F481650

General Info

Members Datasets Scaffolds Average Seq Length
806 336 1612 229

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100202316|Ga0307416_1002023163
Length 242
Sequence MVTTPMARAYARAMADITLNILKPSVNNLSARIFVRAAGLDFEEKDVWGVSTGPDYVAKYPPHLTPSIEAAGLPRGILGESCAIMQYLCNAHGLHRFYPTDPAERAMVDNAMFYLIGTLYPLVARATYPTLGFPQYPGEVATSEASDELKAQAQRDAITALAEPLEVYNTFFLAGNRFIGGDQPSIADIRLAATLEFLRAIDYDFPAWAEGFMGAMEEALGPAYSEPAADVRGFVASVKSAA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
176 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
177 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
201 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
202 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
203 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
204 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
205 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
326 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
327 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
328 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
329 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
330 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
331 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.74
Nodule 0
Rhizoplane 7.94
Rhizosphere 90.32
Stem 0
Stem Tuber 0
Unclassified 3.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100202316 3300032002 Bacteria 1886
2 JGI24751J29686_10013918 3300002459 Bacteria 1661
3 rootH1_10132823 3300003316 Bacteria 1950
4 rootL2_10086781 3300003322 Bacteria 2793
5 JGI25407J50210_10000607 3300003373 Bacteria 7326
6 JGI25407J50210_10006939 3300003373 Bacteria 2832
7 Ga0058861_11896964 3300004800 Bacteria 969
8 Ga0058860_12085262 3300004801 Unclassified 799
9 Ga0070658_11006448 3300005327 Bacteria 725
10 Ga0070676_10018450 3300005328 Bacteria 3867
11 Ga0070676_10049987 3300005328 Bacteria 2449
12 Ga0070683_100042422 3300005329 Bacteria 4189
13 Ga0070683_100446722 3300005329 Bacteria 1234
14 Ga0070683_100592702 3300005329 Unclassified 1061
15 Ga0070670_100173154 3300005331 Bacteria 1872
16 Ga0070670_100566094 3300005331 Unclassified 1015
17 Ga0068869_100488133 3300005334 Bacteria 1027
18 Ga0070682_100019429 3300005337 Bacteria 3985
19 Ga0070682_100247222 3300005337 Bacteria 1284
20 Ga0068868_100019485 3300005338 Bacteria 5083
21 Ga0068868_100062694 3300005338 Bacteria 2948
22 Ga0068868_100413997 3300005338 Bacteria 1166
23 Ga0068868_100526002 3300005338 Bacteria 1039
24 Ga0070689_100074557 3300005340 Bacteria 2655
25 Ga0070689_100075886 3300005340 Bacteria 2633
26 Ga0070689_100312167 3300005340 Bacteria 1311
27 Ga0070691_10033956 3300005341 Bacteria 2400
28 Ga0070691_10066160 3300005341 Bacteria 1747
29 Ga0070687_100240198 3300005343 Bacteria 1120
30 Ga0070692_10039973 3300005345 Bacteria 2397
31 Ga0070692_10080085 3300005345 Bacteria 1758
32 Ga0070692_10201674 3300005345 Bacteria 1165
33 Ga0070668_100196865 3300005347 Bacteria 1653
34 Ga0070668_100383161 3300005347 Bacteria 1197
35 Ga0070669_100500572 3300005353 Bacteria 1008
36 Ga0070675_100023940 3300005354 Bacteria 4886
37 Ga0070671_100158311 3300005355 Bacteria 1914
38 Ga0070674_100024379 3300005356 Bacteria 3925
39 Ga0070674_100138784 3300005356 Bacteria 1822
40 Ga0070674_100196476 3300005356 Bacteria 1555
41 Ga0070688_100012313 3300005365 Bacteria 4789
42 Ga0070659_100029222 3300005366 Bacteria 4260
43 Ga0070659_100184326 3300005366 Bacteria 1714
44 Ga0070710_10200810 3300005437 Bacteria 1259
45 Ga0070701_10153013 3300005438 Bacteria 1330
46 Ga0070711_100070123 3300005439 Bacteria 2467
47 Ga0070700_100036133 3300005441 Bacteria 2994
48 Ga0070700_100057371 3300005441 Bacteria 2443
49 Ga0070700_100385430 3300005441 Bacteria 1049
50 Ga0070700_100667606 3300005441 Bacteria 822
51 Ga0070694_100315494 3300005444 Bacteria 1202
52 Ga0070708_100002722 3300005445 Bacteria 13719
53 Ga0070708_101140158 3300005445 Bacteria 730
54 Ga0070678_100091645 3300005456 Bacteria 2333
55 Ga0070678_100335258 3300005456 Bacteria 1296
56 Ga0070678_100350055 3300005456 Bacteria 1270
57 Ga0070678_100404324 3300005456 Bacteria 1187
58 Ga0070678_100695645 3300005456 Bacteria 915
59 Ga0070678_100785340 3300005456 Unclassified 864
60 Ga0070662_100045309 3300005457 Bacteria 3154
61 Ga0070662_100113935 3300005457 Bacteria 2064
62 Ga0070662_100164008 3300005457 Bacteria 1740
63 Ga0070681_10128567 3300005458 Bacteria 2466
64 Ga0068867_100067735 3300005459 Bacteria 2663
65 Ga0068867_100291332 3300005459 Bacteria 1342
66 Ga0070685_10059346 3300005466 Bacteria 2233
67 Ga0070685_10211453 3300005466 Bacteria 1266
68 Ga0070706_100122930 3300005467 Bacteria 2420
69 Ga0070699_100658735 3300005518 Bacteria 956
70 Ga0070679_100375775 3300005530 Bacteria 1368
71 Ga0070679_100606263 3300005530 Bacteria 1038
72 Ga0070684_100021427 3300005535 Bacteria 5379
73 Ga0070684_100094764 3300005535 Bacteria 2659
74 Ga0070684_100195428 3300005535 Bacteria 1842
75 Ga0070686_100048665 3300005544 Bacteria 2686
76 Ga0070686_100313601 3300005544 Bacteria 1167
77 Ga0070696_100589383 3300005546 Bacteria 895
78 Ga0070665_100038995 3300005548 Bacteria 4777
79 Ga0070704_100389679 3300005549 Bacteria 1186
80 Ga0070664_100066395 3300005564 Bacteria 3081
81 Ga0070664_100083152 3300005564 Bacteria 2762
82 Ga0070664_100200677 3300005564 Bacteria 1780
83 Ga0070664_100384855 3300005564 Bacteria 1281
84 Ga0068857_100001039 3300005577 Bacteria 21477
85 Ga0068857_100183944 3300005577 Bacteria 1902
86 Ga0068857_100212665 3300005577 Bacteria 1765
87 Ga0068854_100199629 3300005578 Bacteria 1572
88 Ga0068854_100648786 3300005578 Bacteria 906
89 Ga0068856_100108720 3300005614 Bacteria 2769
90 Ga0068856_100124308 3300005614 Bacteria 2582
91 Ga0068856_100126200 3300005614 Bacteria 2562
92 Ga0070702_100015356 3300005615 Bacteria 3909
93 Ga0070702_100032891 3300005615 Bacteria 2848
94 Ga0068852_100135707 3300005616 Bacteria 2271
95 Ga0068859_100045371 3300005617 Bacteria 4416
96 Ga0068859_100120119 3300005617 Bacteria 2694
97 Ga0068859_100486679 3300005617 Bacteria 1329
98 Ga0068864_100140259 3300005618 Bacteria 2180
99 Ga0068864_100194895 3300005618 Bacteria 1859
100 Ga0068866_10028086 3300005718 Bacteria 2678
101 Ga0068866_10035539 3300005718 Bacteria 2435
102 Ga0068866_10232794 3300005718 Unclassified 1118
103 Ga0068861_100009396 3300005719 Bacteria 6747
104 Ga0068861_100164406 3300005719 Bacteria 1834
105 Ga0068861_100391600 3300005719 Bacteria 1231
106 Ga0068870_10177854 3300005840 Bacteria 1275
107 Ga0068863_100383022 3300005841 Bacteria 1373
108 Ga0068863_100464271 3300005841 Bacteria 1243
109 Ga0068858_100146696 3300005842 Bacteria 2216
110 Ga0068858_100618390 3300005842 Bacteria 1051
111 Ga0068860_100228497 3300005843 Bacteria 1808
112 Ga0068860_100246766 3300005843 Bacteria 1738
113 Ga0068860_100881911 3300005843 Bacteria 910
114 Ga0081455_10009750 3300005937 Bacteria 9836
115 Ga0081455_10039782 3300005937 Bacteria 4152
116 Ga0081455_10050859 3300005937 Bacteria 3559
117 Ga0081455_10051192 3300005937 Bacteria 3544
118 Ga0081455_10063073 3300005937 Bacteria 3111
119 Ga0081455_10087343 3300005937 Bacteria 2537
120 Ga0081455_10263259 3300005937 Bacteria 1255
121 Ga0081455_10318551 3300005937 Bacteria 1109
122 Ga0081538_10000027 3300005981 Bacteria 125924
123 Ga0081538_10000190 3300005981 Bacteria 67602
124 Ga0081538_10000660 3300005981 Bacteria 38084
125 Ga0081538_10001230 3300005981 Bacteria 26863
126 Ga0081538_10001756 3300005981 Bacteria 21991
127 Ga0081538_10003727 3300005981 Bacteria 14275
128 Ga0081538_10003996 3300005981 Bacteria 13735
129 Ga0081538_10017285 3300005981 Bacteria 5482
130 Ga0081538_10028170 3300005981 Bacteria 3872
131 Ga0081538_10033402 3300005981 Bacteria 3426
132 Ga0081538_10179298 3300005981 Bacteria 909
133 Ga0081540_1002691 3300005983 Bacteria 14453
134 Ga0081539_10099023 3300005985 Bacteria 1490
135 Ga0075365_10054689 3300006038 Bacteria 2648
136 Ga0075365_10058594 3300006038 Bacteria 2564
137 Ga0075432_10026847 3300006058 Bacteria 1980
138 Ga0070712_100030614 3300006175 Bacteria 3619
139 Ga0070712_100234588 3300006175 Bacteria 1459
140 Ga0070712_100409271 3300006175 Bacteria 1122
141 Ga0075366_10185996 3300006195 Bacteria 1262
142 Ga0097621_100765329 3300006237 Bacteria 893
143 Ga0068871_100232029 3300006358 Bacteria 1602
144 Ga0075428_100028301 3300006844 Bacteria 6198
145 Ga0075428_100060097 3300006844 Bacteria 4162
146 Ga0075428_100273079 3300006844 Bacteria 1819
147 Ga0075428_100311934 3300006844 Bacteria 1691
