1049 |
| 111 | Ga0105240_10040263 | 3300009093 | Archaea | 5978 |
| 112 | Ga0105240_10073124 | 3300009093 | Bacteria | 4234 |
| 113 | Ga0105240_10143995 | 3300009093 | Bacteria | 2846 |
| 114 | Ga0105240_10349550 | 3300009093 | Bacteria | 1678 |
| 115 | Ga0105240_10532323 | 3300009093 | Unclassified | 1302 |
| 116 | Ga0105240_10654383 | 3300009093 | Bacteria | 1151 |
| 117 | Ga0111539_10141578 | 3300009094 | Bacteria | 2816 |
| 118 | Ga0105245_10058677 | 3300009098 | Bacteria | 3464 |
| 119 | Ga0105245_10506601 | 3300009098 | Bacteria | 1224 |
| 120 | Ga0105247_10070534 | 3300009101 | Bacteria | 2183 |
| 121 | Ga0105241_10316610 | 3300009174 | Bacteria | 1344 |
| 122 | Ga0105241_10336045 | 3300009174 | Bacteria | 1307 |
| 123 | Ga0105248_10705008 | 3300009177 | Unclassified | 1139 |
| 124 | Ga0105237_10016380 | 3300009545 | Bacteria | 7705 |
| 125 | Ga0105237_10022957 | 3300009545 | Bacteria | 6398 |
| 126 | Ga0105237_10039515 | 3300009545 | Bacteria | 4763 |
| 127 | Ga0105237_10351501 | 3300009545 | Bacteria | 1478 |
| 128 | Ga0105237_10436008 | 3300009545 | Bacteria | 1316 |
| 129 | Ga0105237_10816298 | 3300009545 | Bacteria | 939 |
| 130 | Ga0105238_10082873 | 3300009551 | Bacteria | 3197 |
| 131 | Ga0105238_10264996 | 3300009551 | Bacteria | 1698 |
| 132 | Ga0105238_10331617 | 3300009551 | Unclassified | 1508 |
| 133 | Ga0105239_10967962 | 3300010375 | Bacteria | 978 |
| 134 | Ga0157371_10141324 | 3300013102 | Bacteria | 1714 |
| 135 | Ga0157370_10040631 | 3300013104 | Bacteria | 4490 |
| 136 | Ga0157370_10150393 | 3300013104 | Bacteria | 2166 |
| 137 | Ga0157369_10003497 | 3300013105 | Bacteria | 18655 |
| 138 | Ga0157369_10069215 | 3300013105 | Bacteria | 3792 |
| 139 | Ga0157369_10092028 | 3300013105 | Bacteria | 3236 |
| 140 | Ga0157369_10116962 | 3300013105 | Bacteria | 2830 |
| 141 | Ga0157369_10142872 | 3300013105 | Bacteria | 2532 |
| 142 | Ga0157369_10197170 | 3300013105 | Viruses | 2114 |
| 143 | Ga0157369_10559104 | 3300013105 | Bacteria | 1182 |
| 144 | Ga0157374_10270067 | 3300013296 | Unclassified | 1677 |
| 145 | Ga0157378_10275723 | 3300013297 | Unclassified | 1619 |
| 146 | Ga0163162_10142685 | 3300013306 | Bacteria | 2509 |
| 147 | Ga0157372_10077896 | 3300013307 | Unclassified | 3745 |
| 148 | Ga0157372_10092439 | 3300013307 | Bacteria | 3442 |
| 149 | Ga0157372_10096294 | 3300013307 | Bacteria | 3373 |
| 150 | Ga0157372_10330764 | 3300013307 | Unclassified | 1774 |
| 151 | Ga0157372_10554509 | 3300013307 | Bacteria | 1340 |
| 152 | Ga0182008_10030636 | 3300014497 | Archaea | 2711 |
| 153 | Ga0182008_10048084 | 3300014497 | Unclassified | 2119 |
| 154 | Ga0157376_10052312 | 3300014969 | Bacteria | 3395 |
| 155 | Ga0182006_1042604 | 3300015261 | Bacteria | 1778 |
| 156 | Ga0182007_10011026 | 3300015262 | Bacteria | 3539 |
| 157 | Ga0197907_10437748 | 3300020069 | Bacteria | 1126 |
| 158 | Ga0206356_11766374 | 3300020070 | Bacteria | 1513 |
| 159 | Ga0206354_10892643 | 3300020081 | Bacteria | 1890 |
| 160 | Ga0206354_11476353 | 3300020081 | Bacteria | 1073 |
| 161 | Ga0206354_11660076 | 3300020081 | Bacteria | 1994 |
| 162 | Ga0206353_10436155 | 3300020082 | Bacteria | 1694 |
| 163 | Ga0206353_10664051 | 3300020082 | Unclassified | 1837 |
| 164 | Ga0206353_10793924 | 3300020082 | Bacteria | 1759 |
| 165 | Ga0206353_11825549 | 3300020082 | Bacteria | 3213 |
| 166 | Ga0206353_11838159 | 3300020082 | Bacteria | 10518 |
| 167 | Ga0206353_11887398 | 3300020082 | Bacteria | 1570 |
| 168 | Ga0207692_10081443 | 3300025898 | Bacteria | 1732 |
| 169 | Ga0207692_10540908 | 3300025898 | Bacteria | 743 |
| 170 | Ga0207699_10031962 | 3300025906 | Bacteria | 2961 |
| 171 | Ga0207699_10288657 | 3300025906 | Bacteria | 1142 |
| 172 | Ga0207705_10043796 | 3300025909 | Bacteria | 3215 |
| 173 | Ga0207705_10230652 | 3300025909 | Bacteria | 1408 |
| 174 | Ga0207705_10274057 | 3300025909 | Bacteria | 1290 |
| 175 | Ga0207705_10424893 | 3300025909 | Bacteria | 1029 |
| 176 | Ga0207707_10001354 | 3300025912 | Bacteria | 22790 |
| 177 | Ga0207707_10024189 | 3300025912 | Bacteria | 5313 |
| 178 | Ga0207707_10029791 | 3300025912 | Bacteria | 4774 |
| 179 | Ga0207707_10043812 | 3300025912 | Bacteria | 3902 |
| 180 | Ga0207707_10149015 | 3300025912 | Bacteria | 2046 |
| 181 | Ga0207707_10164927 | 3300025912 | Bacteria | 1936 |
| 182 | Ga0207707_10200088 | 3300025912 | Bacteria | 1742 |
| 183 | Ga0207707_10310157 | 3300025912 | Unclassified | 1363 |
| 184 | Ga0207707_10429853 | 3300025912 | Unclassified | 1131 |
| 185 | Ga0207695_10037681 | 3300025913 | Bacteria | 5215 |
| 186 | Ga0207695_10084211 | 3300025913 | Bacteria | 3211 |
| 187 | Ga0207695_10271197 | 3300025913 | Bacteria | 1592 |
| 188 | Ga0207695_10402216 | 3300025913 | Bacteria | 1254 |
| 189 | Ga0207671_10062625 | 3300025914 | Bacteria | 2763 |
| 190 | Ga0207671_10203613 | 3300025914 | Bacteria | 1546 |
| 191 | Ga0207693_10001707 | 3300025915 | Bacteria | 19335 |
| 192 | Ga0207693_10011495 | 3300025915 | Bacteria | 7161 |
| 193 | Ga0207693_10019163 | 3300025915 | Bacteria | 5446 |
| 194 | Ga0207693_10023979 | 3300025915 | Bacteria | 4843 |
| 195 | Ga0207693_10119738 | 3300025915 | Bacteria | 2067 |
| 196 | Ga0207693_10127806 | 3300025915 | Bacteria | 1998 |
| 197 | Ga0207693_10249853 | 3300025915 | Unclassified | 1392 |
| 198 | Ga0207663_10084539 | 3300025916 | Bacteria | 2087 |
| 199 | Ga0207663_10230747 | 3300025916 | Unclassified | 1352 |
| 200 | Ga0207660_10004499 | 3300025917 | Bacteria | 9091 |
| 201 | Ga0207660_10075932 | 3300025917 | Bacteria | 2456 |
| 202 | Ga0207660_10098775 | 3300025917 | Bacteria | 2178 |
| 203 | Ga0207657_10000184 | 3300025919 | Bacteria | 64813 |
| 204 | Ga0207657_10006239 | 3300025919 | Bacteria | 12392 |
| 205 | Ga0207657_10029035 | 3300025919 | Bacteria | 5040 |
| 206 | Ga0207657_10063338 | 3300025919 | Bacteria | 3162 |
| 207 | Ga0207657_10364866 | 3300025919 | Unclassified | 1138 |
| 208 | Ga0207649_10025080 | 3300025920 | Bacteria | 3472 |
| 209 | Ga0207649_10114834 | 3300025920 | Unclassified | 1805 |
| 210 | Ga0207649_10163291 | 3300025920 | Bacteria | 1545 |
| 211 | Ga0207649_10262615 | 3300025920 | Bacteria | 1248 |
| 212 | Ga0207652_10003340 | 3300025921 | Bacteria | 13271 |
| 213 | Ga0207652_10048976 | 3300025921 | Bacteria | 3615 |
| 214 | Ga0207652_10098149 | 3300025921 | Bacteria | 2583 |
| 215 | Ga0207652_10099735 | 3300025921 | Bacteria | 2563 |
| 216 | Ga0207652_10147970 | 3300025921 | Bacteria | 2102 |
| 217 | Ga0207652_10483942 | 3300025921 | Bacteria | 1115 |
| 218 | Ga0207652_10492524 | 3300025921 | Archaea | 1104 |
| 219 | Ga0207652_10631041 | 3300025921 | Unclassified | 959 |
| 220 | Ga0207646_10001064 | 3300025922 | Bacteria | 34921 |
| 221 | Ga0207646_10172179 | 3300025922 | Bacteria | 1955 |
| 222 | Ga0207646_10251052 | 3300025922 | Bacteria | 1598 |
| 223 | Ga0207694_10035395 | 3300025924 | Bacteria | 3830 |
| 224 | Ga0207694_10110622 | 3300025924 | Bacteria | 2185 |
| 225 | Ga0207694_10134689 | 3300025924 | Bacteria | 1983 |
| 226 | Ga0207687_10198992 | 3300025927 | Bacteria | 1564 |
| 227 | Ga0207700_10042141 | 3300025928 | Bacteria | 3345 |
| 228 | Ga0207700_10077359 | 3300025928 | Bacteria | 2584 |
| 229 | Ga0207700_10108666 | 3300025928 | Bacteria | 2227 |
| 230 | Ga0207700_10177969 | 3300025928 | Bacteria | 1779 |
| 231 | Ga0207700_10393232 | 3300025928 | Bacteria | 1214 |
| 232 | Ga0207664_10003905 | 3300025929 | Bacteria | 10016 |
| 233 | Ga0207664_10014445 | 3300025929 | Bacteria | 5702 |
| 234 | Ga0207664_10030357 | 3300025929 | Bacteria | 4128 |
| 235 | Ga0207664_10046731 | 3300025929 | Archaea | 3399 |
| 236 | Ga0207664_10078806 | 3300025929 | Bacteria | 2673 |
| 237 | Ga0207664_10109643 | 3300025929 | Bacteria | 2294 |
| 238 | Ga0207664_10248860 | 3300025929 | Bacteria | 1550 |
| 239 | Ga0207664_10273269 | 3300025929 | Bacteria | 1481 |
| 240 | Ga0207664_10329584 | 3300025929 | Bacteria | 1348 |
| 241 | Ga0207664_10475062 | 3300025929 | Unclassified | 1118 |
| 242 | Ga0207690_10195554 | 3300025932 | Bacteria | 1532 |
| 243 | Ga0207690_10276106 | 3300025932 | Bacteria | 1307 |
| 244 | Ga0207665_10000359 | 3300025939 | Bacteria | 31672 |
| 245 | Ga0207665_10102158 | 3300025939 | Bacteria | 2003 |
| 246 | Ga0207661_10001055 | 3300025944 | Bacteria | 18320 |
| 247 | Ga0207661_10566227 | 3300025944 | Bacteria | 1041 |
| 248 | Ga0207679_10097784 | 3300025945 | Bacteria | 2287 |
| 249 | Ga0207667_10057570 | 3300025949 | Bacteria | 4080 |
| 250 | Ga0207667_10127997 | 3300025949 | Bacteria | 2615 |
| 251 | Ga0207667_10185113 | 3300025949 | Bacteria | 2138 |
| 252 | Ga0207640_10806380 | 3300025981 | Unclassified | 814 |
| 253 | Ga0207678_10345915 | 3300026067 | Bacteria | 1282 |
| 254 | Ga0207702_10076792 | 3300026078 | Bacteria | 2888 |
