F481612
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 805 | 581 | 546 | 255 |
Family's Representative Sequence
| Representative Sequence | 3300044712|Ga0453684_0000136|Ga0453684_0000136_80941_81825 |
| Length | 294 |
| Sequence | MHRGMRGGRLSQRNIRAYAVRIDGTASPPSRGDTMLSNKTALITGSTSGIGEGIARAFAQAGANIILNGFGDAAQIEALRAEIASAHGVRVRYDGADMSKPVQIEAMMAAAIGEFGAIDVLVNNAGIQHVAPVDEFPTAKWDAIIAINLCSAFHTTRLALPGMKQRGWGRIVNVASAHALVASPFKSAYVAAKHGIAGLTKTVALEVAQAGVTVNAICPGYVRTPLVEKQIPDTARARGITEEQVVKDVMLAAQPTKKFVTVEQVAALARFLCSDDAASITGAMLPIDGGWAAQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 3 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 4 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 5 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 6 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 7 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 8 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 9 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 10 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 11 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 12 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 13 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 14 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 15 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 16 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 17 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 18 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 19 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 20 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 21 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 22 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 23 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 24 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 25 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 26 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 27 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 28 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 29 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 30 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 31 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 32 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 33 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 34 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 35 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 36 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 37 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 38 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 39 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 40 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 41 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 42 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 43 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 44 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 45 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 46 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 47 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 48 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 49 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 50 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 51 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 52 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 53 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 54 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 55 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 56 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 57 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 58 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 59 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 60 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 61 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 62 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 63 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 64 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 65 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 66 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 67 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 68 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 69 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 70 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 71 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 72 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 73 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 74 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 75 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 76 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 77 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 78 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 79 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 80 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 81 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 82 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 83 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 84 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 85 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 86 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 87 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 88 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 89 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 90 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 91 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 92 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 93 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 94 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 95 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 96 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 97 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 98 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 99 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 100 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 101 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 102 