148 Ga0075428_100779571 3300006844 Bacteria 1017
149 Ga0075430_100002129 3300006846 Bacteria 16386
150 Ga0075430_100097456 3300006846 Bacteria 2457
151 Ga0075431_100038437 3300006847 Bacteria 4928
152 Ga0075431_100042612 3300006847 Bacteria 4682
153 Ga0075431_100058416 3300006847 Bacteria 3981
154 Ga0075431_100272686 3300006847 Bacteria 1714
155 Ga0075431_100736590 3300006847 Unclassified 962
156 Ga0075433_10373678 3300006852 Bacteria 1259
157 Ga0075434_100004879 3300006871 Bacteria 12150
158 Ga0075434_100023644 3300006871 Bacteria 5992
159 Ga0075429_100005097 3300006880 Bacteria 11296
160 Ga0075429_100335328 3300006880 Bacteria 1324
161 Ga0075429_100720713 3300006880 Unclassified 874
162 Ga0075429_100769310 3300006880 Bacteria 843
163 Ga0068865_100064009 3300006881 Bacteria 2587
164 Ga0068865_100116697 3300006881 Bacteria 1978
165 Ga0068865_100527034 3300006881 Bacteria 989
166 Ga0075436_100064900 3300006914 Bacteria 2524
167 Ga0097620_100045370 3300006931 Bacteria 4416
168 Ga0097620_100120118 3300006931 Bacteria 2694
169 Ga0097620_100486769 3300006931 Bacteria 1329
170 Ga0075435_100010658 3300007076 Bacteria 6730
171 Ga0075435_100014523 3300007076 Bacteria 5889
172 Ga0105244_10155842 3300009036 Bacteria 1093
173 Ga0111539_10009715 3300009094 Bacteria 12142
174 Ga0111539_10036415 3300009094 Bacteria 5950
175 Ga0111539_10040077 3300009094 Bacteria 5641
176 Ga0111539_10043822 3300009094 Bacteria 5363
177 Ga0111539_10228083 3300009094 Bacteria 2169
178 Ga0111539_10367380 3300009094 Bacteria 1675
179 Ga0111539_10458777 3300009094 Bacteria 1484
180 Ga0111539_10759951 3300009094 Bacteria 1128
181 Ga0111539_10799617 3300009094 Bacteria 1098
182 Ga0111539_10897813 3300009094 Bacteria 1031
183 Ga0111539_11017506 3300009094 Unclassified 963
184 Ga0105245_10001676 3300009098 Bacteria 20158
185 Ga0105245_10020655 3300009098 Bacteria 5774
186 Ga0105245_10091777 3300009098 Bacteria 2796
187 Ga0105245_10091829 3300009098 Bacteria 2795
188 Ga0105245_10109998 3300009098 Bacteria 2561
189 Ga0105245_10131352 3300009098 Bacteria 2349
190 Ga0105245_10162872 3300009098 Bacteria 2118
191 Ga0105245_10212817 3300009098 Bacteria 1861
192 Ga0105245_10468369 3300009098 Bacteria 1271
193 Ga0105245_10527557 3300009098 Bacteria 1200
194 Ga0105245_10601310 3300009098 Bacteria 1126
195 Ga0105247_10046994 3300009101 Bacteria 2651
196 Ga0105247_10236819 3300009101 Bacteria 1242
197 Ga0114129_10011049 3300009147 Bacteria 12861
198 Ga0114129_10235867 3300009147 Bacteria 2461
199 Ga0114129_10298574 3300009147 Bacteria 2148
200 Ga0114129_10877160 3300009147 Bacteria 1139
201 Ga0114129_11007192 3300009147 Bacteria 1049
202 Ga0105243_10031796 3300009148 Bacteria 4071
203 Ga0105243_10192163 3300009148 Bacteria 1784
204 Ga0105243_10718540 3300009148 Bacteria 976
205 Ga0105243_10779935 3300009148 Unclassified 940
206 Ga0105242_10020079 3300009176 Bacteria 5236
207 Ga0105242_10120356 3300009176 Bacteria 2252
208 Ga0105242_10930250 3300009176 Bacteria 872
209 Ga0105248_10117223 3300009177 Bacteria 3003
210 Ga0105248_10165018 3300009177 Bacteria 2497
211 Ga0105248_10316039 3300009177 Bacteria 1759
212 Ga0105237_10403614 3300009545 Bacteria 1371
213 Ga0105238_10381173 3300009551 Bacteria 1401
214 Ga0105238_10502320 3300009551 Bacteria 1214
215 Ga0105238_10849302 3300009551 Bacteria 930
216 Ga0105249_10009174 3300009553 Bacteria 8649
217 Ga0105249_10078601 3300009553 Bacteria 3061
218 Ga0105249_10161095 3300009553 Bacteria 2168
219 Ga0105239_10014777 3300010375 Bacteria 8658
220 Ga0105239_10146751 3300010375 Bacteria 2632
221 Ga0105239_10265222 3300010375 Bacteria 1931
222 Ga0105239_10785714 3300010375 Bacteria 1090
223 Ga0105239_11284794 3300010375 Bacteria 844
224 Ga0105246_10035319 3300011119 Bacteria 3340
225 Ga0105246_10099008 3300011119 Bacteria 2119
226 Ga0105246_10100324 3300011119 Bacteria 2106
227 Ga0105246_10164795 3300011119 Bacteria 1692
228 Ga0157371_10565103 3300013102 Bacteria 844
229 Ga0157369_10254282 3300013105 Bacteria 1833
230 Ga0157369_10885350 3300013105 Unclassified 916
231 Ga0157374_10039828 3300013296 Bacteria 4326
232 Ga0157374_10140871 3300013296 Bacteria 2341
233 Ga0157374_10433074 3300013296 Bacteria 1315
234 Ga0157378_10128078 3300013297 Bacteria 2347
235 Ga0157378_10201409 3300013297 Bacteria 1883
236 Ga0163162_10180114 3300013306 Bacteria 2239
237 Ga0157372_10053205 3300013307 Bacteria 4511
238 Ga0157372_10209078 3300013307 Bacteria 2261
239 Ga0157375_10010836 3300013308 Bacteria 8033
240 Ga0157375_10020182 3300013308 Bacteria 6081
241 Ga0157375_10131418 3300013308 Bacteria 2623
242 Ga0157375_11030667 3300013308 Bacteria 961
243 Ga0163163_10044244 3300014325 Bacteria 4368
244 Ga0163163_10077350 3300014325 Bacteria 3323
245 Ga0163163_10205872 3300014325 Bacteria 2016
246 Ga0157380_10225063 3300014326 Bacteria 1681
247 Ga0157380_10225622 3300014326 Bacteria 1679
248 Ga0157380_10408641 3300014326 Bacteria 1290
249 Ga0157380_10674804 3300014326 Bacteria 1034
250 Ga0182008_10151985 3300014497 Bacteria 1162
251 Ga0157377_10005733 3300014745 Bacteria 5858
252 Ga0157377_10009195 3300014745 Bacteria 4840
253 Ga0157377_10107838 3300014745 Bacteria 1670
254 Ga0157379_10449193 3300014968 Bacteria 1190
255 Ga0157376_10377959 3300014969 Bacteria 1364
256 Ga0182005_1096119 3300015265 Bacteria 827
257 Ga0163161_10180725 3300017792 Bacteria 1617
258 Ga0163161_10212747 3300017792 Bacteria 1494
259 Ga0213876_10065068 3300021384 Bacteria 1924
260 Ga0213875_10053643 3300021388 Bacteria 1888
261 Ga0207653_10032453 3300025885 Bacteria 1689
262 Ga0207692_10145023 3300025898 Bacteria 1354
263 Ga0207642_10175062 3300025899 Bacteria 1164
264 Ga0207688_10027279 3300025901 Bacteria 3141
265 Ga0207688_10034783 3300025901 Bacteria 2790
266 Ga0207688_10089925 3300025901 Bacteria 1762
267 Ga0207688_10366941 3300025901 Unclassified 889
268 Ga0207647_10108613 3300025904 Bacteria 1641
269 Ga0207647_10381030 3300025904 Bacteria 796
270 Ga0207643_10035675 3300025908 Bacteria 2789
271 Ga0207643_10065174 3300025908 Bacteria 2086
272 Ga0207643_10104600 3300025908 Bacteria 1663
273 Ga0207643_10321220 3300025908 Bacteria 967
274 Ga0207654_10191998 3300025911 Bacteria 1339
275 Ga0207707_10190399 3300025912 Bacteria 1790
276 Ga0207671_10444930 3300025914 Bacteria 1032
277 Ga0207693_10045601 3300025915 Bacteria 3444
278 Ga0207693_10087915 3300025915 Bacteria 2435
279 Ga0207693_10101918 3300025915 Bacteria 2251
280 Ga0207663_10013269 3300025916 Bacteria 4475
281 Ga0207663_10057605 3300025916 Bacteria 2449
282 Ga0207660_10296824 3300025917 Bacteria 1286
283 Ga0207662_10059498 3300025918 Bacteria 2290
284 Ga0207662_10068618 3300025918 Bacteria 2141
285 Ga0207657_10127186 3300025919 Bacteria 2092
286 Ga0207649_10259110 3300025920 Bacteria 1256
287 Ga0207681_10124996 3300025923 Bacteria 1893
288 Ga0207681_10390680 3300025923 Bacteria 1122
289 Ga0207694_10499026 3300025924 Bacteria 1019
290 Ga0207694_10606298 3300025924 Bacteria 921
291 Ga0207694_10871408 3300025924 Unclassified 761
292 Ga0207650_10041047 3300025925 Bacteria 3388
293 Ga0207650_10328356 3300025925 Bacteria 1254
294 Ga0207687_10202390 3300025927 Bacteria 1553
295 Ga0207687_10249350 3300025927 Bacteria 1411
296 Ga0207687_10320968 3300025927 Bacteria 1254
297 Ga0207687_10487253 3300025927 Bacteria 1027
298 Ga0207687_10907442 3300025927 Unclassified 754
299 Ga0207644_10098398 3300025931 Bacteria 2193
300 Ga0207690_10101122 3300025932 Bacteria 2059
301 Ga0207690_10170793 3300025932 Bacteria 1629
302 Ga0207706_10002453 3300025933 Bacteria 18103
303 Ga0207706_10021644 3300025933 Bacteria 5773
304 Ga0207706_10143928 3300025933 Bacteria 2097
305 Ga0207706_10239654 3300025933 Bacteria 1586
306 Ga0207709_10165607 3300025935 Bacteria 1546
307 Ga0207709_10350715 3300025935 Bacteria 1114
308 Ga0207709_10372606 3300025935 Bacteria 1084
309 Ga0207709_10386073 3300025935 Bacteria 1067
310 Ga0207709_10438697 3300025935 Bacteria 1007
311 Ga0207670_10052416 3300025936 Bacteria 2743
312 Ga0207670_10488171 3300025936 Bacteria 998
313 Ga0207669_10045448 3300025937 Bacteria 2587
314 Ga0207669_10093987 3300025937 Bacteria 1961
315 Ga0207669_10185433 3300025937 Bacteria 1496
316 Ga0207704_10097953 3300025938 Bacteria 1946
317 Ga0207704_10147926 3300025938 Bacteria 1653
318 Ga0207704_10262839 3300025938 Bacteria 1302
319 Ga0207691_10076170 3300025940 Bacteria 3023
320 Ga0207711_10091931 3300025941 Bacteria 2669
321 Ga0207711_10324212 3300025941 Bacteria 1424
322 Ga0207711_10602364 3300025941 Bacteria 1025