| 255 | Ga0207702_10106090 | 3300026078 | Bacteria | 2489 |
| 256 | Ga0207702_10219373 | 3300026078 | Bacteria | 1772 |
| 257 | Ga0207702_10586174 | 3300026078 | Bacteria | 1093 |
| 258 | Ga0207674_10015785 | 3300026116 | Bacteria | 8283 |
| 259 | Ga0207674_10226055 | 3300026116 | Bacteria | 1820 |
| 260 | Ga0207675_100708543 | 3300026118 | Bacteria | 1016 |
| 261 | Ga0207698_10074684 | 3300026142 | Bacteria | 2706 |
| 262 | Ga0207698_10119952 | 3300026142 | Bacteria | 2224 |
| 263 | Ga0207428_10030531 | 3300027907 | Bacteria | 4455 |
| 264 | Ga0265319_1020830 | 3300028563 | Bacteria | 2419 |
| 265 | Ga0265318_10003454 | 3300028577 | Bacteria | 7930 |
| 266 | Ga0265323_10060336 | 3300028653 | Unclassified | 1321 |
| 267 | Ga0265322_10059565 | 3300028654 | Unclassified | 1083 |
| 268 | Ga0265336_10001745 | 3300028666 | Bacteria | 9535 |
| 269 | Ga0265338_10001085 | 3300028800 | Bacteria | 45201 |
| 270 | Ga0265338_10004329 | 3300028800 | Bacteria | 19254 |
| 271 | Ga0265338_10031718 | 3300028800 | Bacteria | 5173 |
| 272 | Ga0265338_10069615 | 3300028800 | Bacteria | 3021 |
| 273 | Ga0265338_10138017 | 3300028800 | Bacteria | 1913 |
| 274 | Ga0265330_10012111 | 3300031235 | Bacteria | 4033 |
| 275 | Ga0265332_10082576 | 3300031238 | Unclassified | 1362 |
| 276 | Ga0265328_10005579 | 3300031239 | Bacteria | 5381 |
| 277 | Ga0265320_10043067 | 3300031240 | Unclassified | 2234 |
| 278 | Ga0265339_10010275 | 3300031249 | Bacteria | 5822 |
| 279 | Ga0265339_10064427 | 3300031249 | Bacteria | 1966 |
| 280 | Ga0265331_10005519 | 3300031250 | Bacteria | 7626 |
| 281 | Ga0265327_10084610 | 3300031251 | Bacteria | 1558 |
| 282 | Ga0265313_10062434 | 3300031595 | Bacteria | 1740 |
| 283 | Ga0265314_10020273 | 3300031711 | Bacteria | 5134 |
| 284 | Ga0373926_0056554 | 3300035083 | Unclassified | 1424 |
| 285 | Ga0373926_0070424 | 3300035083 | Bacteria | 1284 |
| 286 | Ga0373945_0026187 | 3300035116 | Bacteria | 2031 |
| 287 | Ga0373945_0032462 | 3300035116 | Bacteria | 1850 |
| 288 | Ga0373956_0130744 | 3300035119 | Bacteria | 1175 |
| 289 | Ga0373943_0003742 | 3300035170 | Bacteria | 6917 |
| 290 | Ga0373943_0021062 | 3300035170 | Bacteria | 3010 |
| 291 | Ga0373955_0028993 | 3300035172 | Bacteria | 2875 |
| 292 | Ga0373955_0172969 | 3300035172 | Bacteria | 1279 |
| 293 | Ga0373955_0187473 | 3300035172 | Bacteria | 1229 |
| 294 | Ga0373942_0024582 | 3300035207 | Bacteria | 1546 |
| 295 | Ga0373924_0066248 | 3300035410 | Bacteria | 1518 |
| 296 | Ga0373931_0016041 | 3300035691 | Bacteria | 3683 |
| 297 | Ga0373935_0014109 | 3300035692 | Archaea | 4825 |
| 298 | Ga0373935_0144303 | 3300035692 | Unclassified | 1610 |
| 299 | Ga0373927_0387905 | 3300035695 | Bacteria | 921 |
| 300 | Ga0373947_0013551 | 3300035725 | Bacteria | 4672 |
| 301 | Ga0373947_0079592 | 3300035725 | Bacteria | 2025 |
| 302 | Ga0373947_0141415 | 3300035725 | Bacteria | 1544 |
| 303 | Ga0373937_0004201 | 3300036401 | Bacteria | 12219 |
| 304 | Ga0373937_0087942 | 3300036401 | Bacteria | 2876 |
| 305 | Ga0373937_0095211 | 3300036401 | Bacteria | 2761 |
| 306 | Ga0373925_0001570 | 3300037068 | Bacteria | 19317 |
| 307 | Ga0373925_0004988 | 3300037068 | Bacteria | 9968 |
| 308 | Ga0395899_0026852 | 3300037312 | Bacteria | 4343 |
| 309 | Ga0395900_0023098 | 3300037418 | Bacteria | 6365 |
| 310 | Ga0395900_0023449 | 3300037418 | Bacteria | 6316 |
| 311 | Ga0395900_0074000 | 3300037418 | Bacteria | 3503 |
| 312 | Ga0395900_0074684 | 3300037418 | Bacteria | 3485 |
| 313 | Ga0395900_0298437 | 3300037418 | Unclassified | 1598 |
| 314 | Ga0395900_0463098 | 3300037418 | Unclassified | 1222 |
| 315 | Ga0395900_0720753 | 3300037418 | Bacteria | 930 |
| 316 | Ga0395898_0003505 | 3300037466 | Bacteria | 17509 |
| 317 | Ga0395898_0050830 | 3300037466 | Bacteria | 4055 |
| 318 | Ga0395898_0104059 | 3300037466 | Bacteria | 2723 |
| 319 | Ga0395898_0254753 | 3300037466 | Bacteria | 1674 |
| 320 | Ga0395905_0365554 | 3300037471 | Bacteria | 1336 |
| 321 | Ga0436364_0828763 | 3300037853 | Bacteria | 1581 |
| 322 | Ga0395901_0001441 | 3300038443 | Bacteria | 24821 |
| 323 | Ga0395901_0002561 | 3300038443 | Bacteria | 18423 |
| 324 | Ga0395901_0007588 | 3300038443 | Bacteria | 10957 |
| 325 | Ga0395901_0058497 | 3300038443 | Bacteria | 4008 |
| 326 | Ga0395901_0073925 | 3300038443 | Bacteria | 3556 |
| 327 | Ga0395901_0116304 | 3300038443 | Bacteria | 2809 |
| 328 | Ga0395901_0187413 | 3300038443 | Bacteria | 2170 |
| 329 | Ga0395901_0310364 | 3300038443 | Bacteria | 1634 |
| 330 | Ga0436365_0275742 | 3300039437 | Bacteria | 1067 |
| 331 | Ga0451577_0593015 | 3300042876 | Bacteria | 1006 |
| 332 | Ga0466972_0060611 | 3300044658 | Bacteria | 1815 |
| 333 | Ga0466965_0025618 | 3300044683 | Unclassified | 2855 |
| 334 | Ga0466965_0322125 | 3300044683 | Bacteria | 842 |
| 335 | Ga0466966_0013803 | 3300044684 | Bacteria | 5346 |
| 336 | Ga0466966_0031572 | 3300044684 | Bacteria | 3434 |
| 337 | Ga0466966_0035288 | 3300044684 | Bacteria | 3231 |
| 338 | Ga0466966_0055033 | 3300044684 | Bacteria | 2520 |
| 339 | Ga0466966_0071150 | 3300044684 | Unclassified | 2179 |
| 340 | Ga0466966_0092157 | 3300044684 | Bacteria | 1880 |
| 341 | Ga0466966_0100186 | 3300044684 | Bacteria | 1792 |
| 342 | Ga0466966_0101581 | 3300044684 | Unclassified | 1778 |
| 343 | Ga0466961_0006475 | 3300044693 | Bacteria | 7439 |
| 344 | Ga0466961_0052672 | 3300044693 | Unclassified | 2597 |
| 345 | Ga0466961_0083951 | 3300044693 | Bacteria | 2014 |
| 346 | Ga0466961_0112764 | 3300044693 | Unclassified | 1710 |
| 347 | Ga0466961_0141227 | 3300044693 | Bacteria | 1508 |
| 348 | Ga0466961_0147454 | 3300044693 | Unclassified | 1471 |
| 349 | Ga0466961_0374905 | 3300044693 | Bacteria | 864 |
| 350 | Ga0466963_0000048 | 3300044694 | Bacteria | 39958 |
| 351 | Ga0466963_0000539 | 3300044694 | Bacteria | 17813 |
| 352 | Ga0466963_0002866 | 3300044694 | Bacteria | 9738 |
| 353 | Ga0466963_0004599 | 3300044694 | Bacteria | 8035 |
| 354 | Ga0466963_0005870 | 3300044694 | Bacteria | 7235 |
| 355 | Ga0466963_0006827 | 3300044694 | Bacteria | 6791 |
| 356 | Ga0466963_0013485 | 3300044694 | Bacteria | 5018 |
| 357 | Ga0466963_0019731 | 3300044694 | Bacteria | 4234 |
| 358 | Ga0466963_0023051 | 3300044694 | Bacteria | 3948 |
| 359 | Ga0466963_0024512 | 3300044694 | Bacteria | 3841 |
| 360 | Ga0466963_0027233 | 3300044694 | Bacteria | 3658 |
| 361 | Ga0466963_0030488 | 3300044694 | Bacteria | 3480 |
| 362 | Ga0466963_0053017 | 3300044694 | Bacteria | 2692 |
| 363 | Ga0466963_0056513 | 3300044694 | Bacteria | 2611 |
| 364 | Ga0466963_0059095 | 3300044694 | Bacteria | 2558 |
| 365 | Ga0466963_0069894 | 3300044694 | Bacteria | 2361 |
| 366 | Ga0466963_0129060 | 3300044694 | Bacteria | 1745 |
| 367 | Ga0466963_0165858 | 3300044694 | Bacteria | 1538 |
| 368 | Ga0466963_0547315 | 3300044694 | Bacteria | 817 |
| 369 | Ga0466964_0000795 | 3300044706 | Bacteria | 10278 |
| 370 | Ga0466964_0001317 | 3300044706 | Bacteria | 8460 |
| 371 | Ga0466964_0001566 | 3300044706 | Bacteria | 7876 |
| 372 | Ga0466964_0003905 | 3300044706 | Bacteria | 5477 |
| 373 | Ga0466964_0008240 | 3300044706 | Bacteria | 3910 |
| 374 | Ga0466964_0015104 | 3300044706 | Bacteria | 2940 |
| 375 | Ga0466964_0023922 | 3300044706 | Bacteria | 2377 |
| 376 | Ga0466964_0055758 | 3300044706 | Bacteria | 1632 |
| 377 | Ga0466964_0078280 | 3300044706 | Bacteria | 1413 |
| 378 | Ga0466971_0000533 | 3300044719 | Bacteria | 15074 |
| 379 | Ga0466971_0006417 | 3300044719 | Bacteria | 5109 |
| 380 | Ga0466971_0008025 | 3300044719 | Bacteria | 4603 |
| 381 | Ga0466971_0011104 | 3300044719 | Bacteria | 3943 |
| 382 | Ga0466971_0014729 | 3300044719 | Bacteria | 3442 |
| 383 | Ga0466971_0040437 | 3300044719 | Bacteria | 2094 |
| 384 | Ga0466971_0048848 | 3300044719 | Bacteria | 1903 |
| 385 | Ga0466971_0110863 | 3300044719 | Unclassified | 1266 |
| 386 | Ga0466971_0174142 | 3300044719 | Unclassified | 1010 |
| 387 | Ga0466971_0191840 | 3300044719 | Bacteria | 963 |
| 388 | Ga0466971_0363867 | 3300044719 | Bacteria | 701 |
| 389 | Ga0466968_0005164 | 3300044735 | Bacteria | 4884 |
| 390 | Ga0466968_0007840 | 3300044735 | Bacteria | 4074 |
| 391 | Ga0466968_0015456 | 3300044735 | Bacteria | 3025 |
| 392 | Ga0466968_0114057 | 3300044735 | Bacteria | 1217 |
| 393 | Ga0466970_0009268 | 3300044765 | Bacteria | 4969 |
| 394 | Ga0466970_0192384 | 3300044765 | Bacteria | 1134 |
| 395 | Ga0466957_0000628 | 3300044842 | Bacteria | 17883 |
| 396 | Ga0466957_0009517 | 3300044842 | Bacteria | 5548 |
| 397 | Ga0466957_0015848 | 3300044842 | Bacteria | 4404 |
| 398 | Ga0466957_0019838 | 3300044842 | Bacteria | 3957 |
| 399 | Ga0466957_0025692 | 3300044842 | Bacteria | 3492 |
| 400 | Ga0466957_0026020 | 3300044842 | Bacteria | 3470 |
| 401 | Ga0466957_0049658 | 3300044842 | Bacteria | 2551 |