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 103 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 104 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 105 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 106 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 107 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 108 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 109 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 110 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 111 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 112 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 113 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 114 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 115 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 116 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 117 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 118 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 119 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 120 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 121 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 122 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 123 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 124 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 125 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 126 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 127 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 128 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 129 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 130 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 131 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 132 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 133 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 134 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 135 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 136 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 137 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 138 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 139 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 140 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 141 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 142 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 143 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 144 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 145 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 146 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 147 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 148 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 149 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 150 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 151 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 152 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 153 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 154 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 155 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 156 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 157 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 158 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 159 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 160 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 161 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 162 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 163 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 164 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 165 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 166 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 167 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 168 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 169 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 170 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 171 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 172 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 173 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 174 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 175 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 176 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 177 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 178 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 179 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 180 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 181 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 182 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 183 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 184 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 185 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 186 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 187 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 188 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 189 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 190 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 191 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 192 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 193 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 194 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 195 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 196 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 197 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 198 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 199 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 200 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 201 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 202 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 203 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 204 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 205 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 206 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 207 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 208 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 209 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 210 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 211 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 212 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 213 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 214 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 215 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 216 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 217 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 218 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 219 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 220 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 221 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 222 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 223 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 224 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 225 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 226 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 227 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 228 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 229 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 230 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 231 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 232 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 233 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 234 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 235 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 236 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 237 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 238 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 239 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 240 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 241 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 242 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 243 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 244 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 245 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 246 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 247 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 248 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 249 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 250 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 251 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 252 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 253 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 254 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 255 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 256 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 257 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 258 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 259 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 260 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 261 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 262 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 263 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 264 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 265 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 266 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 267 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 268 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 269 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 270 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 271 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 272 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 273 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 274 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 275 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 276 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 278 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 279 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 280 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 281 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 282 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 283 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 289 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 290 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 291 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 294 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 295 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 296 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 297 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 298 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 299 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 300 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 301 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 302 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 303 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 304 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 307 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 308 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 310 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 311 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 312 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 313 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 314 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 315 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 316 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 317 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 318 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 319 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 320 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 321 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 322 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 323 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 324 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 325 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 327 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 328 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 329 