323 Ga0207689_10207109 3300025942 Bacteria 1620
324 Ga0207689_10261358 3300025942 Bacteria 1432
325 Ga0207689_10270632 3300025942 Bacteria 1406
326 Ga0207661_10016208 3300025944 Bacteria 5495
327 Ga0207661_10085962 3300025944 Bacteria 2609
328 Ga0207661_10136686 3300025944 Bacteria 2106
329 Ga0207661_10300746 3300025944 Bacteria 1438
330 Ga0207679_10063767 3300025945 Bacteria 2752
331 Ga0207679_10198864 3300025945 Bacteria 1673
332 Ga0207679_10282680 3300025945 Bacteria 1424
333 Ga0207679_10784460 3300025945 Bacteria 868
334 Ga0207667_10470156 3300025949 Bacteria 1277
335 Ga0207651_10323599 3300025960 Bacteria 1290
336 Ga0207651_10555443 3300025960 Bacteria 999
337 Ga0207712_10184615 3300025961 Bacteria 1641
338 Ga0207668_10024911 3300025972 Bacteria 3868
339 Ga0207668_10098427 3300025972 Bacteria 2167
340 Ga0207668_10348354 3300025972 Bacteria 1238
341 Ga0207640_10130735 3300025981 Bacteria 1814
342 Ga0207640_10346157 3300025981 Unclassified 1192
343 Ga0207658_10318461 3300025986 Bacteria 1346
344 Ga0207677_10054631 3300026023 Bacteria 2726
345 Ga0207703_10057181 3300026035 Bacteria 3179
346 Ga0207639_10352226 3300026041 Bacteria 1315
347 Ga0207678_10032449 3300026067 Bacteria 4551
348 Ga0207678_10287730 3300026067 Bacteria 1411
349 Ga0207678_10438082 3300026067 Bacteria 1135
350 Ga0207708_10003523 3300026075 Bacteria 11535
351 Ga0207708_10003676 3300026075 Bacteria 11329
352 Ga0207708_10005110 3300026075 Bacteria 9682
353 Ga0207708_10242934 3300026075 Bacteria 1449
354 Ga0207708_10403130 3300026075 Bacteria 1131
355 Ga0207702_10185145 3300026078 Bacteria 1920
356 Ga0207702_10737296 3300026078 Unclassified 972
357 Ga0207641_10197956 3300026088 Bacteria 1851
358 Ga0207641_10215163 3300026088 Bacteria 1779
359 Ga0207648_10031301 3300026089 Bacteria 4704
360 Ga0207648_10041730 3300026089 Bacteria 4029
361 Ga0207648_10081584 3300026089 Bacteria 2821
362 Ga0207648_10082579 3300026089 Bacteria 2802
363 Ga0207676_10493910 3300026095 Bacteria 1161
364 Ga0207676_10947395 3300026095 Unclassified 846
365 Ga0207674_10001739 3300026116 Bacteria 27830
366 Ga0207674_10080873 3300026116 Bacteria 3252
367 Ga0207674_10220434 3300026116 Bacteria 1845
368 Ga0207674_10255327 3300026116 Bacteria 1700
369 Ga0207675_100001559 3300026118 Bacteria 22970
370 Ga0207675_100026116 3300026118 Bacteria 5436
371 Ga0207675_100173489 3300026118 Bacteria 2062
372 Ga0207675_100520085 3300026118 Bacteria 1186
373 Ga0207675_100594778 3300026118 Bacteria 1109
374 Ga0207675_100675798 3300026118 Bacteria 1040
375 Ga0207675_101068321 3300026118 Bacteria 827
376 Ga0207683_10044708 3300026121 Bacteria 3872
377 Ga0207683_10101805 3300026121 Bacteria 2565
378 Ga0207683_10153800 3300026121 Bacteria 2077
379 Ga0207683_10290002 3300026121 Bacteria 1496
380 Ga0207683_10308912 3300026121 Bacteria 1447
381 Ga0207683_10395725 3300026121 Bacteria 1271
382 Ga0207683_10621550 3300026121 Bacteria 1000
383 Ga0207698_10041858 3300026142 Bacteria 3418
384 Ga0207698_10146625 3300026142 Bacteria 2042
385 Ga0207698_10831929 3300026142 Bacteria 927
386 Ga0207428_10004040 3300027907 Bacteria 14067
387 Ga0207428_10037100 3300027907 Bacteria 3967
388 Ga0207428_10374535 3300027907 Bacteria 1045
389 Ga0207428_10649447 3300027907 Unclassified 757
390 Ga0268266_10081549 3300028379 Bacteria 2821
391 Ga0268265_10054176 3300028380 Bacteria 3042
392 Ga0265338_10010165 3300028800 Bacteria 11096
393 Ga0265338_10019745 3300028800 Bacteria 7127
394 Ga0265327_10002180 3300031251 Bacteria 21507
395 Ga0307408_100244065 3300031548 Bacteria 1478
396 Ga0307405_10083571 3300031731 Bacteria 2093
397 Ga0307405_10117539 3300031731 Bacteria 1813
398 Ga0307405_10633228 3300031731 Bacteria 877
399 Ga0307413_10114289 3300031824 Bacteria 1814
400 Ga0307410_10231745 3300031852 Bacteria 1426
401 Ga0307410_10237938 3300031852 Bacteria 1409
402 Ga0307406_10014632 3300031901 Bacteria 4518
403 Ga0307406_10236114 3300031901 Bacteria 1368
404 Ga0307406_10266736 3300031901 Bacteria 1298
405 Ga0307406_10450136 3300031901 Bacteria 1033
406 Ga0307406_10488394 3300031901 Bacteria 996
407 Ga0307406_10617657 3300031901 Bacteria 896
408 Ga0307407_10096310 3300031903 Bacteria 1826
409 Ga0307407_10301368 3300031903 Bacteria 1117
410 Ga0307409_100140834 3300031995 Bacteria 2078
411 Ga0307409_100154795 3300031995 Bacteria 1996
412 Ga0307409_100164607 3300031995 Bacteria 1944
413 Ga0307409_100234666 3300031995 Bacteria 1665
414 Ga0307409_100255740 3300031995 Bacteria 1604
415 Ga0307409_100958815 3300031995 Bacteria 872
416 Ga0307409_101159465 3300031995 Bacteria 795
417 Ga0307409_101337025 3300031995 Bacteria 742
418 Ga0307416_100009367 3300032002 Bacteria 6404
419 Ga0307416_100013709 3300032002 Bacteria 5520
420 Ga0307416_100028899 3300032002 Bacteria 4132
421 Ga0307416_100168359 3300032002 Bacteria 2036
422 Ga0307416_100177367 3300032002 Bacteria 1993
423 Ga0307416_100203901 3300032002 Bacteria 1879
424 Ga0307416_100388636 3300032002 Bacteria 1428
425 Ga0307416_100466717 3300032002 Bacteria 1319
426 Ga0307416_100924265 3300032002 Bacteria 973
427 Ga0307414_10281787 3300032004 Bacteria 1397
428 Ga0307411_10030609 3300032005 Bacteria 3301
429 Ga0307411_10216371 3300032005 Bacteria 1483
430 Ga0307411_10297487 3300032005 Bacteria 1293
431 Ga0307411_10378163 3300032005 Bacteria 1164
432 Ga0307415_100005753 3300032126 Bacteria 6612
433 Ga0307415_100049598 3300032126 Bacteria 2839
434 Ga0307415_100069416 3300032126 Bacteria 2471
435 Ga0307415_100092529 3300032126 Bacteria 2193
436 Ga0307415_100122292 3300032126 Bacteria 1954
437 Ga0307415_100367864 3300032126 Bacteria 1216
438 Ga0373926_0103839 3300035083 Bacteria 1064
439 Ga0373926_0112321 3300035083 Bacteria 1024
440 Ga0373944_0014353 3300035089 Bacteria 2210
441 Ga0373951_0027295 3300035091 Bacteria 1333
442 Ga0373923_0041957 3300035111 Bacteria 1888
443 Ga0373936_0032332 3300035113 Bacteria 2069
444 Ga0373945_0052015 3300035116 Bacteria 1508
445 Ga0373945_0219734 3300035116 Bacteria 794
446 Ga0373953_0113358 3300035117 Bacteria 1148
447 Ga0373943_0041837 3300035170 Bacteria 2217
448 Ga0373943_0153386 3300035170 Bacteria 1249
449 Ga0373943_0304064 3300035170 Unclassified 906
450 Ga0373946_0036367 3300035171 Bacteria 1996
451 Ga0373946_0214054 3300035171 Bacteria 928
452 Ga0373955_0558330 3300035172 Bacteria 700
453 Ga0373942_0057181 3300035207 Bacteria 1109
454 Ga0373931_0147829 3300035691 Bacteria 1367
455 Ga0373935_0219482 3300035692 Bacteria 1320
456 Ga0373927_0034241 3300035695 Bacteria 3305
457 Ga0373927_0054145 3300035695 Bacteria 2595
458 Ga0373933_0123578 3300035724 Bacteria 1622
459 Ga0373947_0049659 3300035725 Bacteria 2520
460 Ga0373937_0212716 3300036401 Bacteria 1819
461 Ga0373925_0006338 3300037068 Bacteria 8713
462 Ga0373925_0135216 3300037068 Bacteria 1926
463 Ga0373925_0281384 3300037068 Bacteria 1340
464 Ga0373925_0327994 3300037068 Bacteria 1240
465 Ga0395899_0314209 3300037312 Bacteria 1057
466 Ga0395900_0044906 3300037418 Bacteria 4551
467 Ga0395900_0064063 3300037418 Bacteria 3779
468 Ga0395900_0076148 3300037418 Bacteria 3449
469 Ga0395900_0147858 3300037418 Bacteria 2402
470 Ga0395900_0205008 3300037418 Bacteria 1993
471 Ga0395900_0387962 3300037418 Bacteria 1363
472 Ga0395898_0041939 3300037466 Bacteria 4518
473 Ga0395898_0090309 3300037466 Bacteria 2948
474 Ga0395905_0059784 3300037471 Bacteria 3563
475 Ga0395905_0119560 3300037471 Bacteria 2476
476 Ga0395905_0468787 3300037471 Bacteria 1158
477 Ga0436364_0811486 3300037853 Bacteria 11292
478 Ga0395901_0008618 3300038443 Bacteria 10305
479 Ga0395901_0026266 3300038443 Bacteria 5978
480 Ga0395901_0230980 3300038443 Bacteria 1931
481 Ga0395901_0292664 3300038443 Bacteria 1689
482 Ga0395901_0570182 3300038443 Bacteria 1145
483 Ga0395901_0721168 3300038443 Bacteria 993
484 Ga0436365_0884306 3300039437 Bacteria 3403
485 Ga0451853_1035158 3300041512 Bacteria 1215
486 Ga0439451_031008 3300042009 Bacteria 1074
487 Ga0450907_031393 3300042146 Bacteria 903
488 Ga0439459_0016693 3300042438 Bacteria 1359
489 Ga0439464_0120510 3300042439 Bacteria 808
490 Ga0450916_010641 3300042530 Unclassified 1153
491 Ga0450918_020024 3300042531 Bacteria 1169
492 Ga0466966_0011497 3300044684 Bacteria 5872
493 Ga0466963_0031734 3300044694 Bacteria 3416
494 Ga0466963_0038681 3300044694 Bacteria 3121
495 Ga0466964_0192549 3300044706 Bacteria 974
496 Ga0466964_0215251 3300044706 Bacteria 930
497 Ga0466971_0080213 3300044719 Bacteria 1487
498 Ga0466970_0098861 3300044765 Bacteria 1588
499 Ga0466957_0023214 3300044842 Bacteria 3666