| 402 | Ga0466957_0060242 | 3300044842 | Bacteria | 2327 |
| 403 | Ga0466957_0065162 | 3300044842 | Bacteria | 2243 |
| 404 | Ga0466957_0072542 | 3300044842 | Bacteria | 2132 |
| 405 | Ga0466957_0135056 | 3300044842 | Unclassified | 1584 |
| 406 | Ga0466957_0149399 | 3300044842 | Bacteria | 1510 |
| 407 | Ga0466957_0149478 | 3300044842 | Bacteria | 1509 |
| 408 | Ga0466957_0318860 | 3300044842 | Bacteria | 1048 |
| 409 | Ga0466957_0469002 | 3300044842 | Bacteria | 869 |
| 410 | Ga0466960_0002833 | 3300044901 | Bacteria | 6573 |
| 411 | Ga0466960_0008110 | 3300044901 | Bacteria | 4291 |
| 412 | Ga0466960_0101889 | 3300044901 | Bacteria | 1480 |
| 413 | Ga0466960_0132325 | 3300044901 | Bacteria | 1318 |
| 414 | Ga0466960_0204354 | 3300044901 | Bacteria | 1081 |
| 415 | Ga0466960_0406566 | 3300044901 | Bacteria | 785 |
| 416 | Ga0466959_0002307 | 3300045049 | Bacteria | 12174 |
| 417 | Ga0466959_0010353 | 3300045049 | Bacteria | 6661 |
| 418 | Ga0466959_0022590 | 3300045049 | Bacteria | 4651 |
| 419 | Ga0466959_0043510 | 3300045049 | Bacteria | 3310 |
| 420 | Ga0466959_0070266 | 3300045049 | Bacteria | 2536 |
| 421 | Ga0466959_0093018 | 3300045049 | Bacteria | 2164 |
| 422 | Ga0466959_0109423 | 3300045049 | Bacteria | 1973 |
| 423 | Ga0466959_0151977 | 3300045049 | Unclassified | 1631 |
| 424 | Ga0466959_0217081 | 3300045049 | Bacteria | 1327 |
| 425 | Ga0466958_0000693 | 3300045836 | Bacteria | 14666 |
| 426 | Ga0466958_0001432 | 3300045836 | Bacteria | 11305 |
| 427 | Ga0466958_0002882 | 3300045836 | Bacteria | 8768 |
| 428 | Ga0466958_0005505 | 3300045836 | Bacteria | 6829 |
| 429 | Ga0466958_0013897 | 3300045836 | Archaea | 4592 |
| 430 | Ga0466958_0025875 | 3300045836 | Bacteria | 3463 |
| 431 | Ga0466958_0050745 | 3300045836 | Bacteria | 2511 |
| 432 | Ga0466958_0063546 | 3300045836 | Bacteria | 2251 |
| 433 | Ga0466958_0071978 | 3300045836 | Bacteria | 2117 |
| 434 | Ga0466958_0083032 | 3300045836 | Bacteria | 1974 |
| 435 | Ga0466958_0127645 | 3300045836 | Bacteria | 1595 |
| 436 | Ga0466958_0194885 | 3300045836 | Bacteria | 1288 |
| 437 | Ga0466967_0000041 | 3300045976 | Bacteria | 46227 |
| 438 | Ga0466967_0000654 | 3300045976 | Bacteria | 17408 |
| 439 | Ga0466967_0002550 | 3300045976 | Bacteria | 11415 |
| 440 | Ga0466967_0004103 | 3300045976 | Bacteria | 9733 |
| 441 | Ga0466967_0007005 | 3300045976 | Bacteria | 8070 |
| 442 | Ga0466967_0007603 | 3300045976 | Bacteria | 7837 |
| 443 | Ga0466967_0013839 | 3300045976 | Bacteria | 6255 |
| 444 | Ga0466967_0021511 | 3300045976 | Bacteria | 5242 |
| 445 | Ga0466967_0021854 | 3300045976 | Bacteria | 5207 |
| 446 | Ga0466967_0026525 | 3300045976 | Bacteria | 4801 |
| 447 | Ga0466967_0039456 | 3300045976 | Bacteria | 4060 |
| 448 | Ga0466967_0041341 | 3300045976 | Bacteria | 3974 |
| 449 | Ga0466967_0054140 | 3300045976 | Bacteria | 3529 |
| 450 | Ga0466967_0054253 | 3300045976 | Bacteria | 3526 |
| 451 | Ga0466967_0062652 | 3300045976 | Bacteria | 3302 |
| 452 | Ga0466967_0063430 | 3300045976 | Bacteria | 3283 |
| 453 | Ga0466967_0069963 | 3300045976 | Bacteria | 3138 |
| 454 | Ga0466967_0086947 | 3300045976 | Bacteria | 2833 |
| 455 | Ga0466967_0088428 | 3300045976 | Archaea | 2811 |
| 456 | Ga0466967_0108933 | 3300045976 | Bacteria | 2542 |
| 457 | Ga0466967_0112517 | 3300045976 | Bacteria | 2503 |
| 458 | Ga0466967_0112591 | 3300045976 | Unclassified | 2502 |
| 459 | Ga0466967_0161635 | 3300045976 | Bacteria | 2102 |
| 460 | Ga0466967_0175532 | 3300045976 | Bacteria | 2018 |
| 461 | Ga0466967_0196915 | 3300045976 | Bacteria | 1906 |
| 462 | Ga0466967_0390502 | 3300045976 | Bacteria | 1353 |
| 463 | Ga0466967_0605961 | 3300045976 | Unclassified | 1081 |
| 464 | Ga0466967_0743732 | 3300045976 | Archaea | 972 |
| 465 | Ga0495592_0001213 | 3300046454 | Bacteria | 17898 |
| 466 | Ga0495592_0002353 | 3300046454 | Bacteria | 13351 |
| 467 | Ga0495592_0011072 | 3300046454 | Bacteria | 6809 |
| 468 | Ga0495603_0011147 | 3300046455 | Bacteria | 5448 |
| 469 | Ga0495629_0031754 | 3300046459 | Bacteria | 3738 |
| 470 | Ga0495629_0059281 | 3300046459 | Bacteria | 2676 |
| 471 | Ga0495629_0079552 | 3300046459 | Bacteria | 2289 |
| 472 | Ga0495629_0299974 | 3300046459 | Bacteria | 1100 |
| 473 | Ga0495641_0047044 | 3300046461 | Bacteria | 1981 |
| 474 | Ga0495641_0097653 | 3300046461 | Bacteria | 1311 |
| 475 | Ga0495641_0103216 | 3300046461 | Bacteria | 1272 |
| 476 | Ga0495641_0103332 | 3300046461 | Bacteria | 1271 |
| 477 | Ga0495651_0002881 | 3300046462 | Bacteria | 13324 |
| 478 | Ga0495651_0006880 | 3300046462 | Bacteria | 8690 |
| 479 | Ga0495651_0131574 | 3300046462 | Bacteria | 1826 |
| 480 | Ga0495651_0311254 | 3300046462 | Unclassified | 1053 |
| 481 | Ga0495653_0011970 | 3300046463 | Bacteria | 7084 |
| 482 | Ga0495653_0028480 | 3300046463 | Bacteria | 4466 |
| 483 | Ga0495653_0047045 | 3300046463 | Bacteria | 3338 |
| 484 | Ga0495653_0057606 | 3300046463 | Bacteria | 2956 |
| 485 | Ga0495653_0068096 | 3300046463 | Bacteria | 2671 |
| 486 | Ga0495653_0070918 | 3300046463 | Bacteria | 2606 |
| 487 | Ga0495653_0093598 | 3300046463 | Bacteria | 2191 |
| 488 | Ga0495653_0106659 | 3300046463 | Bacteria | 2020 |
| 489 | Ga0495653_0193146 | 3300046463 | Archaea | 1387 |
| 490 | Ga0495582_0050311 | 3300046473 | Bacteria | 2296 |
| 491 | Ga0495582_0059005 | 3300046473 | Bacteria | 2116 |
| 492 | Ga0495582_0100497 | 3300046473 | Bacteria | 1619 |
| 493 | Ga0495582_0217659 | 3300046473 | Bacteria | 1092 |
| 494 | Ga0495639_0002130 | 3300046475 | Bacteria | 8726 |
| 495 | Ga0495662_0172573 | 3300046476 | Bacteria | 1065 |
| 496 | Ga0495664_0036849 | 3300046477 | Bacteria | 2884 |
| 497 | Ga0495664_0093262 | 3300046477 | Bacteria | 1811 |
| 498 | Ga0495664_0330217 | 3300046477 | Bacteria | 919 |
| 499 | Ga0495584_0028912 | 3300046491 | Bacteria | 2810 |
| 500 | Ga0495585_0072772 | 3300046492 | Bacteria | 1872 |
| 501 | Ga0495596_0139241 | 3300046500 | Bacteria | 942 |
| 502 | Ga0495607_0066468 | 3300046501 | Bacteria | 2029 |
| 503 | Ga0495608_0001698 | 3300046511 | Bacteria | 15798 |
| 504 | Ga0495608_0003297 | 3300046511 | Bacteria | 11540 |
| 505 | Ga0495608_0007749 | 3300046511 | Bacteria | 7561 |
| 506 | Ga0495608_0043952 | 3300046511 | Bacteria | 2984 |
| 507 | Ga0495618_0008123 | 3300046514 | Archaea | 6355 |
| 508 | Ga0495618_0024876 | 3300046514 | Bacteria | 3712 |
| 509 | Ga0495618_0061099 | 3300046514 | Bacteria | 2390 |
| 510 | Ga0495618_0089019 | 3300046514 | Bacteria | 1974 |
| 511 | Ga0495618_0113111 | 3300046514 | Bacteria | 1738 |
| 512 | Ga0495618_0206899 | 3300046514 | Unclassified | 1241 |
| 513 | Ga0495618_0403534 | 3300046514 | Unclassified | 835 |
| 514 | Ga0495628_0003868 | 3300046516 | Bacteria | 13338 |
| 515 | Ga0495628_0014698 | 3300046516 | Bacteria | 6555 |
| 516 | Ga0495630_0019726 | 3300046517 | Bacteria | 4960 |
| 517 | Ga0495630_0029802 | 3300046517 | Bacteria | 4057 |
| 518 | Ga0495630_0304319 | 3300046517 | Bacteria | 1218 |
| 519 | Ga0495630_0512721 | 3300046517 | Bacteria | 919 |
| 520 | Ga0495630_0570634 | 3300046517 | Bacteria | 867 |
| 521 | Ga0495630_0598511 | 3300046517 | Unclassified | 845 |
| 522 | Ga0495666_0002953 | 3300046526 | Bacteria | 8519 |
| 523 | Ga0495652_0004471 | 3300046529 | Bacteria | 13351 |
| 524 | Ga0495652_0030129 | 3300046529 | Bacteria | 4761 |
| 525 | Ga0495652_0082140 | 3300046529 | Bacteria | 2657 |
| 526 | Ga0495652_0086179 | 3300046529 | Bacteria | 2580 |
| 527 | Ga0495652_0250456 | 3300046529 | Bacteria | 1313 |
| 528 | Ga0495665_0171731 | 3300046531 | Bacteria | 1129 |
| 529 | Ga0495640_0037587 | 3300046533 | Unclassified | 3414 |
| 530 | Ga0495640_0080523 | 3300046533 | Bacteria | 2165 |
| 531 | Ga0495640_0093108 | 3300046533 | Bacteria | 1986 |
| 532 | Ga0495640_0125052 | 3300046533 | Bacteria | 1668 |
| 533 | Ga0495640_0250239 | 3300046533 | Bacteria | 1110 |
| 534 | Ga0495586_0010283 | 3300046535 | Archaea | 4976 |
| 535 | Ga0495586_0224808 | 3300046535 | Bacteria | 1067 |
| 536 | Ga0495587_0002085 | 3300046536 | Bacteria | 13351 |
| 537 | Ga0495587_0075266 | 3300046536 | Bacteria | 1960 |
| 538 | Ga0495587_0248213 | 3300046536 | Bacteria | 1001 |
| 539 | Ga0495598_0029737 | 3300046537 | Bacteria | 1526 |
| 540 | Ga0495609_0066336 | 3300046538 | Bacteria | 1590 |
| 541 | Ga0495621_0093783 | 3300046539 | Bacteria | 1135 |
| 542 | Ga0495645_0002158 | 3300046543 | Bacteria | 13352 |
| 543 | Ga0495645_0010720 | 3300046543 | Bacteria | 6437 |
| 544 | Ga0495645_0093962 | 3300046543 | Bacteria | 2139 |
| 545 | Ga0495645_0477999 | 3300046543 | Bacteria | 782 |
| 546 | Ga0495667_0022496 | 3300046559 | Bacteria | 4246 |
| 547 | Ga0495667_0027924 | 3300046559 | Bacteria | 3799 |
| 548 | Ga0495667_0059597 | 3300046559 | Bacteria | 2505 |
| 549 | Ga0495667_0087518 | 3300046559 | Bacteria | 2020 |