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 330 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 331 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 332 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 333 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 335 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 336 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 337 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 338 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 339 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 340 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 341 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 343 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 344 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 345 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 352 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 353 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 355 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 356 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 359 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 360 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 362 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 363 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 364 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 365 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 366 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 367 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 368 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 369 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 370 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 372 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 373 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 374 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 375 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 377 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 378 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 379 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 381 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 382 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 383 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 384 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 385 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 427 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 432 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 433 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 434 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 435 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 436 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 437 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 438 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 439 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 440 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 441 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 442 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 443 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 444 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 445 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 446 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 447 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 448 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 449 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 450 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 451 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 452 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 453 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 454 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 455 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 456 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 457 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 458 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 459 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 460 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 461 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 462 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 463 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 464 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 465 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 466 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 467 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 468 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 469 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 470 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 471 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 472 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 473 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 474 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 475 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 476 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 477 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 478 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 479 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 480 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 506 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 507 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 508 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 509 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 510 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 511 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 512 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 513 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 514 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 515 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 516 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 517 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 518 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 519 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 520 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 521 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 522 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 523 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 524 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 525 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 527 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 528 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 529 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 534 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 535 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 537 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 538 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 539 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 540 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 542 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 544 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 545 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 546 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 547 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 548 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 549 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 550 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 551 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 554 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 555 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 556 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 557 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 558 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 559 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 560 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 561 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 562 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 563 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 564 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 565 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 566 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 567 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 568 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 571 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 572 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 573 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 574 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 575 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 576 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 577 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 578 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 579 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 580 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 581 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 67.33 |
| Metatranscriptomes | 0.5 |
| Isolates | 32.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.5 |
| Bulb | 0 |
| Endosphere | 8.07 |
| Nodule | 26.46 |
| Rhizoplane | 3.6 |
| Rhizosphere | 54.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1053217 | 2162886007 | Bacteria | 937 |
| 2 | JGI24739J22299_10021846 | 3300001989 | Bacteria | 2274 |
| 3 | JGI25152J39213_1003305 | 3300002773 | Bacteria | 5566 |
| 4 | JGI25150J39212_1001863 | 3300002774 | Bacteria | 5566 |
| 5 | JGI25159J45721_1003478 | 3300002987 | Bacteria | 5558 |
| 6 | JGI25159J45721_1005737 | 3300002987 | Bacteria | 3844 |
| 7 | JGI25151J46595_10000429 | 3300003187 | Bacteria | 41718 |
| 8 | JGI25151J46595_10009456 | 3300003187 | Bacteria | 4614 |
| 9 | JGI25153J46596_10009233 | 3300003215 | Bacteria | 4614 |
| 10 | JGI25160J50197_1006724 | 3300003354 | Bacteria | 4614 |
| 11 | JGI25161J50226_1002548 | 3300003374 | Bacteria | 4610 |
| 12 | JGI25404J52841_10004368 | 3300003659 | Bacteria | 2859 |
| 13 | Ga0055526_1009636 | 3300003771 | Bacteria | 4614 |
| 14 | Ga0055537_1003708 | 3300003773 | Bacteria | 4614 |
| 15 | Ga0055524_1007517 | 3300003775 | Bacteria | 4614 |
| 16 | Ga0055534_1003816 | 3300003784 | Bacteria | 4614 |
| 17 | Ga0055528_1007964 | 3300003790 | Bacteria | 4614 |
| 18 | Ga0055531_10010117 | 3300003794 | Bacteria | 4734 |
| 19 | Ga0058692_1000031 | 3300003856 | Bacteria | 188488 |
| 20 | Ga0055543_1001596 | 3300004625 | Bacteria | 8706 |
| 21 | Ga0065165_1006794 | 3300005262 | Bacteria | 5845 |
| 22 | Ga0065704_10136423 | 3300005289 | Bacteria | 1566 |
| 23 | Ga0065715_10270724 | 3300005293 | Bacteria | 1112 |
| 24 | Ga0065715_10358234 | 3300005293 | Bacteria | 940 |
| 25 | Ga0065707_10218408 | 3300005295 | Bacteria | 1235 |
| 26 | Ga0070658_10002319 | 3300005327 | Bacteria | 15978 |
| 27 | Ga0070683_100066981 | 3300005329 | Bacteria | 3344 |
| 28 | Ga0070690_100085605 | 3300005330 | Bacteria | 2068 |
| 29 | Ga0070690_100245131 | 3300005330 | Bacteria | 1265 |
| 30 | Ga0070670_100002932 | 3300005331 | Bacteria | 14123 |
| 31 | Ga0070670_100254601 | 3300005331 | Bacteria | 1530 |
| 32 | Ga0070680_100060440 | 3300005336 | Bacteria | 3101 |
| 33 | Ga0070680_100100163 | 3300005336 | Bacteria | 2405 |
| 34 | Ga0068868_100180245 | 3300005338 | Bacteria | 1752 |
| 35 | Ga0068868_100300150 | 3300005338 | Bacteria | 1364 |
| 36 | Ga0070689_100118202 | 3300005340 | Bacteria | 2115 |
| 37 | Ga0070689_100378338 | 3300005340 | Bacteria | 1193 |
| 38 | Ga0070661_100004790 | 3300005344 | Bacteria | 9318 |
| 39 | Ga0070661_100009092 | 3300005344 | Bacteria | 6872 |
| 40 | Ga0070668_100001538 | 3300005347 | Bacteria | 16641 |
| 41 | Ga0070675_100068054 | 3300005354 | Bacteria | 2948 |
| 42 | Ga0070674_100048218 | 3300005356 | Bacteria | 2923 |
| 43 | Ga0070673_100084974 | 3300005364 | Bacteria | 2575 |
| 44 | Ga0070688_100069052 | 3300005365 | Bacteria | 2255 |
| 45 | Ga0070688_100199772 | 3300005365 | Bacteria | 1398 |
| 46 | Ga0070667_100043458 | 3300005367 | Bacteria | 3771 |
| 47 | Ga0070694_100041430 | 3300005444 | Bacteria | 3073 |
| 48 | Ga0070678_100181311 | 3300005456 | Bacteria | 1724 |
| 49 | Ga0070678_100229328 | 3300005456 | Bacteria | 1547 |
| 50 | Ga0070678_100422966 | 3300005456 | Bacteria | 1162 |
| 51 | Ga0070662_100041549 | 3300005457 | Bacteria | 3281 |
| 52 | Ga0070662_100413343 | 3300005457 | Bacteria | 1115 |
| 53 | Ga0068867_100012518 | 3300005459 | Bacteria | 6003 |