500 Ga0466960_0031222 3300044901 Bacteria 2457
501 Ga0451576_0430811 3300045051 Bacteria 1384
502 Ga0466958_0086452 3300045836 Bacteria 1935
503 Ga0466967_0009270 3300045976 Bacteria 7293
504 Ga0466967_0071550 3300045976 Bacteria 3106
505 Ga0466967_0280504 3300045976 Bacteria 1599
506 Ga0495603_0013366 3300046455 Bacteria 4967
507 Ga0495603_0081398 3300046455 Bacteria 1897
508 Ga0495603_0125254 3300046455 Bacteria 1497
509 Ga0495629_0077512 3300046459 Bacteria 2320
510 Ga0495629_0102146 3300046459 Bacteria 2000
511 Ga0495629_0211389 3300046459 Bacteria 1340
512 Ga0495641_0022549 3300046461 Bacteria 3147
513 Ga0495641_0056141 3300046461 Bacteria 1785
514 Ga0495641_0089477 3300046461 Bacteria 1376
515 Ga0495641_0103448 3300046461 Bacteria 1271
516 Ga0495651_0180509 3300046462 Bacteria 1494
517 Ga0495653_0063222 3300046463 Bacteria 2794
518 Ga0495580_0078431 3300046472 Bacteria 2304
519 Ga0495582_0006636 3300046473 Bacteria 6429
520 Ga0495582_0084684 3300046473 Bacteria 1762
521 Ga0495582_0087283 3300046473 Bacteria 1737
522 Ga0495605_0089056 3300046474 Bacteria 1433
523 Ga0495605_0141730 3300046474 Bacteria 1078
524 Ga0495639_0029065 3300046475 Bacteria 2452
525 Ga0495662_0008160 3300046476 Bacteria 5160
526 Ga0495662_0019140 3300046476 Bacteria 3313
527 Ga0495584_0034792 3300046491 Bacteria 2547
528 Ga0495594_0025587 3300046499 Bacteria 3172
529 Ga0495594_0142573 3300046499 Bacteria 1359
530 Ga0495596_0109633 3300046500 Bacteria 1072
531 Ga0495607_0081250 3300046501 Bacteria 1781
532 Ga0495607_0150081 3300046501 Bacteria 1194
533 Ga0495608_0078551 3300046511 Bacteria 2146
534 Ga0495618_0065812 3300046514 Bacteria 2303
535 Ga0495628_0505354 3300046516 Bacteria 872
536 Ga0495631_0145592 3300046518 Bacteria 1017
537 Ga0495637_0182095 3300046520 Bacteria 779
538 Ga0495644_0226193 3300046523 Bacteria 724
539 Ga0495666_0034046 3300046526 Bacteria 2487
540 Ga0495666_0078351 3300046526 Bacteria 1565
541 Ga0495652_0218813 3300046529 Bacteria 1432
542 Ga0495665_0039368 3300046531 Bacteria 2518
543 Ga0495665_0242889 3300046531 Bacteria 928
544 Ga0495640_0044661 3300046533 Bacteria 3080
545 Ga0495640_0451748 3300046533 Bacteria 785
546 Ga0495587_0198370 3300046536 Bacteria 1135
547 Ga0495667_0249157 3300046559 Bacteria 1130
548 Ga0495656_0252649 3300046615 Unclassified 891
549 Ga0495668_0255322 3300046616 Bacteria 960
550 Ga0495634_0018433 3300046642 Bacteria 4970
551 Ga0495611_0154972 3300046648 Unclassified 1070
552 Ga0495635_0103413 3300046663 Bacteria 1946
553 Ga0495635_0223504 3300046663 Bacteria 1273
554 Ga0495661_0176375 3300046665 Bacteria 1136
555 Ga0495588_0012191 3300046674 Bacteria 4055
556 Ga0495588_0031917 3300046674 Bacteria 2653
557 Ga0495657_0086794 3300046675 Bacteria 2014
558 Ga0495599_0119116 3300046678 Bacteria 1641
559 Ga0495623_0160065 3300046679 Bacteria 1324
560 Ga0495646_0047364 3300046680 Bacteria 2617
561 Ga0495647_0002785 3300046681 Bacteria 5542
562 Ga0495647_0237975 3300046681 Unclassified 808
563 Ga0495658_0013514 3300046683 Bacteria 4156
564 Ga0495658_0053689 3300046683 Bacteria 2289
565 Ga0495658_0159781 3300046683 Bacteria 1389
566 Ga0495613_0104523 3300046689 Bacteria 2044
567 Ga0495613_0463169 3300046689 Unclassified 858
568 Ga0495624_0049718 3300046690 Bacteria 2658
569 Ga0495671_0255180 3300046692 Bacteria 846
570 Ga0495671_0275552 3300046692 Bacteria 811
571 Ga0495589_0164619 3300046794 Bacteria 1056
572 Ga0495600_0013935 3300046809 Bacteria 5066
573 Ga0495604_0034877 3300047317 Bacteria 3976
574 Ga0495604_0123478 3300047317 Bacteria 1871
575 Ga0495674_0035538 3300047319 Bacteria 4493
576 Ga0495676_0026971 3300047321 Bacteria 4934
577 Ga0495676_0059058 3300047321 Bacteria 3014
578 Ga0495680_0087788 3300047322 Bacteria 2338
579 Ga0495675_0184701 3300047444 Bacteria 1275
580 Ga0495684_0044375 3300047471 Bacteria 3403
581 Ga0495593_0033807 3300047673 Bacteria 2782
582 Ga0495602_0176671 3300048088 Bacteria 1651
583 Ga0495602_0212225 3300048088 Bacteria 1468
584 Ga0495614_0040528 3300048089 Bacteria 1998
585 Ga0495614_0107163 3300048089 Bacteria 1225
586 Ga0496100_0007742 3300048903 Bacteria 5950
587 Ga0496100_0065781 3300048903 Bacteria 2403
588 Ga0496100_1056602 3300048903 Bacteria 639
589 Ga0496101_0003941 3300048904 Bacteria 9281
590 Ga0496101_0199317 3300048904 Bacteria 1547
591 Ga0496101_0305866 3300048904 Bacteria 1246
592 Ga0496101_0440096 3300048904 Bacteria 1028
593 Ga0496102_0005045 3300048905 Bacteria 11179
594 Ga0496102_0089472 3300048905 Bacteria 2848
595 Ga0496102_0122617 3300048905 Bacteria 2428
596 Ga0496102_0283070 3300048905 Bacteria 1563
597 Ga0496103_0308960 3300048906 Bacteria 1017
598 Ga0496103_0407642 3300048906 Bacteria 873
599 Ga0496104_0019827 3300048907 Bacteria 6158
600 Ga0496104_0087150 3300048907 Bacteria 2981
601 Ga0496104_0490726 3300048907 Bacteria 1139
602 Ga0496104_0505545 3300048907 Bacteria 1120
603 Ga0496104_0563657 3300048907 Bacteria 1050
604 Ga0496104_0858207 3300048907 Bacteria 813
605 Ga0496105_0002403 3300048908 Bacteria 13552
606 Ga0496105_0015028 3300048908 Bacteria 6159
607 Ga0496106_0004709 3300048909 Bacteria 10107
608 Ga0496106_0072234 3300048909 Bacteria 2639
609 Ga0496106_0335584 3300048909 Bacteria 1214
610 Ga0496106_0515974 3300048909 Bacteria 960
611 Ga0496107_0004666 3300048910 Bacteria 9301
612 Ga0496107_0016031 3300048910 Bacteria 5257
613 Ga0496107_0336221 3300048910 Bacteria 1123
614 Ga0496107_0426999 3300048910 Bacteria 985
615 Ga0496108_0026589 3300048911 Bacteria 4773
616 Ga0496108_0047250 3300048911 Bacteria 3598
617 Ga0496109_0007887 3300048912 Bacteria 9023
618 Ga0496109_0030618 3300048912 Bacteria 4823
619 Ga0496109_0116000 3300048912 Bacteria 2492
620 Ga0496109_0280977 3300048912 Bacteria 1569
621 Ga0496109_0348241 3300048912 Bacteria 1399
622 Ga0496109_0383421 3300048912 Bacteria 1328
623 Ga0496109_0556643 3300048912 Bacteria 1082
624 Ga0496109_0817523 3300048912 Bacteria 870
625 Ga0496110_0018785 3300048913 Bacteria 5803
626 Ga0496110_0038435 3300048913 Bacteria 4165
627 Ga0496110_0084589 3300048913 Bacteria 2831
628 Ga0496110_0133474 3300048913 Bacteria 2243
629 Ga0496110_0404039 3300048913 Bacteria 1245
630 Ga0496111_0009623 3300048914 Bacteria 6455
631 Ga0496111_0025246 3300048914 Bacteria 4192
632 Ga0496111_0036596 3300048914 Bacteria 3510
633 Ga0496111_0275564 3300048914 Bacteria 1248
634 Ga0496112_0002194 3300048915 Bacteria 15543
635 Ga0496112_0002940 3300048915 Bacteria 13886
636 Ga0496112_0018171 3300048915 Bacteria 6617
637 Ga0496112_0053036 3300048915 Bacteria 3981
638 Ga0496112_0196449 3300048915 Bacteria 1978
639 Ga0496112_0219103 3300048915 Bacteria 1859
640 Ga0496112_0255006 3300048915 Bacteria 1704
641 Ga0496112_0330620 3300048915 Bacteria 1468
642 Ga0496113_0005201 3300048916 Bacteria 8095
643 Ga0496113_0093453 3300048916 Bacteria 2321
644 Ga0496113_0402380 3300048916 Unclassified 1099
645 Ga0496114_0019620 3300048917 Bacteria 5478
646 Ga0496114_0248257 3300048917 Bacteria 1566
647 Ga0496115_0002213 3300048918 Bacteria 13937
648 Ga0496115_0071793 3300048918 Bacteria 2808
649 Ga0496115_0189033 3300048918 Bacteria 1701
650 Ga0501031_0004077 3300049568 Bacteria 9429
651 Ga0501031_0007133 3300049568 Bacteria 7293
652 Ga0501032_0023442 3300049569 Bacteria 4263
653 Ga0501032_0046833 3300049569 Bacteria 2921
654 Ga0501033_0025831 3300049570 Bacteria 4422
655 Ga0501033_0044703 3300049570 Bacteria 3296
656 Ga0501034_0029234 3300049571 Bacteria 5602
657 Ga0501036_0000847 3300049572 Bacteria 22777
658 Ga0501036_0042724 3300049572 Bacteria 3837
659 Ga0501036_0239977 3300049572 Bacteria 1520
660 Ga0501036_0320545 3300049572 Bacteria 1295
661 Ga0501036_0394407 3300049572 Bacteria 1155
662 Ga0501036_0491748 3300049572 Bacteria 1021
663 Ga0501036_0534950 3300049572 Bacteria 974
664 Ga0501037_0094995 3300049573 Bacteria 2155
665 Ga0501038_0004907 3300049574 Bacteria 12427
666 Ga0501038_0229041 3300049574 Bacteria 1480
667 Ga0501039_0004812 3300049575 Bacteria 10224
668 Ga0501039_0020315 3300049575 Bacteria 5091
669 Ga0501040_0025863 3300049576 Bacteria 3948
670 Ga0501040_0091543 3300049576 Bacteria 2114
671 Ga0501040_0106182 3300049576 Bacteria 1962
672 Ga0501040_0174142 3300049576 Bacteria 1524
673 Ga0501041_0008952 3300049577 Bacteria 5891
674 Ga0501041_0019206 3300049577 Bacteria 4077
675 Ga0501041_0019578 3300049577 Bacteria 4042
676 Ga0501042_0003306 3300049578 Bacteria 10085
677 Ga0501042_0114424 3300049578 Bacteria 1942
678 Ga0501042_0158469 3300049578 Bacteria 1633