| 550 | Ga0495667_0176693 | 3300046559 | Bacteria | 1371 |
| 551 | Ga0495667_0393396 | 3300046559 | Unclassified | 873 |
| 552 | Ga0495634_0019155 | 3300046642 | Bacteria | 4864 |
| 553 | Ga0495634_0120641 | 3300046642 | Bacteria | 1679 |
| 554 | Ga0495634_0129368 | 3300046642 | Bacteria | 1611 |
| 555 | Ga0495634_0255898 | 3300046642 | Archaea | 1069 |
| 556 | Ga0495634_0298205 | 3300046642 | Bacteria | 975 |
| 557 | Ga0495611_0026211 | 3300046648 | Bacteria | 2543 |
| 558 | Ga0495635_0009680 | 3300046663 | Bacteria | 6737 |
| 559 | Ga0495635_0045496 | 3300046663 | Bacteria | 3029 |
| 560 | Ga0495635_0052256 | 3300046663 | Bacteria | 2815 |
| 561 | Ga0495635_0067173 | 3300046663 | Bacteria | 2459 |
| 562 | Ga0495588_0277163 | 3300046674 | Bacteria | 884 |
| 563 | Ga0495657_0010733 | 3300046675 | Bacteria | 6885 |
| 564 | Ga0495657_0039259 | 3300046675 | Bacteria | 3254 |
| 565 | Ga0495657_0287585 | 3300046675 | Bacteria | 982 |
| 566 | Ga0495599_0001519 | 3300046678 | Bacteria | 13351 |
| 567 | Ga0495599_0004995 | 3300046678 | Bacteria | 7890 |
| 568 | Ga0495623_0000030 | 3300046679 | Bacteria | 85003 |
| 569 | Ga0495623_0046878 | 3300046679 | Bacteria | 2743 |
| 570 | Ga0495646_0006707 | 3300046680 | Bacteria | 7302 |
| 571 | Ga0495646_0036355 | 3300046680 | Bacteria | 3051 |
| 572 | Ga0495646_0176612 | 3300046680 | Unclassified | 1174 |
| 573 | Ga0495647_0000373 | 3300046681 | Bacteria | 12661 |
| 574 | Ga0495647_0083774 | 3300046681 | Unclassified | 1297 |
| 575 | Ga0495647_0154883 | 3300046681 | Bacteria | 984 |
| 576 | Ga0495658_0027860 | 3300046683 | Bacteria | 3044 |
| 577 | Ga0495658_0040135 | 3300046683 | Bacteria | 2601 |
| 578 | Ga0495658_0088548 | 3300046683 | Bacteria | 1830 |
| 579 | Ga0495658_0106405 | 3300046683 | Unclassified | 1681 |
| 580 | Ga0495613_0001141 | 3300046689 | Bacteria | 20239 |
| 581 | Ga0495613_0041936 | 3300046689 | Bacteria | 3387 |
| 582 | Ga0495613_0066064 | 3300046689 | Bacteria | 2642 |
| 583 | Ga0495613_0082837 | 3300046689 | Bacteria | 2329 |
| 584 | Ga0495613_0096188 | 3300046689 | Bacteria | 2141 |
| 585 | Ga0495624_0074224 | 3300046690 | Bacteria | 2113 |
| 586 | Ga0495624_0080314 | 3300046690 | Bacteria | 2021 |
| 587 | Ga0495589_0070893 | 3300046794 | Bacteria | 1704 |
| 588 | Ga0495600_0007090 | 3300046809 | Bacteria | 6849 |
| 589 | Ga0495600_0231861 | 3300046809 | Bacteria | 1178 |
| 590 | Ga0495581_0003607 | 3300047315 | Bacteria | 8910 |
| 591 | Ga0495581_0242176 | 3300047315 | Bacteria | 1055 |
| 592 | Ga0495604_0003068 | 3300047317 | Bacteria | 13351 |
| 593 | Ga0495604_0019930 | 3300047317 | Bacteria | 5362 |
| 594 | Ga0495604_0489362 | 3300047317 | Bacteria | 799 |
| 595 | Ga0495636_0014712 | 3300047318 | Bacteria | 3114 |
| 596 | Ga0495674_0019490 | 3300047319 | Bacteria | 6294 |
| 597 | Ga0495674_0083773 | 3300047319 | Bacteria | 2733 |
| 598 | Ga0495674_0100715 | 3300047319 | Bacteria | 2458 |
| 599 | Ga0495674_0119851 | 3300047319 | Bacteria | 2224 |
| 600 | Ga0495674_0499070 | 3300047319 | Unclassified | 973 |
| 601 | Ga0495676_0063402 | 3300047321 | Bacteria | 2880 |
| 602 | Ga0495676_0388080 | 3300047321 | Bacteria | 928 |
| 603 | Ga0495676_0492368 | 3300047321 | Bacteria | 805 |
| 604 | Ga0495680_0004424 | 3300047322 | Bacteria | 13428 |
| 605 | Ga0495680_0045724 | 3300047322 | Bacteria | 3456 |
| 606 | Ga0495680_0059585 | 3300047322 | Bacteria | 2946 |
| 607 | Ga0495680_0072036 | 3300047322 | Unclassified | 2629 |
| 608 | Ga0495680_0076309 | 3300047322 | Bacteria | 2541 |
| 609 | Ga0495680_0202805 | 3300047322 | Bacteria | 1422 |
| 610 | Ga0495680_0281468 | 3300047322 | Bacteria | 1172 |
| 611 | Ga0495680_0317201 | 3300047322 | Bacteria | 1091 |
| 612 | Ga0495683_0169655 | 3300047323 | Bacteria | 1004 |
| 613 | Ga0495675_0001663 | 3300047444 | Bacteria | 13319 |
| 614 | Ga0495675_0043313 | 3300047444 | Bacteria | 2868 |
| 615 | Ga0495675_0311489 | 3300047444 | Unclassified | 933 |
| 616 | Ga0495675_0319160 | 3300047444 | Bacteria | 919 |
| 617 | Ga0495684_0021275 | 3300047471 | Bacteria | 4997 |
| 618 | Ga0495684_0053738 | 3300047471 | Bacteria | 3073 |
| 619 | Ga0495684_0165990 | 3300047471 | Archaea | 1644 |
| 620 | Ga0495684_0211856 | 3300047471 | Bacteria | 1424 |
| 621 | Ga0495684_0312935 | 3300047471 | Bacteria | 1124 |
| 622 | Ga0495684_0350902 | 3300047471 | Bacteria | 1047 |
| 623 | Ga0495593_0005681 | 3300047673 | Bacteria | 7359 |
| 624 | Ga0495602_0005668 | 3300048088 | Bacteria | 13098 |
| 625 | Ga0495602_0097753 | 3300048088 | Bacteria | 2418 |
| 626 | Ga0495614_0003371 | 3300048089 | Bacteria | 7141 |
| 627 | Ga0496100_0001055 | 3300048903 | Bacteria | 13288 |
| 628 | Ga0496100_0005613 | 3300048903 | Bacteria | 6776 |
| 629 | Ga0496100_0035402 | 3300048903 | Bacteria | 3139 |
| 630 | Ga0496100_0063676 | 3300048903 | Bacteria | 2438 |
| 631 | Ga0496100_0108797 | 3300048903 | Bacteria | 1923 |
| 632 | Ga0496100_0263010 | 3300048903 | Bacteria | 1280 |
| 633 | Ga0496101_0006784 | 3300048904 | Bacteria | 7383 |
| 634 | Ga0496101_0040049 | 3300048904 | Bacteria | 3336 |
| 635 | Ga0496101_0044675 | 3300048904 | Bacteria | 3170 |
| 636 | Ga0496101_0075248 | 3300048904 | Archaea | 2485 |
| 637 | Ga0496101_0235705 | 3300048904 | Bacteria | 1423 |
| 638 | Ga0496102_0004720 | 3300048905 | Bacteria | 11537 |
| 639 | Ga0496102_0006676 | 3300048905 | Bacteria | 9856 |
| 640 | Ga0496102_0033899 | 3300048905 | Bacteria | 4591 |
| 641 | Ga0496104_0002384 | 3300048907 | Bacteria | 16190 |
| 642 | Ga0496104_0005229 | 3300048907 | Bacteria | 11353 |
| 643 | Ga0496104_0076655 | 3300048907 | Bacteria | 3184 |
| 644 | Ga0496104_0114404 | 3300048907 | Bacteria | 2587 |
| 645 | Ga0496104_0122355 | 3300048907 | Bacteria | 2498 |
| 646 | Ga0496104_0244043 | 3300048907 | Bacteria | 1708 |
| 647 | Ga0496105_0000406 | 3300048908 | Bacteria | 28366 |
| 648 | Ga0496105_0007590 | 3300048908 | Bacteria | 8406 |
| 649 | Ga0496105_0020580 | 3300048908 | Bacteria | 5333 |
| 650 | Ga0496105_0051035 | 3300048908 | Bacteria | 3418 |
| 651 | Ga0496105_0101058 | 3300048908 | Bacteria | 2381 |
| 652 | Ga0496105_0260043 | 3300048908 | Bacteria | 1404 |
| 653 | Ga0496105_0270771 | 3300048908 | Bacteria | 1371 |
| 654 | Ga0496105_0328038 | 3300048908 | Bacteria | 1225 |
| 655 | Ga0496106_0000263 | 3300048909 | Bacteria | 36905 |
| 656 | Ga0496106_0003160 | 3300048909 | Bacteria | 12295 |
| 657 | Ga0496106_0039454 | 3300048909 | Bacteria | 3536 |
| 658 | Ga0496106_0461409 | 3300048909 | Bacteria | 1020 |
| 659 | Ga0496107_0000712 | 3300048910 | Bacteria | 18973 |
| 660 | Ga0496107_0003838 | 3300048910 | Bacteria | 10099 |
| 661 | Ga0496107_0020318 | 3300048910 | Bacteria | 4689 |
| 662 | Ga0496107_0153269 | 3300048910 | Unclassified | 1705 |
| 663 | Ga0496107_0505335 | 3300048910 | Bacteria | 896 |
| 664 | Ga0496108_0007285 | 3300048911 | Bacteria | 8969 |
| 665 | Ga0496108_0023585 | 3300048911 | Bacteria | 5064 |
| 666 | Ga0496108_0065217 | 3300048911 | Bacteria | 3069 |
| 667 | Ga0496108_0103168 | 3300048911 | Bacteria | 2433 |
| 668 | Ga0496108_0251240 | 3300048911 | Unclassified | 1538 |
| 669 | Ga0496108_0749559 | 3300048911 | Bacteria | 845 |
| 670 | Ga0496108_0888721 | 3300048911 | Bacteria | 765 |
| 671 | Ga0496109_0001107 | 3300048912 | Bacteria | 22340 |
| 672 | Ga0496109_0029773 | 3300048912 | Bacteria | 4891 |
| 673 | Ga0496109_0070652 | 3300048912 | Bacteria | 3204 |
| 674 | Ga0496109_0111049 | 3300048912 | Bacteria | 2549 |
| 675 | Ga0496109_0187479 | 3300048912 | Bacteria | 1943 |
| 676 | Ga0496109_0258485 | 3300048912 | Unclassified | 1640 |
| 677 | Ga0496109_0346111 | 3300048912 | Unclassified | 1404 |
| 678 | Ga0496109_0456490 | 3300048912 | Bacteria | 1207 |
| 679 | Ga0496110_0001849 | 3300048913 | Bacteria | 15623 |
| 680 | Ga0496110_0030017 | 3300048913 | Bacteria | 4684 |
| 681 | Ga0496110_0566455 | 3300048913 | Bacteria | 1032 |
| 682 | Ga0496110_0596145 | 3300048913 | Bacteria | 1003 |
| 683 | Ga0496110_0744579 | 3300048913 | Bacteria | 883 |
| 684 | Ga0496111_0006168 | 3300048914 | Bacteria | 7760 |
| 685 | Ga0496111_0013375 | 3300048914 | Bacteria | 5582 |
| 686 | Ga0496111_0032855 | 3300048914 | Bacteria | 3700 |
| 687 | Ga0496111_0377587 | 3300048914 | Unclassified | 1048 |
| 688 | Ga0496112_0041605 | 3300048915 | Bacteria | 4496 |
| 689 | Ga0496112_0047557 | 3300048915 | Bacteria | 4209 |
| 690 | Ga0496112_0054615 | 3300048915 | Bacteria | 3925 |
| 691 | Ga0496112_0078461 | 3300048915 | Bacteria | 3266 |
| 692 | Ga0496112_0129020 | 3300048915 | Bacteria | 2499 |
| 693 | Ga0496112_0159275 | 3300048915 | Bacteria | 2224 |
| 694 | Ga0496112_0186648 | 3300048915 | Bacteria | 2036 |
| 695 | Ga0496112_0327886 | 3300048915 | Bacteria | 1475 |
| 696 | Ga0496112_0341244 | 3300048915 | Bacteria | 1441 |