| 54 | Ga0068867_100034317 | 3300005459 | Bacteria | 3677 |
| 55 | Ga0068867_100106014 | 3300005459 | Bacteria | 2152 |
| 56 | Ga0070685_10002961 | 3300005466 | Bacteria | 8670 |
| 57 | Ga0070706_100055825 | 3300005467 | Bacteria | 3646 |
| 58 | Ga0070706_100603723 | 3300005467 | Bacteria | 1020 |
| 59 | Ga0070698_100046656 | 3300005471 | Bacteria | 4430 |
| 60 | Ga0070699_100115877 | 3300005518 | Bacteria | 2354 |
| 61 | Ga0070684_100007310 | 3300005535 | Bacteria | 8582 |
| 62 | Ga0070697_100096800 | 3300005536 | Bacteria | 2449 |
| 63 | Ga0068853_100048814 | 3300005539 | Bacteria | 3636 |
| 64 | Ga0068853_100059078 | 3300005539 | Bacteria | 3312 |
| 65 | Ga0068853_100110335 | 3300005539 | Bacteria | 2443 |
| 66 | Ga0068853_100279474 | 3300005539 | Bacteria | 1539 |
| 67 | Ga0068853_100309546 | 3300005539 | Bacteria | 1462 |
| 68 | Ga0070672_100001670 | 3300005543 | Bacteria | 13824 |
| 69 | Ga0070672_100016821 | 3300005543 | Bacteria | 5246 |
| 70 | Ga0070672_100374412 | 3300005543 | Bacteria | 1217 |
| 71 | Ga0070686_100097071 | 3300005544 | Bacteria | 1983 |
| 72 | Ga0070695_100329651 | 3300005545 | Bacteria | 1137 |
| 73 | Ga0070695_100425536 | 3300005545 | Bacteria | 1012 |
| 74 | Ga0070696_100126591 | 3300005546 | Bacteria | 1854 |
| 75 | Ga0070696_100154102 | 3300005546 | Bacteria | 1689 |
| 76 | Ga0070665_100005441 | 3300005548 | Bacteria | 13132 |
| 77 | Ga0070665_100031591 | 3300005548 | Bacteria | 5330 |
| 78 | Ga0070704_100076128 | 3300005549 | Bacteria | 2453 |
| 79 | Ga0070704_100120331 | 3300005549 | Bacteria | 2016 |
| 80 | Ga0068855_100000006 | 3300005563 | Bacteria | 298092 |
| 81 | Ga0068855_100023209 | 3300005563 | Bacteria | 7432 |
| 82 | Ga0068855_100069804 | 3300005563 | Bacteria | 4088 |
| 83 | Ga0068855_100113643 | 3300005563 | Bacteria | 3106 |
| 84 | Ga0068855_100694064 | 3300005563 | Bacteria | 1090 |
| 85 | Ga0070664_100058712 | 3300005564 | Bacteria | 3272 |
| 86 | Ga0068857_100011595 | 3300005577 | Bacteria | 7669 |
| 87 | Ga0068854_100057311 | 3300005578 | Bacteria | 2810 |
| 88 | Ga0068854_100340607 | 3300005578 | Bacteria | 1224 |
| 89 | Ga0068856_100024483 | 3300005614 | Bacteria | 5878 |
| 90 | Ga0068856_100307339 | 3300005614 | Bacteria | 1603 |
| 91 | Ga0068852_100001922 | 3300005616 | Bacteria | 14156 |
| 92 | Ga0068852_100014664 | 3300005616 | Bacteria | 6043 |
| 93 | Ga0068852_100055850 | 3300005616 | Bacteria | 3410 |
| 94 | Ga0068852_100067802 | 3300005616 | Bacteria | 3120 |
| 95 | Ga0068852_100391162 | 3300005616 | Bacteria | 1366 |
| 96 | Ga0068859_100004020 | 3300005617 | Bacteria | 14992 |
| 97 | Ga0068859_100028791 | 3300005617 | Bacteria | 5570 |
| 98 | Ga0068859_100216912 | 3300005617 | Bacteria | 2001 |
| 99 | Ga0068859_100613945 | 3300005617 | Bacteria | 1180 |
| 100 | Ga0068859_101148735 | 3300005617 | Bacteria | 855 |
| 101 | Ga0068864_100001391 | 3300005618 | Bacteria | 20051 |
| 102 | Ga0068864_100002912 | 3300005618 | Bacteria | 14157 |
| 103 | Ga0068864_100267773 | 3300005618 | Bacteria | 1591 |
| 104 | Ga0068861_100000210 | 3300005719 | Bacteria | 31407 |
| 105 | Ga0068851_10086788 | 3300005834 | Bacteria | 1642 |
| 106 | Ga0068870_10042500 | 3300005840 | Bacteria | 2367 |
| 107 | Ga0068863_100002813 | 3300005841 | Bacteria | 17226 |
| 108 | Ga0068863_100006041 | 3300005841 | Bacteria | 11881 |
| 109 | Ga0068863_100019035 | 3300005841 | Bacteria | 6572 |
| 110 | Ga0068858_100045566 | 3300005842 | Bacteria | 4065 |
| 111 | Ga0068860_100004339 | 3300005843 | Bacteria | 14497 |
| 112 | Ga0068860_100004940 | 3300005843 | Bacteria | 13590 |
| 113 | Ga0068860_100140989 | 3300005843 | Bacteria | 2317 |
| 114 | Ga0068860_100292283 | 3300005843 | Bacteria | 1595 |
| 115 | Ga0068862_100004054 | 3300005844 | Bacteria | 12418 |
| 116 | Ga0068862_100195797 | 3300005844 | Bacteria | 1820 |
| 117 | Ga0081455_10000479 | 3300005937 | Bacteria | 51768 |
| 118 | Ga0081455_10045769 | 3300005937 | Bacteria | 3804 |
| 119 | Ga0081540_1064076 | 3300005983 | Bacteria | 1736 |
| 120 | Ga0081539_10001648 | 3300005985 | Bacteria | 36250 |
| 121 | Ga0081539_10017784 | 3300005985 | Bacteria | 4968 |
| 122 | Ga0070717_10431301 | 3300006028 | Bacteria | 1186 |
| 123 | Ga0075365_10106496 | 3300006038 | Bacteria | 1924 |
| 124 | Ga0075368_10035856 | 3300006042 | Bacteria | 1937 |
| 125 | Ga0075368_10092812 | 3300006042 | Bacteria | 1235 |
| 126 | Ga0075363_100020064 | 3300006048 | Bacteria | 3349 |
| 127 | Ga0075363_100026566 | 3300006048 | Bacteria | 2963 |
| 128 | Ga0075362_10000592 | 3300006177 | Bacteria | 10626 |
| 129 | Ga0075362_10005194 | 3300006177 | Bacteria | 4745 |
| 130 | Ga0075367_10000751 | 3300006178 | Bacteria | 12637 |
| 131 | Ga0075367_10152724 | 3300006178 | Bacteria | 1433 |
| 132 | Ga0075369_10000268 | 3300006186 | Bacteria | 15479 |
| 133 | Ga0075366_10057364 | 3300006195 | Bacteria | 2314 |
| 134 | Ga0097621_100134741 | 3300006237 | Bacteria | 2106 |
| 135 | Ga0075370_10038622 | 3300006353 | Bacteria | 2687 |
| 136 | Ga0075370_10069612 | 3300006353 | Bacteria | 2011 |
| 137 | Ga0075370_10220538 | 3300006353 | Bacteria | 1121 |
| 138 | Ga0068871_100124136 | 3300006358 | Bacteria | 2184 |
| 139 | Ga0075433_10291310 | 3300006852 | Bacteria | 1446 |
| 140 | Ga0075434_100058662 | 3300006871 | Bacteria | 3825 |
| 141 | Ga0075429_100079383 | 3300006880 | Bacteria | 2861 |
| 142 | Ga0068865_100025074 | 3300006881 | Bacteria | 3919 |
| 143 | Ga0075436_100011403 | 3300006914 | Bacteria | 6103 |
| 144 | Ga0075436_100014247 | 3300006914 | Bacteria | 5444 |
| 145 | Ga0097620_100004020 | 3300006931 | Bacteria | 14992 |
| 146 | Ga0097620_100028791 | 3300006931 | Bacteria | 5570 |
| 147 | Ga0097620_100216899 | 3300006931 | Bacteria | 2001 |
| 148 | Ga0097620_100613990 | 3300006931 | Bacteria | 1180 |
| 149 | Ga0097620_101148542 | 3300006931 | Bacteria | 855 |
| 150 | Ga0079104_1014959 | 3300006946 | Bacteria | 2320 |
| 151 | Ga0075435_100007808 | 3300007076 | Bacteria | 7650 |
| 152 | Ga0105244_10079869 | 3300009036 | Bacteria | 1620 |
| 153 | Ga0105240_10000080 | 3300009093 | Bacteria | 195633 |
| 154 | Ga0111539_10220614 | 3300009094 | Bacteria | 2208 |
| 155 | Ga0111539_10261159 | 3300009094 | Bacteria | 2016 |
| 156 | Ga0111539_10522854 | 3300009094 | Bacteria | 1382 |