679 Ga0501042_0549679 3300049578 Unclassified 839
680 Ga0501043_0005710 3300049579 Bacteria 10023
681 Ga0501043_0008124 3300049579 Bacteria 8280
682 Ga0501043_0104094 3300049579 Bacteria 2230
683 Ga0501046_0010734 3300049580 Bacteria 7855
684 Ga0501046_0025381 3300049580 Bacteria 4850
685 Ga0501046_0079695 3300049580 Bacteria 2531
686 Ga0501047_0026740 3300049581 Bacteria 5553
687 Ga0501048_0008667 3300049582 Bacteria 7666
688 Ga0501048_0040386 3300049582 Bacteria 3344
689 Ga0501048_0090794 3300049582 Bacteria 2154
690 Ga0501048_0309964 3300049582 Bacteria 1124
691 Ga0501048_0487391 3300049582 Bacteria 884
692 Ga0501067_0000732 3300049583 Bacteria 17659
693 Ga0501067_0018287 3300049583 Bacteria 3883
694 Ga0501068_0006410 3300049584 Bacteria 6485
695 Ga0501068_0010687 3300049584 Bacteria 5163
696 Ga0501068_0360262 3300049584 Bacteria 935
697 Ga0501069_0011540 3300049585 Bacteria 4682
698 Ga0501069_0014212 3300049585 Bacteria 4252
699 Ga0501069_0024281 3300049585 Bacteria 3305
700 Ga0501069_0418343 3300049585 Bacteria 794
701 Ga0501070_0011069 3300049586 Bacteria 7613
702 Ga0501070_0040011 3300049586 Bacteria 3910
703 Ga0501070_0114410 3300049586 Unclassified 2229
704 Ga0501071_0001931 3300049587 Bacteria 12344
705 Ga0501071_0013891 3300049587 Bacteria 5498
706 Ga0501071_0055633 3300049587 Bacteria 2856
707 Ga0501071_0110706 3300049587 Bacteria 2029
708 Ga0501072_0008212 3300049588 Bacteria 7927
709 Ga0501072_0009315 3300049588 Bacteria 7464
710 Ga0501072_0037868 3300049588 Bacteria 3783
711 Ga0501072_0040501 3300049588 Bacteria 3658
712 Ga0501072_0320542 3300049588 Bacteria 1232
713 Ga0501072_0389882 3300049588 Bacteria 1105
714 Ga0501073_0120853 3300049589 Bacteria 1815
715 Ga0501073_0191497 3300049589 Bacteria 1415
716 Ga0501074_0036590 3300049590 Bacteria 3555
717 Ga0501074_0042027 3300049590 Unclassified 3309
718 Ga0501074_0256136 3300049590 Bacteria 1244
719 Ga0501075_0014936 3300049591 Bacteria 5570
720 Ga0501075_0016402 3300049591 Bacteria 5336
721 Ga0501075_0070570 3300049591 Bacteria 2639
722 Ga0501075_0359694 3300049591 Bacteria 1109
723 Ga0501076_0017379 3300049592 Bacteria 5466
724 Ga0501076_0042326 3300049592 Bacteria 3585
725 Ga0501076_0061534 3300049592 Bacteria 2988
726 Ga0501076_0074267 3300049592 Bacteria 2723
727 Ga0501076_0259197 3300049592 Bacteria 1423
728 Ga0501077_0007004 3300049593 Bacteria 6950
729 Ga0501077_0021056 3300049593 Bacteria 4125
730 Ga0501077_0076337 3300049593 Bacteria 2122
731 Ga0501077_0259061 3300049593 Bacteria 1106
732 Ga0501079_0014843 3300049741 Bacteria 5937
733 Ga0501079_0016463 3300049741 Bacteria 5645
734 Ga0501079_0026482 3300049741 Bacteria 4446
735 Ga0501079_0358370 3300049741 Bacteria 1143
736 Ga0501080_0085462 3300049742 Bacteria 2931
737 Ga0501081_0001380 3300049743 Bacteria 14857
738 Ga0501081_0003439 3300049743 Bacteria 10101
739 Ga0501081_0010862 3300049743 Bacteria 5951
740 Ga0501081_0102488 3300049743 Bacteria 2024
741 Ga0501081_0140162 3300049743 Bacteria 1733
742 Ga0501081_0316467 3300049743 Bacteria 1146
743 Ga0501083_0027213 3300049744 Bacteria 3946
744 Ga0501083_0028406 3300049744 Bacteria 3854
745 Ga0501083_0078036 3300049744 Bacteria 2197
746 Ga0501035_0024612 3300049822 Bacteria 5520
747 Ga0501035_0036558 3300049822 Bacteria 4451
748 Ga0501035_0078261 3300049822 Bacteria 2921
749 Ga0501035_0216091 3300049822 Bacteria 1639
750 Ga0501035_0465611 3300049822 Bacteria 1044
751 Ga0501044_0100321 3300049823 Bacteria 2913
752 Ga0501044_0114604 3300049823 Bacteria 2701
753 Ga0501045_0003797 3300049824 Bacteria 10389
754 Ga0501045_0035869 3300049824 Bacteria 3601
755 Ga0501045_0041058 3300049824 Bacteria 3365
756 Ga0501045_0066822 3300049824 Bacteria 2639
757 Ga0501045_0161396 3300049824 Bacteria 1668
758 nmdc:mga0yw44_124079_c1 3300050492 Bacteria 1666
759 nmdc:mga0yw44_141591_c1 3300050492 Bacteria 1563
760 nmdc:mga0k408_255596_c1 3300050493 Bacteria 1046
761 nmdc:mga05p37_185358_c1 3300050507 Bacteria 2530
762 nmdc:mga05p37_37865_c1 3300050507 Bacteria 5915
763 nmdc:mga05p37_598905_c1 3300050507 Bacteria 1244
764 nmdc:mga09592_134787_c1 3300050508 Bacteria 2127
765 nmdc:mga09592_236812_c1 3300050508 Bacteria 1581
766 nmdc:mga09592_302681_c1 3300050508 Bacteria 969
767 nmdc:mga09592_85011_c1 3300050508 Bacteria 2698
768 nmdc:mga0qj67_617766_c1 3300050509 Bacteria 866
769 nmdc:mga0qj67_72724_c1 3300050509 Bacteria 2746
770 nmdc:mga0qj67_91505_c1 3300050509 Bacteria 2445
771 nmdc:mga06r32_209738_c1 3300050510 Bacteria 1936
772 nmdc:mga06r32_37472_c1 3300050510 Bacteria 4586
773 nmdc:mga06r32_748905_c1 3300050510 Unclassified 940
774 nmdc:mga08y16_147782_c1 3300050511 Bacteria 2443
775 nmdc:mga08y16_162164_c1 3300050511 Bacteria 2323
776 nmdc:mga08y16_252145_c1 3300050511 Bacteria 1824
777 nmdc:mga08y16_405951_c1 3300050511 Bacteria 1394
778 nmdc:mga08y16_597283_c1 3300050511 Bacteria 1113
779 nmdc:mga08y16_9819_c1 3300050511 Bacteria 10046
780 nmdc:mga0n895_163306_c1 3300050512 Bacteria 2259
781 nmdc:mga0n895_6064_c1 3300050512 Bacteria 10191
782 nmdc:mga0rr50_24985_c1 3300050513 Bacteria 4148
783 nmdc:mga08x19_84469_c1 3300050514 Bacteria 2088
784 nmdc:mga0a205_3354_c1 3300050515 Bacteria 12991
785 nmdc:mga0a205_355767_c1 3300050515 Bacteria 1331
786 nmdc:mga0a205_37052_c1 3300050515 Bacteria 4689
787 Ga0495601_0153355 3300053077 Bacteria 1504
788 Ga0495612_0038450 3300053078 Bacteria 1944
789 Ga0495655_0022602 3300053083 Bacteria 1439
790 Ga0495595_0004583 3300053084 Bacteria 5558
791 Ga0495619_0014153 3300053085 Bacteria 5037
792 Ga0495619_0105657 3300053085 Bacteria 1920
793 Ga0501084_0014902 3300054114 Bacteria 6447
794 Ga0501084_0019497 3300054114 Bacteria 5650
795 Ga0501084_0044911 3300054114 Bacteria 3699
796 Ga0501082_0006093 3300060353 Bacteria 10466
797 Ga0501082_0046502 3300060353 Bacteria 3740
798 Ga0501082_0130834 3300060353 Bacteria 2177
799 Ga0501082_0321449 3300060353 Bacteria 1348
800 Ga0530510_0001678 3300061734 Bacteria 14982
801 Ga0530510_0063291 3300061734 Bacteria 2678
802 Ga0530510_0078477 3300061734 Bacteria 2401
803 Ga0530510_0178540 3300061734 Bacteria 1574
804 Ga0530510_0199633 3300061734 Bacteria 1485
805 Ga0530510_0232942 3300061734 Bacteria 1370
806 Ga0530510_0591771 3300061734 Bacteria 843
807 Ga0307416_100202316
808 JGI24751J29686_10013918
809 rootH1_10132823
810 rootL2_10086781
811 JGI25407J50210_10000607
812 JGI25407J50210_10006939
813 Ga0058861_11896964
814 Ga0058860_12085262
815 Ga0070658_11006448
816 Ga0070676_10018450
817 Ga0070676_10049987
818 Ga0070683_100042422
819 Ga0070683_100446722
820 Ga0070683_100592702
821 Ga0070670_100173154
822 Ga0070670_100566094
823 Ga0068869_100488133
824 Ga0070682_100019429
825 Ga0070682_100247222
826 Ga0068868_100019485
827 Ga0068868_100062694
828 Ga0068868_100413997
829 Ga0068868_100526002
830 Ga0070689_100074557
831 Ga0070689_100075886
832 Ga0070689_100312167
833 Ga0070691_10033956
834 Ga0070691_10066160
835 Ga0070687_100240198
836 Ga0070692_10039973
837 Ga0070692_10080085
838 Ga0070692_10201674
839 Ga0070668_100196865
840 Ga0070668_100383161
841 Ga0070669_100500572
842 Ga0070675_100023940
843 Ga0070671_100158311
844 Ga0070674_100024379
845 Ga0070674_100138784
846 Ga0070674_100196476
847 Ga0070688_100012313
848 Ga0070659_100029222
849 Ga0070659_100184326
850 Ga0070710_10200810
851 Ga0070701_10153013
852 Ga0070711_100070123
853 Ga0070700_100036133
854 Ga0070700_100057371
855 Ga0070700_100385430
856 Ga0070700_100667606
857 Ga0070694_100315494
858 Ga0070708_100002722
859 Ga0070708_101140158
860 Ga0070678_100091645
861 Ga0070678_100335258
862 Ga0070678_100350055
863 Ga0070678_100404324
864 Ga0070678_100695645
865 Ga0070678_100785340
866 Ga0070662_100045309
867 Ga0070662_100113935
868 Ga0070662_100164008
869 Ga0070681_10128567
870 Ga0068867_100067735
871 Ga0068867_100291332
872 Ga0070685_10059346
873 Ga0070685_10211453
874 Ga0070706_100122930
875 Ga0070699_100658735
876 Ga0070679_100375775
877 Ga0070679_100606263
878 Ga0070684_100021427
879 Ga0070684_100094764
880 Ga0070684_100195428
881 Ga0070686_100048665
882 Ga0070686_100313601
883 Ga0070696_100589383
884 Ga0070665_100038995
885 Ga0070704_100389679
886 Ga0070664_100066395
887 Ga0070664_100083152
888 Ga0070664_100200677
889 Ga0070664_100384855
890 Ga0068857_100001039
891 Ga0068857_100183944
892 Ga0068857_100212665
893 Ga0068854_100199629
894 Ga0068854_100648786
895 Ga0068856_100108720
896 Ga0068856_100124308
897 Ga0068856_100126200
898 Ga0070702_100015356
899 Ga0070702_100032891
900 Ga0068852_100135707
901 Ga0068859_100045371