| 697 | Ga0496113_0011248 | 3300048916 | Bacteria | 5960 |
| 698 | Ga0496113_0172548 | 3300048916 | Bacteria | 1713 |
| 699 | Ga0496113_0183168 | 3300048916 | Unclassified | 1660 |
| 700 | Ga0496113_0230843 | 3300048916 | Bacteria | 1475 |
| 701 | Ga0496114_0000444 | 3300048917 | Bacteria | 30383 |
| 702 | Ga0496114_0021194 | 3300048917 | Archaea | 5285 |
| 703 | Ga0496114_0035397 | 3300048917 | Bacteria | 4123 |
| 704 | Ga0496114_0725065 | 3300048917 | Bacteria | 870 |
| 705 | Ga0496115_0000415 | 3300048918 | Bacteria | 34771 |
| 706 | Ga0496115_0014475 | 3300048918 | Bacteria | 5972 |
| 707 | Ga0496115_0032107 | 3300048918 | Bacteria | 4142 |
| 708 | Ga0496115_0368531 | 3300048918 | Bacteria | 1169 |
| 709 | Ga0496115_0543249 | 3300048918 | Bacteria | 929 |
| 710 | Ga0501031_0142830 | 3300049568 | Unclassified | 1564 |
| 711 | Ga0501032_0028359 | 3300049569 | Bacteria | 3847 |
| 712 | Ga0501033_0012589 | 3300049570 | Bacteria | 6455 |
| 713 | Ga0501036_0012780 | 3300049572 | Bacteria | 6964 |
| 714 | Ga0501037_0022411 | 3300049573 | Bacteria | 4672 |
| 715 | Ga0501038_0622973 | 3300049574 | Unclassified | 814 |
| 716 | Ga0501039_0010101 | 3300049575 | Bacteria | 7189 |
| 717 | Ga0501040_0031459 | 3300049576 | Bacteria | 3586 |
| 718 | Ga0501041_0020896 | 3300049577 | Bacteria | 3919 |
| 719 | Ga0501042_0034520 | 3300049578 | Bacteria | 3587 |
| 720 | Ga0501043_0004631 | 3300049579 | Bacteria | 11150 |
| 721 | Ga0501047_0056675 | 3300049581 | Bacteria | 3790 |
| 722 | Ga0501048_0402441 | 3300049582 | Bacteria | 978 |
| 723 | Ga0501067_0007172 | 3300049583 | Bacteria | 6192 |
| 724 | Ga0501067_0012311 | 3300049583 | Archaea | 4743 |
| 725 | Ga0501068_0027574 | 3300049584 | Bacteria | 3354 |
| 726 | Ga0501068_0069797 | 3300049584 | Bacteria | 2143 |
| 727 | Ga0501068_0290350 | 3300049584 | Bacteria | 1046 |
| 728 | Ga0501068_0369691 | 3300049584 | Bacteria | 923 |
| 729 | Ga0501069_0003977 | 3300049585 | Bacteria | 7626 |
| 730 | Ga0501069_0097011 | 3300049585 | Bacteria | 1670 |
| 731 | Ga0501069_0133061 | 3300049585 | Bacteria | 1425 |
| 732 | Ga0501069_0156382 | 3300049585 | Bacteria | 1312 |
| 733 | Ga0501070_0017997 | 3300049586 | Bacteria | 5929 |
| 734 | Ga0501070_0048643 | 3300049586 | Bacteria | 3521 |
| 735 | Ga0501070_0061713 | 3300049586 | Bacteria | 3106 |
| 736 | Ga0501070_0290710 | 3300049586 | Bacteria | 1332 |
| 737 | Ga0501070_0544700 | 3300049586 | Bacteria | 929 |
| 738 | Ga0501072_0062680 | 3300049588 | Bacteria | 2932 |
| 739 | Ga0501073_0010789 | 3300049589 | Bacteria | 6691 |
| 740 | Ga0501073_0011468 | 3300049589 | Bacteria | 6483 |
| 741 | Ga0501074_0040728 | 3300049590 | Bacteria | 3363 |
| 742 | Ga0501074_0071720 | 3300049590 | Unclassified | 2489 |
| 743 | Ga0501074_0108961 | 3300049590 | Bacteria | 1982 |
| 744 | Ga0501074_0196079 | 3300049590 | Bacteria | 1439 |
| 745 | Ga0501075_0020523 | 3300049591 | Bacteria | 4808 |
| 746 | Ga0501076_0029468 | 3300049592 | Bacteria | 4268 |
| 747 | Ga0501077_0013125 | 3300049593 | Bacteria | 5191 |
| 748 | Ga0501079_0025056 | 3300049741 | Bacteria | 4577 |
| 749 | Ga0501079_0073494 | 3300049741 | Bacteria | 2642 |
| 750 | Ga0501080_0017302 | 3300049742 | Bacteria | 6663 |
| 751 | Ga0501080_0030527 | 3300049742 | Bacteria | 5021 |
| 752 | Ga0501080_0189370 | 3300049742 | Bacteria | 1891 |
| 753 | Ga0501080_0199451 | 3300049742 | Bacteria | 1837 |
| 754 | Ga0501081_0012861 | 3300049743 | Bacteria | 5503 |
| 755 | Ga0501083_0003468 | 3300049744 | Bacteria | 11026 |
| 756 | Ga0501083_0394355 | 3300049744 | Bacteria | 900 |
| 757 | Ga0501035_0011854 | 3300049822 | Bacteria | 8071 |
| 758 | Ga0501035_0066500 | 3300049822 | Bacteria | 3199 |
| 759 | Ga0501044_0249771 | 3300049823 | Unclassified | 1715 |
| 760 | Ga0501044_0474985 | 3300049823 | Bacteria | 1154 |
| 761 | Ga0501044_0539353 | 3300049823 | Bacteria | 1065 |
| 762 | Ga0501045_0003958 | 3300049824 | Bacteria | 10193 |
| 763 | nmdc:mga00v17_40688_c1 | 3300050491 | Bacteria | 2789 |
| 764 | nmdc:mga0yw44_12817_c1 | 3300050492 | Bacteria | 4386 |
| 765 | nmdc:mga06r32_21395_c1 | 3300050510 | Bacteria | 5972 |
| 766 | nmdc:mga08y16_134989_c1 | 3300050511 | Bacteria | 2565 |
| 767 | nmdc:mga0n895_47264_c1 | 3300050512 | Bacteria | 4208 |
| 768 | nmdc:mga0rr50_13085_c1 | 3300050513 | Bacteria | 5388 |
| 769 | nmdc:mga0rr50_54601_c1 | 3300050513 | Bacteria | 2977 |
| 770 | nmdc:mga08x19_137974_c1 | 3300050514 | Unclassified | 1645 |
| 771 | nmdc:mga0a205_168028_c1 | 3300050515 | Bacteria | 2089 |
| 772 | Ga0495601_0001383 | 3300053077 | Bacteria | 13345 |
| 773 | Ga0495601_0012130 | 3300053077 | Bacteria | 5166 |
| 774 | Ga0495601_0079745 | 3300053077 | Bacteria | 2099 |
| 775 | Ga0495601_0103136 | 3300053077 | Bacteria | 1843 |
| 776 | Ga0495601_0163961 | 3300053077 | Bacteria | 1452 |
| 777 | Ga0495612_0048272 | 3300053078 | Bacteria | 1745 |
| 778 | Ga0495612_0060374 | 3300053078 | Bacteria | 1569 |
| 779 | Ga0495612_0097652 | 3300053078 | Bacteria | 1248 |
| 780 | Ga0495612_0194326 | 3300053078 | Bacteria | 894 |
| 781 | Ga0495595_0001006 | 3300053084 | Bacteria | 10860 |
| 782 | Ga0495595_0033723 | 3300053084 | Bacteria | 2312 |
| 783 | Ga0495595_0041927 | 3300053084 | Bacteria | 2096 |
| 784 | Ga0495619_0002076 | 3300053085 | Bacteria | 13320 |
| 785 | Ga0495619_0012085 | 3300053085 | Bacteria | 5439 |
| 786 | Ga0495619_0051724 | 3300053085 | Bacteria | 2715 |
| 787 | Ga0495619_0063399 | 3300053085 | Bacteria | 2462 |
| 788 | Ga0495619_0065010 | 3300053085 | Bacteria | 2433 |
| 789 | Ga0495619_0188808 | 3300053085 | Bacteria | 1426 |
| 790 | Ga0500566_0270515 | 3300053094 | Bacteria | 815 |
| 791 | Ga0501084_0047995 | 3300054114 | Bacteria | 3575 |
| 792 | Ga0501084_0578109 | 3300054114 | Bacteria | 949 |
| 793 | Ga0501082_0049100 | 3300060353 | Bacteria | 3638 |
| 794 | Ga0501082_0229877 | 3300060353 | Bacteria | 1614 |
| 795 | Ga0501082_0777027 | 3300060353 | Bacteria | 838 |
| 796 | Ga0466962_0000686 | 3300061719 | Bacteria | 15058 |
| 797 | Ga0466962_0000731 | 3300061719 | Bacteria | 14723 |
| 798 | Ga0466962_0001101 | 3300061719 | Bacteria | 12437 |
| 799 | Ga0466962_0001681 | 3300061719 | Bacteria | 10380 |
| 800 | Ga0466962_0033796 | 3300061719 | Bacteria | 2447 |
| 801 | Ga0466962_0044941 | 3300061719 | Bacteria | 2112 |
| 802 | Ga0466962_0063561 | 3300061719 | Bacteria | 1762 |
| 803 | Ga0466962_0246723 | 3300061719 | Bacteria | 877 |
| 804 | Ga0466962_0273169 | 3300061719 | Bacteria | 833 |
| 805 | Ga0530510_0014794 | 3300061734 | Bacteria | 5510 |
| 806 | Ga0530510_0370289 | 3300061734 | Archaea | 1077 |
| 807 | Ga0466963_0062301 | |||
| 808 | Ga0070658_10023144 | |||
| 809 | Ga0070658_10052039 | |||
| 810 | Ga0070658_10069945 | |||
| 811 | Ga0070683_100144770 | |||
| 812 | Ga0070680_100007611 | |||
| 813 | Ga0070680_100052968 | |||
| 814 | Ga0070680_100077028 | |||
| 815 | Ga0070680_100128504 | |||
| 816 | Ga0070682_100095477 | |||
| 817 | Ga0070682_100195407 | |||
| 818 | Ga0070682_100246459 | |||
| 819 | Ga0070682_100346033 | |||
| 820 | Ga0070660_100004010 | |||
| 821 | Ga0070660_100008337 | |||
| 822 | Ga0070660_100112159 | |||
| 823 | Ga0070660_100119240 | |||
| 824 | Ga0070691_10038504 | |||
| 825 | Ga0070661_100020278 | |||
| 826 | Ga0070661_100107728 | |||
| 827 | Ga0070661_100222123 | |||
| 828 | Ga0070671_100109490 | |||
| 829 | Ga0070659_100004651 | |||
| 830 | Ga0070659_100241657 | |||
| 831 | Ga0070709_10015614 | |||
| 832 | Ga0070709_10039205 | |||
| 833 | Ga0070709_10388193 | |||
| 834 | Ga0070714_100043179 | |||
| 835 | Ga0070714_100045291 | |||
| 836 | Ga0070714_100049668 | |||
| 837 | Ga0070714_100055409 | |||
| 838 | Ga0070714_100082110 | |||
| 839 | Ga0070714_100145507 | |||
| 840 | Ga0070714_100180757 | |||
| 841 | Ga0070713_100008162 | |||
| 842 | Ga0070713_100167501 | |||
| 843 | Ga0070710_10020558 | |||
| 844 | Ga0070710_10135065 | |||
| 845 | Ga0070710_10228944 | |||
| 846 | Ga0070711_100021578 | |||
| 847 | Ga0070711_100129317 | |||
| 848 | Ga0070711_100338386 | |||
| 849 | Ga0070681_10014602 | |||
| 850 | Ga0070681_10030783 | |||
| 851 | Ga0070681_10092816 | |||
| 852 | Ga0070681_10094224 | |||
| 853 | Ga0070681_10116935 | |||
| 854 | Ga0070681_10138921 | |||
| 855 | Ga0070681_10152619 | |||
| 856 | Ga0070681_10159286 | |||
| 857 | Ga0070681_10185870 | |||
| 858 | Ga0070681_10251638 | |||
| 859 | Ga0070681_10284121 | |||
| 860 | Ga0070681_10349031 | |||
| 861 | Ga0070681_10510842 | |||
| 862 | Ga0070707_100013157 | |||
| 863 | Ga0070707_100064661 | |||
| 864 | Ga0070707_100180899 | |||
| 865 | Ga0070679_100004023 | |||
| 866 | Ga0070679_100037286 | |||
| 867 | Ga0070679_100064377 | |||
| 868 | Ga0070679_100143142 | |||
| 869 | Ga0070679_100181709 | |||
| 870 | Ga0070679_100221711 | |||
| 871 | Ga0070679_100293531 | |||