| 157 | Ga0114129_10240633 | 3300009147 | Bacteria | 2433 |
| 158 | Ga0105241_10003718 | 3300009174 | Bacteria | 11328 |
| 159 | Ga0105241_10424753 | 3300009174 | Bacteria | 1170 |
| 160 | Ga0105242_10155099 | 3300009176 | Bacteria | 2000 |
| 161 | Ga0105237_10008317 | 3300009545 | Bacteria | 11257 |
| 162 | Ga0105237_10013907 | 3300009545 | Bacteria | 8421 |
| 163 | Ga0105237_10297551 | 3300009545 | Bacteria | 1617 |
| 164 | Ga0105238_10000677 | 3300009551 | Bacteria | 35835 |
| 165 | Ga0105238_10009692 | 3300009551 | Bacteria | 9642 |
| 166 | Ga0105238_10048290 | 3300009551 | Bacteria | 4291 |
| 167 | Ga0105238_10166261 | 3300009551 | Bacteria | 2182 |
| 168 | Ga0105238_10244661 | 3300009551 | Bacteria | 1771 |
| 169 | Ga0105249_10194867 | 3300009553 | Bacteria | 1980 |
| 170 | Ga0105249_10603599 | 3300009553 | Bacteria | 1152 |
| 171 | Ga0105239_10001550 | 3300010375 | Bacteria | 30371 |
| 172 | Ga0105239_10025620 | 3300010375 | Bacteria | 6494 |
| 173 | Ga0105239_10117384 | 3300010375 | Bacteria | 2953 |
| 174 | Ga0105239_10388697 | 3300010375 | Bacteria | 1578 |
| 175 | Ga0105239_10393998 | 3300010375 | Bacteria | 1567 |
| 176 | Ga0105239_10654371 | 3300010375 | Bacteria | 1200 |
| 177 | Ga0105246_10009952 | 3300011119 | Bacteria | 5866 |
| 178 | Ga0157346_1001597 | 3300012480 | Bacteria | 1093 |
| 179 | Ga0157373_10018460 | 3300013100 | Bacteria | 5078 |
| 180 | Ga0157371_10114508 | 3300013102 | Bacteria | 1915 |
| 181 | Ga0157371_10124379 | 3300013102 | Bacteria | 1834 |
| 182 | Ga0157371_10147773 | 3300013102 | Bacteria | 1676 |
| 183 | Ga0157370_10092714 | 3300013104 | Bacteria | 2835 |
| 184 | Ga0157370_10281549 | 3300013104 | Bacteria | 1536 |
| 185 | Ga0157369_10003606 | 3300013105 | Bacteria | 18398 |
| 186 | Ga0157369_10006059 | 3300013105 | Bacteria | 14033 |
| 187 | Ga0157369_10044850 | 3300013105 | Bacteria | 4811 |
| 188 | Ga0157369_10591869 | 3300013105 | Bacteria | 1145 |
| 189 | Ga0157378_10009890 | 3300013297 | Bacteria | 8312 |
| 190 | Ga0157375_10015650 | 3300013308 | Bacteria | 6793 |
| 191 | Ga0163163_10000041 | 3300014325 | Bacteria | 142066 |
| 192 | Ga0163163_10001081 | 3300014325 | Bacteria | 23120 |
| 193 | Ga0163163_10020198 | 3300014325 | Bacteria | 6269 |
| 194 | Ga0163163_10198315 | 3300014325 | Bacteria | 2055 |
| 195 | Ga0157380_10090380 | 3300014326 | Bacteria | 2526 |
| 196 | Ga0157379_10003245 | 3300014968 | Bacteria | 13798 |
| 197 | Ga0157379_10079007 | 3300014968 | Bacteria | 2947 |
| 198 | Ga0157379_10261222 | 3300014968 | Bacteria | 1573 |
| 199 | Ga0157379_10480958 | 3300014968 | Bacteria | 1149 |
| 200 | Ga0157376_10053276 | 3300014969 | Bacteria | 3368 |
| 201 | Ga0182006_1003007 | 3300015261 | Bacteria | 8869 |
| 202 | Ga0182006_1018903 | 3300015261 | Bacteria | 2907 |
| 203 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 204 | Ga0213876_10001143 | 3300021384 | Bacteria | 16854 |
| 205 | Ga0213876_10154618 | 3300021384 | Bacteria | 1220 |
| 206 | Ga0213875_10122254 | 3300021388 | Bacteria | 1216 |
| 207 | Ga0209436_114655 | 3300025208 | Bacteria | 1241 |
| 208 | Ga0207425_1001080 | 3300025245 | Bacteria | 12404 |
| 209 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 210 | Ga0209565_1000125 | 3300025263 | Bacteria | 110485 |
| 211 | Ga0209673_1002969 | 3300025273 | Bacteria | 10598 |
| 212 | Ga0209130_1000069 | 3300025284 | Bacteria | 179177 |
| 213 | Ga0209675_1000427 | 3300025291 | Bacteria | 34021 |
| 214 | Ga0209025_1000282 | 3300025294 | Bacteria | 115627 |
| 215 | Ga0209025_1000316 | 3300025294 | Bacteria | 107447 |
| 216 | Ga0209564_1000270 | 3300025295 | Bacteria | 108503 |
| 217 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 218 | Ga0209050_1002684 | 3300025298 | Bacteria | 14503 |
| 219 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 220 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 221 | Ga0209051_1002758 | 3300025303 | Bacteria | 12132 |
| 222 | Ga0209051_1022726 | 3300025303 | Bacteria | 2630 |
| 223 | Ga0209257_1002269 | 3300025304 | Bacteria | 19614 |
| 224 | Ga0207642_10123973 | 3300025899 | Bacteria | 1337 |
| 225 | Ga0207643_10048399 | 3300025908 | Bacteria | 2408 |
| 226 | Ga0207705_10001097 | 3300025909 | Bacteria | 21979 |
| 227 | Ga0207684_10300634 | 3300025910 | Bacteria | 1384 |
| 228 | Ga0207684_10606527 | 3300025910 | Bacteria | 935 |
| 229 | Ga0207654_10139725 | 3300025911 | Bacteria | 1543 |
| 230 | Ga0207707_10016035 | 3300025912 | Bacteria | 6534 |
| 231 | Ga0207695_10000004 | 3300025913 | Bacteria | 1288665 |
| 232 | Ga0207695_10003360 | 3300025913 | Bacteria | 22614 |
| 233 | Ga0207695_10303832 | 3300025913 | Bacteria | 1487 |
| 234 | Ga0207695_10435464 | 3300025913 | Bacteria | 1195 |
| 235 | Ga0207695_10453034 | 3300025913 | Bacteria | 1166 |
| 236 | Ga0207671_10052369 | 3300025914 | Bacteria | 3025 |
| 237 | Ga0207671_10070925 | 3300025914 | Bacteria | 2598 |
| 238 | Ga0207671_10081624 | 3300025914 | Bacteria | 2425 |
| 239 | Ga0207662_10329665 | 3300025918 | Bacteria | 1021 |
| 240 | Ga0207649_10016306 | 3300025920 | Bacteria | 4186 |
| 241 | Ga0207649_10546663 | 3300025920 | Bacteria | 886 |
| 242 | Ga0207652_10068548 | 3300025921 | Bacteria | 3078 |
| 243 | Ga0207681_10028880 | 3300025923 | Bacteria | 3596 |
| 244 | Ga0207681_10159531 | 3300025923 | Bacteria | 1698 |
| 245 | Ga0207694_10000014 | 3300025924 | Bacteria | 374435 |
| 246 | Ga0207694_10007643 | 3300025924 | Bacteria | 8188 |
| 247 | Ga0207694_10008420 | 3300025924 | Bacteria | 7783 |
| 248 | Ga0207694_10078789 | 3300025924 | Bacteria | 2583 |
| 249 | Ga0207694_10132622 | 3300025924 | Bacteria | 1998 |
| 250 | Ga0207650_10031394 | 3300025925 | Bacteria | 3836 |
| 251 | Ga0207650_10406962 | 3300025925 | Bacteria | 1127 |
| 252 | Ga0207659_10034680 | 3300025926 | Bacteria | 3482 |
| 253 | Ga0207659_10334682 | 3300025926 | Bacteria | 1252 |
| 254 | Ga0207706_10412605 | 3300025933 | Bacteria | 1170 |
| 255 | Ga0207686_10322658 | 3300025934 | Bacteria | 1154 |
| 256 | Ga0207709_10186550 | 3300025935 | Bacteria | 1469 |
| 257 | Ga0207670_10386106 | 3300025936 | Bacteria | 1116 |
| 258 | Ga0207669_10271296 | 3300025937 | Bacteria | 1274 |
| 259 | Ga0207704_10141287 | 3300025938 | Bacteria | 1685 |
| 260 | Ga0207691_10010252 | 3300025940 | Bacteria | 8990 |