902 Ga0068859_100120119
903 Ga0068859_100486679
904 Ga0068864_100140259
905 Ga0068864_100194895
906 Ga0068866_10028086
907 Ga0068866_10035539
908 Ga0068866_10232794
909 Ga0068861_100009396
910 Ga0068861_100164406
911 Ga0068861_100391600
912 Ga0068870_10177854
913 Ga0068863_100383022
914 Ga0068863_100464271
915 Ga0068858_100146696
916 Ga0068858_100618390
917 Ga0068860_100228497
918 Ga0068860_100246766
919 Ga0068860_100881911
920 Ga0081455_10009750
921 Ga0081455_10039782
922 Ga0081455_10050859
923 Ga0081455_10051192
924 Ga0081455_10063073
925 Ga0081455_10087343
926 Ga0081455_10263259
927 Ga0081455_10318551
928 Ga0081538_10000027
929 Ga0081538_10000190
930 Ga0081538_10000660
931 Ga0081538_10001230
932 Ga0081538_10001756
933 Ga0081538_10003727
934 Ga0081538_10003996
935 Ga0081538_10017285
936 Ga0081538_10028170
937 Ga0081538_10033402
938 Ga0081538_10179298
939 Ga0081540_1002691
940 Ga0081539_10099023
941 Ga0075365_10054689
942 Ga0075365_10058594
943 Ga0075432_10026847
944 Ga0070712_100030614
945 Ga0070712_100234588
946 Ga0070712_100409271
947 Ga0075366_10185996
948 Ga0097621_100765329
949 Ga0068871_100232029
950 Ga0075428_100028301
951 Ga0075428_100060097
952 Ga0075428_100273079
953 Ga0075428_100311934
954 Ga0075428_100779571
955 Ga0075430_100002129
956 Ga0075430_100097456
957 Ga0075431_100038437
958 Ga0075431_100042612
959 Ga0075431_100058416
960 Ga0075431_100272686
961 Ga0075431_100736590
962 Ga0075433_10373678
963 Ga0075434_100004879
964 Ga0075434_100023644
965 Ga0075429_100005097
966 Ga0075429_100335328
967 Ga0075429_100720713
968 Ga0075429_100769310
969 Ga0068865_100064009
970 Ga0068865_100116697
971 Ga0068865_100527034
972 Ga0075436_100064900
973 Ga0097620_100045370
974 Ga0097620_100120118
975 Ga0097620_100486769
976 Ga0075435_100010658
977 Ga0075435_100014523
978 Ga0105244_10155842
979 Ga0111539_10009715
980 Ga0111539_10036415
981 Ga0111539_10040077
982 Ga0111539_10043822
983 Ga0111539_10228083
984 Ga0111539_10367380
985 Ga0111539_10458777
986 Ga0111539_10759951
987 Ga0111539_10799617
988 Ga0111539_10897813
989 Ga0111539_11017506
990 Ga0105245_10001676
991 Ga0105245_10020655
992 Ga0105245_10091777
993 Ga0105245_10091829
994 Ga0105245_10109998
995 Ga0105245_10131352
996 Ga0105245_10162872
997 Ga0105245_10212817
998 Ga0105245_10468369
999 Ga0105245_10527557
1000 Ga0105245_10601310
1001 Ga0105247_10046994
1002 Ga0105247_10236819
1003 Ga0114129_10011049
1004 Ga0114129_10235867
1005 Ga0114129_10298574
1006 Ga0114129_10877160
1007 Ga0114129_11007192
1008 Ga0105243_10031796
1009 Ga0105243_10192163
1010 Ga0105243_10718540
1011 Ga0105243_10779935
1012 Ga0105242_10020079
1013 Ga0105242_10120356
1014 Ga0105242_10930250
1015 Ga0105248_10117223
1016 Ga0105248_10165018
1017 Ga0105248_10316039
1018 Ga0105237_10403614
1019 Ga0105238_10381173
1020 Ga0105238_10502320
1021 Ga0105238_10849302
1022 Ga0105249_10009174
1023 Ga0105249_10078601
1024 Ga0105249_10161095
1025 Ga0105239_10014777
1026 Ga0105239_10146751
1027 Ga0105239_10265222
1028 Ga0105239_10785714
1029 Ga0105239_11284794
1030 Ga0105246_10035319
1031 Ga0105246_10099008
1032 Ga0105246_10100324
1033 Ga0105246_10164795
1034 Ga0157371_10565103
1035 Ga0157369_10254282
1036 Ga0157369_10885350
1037 Ga0157374_10039828
1038 Ga0157374_10140871
1039 Ga0157374_10433074
1040 Ga0157378_10128078
1041 Ga0157378_10201409
1042 Ga0163162_10180114
1043 Ga0157372_10053205
1044 Ga0157372_10209078
1045 Ga0157375_10010836
1046 Ga0157375_10020182
1047 Ga0157375_10131418
1048 Ga0157375_11030667
1049 Ga0163163_10044244
1050 Ga0163163_10077350
1051 Ga0163163_10205872
1052 Ga0157380_10225063
1053 Ga0157380_10225622
1054 Ga0157380_10408641
1055 Ga0157380_10674804
1056 Ga0182008_10151985
1057 Ga0157377_10005733
1058 Ga0157377_10009195
1059 Ga0157377_10107838
1060 Ga0157379_10449193
1061 Ga0157376_10377959
1062 Ga0182005_1096119
1063 Ga0163161_10180725
1064 Ga0163161_10212747
1065 Ga0213876_10065068
1066 Ga0213875_10053643
1067 Ga0207653_10032453
1068 Ga0207692_10145023
1069 Ga0207642_10175062
1070 Ga0207688_10027279
1071 Ga0207688_10034783
1072 Ga0207688_10089925
1073 Ga0207688_10366941
1074 Ga0207647_10108613
1075 Ga0207647_10381030
1076 Ga0207643_10035675
1077 Ga0207643_10065174
1078 Ga0207643_10104600
1079 Ga0207643_10321220
1080 Ga0207654_10191998
1081 Ga0207707_10190399
1082 Ga0207671_10444930
1083 Ga0207693_10045601
1084 Ga0207693_10087915
1085 Ga0207693_10101918
1086 Ga0207663_10013269
1087 Ga0207663_10057605
1088 Ga0207660_10296824
1089 Ga0207662_10059498
1090 Ga0207662_10068618
1091 Ga0207657_10127186
1092 Ga0207649_10259110
1093 Ga0207681_10124996
1094 Ga0207681_10390680
1095 Ga0207694_10499026
1096 Ga0207694_10606298
1097 Ga0207694_10871408
1098 Ga0207650_10041047
1099 Ga0207650_10328356
1100 Ga0207687_10202390
1101 Ga0207687_10249350
1102 Ga0207687_10320968
1103 Ga0207687_10487253
1104 Ga0207687_10907442
1105 Ga0207644_10098398
1106 Ga0207690_10101122
1107 Ga0207690_10170793
1108 Ga0207706_10002453
1109 Ga0207706_10021644
1110 Ga0207706_10143928
1111 Ga0207706_10239654
1112 Ga0207709_10165607
1113 Ga0207709_10350715
1114 Ga0207709_10372606
1115 Ga0207709_10386073
1116 Ga0207709_10438697
1117 Ga0207670_10052416
1118 Ga0207670_10488171
1119 Ga0207669_10045448
1120 Ga0207669_10093987
1121 Ga0207669_10185433
1122 Ga0207704_10097953
1123 Ga0207704_10147926
1124 Ga0207704_10262839
1125 Ga0207691_10076170
1126 Ga0207711_10091931
1127 Ga0207711_10324212
1128 Ga0207711_10602364
1129 Ga0207689_10207109
1130 Ga0207689_10261358
1131 Ga0207689_10270632
1132 Ga0207661_10016208
1133 Ga0207661_10085962
1134 Ga0207661_10136686
1135 Ga0207661_10300746
1136 Ga0207679_10063767
1137 Ga0207679_10198864
1138 Ga0207679_10282680
1139 Ga0207679_10784460
1140 Ga0207667_10470156
1141 Ga0207651_10323599
1142 Ga0207651_10555443
1143 Ga0207712_10184615
1144 Ga0207668_10024911
1145 Ga0207668_10098427
1146 Ga0207668_10348354
1147 Ga0207640_10130735
1148 Ga0207640_10346157
1149 Ga0207658_10318461
1150 Ga0207677_10054631
1151 Ga0207703_10057181
1152 Ga0207639_10352226
1153 Ga0207678_10032449
1154 Ga0207678_10287730
1155 Ga0207678_10438082
1156 Ga0207708_10003523
1157 Ga0207708_10003676
1158 Ga0207708_10005110
1159 Ga0207708_10242934
1160 Ga0207708_10403130
1161 Ga0207702_10185145
1162 Ga0207702_10737296
1163 Ga0207641_10197956
1164 Ga0207641_10215163
1165 Ga0207648_10031301
1166 Ga0207648_10041730
1167 Ga0207648_10081584
1168 Ga0207648_10082579
1169 Ga0207676_10493910
1170 Ga0207676_10947395
1171 Ga0207674_10001739
1172 Ga0207674_10080873
1173 Ga0207674_10220434
1174 Ga0207674_10255327
1175 Ga0207675_100001559
1176 Ga0207675_100026116
1177 Ga0207675_100173489
1178 Ga0207675_100520085
1179 Ga0207675_100594778
1180 Ga0207675_100675798
1181 Ga0207675_101068321
1182 Ga0207683_10044708
1183 Ga0207683_10101805
1184 Ga0207683_10153800
1185 Ga0207683_10290002
1186 Ga0207683_10308912
1187 Ga0207683_10395725
1188 Ga0207683_10621550
1189 Ga0207698_10041858
1190 Ga0207698_10146625
1191 Ga0207698_10831929
1192 Ga0207428_10004040
1193 Ga0207428_10037100
1194 Ga0207428_10374535
1195 Ga0207428_10649447
1196 Ga0268266_10081549
1197 Ga0268265_10054176
1198 Ga0265338_10010165
1199 Ga0265338_10019745
1200 Ga0265327_10002180
1201 Ga0307408_100244065
1202 Ga0307405_10083571
1203 Ga0307405_10117539
1204 Ga0307405_10633228
1205 Ga0307413_10114289
1206 Ga0307410_10231745
1207 Ga0307410_10237938
1208 Ga0307406_10014632
1209 Ga0307406_10236114
1210 Ga0307406_10266736
1211 Ga0307406_10450136
1212 Ga0307406_10488394
1213 Ga0307406_10617657
1214 Ga0307407_10096310
1215 Ga0307407_10301368
1216 Ga0307409_100140834
1217 Ga0307409_100154795
1218 Ga0307409_100164607
1219 Ga0307409_100234666
1220 Ga0307409_100255740
1221 Ga0307409_100958815
1222 Ga0307409_101159465
1223 Ga0307409_101337025
1224 Ga0307416_100009367
1225 Ga0307416_100013709
1226 Ga0307416_100028899
1227 Ga0307416_100168359
1228 Ga0307416_100177367
1229 Ga0307416_100203901
1230 Ga0307416_100388636
1231 Ga0307416_100466717
1232 Ga0307416_100924265
1233 Ga0307414_10281787
1234 Ga0307411_10030609
1235 Ga0307411_10216371
1236 Ga0307411_10297487
1237 Ga0307411_10378163
1238 Ga0307415_100005753
1239 Ga0307415_100049598
1240 Ga0307415_100069416
1241 Ga0307415_100092529
1242 Ga0307415_100122292
1243 Ga0307415_100367864
1244 Ga0373926_0103839
1245 Ga0373926_0112321
1246 Ga0373944_0014353
1247 Ga0373951_0027295
1248 Ga0373923_0041957
1249 Ga0373936_0032332
1250 Ga0373945_0052015
1251 Ga0373945_0219734
1252 Ga0373953_0113358
1253 Ga0373943_0041837
1254 Ga0373943_0153386