| 872 | Ga0070679_100329904 | |||
| 873 | Ga0070684_100031251 | |||
| 874 | Ga0070684_100069598 | |||
| 875 | Ga0070684_100308587 | |||
| 876 | Ga0070695_100000209 | |||
| 877 | Ga0070695_100477561 | |||
| 878 | Ga0070693_100278810 | |||
| 879 | Ga0070665_100008828 | |||
| 880 | Ga0068855_100003360 | |||
| 881 | Ga0068855_100026961 | |||
| 882 | Ga0068855_100069489 | |||
| 883 | Ga0068855_100305368 | |||
| 884 | Ga0068855_100326884 | |||
| 885 | Ga0070664_100099309 | |||
| 886 | Ga0068857_100010310 | |||
| 887 | Ga0068857_100980121 | |||
| 888 | Ga0068856_100064851 | |||
| 889 | Ga0068856_100102593 | |||
| 890 | Ga0068856_100192546 | |||
| 891 | Ga0068856_100581065 | |||
| 892 | Ga0068852_100141014 | |||
| 893 | Ga0068852_100371317 | |||
| 894 | Ga0068852_100890370 | |||
| 895 | Ga0068851_10218828 | |||
| 896 | Ga0068863_100493577 | |||
| 897 | Ga0081538_10002526 | |||
| 898 | Ga0070717_10017583 | |||
| 899 | Ga0070717_10042668 | |||
| 900 | Ga0070717_10117772 | |||
| 901 | Ga0070717_10384477 | |||
| 902 | Ga0075365_10010117 | |||
| 903 | Ga0075364_10023663 | |||
| 904 | Ga0070716_100220682 | |||
| 905 | Ga0070712_100042216 | |||
| 906 | Ga0070712_100131166 | |||
| 907 | Ga0070712_100150785 | |||
| 908 | Ga0070712_100305997 | |||
| 909 | Ga0070712_100697232 | |||
| 910 | Ga0075362_10009981 | |||
| 911 | Ga0075366_10304450 | |||
| 912 | Ga0068871_100337525 | |||
| 913 | Ga0075430_100083529 | |||
| 914 | Ga0075434_100058417 | |||
| 915 | Ga0075436_100127152 | |||
| 916 | Ga0075436_100360591 | |||
| 917 | Ga0105240_10040263 | |||
| 918 | Ga0105240_10073124 | |||
| 919 | Ga0105240_10143995 | |||
| 920 | Ga0105240_10349550 | |||
| 921 | Ga0105240_10532323 | |||
| 922 | Ga0105240_10654383 | |||
| 923 | Ga0111539_10141578 | |||
| 924 | Ga0105245_10058677 | |||
| 925 | Ga0105245_10506601 | |||
| 926 | Ga0105247_10070534 | |||
| 927 | Ga0105241_10316610 | |||
| 928 | Ga0105241_10336045 | |||
| 929 | Ga0105248_10705008 | |||
| 930 | Ga0105237_10016380 | |||
| 931 | Ga0105237_10022957 | |||
| 932 | Ga0105237_10039515 | |||
| 933 | Ga0105237_10351501 | |||
| 934 | Ga0105237_10436008 | |||
| 935 | Ga0105237_10816298 | |||
| 936 | Ga0105238_10082873 | |||
| 937 | Ga0105238_10264996 | |||
| 938 | Ga0105238_10331617 | |||
| 939 | Ga0105239_10967962 | |||
| 940 | Ga0157371_10141324 | |||
| 941 | Ga0157370_10040631 | |||
| 942 | Ga0157370_10150393 | |||
| 943 | Ga0157369_10003497 | |||
| 944 | Ga0157369_10069215 | |||
| 945 | Ga0157369_10092028 | |||
| 946 | Ga0157369_10116962 | |||
| 947 | Ga0157369_10142872 | |||
| 948 | Ga0157369_10197170 | |||
| 949 | Ga0157369_10559104 | |||
| 950 | Ga0157374_10270067 | |||
| 951 | Ga0157378_10275723 | |||
| 952 | Ga0163162_10142685 | |||
| 953 | Ga0157372_10077896 | |||
| 954 | Ga0157372_10092439 | |||
| 955 | Ga0157372_10096294 | |||
| 956 | Ga0157372_10330764 | |||
| 957 | Ga0157372_10554509 | |||
| 958 | Ga0182008_10030636 | |||
| 959 | Ga0182008_10048084 | |||
| 960 | Ga0157376_10052312 | |||
| 961 | Ga0182006_1042604 | |||
| 962 | Ga0182007_10011026 | |||
| 963 | Ga0197907_10437748 | |||
| 964 | Ga0206356_11766374 | |||
| 965 | Ga0206354_10892643 | |||
| 966 | Ga0206354_11476353 | |||
| 967 | Ga0206354_11660076 | |||
| 968 | Ga0206353_10436155 | |||
| 969 | Ga0206353_10664051 | |||
| 970 | Ga0206353_10793924 | |||
| 971 | Ga0206353_11825549 | |||
| 972 | Ga0206353_11838159 | |||
| 973 | Ga0206353_11887398 | |||
| 974 | Ga0207692_10081443 | |||
| 975 | Ga0207692_10540908 | |||
| 976 | Ga0207699_10031962 | |||
| 977 | Ga0207699_10288657 | |||
| 978 | Ga0207705_10043796 | |||
| 979 | Ga0207705_10230652 | |||
| 980 | Ga0207705_10274057 | |||
| 981 | Ga0207705_10424893 | |||
| 982 | Ga0207707_10001354 | |||
| 983 | Ga0207707_10024189 | |||
| 984 | Ga0207707_10029791 | |||
| 985 | Ga0207707_10043812 | |||
| 986 | Ga0207707_10149015 | |||
| 987 | Ga0207707_10164927 | |||
| 988 | Ga0207707_10200088 | |||
| 989 | Ga0207707_10310157 | |||
| 990 | Ga0207707_10429853 | |||
| 991 | Ga0207695_10037681 | |||
| 992 | Ga0207695_10084211 | |||
| 993 | Ga0207695_10271197 | |||
| 994 | Ga0207695_10402216 | |||
| 995 | Ga0207671_10062625 | |||
| 996 | Ga0207671_10203613 | |||
| 997 | Ga0207693_10001707 | |||
| 998 | Ga0207693_10011495 | |||
| 999 | Ga0207693_10019163 | |||
| 1000 | Ga0207693_10023979 | |||
| 1001 | Ga0207693_10119738 | |||
| 1002 | Ga0207693_10127806 | |||
| 1003 | Ga0207693_10249853 | |||
| 1004 | Ga0207663_10084539 | |||
| 1005 | Ga0207663_10230747 | |||
| 1006 | Ga0207660_10004499 | |||
| 1007 | Ga0207660_10075932 | |||
| 1008 | Ga0207660_10098775 | |||
| 1009 | Ga0207657_10000184 | |||
| 1010 | Ga0207657_10006239 | |||
| 1011 | Ga0207657_10029035 | |||
| 1012 | Ga0207657_10063338 | |||
| 1013 | Ga0207657_10364866 | |||
| 1014 | Ga0207649_10025080 | |||
| 1015 | Ga0207649_10114834 | |||
| 1016 | Ga0207649_10163291 | |||
| 1017 | Ga0207649_10262615 | |||
| 1018 | Ga0207652_10003340 | |||
| 1019 | Ga0207652_10048976 | |||
| 1020 | Ga0207652_10098149 | |||
| 1021 | Ga0207652_10099735 | |||
| 1022 | Ga0207652_10147970 | |||
| 1023 | Ga0207652_10483942 | |||
| 1024 | Ga0207652_10492524 | |||
| 1025 | Ga0207652_10631041 | |||
| 1026 | Ga0207646_10001064 | |||
| 1027 | Ga0207646_10172179 | |||
| 1028 | Ga0207646_10251052 | |||
| 1029 | Ga0207694_10035395 | |||
| 1030 | Ga0207694_10110622 | |||
| 1031 | Ga0207694_10134689 | |||
| 1032 | Ga0207687_10198992 | |||
| 1033 | Ga0207700_10042141 | |||
| 1034 | Ga0207700_10077359 | |||
| 1035 | Ga0207700_10108666 | |||
| 1036 | Ga0207700_10177969 | |||
| 1037 | Ga0207700_10393232 | |||
| 1038 | Ga0207664_10003905 | |||
| 1039 | Ga0207664_10014445 | |||
| 1040 | Ga0207664_10030357 | |||
| 1041 | Ga0207664_10046731 | |||
| 1042 | Ga0207664_10078806 | |||
| 1043 | Ga0207664_10109643 | |||
| 1044 | Ga0207664_10248860 | |||
| 1045 | Ga0207664_10273269 | |||
| 1046 | Ga0207664_10329584 | |||
| 1047 | Ga0207664_10475062 | |||
| 1048 | Ga0207690_10195554 | |||
| 1049 | Ga0207690_10276106 | |||
| 1050 | Ga0207665_10000359 | |||
| 1051 | Ga0207665_10102158 | |||
| 1052 | Ga0207661_10001055 | |||
| 1053 | Ga0207661_10566227 | |||
| 1054 | Ga0207679_10097784 | |||
| 1055 | Ga0207667_10057570 | |||
| 1056 | Ga0207667_10127997 | |||
| 1057 | Ga0207667_10185113 | |||
| 1058 | Ga0207640_10806380 | |||
| 1059 | Ga0207678_10345915 | |||
| 1060 | Ga0207702_10076792 | |||
| 1061 | Ga0207702_10106090 | |||
| 1062 | Ga0207702_10219373 | |||
| 1063 | Ga0207702_10586174 | |||
| 1064 | Ga0207674_10015785 | |||
| 1065 | Ga0207674_10226055 | |||
| 1066 | Ga0207675_100708543 | |||
| 1067 | Ga0207698_10074684 | |||
| 1068 | Ga0207698_10119952 | |||
| 1069 | Ga0207428_10030531 | |||
| 1070 | Ga0265319_1020830 | |||
| 1071 | Ga0265318_10003454 | |||
| 1072 | Ga0265323_10060336 | |||
| 1073 | Ga0265322_10059565 | |||
| 1074 | Ga0265336_10001745 | |||
| 1075 | Ga0265338_10001085 | |||
| 1076 | Ga0265338_10004329 | |||
| 1077 | Ga0265338_10031718 | |||
| 1078 | Ga0265338_10069615 | |||
| 1079 | Ga0265338_10138017 | |||
| 1080 | Ga0265330_10012111 | |||
| 1081 | Ga0265332_10082576 | |||
| 1082 | Ga0265328_10005579 | |||
| 1083 | Ga0265320_10043067 | |||
| 1084 | Ga0265339_10010275 | |||
| 1085 | Ga0265339_10064427 | |||
| 1086 | Ga0265331_10005519 | |||
| 1087 | Ga0265327_10084610 | |||
| 1088 | Ga0265313_10062434 | |||
| 1089 | Ga0265314_10020273 | |||
| 1090 | Ga0373926_0056554 | |||
| 1091 | Ga0373926_0070424 | |||
| 1092 | Ga0373945_0026187 | |||
| 1093 | Ga0373945_0032462 | |||
| 1094 | Ga0373956_0130744 | |||
| 1095 | Ga0373943_0003742 | |||
| 1096 | Ga0373943_0021062 | |||
| 1097 | Ga0373955_0028993 | |||
| 1098 | Ga0373955_0172969 | |||
| 1099 | Ga0373955_0187473 | |||
| 1100 | Ga0373942_0024582 | |||
| 1101 | Ga0373924_0066248 | |||
| 1102 | Ga0373931_0016041 | |||
| 1103 | Ga0373935_0014109 | |||
| 1104 | Ga0373935_0144303 | |||
| 1105 | Ga0373927_0387905 | |||
| 1106 | Ga0373947_0013551 | |||
| 1107 | Ga0373947_0079592 | |||
| 1108 | Ga0373947_0141415 | |||
| 1109 | Ga0373937_0004201 | |||
| 1110 | Ga0373937_0087942 | |||
| 1111 | Ga0373937_0095211 | |||
| 1112 | Ga0373925_0001570 | |||
| 1113 | Ga0373925_0004988 | |||
| 1114 | Ga0395899_0026852 | |||
| 1115 | Ga0395900_0023098 | |||
| 1116 | Ga0395900_0023449 | |||
| 1117 | Ga0395900_0074000 | |||
| 1118 | Ga0395900_0074684 | |||
| 1119 | Ga0395900_0298437 | |||
| 1120 | Ga0395900_0463098 | |||
| 1121 | Ga0395900_0720753 | |||
| 1122 | Ga0395898_0003505 | |||
| 1123 | Ga0395898_0050830 | |||
| 1124 | Ga0395898_0104059 | |||
| 1125 | Ga0395898_0254753 | |||
| 1126 | Ga0395905_0365554 | |||
| 1127 | Ga0436364_0828763 | |||
| 1128 | Ga0395901_0001441 | |||
| 1129 | Ga0395901_0002561 | |||
| 1130 | Ga0395901_0007588 | |||
| 1131 | Ga0395901_0058497 | |||
| 1132 | Ga0395901_0073925 | |||