1255 Ga0373943_0304064
1256 Ga0373946_0036367
1257 Ga0373946_0214054
1258 Ga0373955_0558330
1259 Ga0373942_0057181
1260 Ga0373931_0147829
1261 Ga0373935_0219482
1262 Ga0373927_0034241
1263 Ga0373927_0054145
1264 Ga0373933_0123578
1265 Ga0373947_0049659
1266 Ga0373937_0212716
1267 Ga0373925_0006338
1268 Ga0373925_0135216
1269 Ga0373925_0281384
1270 Ga0373925_0327994
1271 Ga0395899_0314209
1272 Ga0395900_0044906
1273 Ga0395900_0064063
1274 Ga0395900_0076148
1275 Ga0395900_0147858
1276 Ga0395900_0205008
1277 Ga0395900_0387962
1278 Ga0395898_0041939
1279 Ga0395898_0090309
1280 Ga0395905_0059784
1281 Ga0395905_0119560
1282 Ga0395905_0468787
1283 Ga0436364_0811486
1284 Ga0395901_0008618
1285 Ga0395901_0026266
1286 Ga0395901_0230980
1287 Ga0395901_0292664
1288 Ga0395901_0570182
1289 Ga0395901_0721168
1290 Ga0436365_0884306
1291 Ga0451853_1035158
1292 Ga0439451_031008
1293 Ga0450907_031393
1294 Ga0439459_0016693
1295 Ga0439464_0120510
1296 Ga0450916_010641
1297 Ga0450918_020024
1298 Ga0466966_0011497
1299 Ga0466963_0031734
1300 Ga0466963_0038681
1301 Ga0466964_0192549
1302 Ga0466964_0215251
1303 Ga0466971_0080213
1304 Ga0466970_0098861
1305 Ga0466957_0023214
1306 Ga0466960_0031222
1307 Ga0451576_0430811
1308 Ga0466958_0086452
1309 Ga0466967_0009270
1310 Ga0466967_0071550
1311 Ga0466967_0280504
1312 Ga0495603_0013366
1313 Ga0495603_0081398
1314 Ga0495603_0125254
1315 Ga0495629_0077512
1316 Ga0495629_0102146
1317 Ga0495629_0211389
1318 Ga0495641_0022549
1319 Ga0495641_0056141
1320 Ga0495641_0089477
1321 Ga0495641_0103448
1322 Ga0495651_0180509
1323 Ga0495653_0063222
1324 Ga0495580_0078431
1325 Ga0495582_0006636
1326 Ga0495582_0084684
1327 Ga0495582_0087283
1328 Ga0495605_0089056
1329 Ga0495605_0141730
1330 Ga0495639_0029065
1331 Ga0495662_0008160
1332 Ga0495662_0019140
1333 Ga0495584_0034792
1334 Ga0495594_0025587
1335 Ga0495594_0142573
1336 Ga0495596_0109633
1337 Ga0495607_0081250
1338 Ga0495607_0150081
1339 Ga0495608_0078551
1340 Ga0495618_0065812
1341 Ga0495628_0505354
1342 Ga0495631_0145592
1343 Ga0495637_0182095
1344 Ga0495644_0226193
1345 Ga0495666_0034046
1346 Ga0495666_0078351
1347 Ga0495652_0218813
1348 Ga0495665_0039368
1349 Ga0495665_0242889
1350 Ga0495640_0044661
1351 Ga0495640_0451748
1352 Ga0495587_0198370
1353 Ga0495667_0249157
1354 Ga0495656_0252649
1355 Ga0495668_0255322
1356 Ga0495634_0018433
1357 Ga0495611_0154972
1358 Ga0495635_0103413
1359 Ga0495635_0223504
1360 Ga0495661_0176375
1361 Ga0495588_0012191
1362 Ga0495588_0031917
1363 Ga0495657_0086794
1364 Ga0495599_0119116
1365 Ga0495623_0160065
1366 Ga0495646_0047364
1367 Ga0495647_0002785
1368 Ga0495647_0237975
1369 Ga0495658_0013514
1370 Ga0495658_0053689
1371 Ga0495658_0159781
1372 Ga0495613_0104523
1373 Ga0495613_0463169
1374 Ga0495624_0049718
1375 Ga0495671_0255180
1376 Ga0495671_0275552
1377 Ga0495589_0164619
1378 Ga0495600_0013935
1379 Ga0495604_0034877
1380 Ga0495604_0123478
1381 Ga0495674_0035538
1382 Ga0495676_0026971
1383 Ga0495676_0059058
1384 Ga0495680_0087788
1385 Ga0495675_0184701
1386 Ga0495684_0044375
1387 Ga0495593_0033807
1388 Ga0495602_0176671
1389 Ga0495602_0212225
1390 Ga0495614_0040528
1391 Ga0495614_0107163
1392 Ga0496100_0007742
1393 Ga0496100_0065781
1394 Ga0496100_1056602
1395 Ga0496101_0003941
1396 Ga0496101_0199317
1397 Ga0496101_0305866
1398 Ga0496101_0440096
1399 Ga0496102_0005045
1400 Ga0496102_0089472
1401 Ga0496102_0122617
1402 Ga0496102_0283070
1403 Ga0496103_0308960
1404 Ga0496103_0407642
1405 Ga0496104_0019827
1406 Ga0496104_0087150
1407 Ga0496104_0490726
1408 Ga0496104_0505545
1409 Ga0496104_0563657
1410 Ga0496104_0858207
1411 Ga0496105_0002403
1412 Ga0496105_0015028
1413 Ga0496106_0004709
1414 Ga0496106_0072234
1415 Ga0496106_0335584
1416 Ga0496106_0515974
1417 Ga0496107_0004666
1418 Ga0496107_0016031
1419 Ga0496107_0336221
1420 Ga0496107_0426999
1421 Ga0496108_0026589
1422 Ga0496108_0047250
1423 Ga0496109_0007887
1424 Ga0496109_0030618
1425 Ga0496109_0116000
1426 Ga0496109_0280977
1427 Ga0496109_0348241
1428 Ga0496109_0383421
1429 Ga0496109_0556643
1430 Ga0496109_0817523
1431 Ga0496110_0018785
1432 Ga0496110_0038435
1433 Ga0496110_0084589
1434 Ga0496110_0133474
1435 Ga0496110_0404039
1436 Ga0496111_0009623
1437 Ga0496111_0025246
1438 Ga0496111_0036596
1439 Ga0496111_0275564
1440 Ga0496112_0002194
1441 Ga0496112_0002940
1442 Ga0496112_0018171
1443 Ga0496112_0053036
1444 Ga0496112_0196449
1445 Ga0496112_0219103
1446 Ga0496112_0255006
1447 Ga0496112_0330620
1448 Ga0496113_0005201
1449 Ga0496113_0093453
1450 Ga0496113_0402380
1451 Ga0496114_0019620
1452 Ga0496114_0248257
1453 Ga0496115_0002213
1454 Ga0496115_0071793
1455 Ga0496115_0189033
1456 Ga0501031_0004077
1457 Ga0501031_0007133
1458 Ga0501032_0023442
1459 Ga0501032_0046833
1460 Ga0501033_0025831
1461 Ga0501033_0044703
1462 Ga0501034_0029234
1463 Ga0501036_0000847
1464 Ga0501036_0042724
1465 Ga0501036_0239977
1466 Ga0501036_0320545
1467 Ga0501036_0394407
1468 Ga0501036_0491748
1469 Ga0501036_0534950
1470 Ga0501037_0094995
1471 Ga0501038_0004907
1472 Ga0501038_0229041
1473 Ga0501039_0004812
1474 Ga0501039_0020315
1475 Ga0501040_0025863
1476 Ga0501040_0091543
1477 Ga0501040_0106182
1478 Ga0501040_0174142
1479 Ga0501041_0008952
1480 Ga0501041_0019206
1481 Ga0501041_0019578
1482 Ga0501042_0003306
1483 Ga0501042_0114424
1484 Ga0501042_0158469
1485 Ga0501042_0549679
1486 Ga0501043_0005710
1487 Ga0501043_0008124
1488 Ga0501043_0104094
1489 Ga0501046_0010734
1490 Ga0501046_0025381
1491 Ga0501046_0079695
1492 Ga0501047_0026740
1493 Ga0501048_0008667
1494 Ga0501048_0040386
1495 Ga0501048_0090794
1496 Ga0501048_0309964
1497 Ga0501048_0487391
1498 Ga0501067_0000732
1499 Ga0501067_0018287
1500 Ga0501068_0006410
1501 Ga0501068_0010687
1502 Ga0501068_0360262
1503 Ga0501069_0011540
1504 Ga0501069_0014212
1505 Ga0501069_0024281
1506 Ga0501069_0418343
1507 Ga0501070_0011069
1508 Ga0501070_0040011
1509 Ga0501070_0114410
1510 Ga0501071_0001931
1511 Ga0501071_0013891
1512 Ga0501071_0055633
1513 Ga0501071_0110706
1514 Ga0501072_0008212
1515 Ga0501072_0009315
1516 Ga0501072_0037868
1517 Ga0501072_0040501
1518 Ga0501072_0320542
1519 Ga0501072_0389882
1520 Ga0501073_0120853
1521 Ga0501073_0191497
1522 Ga0501074_0036590
1523 Ga0501074_0042027
1524 Ga0501074_0256136
1525 Ga0501075_0014936
1526 Ga0501075_0016402
1527 Ga0501075_0070570
1528 Ga0501075_0359694
1529 Ga0501076_0017379
1530 Ga0501076_0042326
1531 Ga0501076_0061534
1532 Ga0501076_0074267
1533 Ga0501076_0259197
1534 Ga0501077_0007004
1535 Ga0501077_0021056
1536 Ga0501077_0076337
1537 Ga0501077_0259061
1538 Ga0501079_0014843
1539 Ga0501079_0016463
1540 Ga0501079_0026482
1541 Ga0501079_0358370
1542 Ga0501080_0085462
1543 Ga0501081_0001380
1544 Ga0501081_0003439
1545 Ga0501081_0010862
1546 Ga0501081_0102488
1547 Ga0501081_0140162
1548 Ga0501081_0316467
1549 Ga0501083_0027213
1550 Ga0501083_0028406
1551 Ga0501083_0078036
1552 Ga0501035_0024612
1553 Ga0501035_0036558
1554 Ga0501035_0078261
1555 Ga0501035_0216091
1556 Ga0501035_0465611
1557 Ga0501044_0100321
1558 Ga0501044_0114604
1559 Ga0501045_0003797
1560 Ga0501045_0035869
1561 Ga0501045_0041058
1562 Ga0501045_0066822
1563 Ga0501045_0161396
1564 nmdc:mga0yw44_124079_c1
1565 nmdc:mga0yw44_141591_c1
1566 nmdc:mga0k408_255596_c1
1567 nmdc:mga05p37_185358_c1
1568 nmdc:mga05p37_37865_c1
1569 nmdc:mga05p37_598905_c1
1570 nmdc:mga09592_134787_c1
1571 nmdc:mga09592_236812_c1
1572 nmdc:mga09592_302681_c1
1573 nmdc:mga09592_85011_c1
1574 nmdc:mga0qj67_617766_c1
1575 nmdc:mga0qj67_72724_c1
1576 nmdc:mga0qj67_91505_c1
1577 nmdc:mga06r32_209738_c1
1578 nmdc:mga06r32_37472_c1
1579 nmdc:mga06r32_748905_c1
1580 nmdc:mga08y16_147782_c1
1581 nmdc:mga08y16_162164_c1
1582 nmdc:mga08y16_252145_c1
1583 nmdc:mga08y16_405951_c1
1584 nmdc:mga08y16_597283_c1
1585 nmdc:mga08y16_9819_c1
1586 nmdc:mga0n895_163306_c1
1587 nmdc:mga0n895_6064_c1
1588 nmdc:mga0rr50_24985_c1
1589 nmdc:mga08x19_84469_c1
1590 nmdc:mga0a205_3354_c1
1591 nmdc:mga0a205_355767_c1
1592 nmdc:mga0a205_37052_c1
1593 Ga0495601_0153355
1594 Ga0495612_0038450
1595 Ga0495655_0022602
1596 Ga0495595_0004583
1597 Ga0495619_0014153
1598 Ga0495619_0105657
1599 Ga0501084_0014902
1600 Ga0501084_0019497
1601 Ga0501084_0044911
1602 Ga0501082_0006093
1603 Ga0501082_0046502
1604 Ga0501082_0130834
1605 Ga0501082_0321449
1606 Ga0530510_0001678
1607 Ga0530510_0063291
1608 Ga0530510_0078477
1609 Ga0530510_0178540
1610 Ga0530510_0199633
1611 Ga0530510_0232942
1612 Ga0530510_0591771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