| 1133 | Ga0395901_0116304 | |||
| 1134 | Ga0395901_0187413 | |||
| 1135 | Ga0395901_0310364 | |||
| 1136 | Ga0436365_0275742 | |||
| 1137 | Ga0451577_0593015 | |||
| 1138 | Ga0466972_0060611 | |||
| 1139 | Ga0466965_0025618 | |||
| 1140 | Ga0466965_0322125 | |||
| 1141 | Ga0466966_0013803 | |||
| 1142 | Ga0466966_0031572 | |||
| 1143 | Ga0466966_0035288 | |||
| 1144 | Ga0466966_0055033 | |||
| 1145 | Ga0466966_0071150 | |||
| 1146 | Ga0466966_0092157 | |||
| 1147 | Ga0466966_0100186 | |||
| 1148 | Ga0466966_0101581 | |||
| 1149 | Ga0466961_0006475 | |||
| 1150 | Ga0466961_0052672 | |||
| 1151 | Ga0466961_0083951 | |||
| 1152 | Ga0466961_0112764 | |||
| 1153 | Ga0466961_0141227 | |||
| 1154 | Ga0466961_0147454 | |||
| 1155 | Ga0466961_0374905 | |||
| 1156 | Ga0466963_0000048 | |||
| 1157 | Ga0466963_0000539 | |||
| 1158 | Ga0466963_0002866 | |||
| 1159 | Ga0466963_0004599 | |||
| 1160 | Ga0466963_0005870 | |||
| 1161 | Ga0466963_0006827 | |||
| 1162 | Ga0466963_0013485 | |||
| 1163 | Ga0466963_0019731 | |||
| 1164 | Ga0466963_0023051 | |||
| 1165 | Ga0466963_0024512 | |||
| 1166 | Ga0466963_0027233 | |||
| 1167 | Ga0466963_0030488 | |||
| 1168 | Ga0466963_0053017 | |||
| 1169 | Ga0466963_0056513 | |||
| 1170 | Ga0466963_0059095 | |||
| 1171 | Ga0466963_0069894 | |||
| 1172 | Ga0466963_0129060 | |||
| 1173 | Ga0466963_0165858 | |||
| 1174 | Ga0466963_0547315 | |||
| 1175 | Ga0466964_0000795 | |||
| 1176 | Ga0466964_0001317 | |||
| 1177 | Ga0466964_0001566 | |||
| 1178 | Ga0466964_0003905 | |||
| 1179 | Ga0466964_0008240 | |||
| 1180 | Ga0466964_0015104 | |||
| 1181 | Ga0466964_0023922 | |||
| 1182 | Ga0466964_0055758 | |||
| 1183 | Ga0466964_0078280 | |||
| 1184 | Ga0466971_0000533 | |||
| 1185 | Ga0466971_0006417 | |||
| 1186 | Ga0466971_0008025 | |||
| 1187 | Ga0466971_0011104 | |||
| 1188 | Ga0466971_0014729 | |||
| 1189 | Ga0466971_0040437 | |||
| 1190 | Ga0466971_0048848 | |||
| 1191 | Ga0466971_0110863 | |||
| 1192 | Ga0466971_0174142 | |||
| 1193 | Ga0466971_0191840 | |||
| 1194 | Ga0466971_0363867 | |||
| 1195 | Ga0466968_0005164 | |||
| 1196 | Ga0466968_0007840 | |||
| 1197 | Ga0466968_0015456 | |||
| 1198 | Ga0466968_0114057 | |||
| 1199 | Ga0466970_0009268 | |||
| 1200 | Ga0466970_0192384 | |||
| 1201 | Ga0466957_0000628 | |||
| 1202 | Ga0466957_0009517 | |||
| 1203 | Ga0466957_0015848 | |||
| 1204 | Ga0466957_0019838 | |||
| 1205 | Ga0466957_0025692 | |||
| 1206 | Ga0466957_0026020 | |||
| 1207 | Ga0466957_0049658 | |||
| 1208 | Ga0466957_0060242 | |||
| 1209 | Ga0466957_0065162 | |||
| 1210 | Ga0466957_0072542 | |||
| 1211 | Ga0466957_0135056 | |||
| 1212 | Ga0466957_0149399 | |||
| 1213 | Ga0466957_0149478 | |||
| 1214 | Ga0466957_0318860 | |||
| 1215 | Ga0466957_0469002 | |||
| 1216 | Ga0466960_0002833 | |||
| 1217 | Ga0466960_0008110 | |||
| 1218 | Ga0466960_0101889 | |||
| 1219 | Ga0466960_0132325 | |||
| 1220 | Ga0466960_0204354 | |||
| 1221 | Ga0466960_0406566 | |||
| 1222 | Ga0466959_0002307 | |||
| 1223 | Ga0466959_0010353 | |||
| 1224 | Ga0466959_0022590 | |||
| 1225 | Ga0466959_0043510 | |||
| 1226 | Ga0466959_0070266 | |||
| 1227 | Ga0466959_0093018 | |||
| 1228 | Ga0466959_0109423 | |||
| 1229 | Ga0466959_0151977 | |||
| 1230 | Ga0466959_0217081 | |||
| 1231 | Ga0466958_0000693 | |||
| 1232 | Ga0466958_0001432 | |||
| 1233 | Ga0466958_0002882 | |||
| 1234 | Ga0466958_0005505 | |||
| 1235 | Ga0466958_0013897 | |||
| 1236 | Ga0466958_0025875 | |||
| 1237 | Ga0466958_0050745 | |||
| 1238 | Ga0466958_0063546 | |||
| 1239 | Ga0466958_0071978 | |||
| 1240 | Ga0466958_0083032 | |||
| 1241 | Ga0466958_0127645 | |||
| 1242 | Ga0466958_0194885 | |||
| 1243 | Ga0466967_0000041 | |||
| 1244 | Ga0466967_0000654 | |||
| 1245 | Ga0466967_0002550 | |||
| 1246 | Ga0466967_0004103 | |||
| 1247 | Ga0466967_0007005 | |||
| 1248 | Ga0466967_0007603 | |||
| 1249 | Ga0466967_0013839 | |||
| 1250 | Ga0466967_0021511 | |||
| 1251 | Ga0466967_0021854 | |||
| 1252 | Ga0466967_0026525 | |||
| 1253 | Ga0466967_0039456 | |||
| 1254 | Ga0466967_0041341 | |||
| 1255 | Ga0466967_0054140 | |||
| 1256 | Ga0466967_0054253 | |||
| 1257 | Ga0466967_0062652 | |||
| 1258 | Ga0466967_0063430 | |||
| 1259 | Ga0466967_0069963 | |||
| 1260 | Ga0466967_0086947 | |||
| 1261 | Ga0466967_0088428 | |||
| 1262 | Ga0466967_0108933 | |||
| 1263 | Ga0466967_0112517 | |||
| 1264 | Ga0466967_0112591 | |||
| 1265 | Ga0466967_0161635 | |||
| 1266 | Ga0466967_0175532 | |||
| 1267 | Ga0466967_0196915 | |||
| 1268 | Ga0466967_0390502 | |||
| 1269 | Ga0466967_0605961 | |||
| 1270 | Ga0466967_0743732 | |||
| 1271 | Ga0495592_0001213 | |||
| 1272 | Ga0495592_0002353 | |||
| 1273 | Ga0495592_0011072 | |||
| 1274 | Ga0495603_0011147 | |||
| 1275 | Ga0495629_0031754 | |||
| 1276 | Ga0495629_0059281 | |||
| 1277 | Ga0495629_0079552 | |||
| 1278 | Ga0495629_0299974 | |||
| 1279 | Ga0495641_0047044 | |||
| 1280 | Ga0495641_0097653 | |||
| 1281 | Ga0495641_0103216 | |||
| 1282 | Ga0495641_0103332 | |||
| 1283 | Ga0495651_0002881 | |||
| 1284 | Ga0495651_0006880 | |||
| 1285 | Ga0495651_0131574 | |||
| 1286 | Ga0495651_0311254 | |||
| 1287 | Ga0495653_0011970 | |||
| 1288 | Ga0495653_0028480 | |||
| 1289 | Ga0495653_0047045 | |||
| 1290 | Ga0495653_0057606 | |||
| 1291 | Ga0495653_0068096 | |||
| 1292 | Ga0495653_0070918 | |||
| 1293 | Ga0495653_0093598 | |||
| 1294 | Ga0495653_0106659 | |||
| 1295 | Ga0495653_0193146 | |||
| 1296 | Ga0495582_0050311 | |||
| 1297 | Ga0495582_0059005 | |||
| 1298 | Ga0495582_0100497 | |||
| 1299 | Ga0495582_0217659 | |||
| 1300 | Ga0495639_0002130 | |||
| 1301 | Ga0495662_0172573 | |||
| 1302 | Ga0495664_0036849 | |||
| 1303 | Ga0495664_0093262 | |||
| 1304 | Ga0495664_0330217 | |||
| 1305 | Ga0495584_0028912 | |||
| 1306 | Ga0495585_0072772 | |||
| 1307 | Ga0495596_0139241 | |||
| 1308 | Ga0495607_0066468 | |||
| 1309 | Ga0495608_0001698 | |||
| 1310 | Ga0495608_0003297 | |||
| 1311 | Ga0495608_0007749 | |||
| 1312 | Ga0495608_0043952 | |||
| 1313 | Ga0495618_0008123 | |||
| 1314 | Ga0495618_0024876 | |||
| 1315 | Ga0495618_0061099 | |||
| 1316 | Ga0495618_0089019 | |||
| 1317 | Ga0495618_0113111 | |||
| 1318 | Ga0495618_0206899 | |||
| 1319 | Ga0495618_0403534 | |||
| 1320 | Ga0495628_0003868 | |||
| 1321 | Ga0495628_0014698 | |||
| 1322 | Ga0495630_0019726 | |||
| 1323 | Ga0495630_0029802 | |||
| 1324 | Ga0495630_0304319 | |||
| 1325 | Ga0495630_0512721 | |||
| 1326 | Ga0495630_0570634 | |||
| 1327 | Ga0495630_0598511 | |||
| 1328 | Ga0495666_0002953 | |||
| 1329 | Ga0495652_0004471 | |||
| 1330 | Ga0495652_0030129 | |||
| 1331 | Ga0495652_0082140 | |||
| 1332 | Ga0495652_0086179 | |||
| 1333 | Ga0495652_0250456 | |||
| 1334 | Ga0495665_0171731 | |||
| 1335 | Ga0495640_0037587 | |||
| 1336 | Ga0495640_0080523 | |||
| 1337 | Ga0495640_0093108 | |||
| 1338 | Ga0495640_0125052 | |||
| 1339 | Ga0495640_0250239 | |||
| 1340 | Ga0495586_0010283 | |||
| 1341 | Ga0495586_0224808 | |||
| 1342 | Ga0495587_0002085 | |||
| 1343 | Ga0495587_0075266 | |||
| 1344 | Ga0495587_0248213 | |||
| 1345 | Ga0495598_0029737 | |||
| 1346 | Ga0495609_0066336 | |||
| 1347 | Ga0495621_0093783 | |||
| 1348 | Ga0495645_0002158 | |||
| 1349 | Ga0495645_0010720 | |||
| 1350 | Ga0495645_0093962 | |||
| 1351 | Ga0495645_0477999 | |||
| 1352 | Ga0495667_0022496 | |||
| 1353 | Ga0495667_0027924 | |||
| 1354 | Ga0495667_0059597 | |||
| 1355 | Ga0495667_0087518 | |||
| 1356 | Ga0495667_0176693 | |||
| 1357 | Ga0495667_0393396 | |||
| 1358 | Ga0495634_0019155 | |||
| 1359 | Ga0495634_0120641 | |||
| 1360 | Ga0495634_0129368 | |||
| 1361 | Ga0495634_0255898 | |||
| 1362 | Ga0495634_0298205 | |||
| 1363 | Ga0495611_0026211 | |||
| 1364 | Ga0495635_0009680 | |||
| 1365 | Ga0495635_0045496 | |||
| 1366 | Ga0495635_0052256 | |||
| 1367 | Ga0495635_0067173 | |||
| 1368 | Ga0495588_0277163 | |||
| 1369 | Ga0495657_0010733 | |||
| 1370 | Ga0495657_0039259 | |||
| 1371 | Ga0495657_0287585 | |||
| 1372 | Ga0495599_0001519 | |||
| 1373 | Ga0495599_0004995 | |||
| 1374 | Ga0495623_0000030 | |||
| 1375 | Ga0495623_0046878 | |||
| 1376 | Ga0495646_0006707 | |||
| 1377 | Ga0495646_0036355 | |||
| 1378 | Ga0495646_0176612 | |||
| 1379 | Ga0495647_0000373 | |||
| 1380 | Ga0495647_0083774 | |||
| 1381 | Ga0495647_0154883 | |||
| 1382 | Ga0495658_0027860 | |||
| 1383 | Ga0495658_0040135 | |||
| 1384 | Ga0495658_0088548 | |||
| 1385 | Ga0495658_0106405 | |||
| 1386 | Ga0495613_0001141 | |||
| 1387 | Ga0495613_0041936 | |||
| 1388 | Ga0495613_0066064 | |||
| 1389 | Ga0495613_0082837 | |||
| 1390 | Ga0495613_0096188 | |||
| 1391 | Ga0495624_0074224 | |||
| 1392 | Ga0495624_0080314 | |||
| 1393 | Ga0495589_0070893 | |||
| 1394 | Ga0495600_0007090 | |||
| 1395 | Ga0495600_0231861 | |||
| 1396 | Ga0495581_0003607 | |||
| 1397 | Ga0495581_0242176 | |||