26

96

0.92

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

114

215

0.81

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

148

217

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iel-assembly1.cif.gz_A-2 crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione 0.8857 2 209
6nxv-assembly1.cif.gz_A crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.8677 1 216
6nv6-assembly2.cif.gz_B crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.8597 1 215
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.8564 1 216
4ke3-assembly4.cif.gz_D crystal structure of a glutathione transferase family member from burkholderia graminis, target efi-507264, no gsh, disordered domains, space group p21, form(2) 0.8555 4 218
ID Description Score Start End Superfamily
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9243 4 78 3.40.30.10
3ubkA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9152 3 78 3.40.30.10
5zfgB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9128 4 78 3.40.30.10
af_Q9FHE1_1_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9116 3 78 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9115 4 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A5R2NK70-F1-model_v4 Glutathione S-transferase family protein 0.9937 96 226 GO:0016740
AF-A0A3S3E992-F1-model_v4 Glutathione S-transferase family protein 0.9926 2 226 GO:0004364
GO:0006749
AF-A0A532E612-F1-model_v4 Glutathione S-transferase family protein 0.9911 2 226 GO:0004364
GO:0006749
AF-A0A5R2N8W6-F1-model_v4 Glutathione S-transferase family protein 0.9907 2 97 GO:0004364
GO:0006749
AF-A0A529P8A6-F1-model_v4 Glutathione S-transferase family protein 0.9894 4 191 GO:0004364
GO:0006749

Map