| 1398 | Ga0495604_0003068 | |||
| 1399 | Ga0495604_0019930 | |||
| 1400 | Ga0495604_0489362 | |||
| 1401 | Ga0495636_0014712 | |||
| 1402 | Ga0495674_0019490 | |||
| 1403 | Ga0495674_0083773 | |||
| 1404 | Ga0495674_0100715 | |||
| 1405 | Ga0495674_0119851 | |||
| 1406 | Ga0495674_0499070 | |||
| 1407 | Ga0495676_0063402 | |||
| 1408 | Ga0495676_0388080 | |||
| 1409 | Ga0495676_0492368 | |||
| 1410 | Ga0495680_0004424 | |||
| 1411 | Ga0495680_0045724 | |||
| 1412 | Ga0495680_0059585 | |||
| 1413 | Ga0495680_0072036 | |||
| 1414 | Ga0495680_0076309 | |||
| 1415 | Ga0495680_0202805 | |||
| 1416 | Ga0495680_0281468 | |||
| 1417 | Ga0495680_0317201 | |||
| 1418 | Ga0495683_0169655 | |||
| 1419 | Ga0495675_0001663 | |||
| 1420 | Ga0495675_0043313 | |||
| 1421 | Ga0495675_0311489 | |||
| 1422 | Ga0495675_0319160 | |||
| 1423 | Ga0495684_0021275 | |||
| 1424 | Ga0495684_0053738 | |||
| 1425 | Ga0495684_0165990 | |||
| 1426 | Ga0495684_0211856 | |||
| 1427 | Ga0495684_0312935 | |||
| 1428 | Ga0495684_0350902 | |||
| 1429 | Ga0495593_0005681 | |||
| 1430 | Ga0495602_0005668 | |||
| 1431 | Ga0495602_0097753 | |||
| 1432 | Ga0495614_0003371 | |||
| 1433 | Ga0496100_0001055 | |||
| 1434 | Ga0496100_0005613 | |||
| 1435 | Ga0496100_0035402 | |||
| 1436 | Ga0496100_0063676 | |||
| 1437 | Ga0496100_0108797 | |||
| 1438 | Ga0496100_0263010 | |||
| 1439 | Ga0496101_0006784 | |||
| 1440 | Ga0496101_0040049 | |||
| 1441 | Ga0496101_0044675 | |||
| 1442 | Ga0496101_0075248 | |||
| 1443 | Ga0496101_0235705 | |||
| 1444 | Ga0496102_0004720 | |||
| 1445 | Ga0496102_0006676 | |||
| 1446 | Ga0496102_0033899 | |||
| 1447 | Ga0496104_0002384 | |||
| 1448 | Ga0496104_0005229 | |||
| 1449 | Ga0496104_0076655 | |||
| 1450 | Ga0496104_0114404 | |||
| 1451 | Ga0496104_0122355 | |||
| 1452 | Ga0496104_0244043 | |||
| 1453 | Ga0496105_0000406 | |||
| 1454 | Ga0496105_0007590 | |||
| 1455 | Ga0496105_0020580 | |||
| 1456 | Ga0496105_0051035 | |||
| 1457 | Ga0496105_0101058 | |||
| 1458 | Ga0496105_0260043 | |||
| 1459 | Ga0496105_0270771 | |||
| 1460 | Ga0496105_0328038 | |||
| 1461 | Ga0496106_0000263 | |||
| 1462 | Ga0496106_0003160 | |||
| 1463 | Ga0496106_0039454 | |||
| 1464 | Ga0496106_0461409 | |||
| 1465 | Ga0496107_0000712 | |||
| 1466 | Ga0496107_0003838 | |||
| 1467 | Ga0496107_0020318 | |||
| 1468 | Ga0496107_0153269 | |||
| 1469 | Ga0496107_0505335 | |||
| 1470 | Ga0496108_0007285 | |||
| 1471 | Ga0496108_0023585 | |||
| 1472 | Ga0496108_0065217 | |||
| 1473 | Ga0496108_0103168 | |||
| 1474 | Ga0496108_0251240 | |||
| 1475 | Ga0496108_0749559 | |||
| 1476 | Ga0496108_0888721 | |||
| 1477 | Ga0496109_0001107 | |||
| 1478 | Ga0496109_0029773 | |||
| 1479 | Ga0496109_0070652 | |||
| 1480 | Ga0496109_0111049 | |||
| 1481 | Ga0496109_0187479 | |||
| 1482 | Ga0496109_0258485 | |||
| 1483 | Ga0496109_0346111 | |||
| 1484 | Ga0496109_0456490 | |||
| 1485 | Ga0496110_0001849 | |||
| 1486 | Ga0496110_0030017 | |||
| 1487 | Ga0496110_0566455 | |||
| 1488 | Ga0496110_0596145 | |||
| 1489 | Ga0496110_0744579 | |||
| 1490 | Ga0496111_0006168 | |||
| 1491 | Ga0496111_0013375 | |||
| 1492 | Ga0496111_0032855 | |||
| 1493 | Ga0496111_0377587 | |||
| 1494 | Ga0496112_0041605 | |||
| 1495 | Ga0496112_0047557 | |||
| 1496 | Ga0496112_0054615 | |||
| 1497 | Ga0496112_0078461 | |||
| 1498 | Ga0496112_0129020 | |||
| 1499 | Ga0496112_0159275 | |||
| 1500 | Ga0496112_0186648 | |||
| 1501 | Ga0496112_0327886 | |||
| 1502 | Ga0496112_0341244 | |||
| 1503 | Ga0496113_0011248 | |||
| 1504 | Ga0496113_0172548 | |||
| 1505 | Ga0496113_0183168 | |||
| 1506 | Ga0496113_0230843 | |||
| 1507 | Ga0496114_0000444 | |||
| 1508 | Ga0496114_0021194 | |||
| 1509 | Ga0496114_0035397 | |||
| 1510 | Ga0496114_0725065 | |||
| 1511 | Ga0496115_0000415 | |||
| 1512 | Ga0496115_0014475 | |||
| 1513 | Ga0496115_0032107 | |||
| 1514 | Ga0496115_0368531 | |||
| 1515 | Ga0496115_0543249 | |||
| 1516 | Ga0501031_0142830 | |||
| 1517 | Ga0501032_0028359 | |||
| 1518 | Ga0501033_0012589 | |||
| 1519 | Ga0501036_0012780 | |||
| 1520 | Ga0501037_0022411 | |||
| 1521 | Ga0501038_0622973 | |||
| 1522 | Ga0501039_0010101 | |||
| 1523 | Ga0501040_0031459 | |||
| 1524 | Ga0501041_0020896 | |||
| 1525 | Ga0501042_0034520 | |||
| 1526 | Ga0501043_0004631 | |||
| 1527 | Ga0501047_0056675 | |||
| 1528 | Ga0501048_0402441 | |||
| 1529 | Ga0501067_0007172 | |||
| 1530 | Ga0501067_0012311 | |||
| 1531 | Ga0501068_0027574 | |||
| 1532 | Ga0501068_0069797 | |||
| 1533 | Ga0501068_0290350 | |||
| 1534 | Ga0501068_0369691 | |||
| 1535 | Ga0501069_0003977 | |||
| 1536 | Ga0501069_0097011 | |||
| 1537 | Ga0501069_0133061 | |||
| 1538 | Ga0501069_0156382 | |||
| 1539 | Ga0501070_0017997 | |||
| 1540 | Ga0501070_0048643 | |||
| 1541 | Ga0501070_0061713 | |||
| 1542 | Ga0501070_0290710 | |||
| 1543 | Ga0501070_0544700 | |||
| 1544 | Ga0501072_0062680 | |||
| 1545 | Ga0501073_0010789 | |||
| 1546 | Ga0501073_0011468 | |||
| 1547 | Ga0501074_0040728 | |||
| 1548 | Ga0501074_0071720 | |||
| 1549 | Ga0501074_0108961 | |||
| 1550 | Ga0501074_0196079 | |||
| 1551 | Ga0501075_0020523 | |||
| 1552 | Ga0501076_0029468 | |||
| 1553 | Ga0501077_0013125 | |||
| 1554 | Ga0501079_0025056 | |||
| 1555 | Ga0501079_0073494 | |||
| 1556 | Ga0501080_0017302 | |||
| 1557 | Ga0501080_0030527 | |||
| 1558 | Ga0501080_0189370 | |||
| 1559 | Ga0501080_0199451 | |||
| 1560 | Ga0501081_0012861 | |||
| 1561 | Ga0501083_0003468 | |||
| 1562 | Ga0501083_0394355 | |||
| 1563 | Ga0501035_0011854 | |||
| 1564 | Ga0501035_0066500 | |||
| 1565 | Ga0501044_0249771 | |||
| 1566 | Ga0501044_0474985 | |||
| 1567 | Ga0501044_0539353 | |||
| 1568 | Ga0501045_0003958 | |||
| 1569 | nmdc:mga00v17_40688_c1 | |||
| 1570 | nmdc:mga0yw44_12817_c1 | |||
| 1571 | nmdc:mga06r32_21395_c1 | |||
| 1572 | nmdc:mga08y16_134989_c1 | |||
| 1573 | nmdc:mga0n895_47264_c1 | |||
| 1574 | nmdc:mga0rr50_13085_c1 | |||
| 1575 | nmdc:mga0rr50_54601_c1 | |||
| 1576 | nmdc:mga08x19_137974_c1 | |||
| 1577 | nmdc:mga0a205_168028_c1 | |||
| 1578 | Ga0495601_0001383 | |||
| 1579 | Ga0495601_0012130 | |||
| 1580 | Ga0495601_0079745 | |||
| 1581 | Ga0495601_0103136 | |||
| 1582 | Ga0495601_0163961 | |||
| 1583 | Ga0495612_0048272 | |||
| 1584 | Ga0495612_0060374 | |||
| 1585 | Ga0495612_0097652 | |||
| 1586 | Ga0495612_0194326 | |||
| 1587 | Ga0495595_0001006 | |||
| 1588 | Ga0495595_0033723 | |||
| 1589 | Ga0495595_0041927 | |||
| 1590 | Ga0495619_0002076 | |||
| 1591 | Ga0495619_0012085 | |||
| 1592 | Ga0495619_0051724 | |||
| 1593 | Ga0495619_0063399 | |||
| 1594 | Ga0495619_0065010 | |||
| 1595 | Ga0495619_0188808 | |||
| 1596 | Ga0500566_0270515 | |||
| 1597 | Ga0501084_0047995 | |||
| 1598 | Ga0501084_0578109 | |||
| 1599 | Ga0501082_0049100 | |||
| 1600 | Ga0501082_0229877 | |||
| 1601 | Ga0501082_0777027 | |||
| 1602 | Ga0466962_0000686 | |||
| 1603 | Ga0466962_0000731 | |||
| 1604 | Ga0466962_0001101 | |||
| 1605 | Ga0466962_0001681 | |||
| 1606 | Ga0466962_0033796 | |||
| 1607 | Ga0466962_0044941 | |||
| 1608 | Ga0466962_0063561 | |||
| 1609 | Ga0466962_0246723 | |||
| 1610 | Ga0466962_0273169 | |||
| 1611 | Ga0530510_0014794 | |||
| 1612 | Ga0530510_0370289 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3l5k-assembly1.cif.gz_A | the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a) | 0.8315 | 2 | 212 |
| 8i8b-assembly1.cif.gz_J | outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) | 0.811 | 83 | 134 |
| 3e58-assembly1.cif.gz_B | crystal structure of putative beta-phosphoglucomutase from streptococcus thermophilus | 0.8026 | 1 | 208 |
| 7ocs-assembly1.cif.gz_D | mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii | 0.7869 | 2 | 216 |
| 2fdr-assembly1.cif.gz_A | crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58 | 0.7833 | 3 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P32662_111_227_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9273 | 89 | 186 | 3.40.50.1000 |
| 4uatA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9258 | 87 | 209 | 3.40.50.1000 |
| af_I1K4I3_171_289_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9244 | 88 | 202 | 3.40.50.1000 |
| af_Q6ZDS0_185_318_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9234 | 88 | 218 | 3.40.50.1000 |
| af_Q652P6_229_339_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9105 | 99 | 209 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7UE20-F1-model_v4 | Haloacid dehalogenase | 0.9898 | 88 | 222 |
GO:0003824
|
| AF-A0A537W1K3-F1-model_v4 | HAD family hydrolase | 0.9742 | 1 | 218 |
GO:0016787
|
| AF-A0A538LBW9-F1-model_v4 | HAD family hydrolase | 0.9699 | 1 | 219 |
GO:0016787
|
| AF-A0A1Q7UE20-F1-model_v4 | Haloacid dehalogenase | 0.9684 | 88 | 222 |
GO:0003824
|
| AF-A0A0Q9QKT9-F1-model_v4 | HAD family hydrolase | 0.9667 | 3 | 220 |
GO:0003824
|