| 261 | Ga0207691_10028031 | 3300025940 | Bacteria | 5277 |
| 262 | Ga0207691_10057154 | 3300025940 | Bacteria | 3552 |
| 263 | Ga0207691_10249669 | 3300025940 | Bacteria | 1532 |
| 264 | Ga0207691_10711330 | 3300025940 | Bacteria | 847 |
| 265 | Ga0207711_10069135 | 3300025941 | Bacteria | 3060 |
| 266 | Ga0207711_10234899 | 3300025941 | Bacteria | 1680 |
| 267 | Ga0207661_10497714 | 3300025944 | Bacteria | 1113 |
| 268 | Ga0207679_10193858 | 3300025945 | Bacteria | 1692 |
| 269 | Ga0207679_10226009 | 3300025945 | Bacteria | 1577 |
| 270 | Ga0207679_10294590 | 3300025945 | Bacteria | 1396 |
| 271 | Ga0207667_10000202 | 3300025949 | Bacteria | 86408 |
| 272 | Ga0207667_10005447 | 3300025949 | Bacteria | 15517 |
| 273 | Ga0207651_10378739 | 3300025960 | Bacteria | 1199 |
| 274 | Ga0207668_10003142 | 3300025972 | Bacteria | 9665 |
| 275 | Ga0207668_10073153 | 3300025972 | Bacteria | 2455 |
| 276 | Ga0207640_10436875 | 3300025981 | Bacteria | 1075 |
| 277 | Ga0207640_10483535 | 3300025981 | Bacteria | 1027 |
| 278 | Ga0207640_10492857 | 3300025981 | Bacteria | 1019 |
| 279 | Ga0207658_10003586 | 3300025986 | Bacteria | 10963 |
| 280 | Ga0207658_10115692 | 3300025986 | Bacteria | 2129 |
| 281 | Ga0207677_10128286 | 3300026023 | Bacteria | 1921 |
| 282 | Ga0207677_10354238 | 3300026023 | Bacteria | 1231 |
| 283 | Ga0207703_10048586 | 3300026035 | Bacteria | 3426 |
| 284 | Ga0207703_10072360 | 3300026035 | Bacteria | 2849 |
| 285 | Ga0207639_10062145 | 3300026041 | Bacteria | 2886 |
| 286 | Ga0207639_10242054 | 3300026041 | Bacteria | 1569 |
| 287 | Ga0207702_10210097 | 3300026078 | Bacteria | 1809 |
| 288 | Ga0207641_10003697 | 3300026088 | Bacteria | 13474 |
| 289 | Ga0207641_10010598 | 3300026088 | Bacteria | 7563 |
| 290 | Ga0207641_10014858 | 3300026088 | Bacteria | 6382 |
| 291 | Ga0207641_10257139 | 3300026088 | Bacteria | 1633 |
| 292 | Ga0207641_10299875 | 3300026088 | Bacteria | 1517 |
| 293 | Ga0207648_10000442 | 3300026089 | Bacteria | 45913 |
| 294 | Ga0207648_10016794 | 3300026089 | Bacteria | 6675 |
| 295 | Ga0207648_10174590 | 3300026089 | Bacteria | 1900 |
| 296 | Ga0207648_10297682 | 3300026089 | Bacteria | 1446 |
| 297 | Ga0207676_10174433 | 3300026095 | Bacteria | 1876 |
| 298 | Ga0207676_10215106 | 3300026095 | Bacteria | 1708 |
| 299 | Ga0207676_10614417 | 3300026095 | Bacteria | 1045 |
| 300 | Ga0207674_10013821 | 3300026116 | Bacteria | 8931 |
| 301 | Ga0207674_10034700 | 3300026116 | Bacteria | 5271 |
| 302 | Ga0207675_100000633 | 3300026118 | Bacteria | 34481 |
| 303 | Ga0207675_100169465 | 3300026118 | Bacteria | 2086 |
| 304 | Ga0207675_100782575 | 3300026118 | Bacteria | 967 |
| 305 | Ga0207683_10118547 | 3300026121 | Bacteria | 2374 |
| 306 | Ga0207683_10148835 | 3300026121 | Bacteria | 2112 |
| 307 | Ga0207683_10267661 | 3300026121 | Bacteria | 1561 |
| 308 | Ga0207683_10546619 | 3300026121 | Bacteria | 1071 |
| 309 | Ga0207698_10003027 | 3300026142 | Bacteria | 10076 |
| 310 | Ga0207698_10021921 | 3300026142 | Bacteria | 4428 |
| 311 | Ga0207698_10058457 | 3300026142 | Bacteria | 2988 |
| 312 | Ga0209281_1000190 | 3300027111 | Bacteria | 140658 |
| 313 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 314 | Ga0268266_10018802 | 3300028379 | Bacteria | 5888 |
| 315 | Ga0268265_10003872 | 3300028380 | Bacteria | 10569 |
| 316 | Ga0268265_10119814 | 3300028380 | Bacteria | 2166 |
| 317 | Ga0268265_10399006 | 3300028380 | Bacteria | 1271 |
| 318 | Ga0268264_10002795 | 3300028381 | Bacteria | 15247 |
| 319 | Ga0268264_10006716 | 3300028381 | Bacteria | 9669 |
| 320 | Ga0268264_10489755 | 3300028381 | Bacteria | 1197 |
| 321 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 322 | Ga0265332_10198066 | 3300031238 | Bacteria | 835 |
| 323 | Ga0307508_10001988 | 3300031616 | Bacteria | 22347 |
| 324 | Ga0316575_10083463 | 3300031665 | Bacteria | 1290 |
| 325 | Ga0316576_10391552 | 3300031727 | Bacteria | 1031 |
| 326 | Ga0307516_10052976 | 3300031730 | Bacteria | 3970 |
| 327 | Ga0307516_10345959 | 3300031730 | Bacteria | 1153 |
| 328 | Ga0307405_10306417 | 3300031731 | Bacteria | 1207 |
| 329 | Ga0307412_10002067 | 3300031911 | Bacteria | 11137 |
| 330 | Ga0307412_10093720 | 3300031911 | Bacteria | 2107 |
| 331 | Ga0307409_100018422 | 3300031995 | Bacteria | 4695 |
| 332 | Ga0307414_10015522 | 3300032004 | Bacteria | 4598 |
| 333 | Ga0307414_10152700 | 3300032004 | Bacteria | 1824 |
| 334 | Ga0307411_10000177 | 3300032005 | Bacteria | 20429 |
| 335 | Ga0373926_0000848 | 3300035083 | Bacteria | 8714 |
| 336 | Ga0373944_0007159 | 3300035089 | Bacteria | 2983 |
| 337 | Ga0373923_0022370 | 3300035111 | Bacteria | 2479 |
| 338 | Ga0373936_0017975 | 3300035113 | Bacteria | 2727 |
| 339 | Ga0373936_0022446 | 3300035113 | Bacteria | 2457 |
| 340 | Ga0373945_0002899 | 3300035116 | Bacteria | 5387 |
| 341 | Ga0373954_0003556 | 3300035118 | Bacteria | 6623 |
| 342 | Ga0373943_0007874 | 3300035170 | Bacteria | 4782 |
| 343 | Ga0373946_0006412 | 3300035171 | Bacteria | 4265 |
| 344 | Ga0316574_0042754 | 3300035398 | Bacteria | 2798 |
| 345 | Ga0373924_0047336 | 3300035410 | Bacteria | 1774 |
| 346 | Ga0373935_0080692 | 3300035692 | Bacteria | 2113 |
| 347 | Ga0373927_0005282 | 3300035695 | Bacteria | 8932 |
| 348 | Ga0373937_0028390 | 3300036401 | Bacteria | 5063 |
| 349 | Ga0373925_0128015 | 3300037068 | Bacteria | 1977 |
| 350 | Ga0373925_0231858 | 3300037068 | Bacteria | 1476 |
| 351 | Ga0395899_0001843 | 3300037312 | Bacteria | 17548 |
| 352 | Ga0395899_0255571 | 3300037312 | Bacteria | 1201 |
| 353 | Ga0395900_0050886 | 3300037418 | Bacteria | 4267 |
| 354 | Ga0395900_0084466 | 3300037418 | Bacteria | 3262 |
| 355 | Ga0395905_0000240 | 3300037471 | Bacteria | 83076 |
| 356 | Ga0395905_0057254 | 3300037471 | Bacteria | 3646 |
| 357 | Ga0395905_0105782 | 3300037471 | Bacteria | 2642 |
| 358 | Ga0395905_0132923 | 3300037471 | Bacteria | 2340 |
| 359 | Ga0395905_0147579 | 3300037471 | Bacteria | 2213 |
| 360 | Ga0395905_0253586 | 3300037471 | Bacteria | 1643 |
| 361 | Ga0436364_0448854 | 3300037853 | Bacteria | 1765 |
| 362 | Ga0436364_1128088 | 3300037853 | Bacteria | 1630 |
| 363 | Ga0395901_0008600 | 3300038443 | Bacteria | 10318 |
| 364 | Ga0395901_0126475 | 3300038443 | Bacteria | 2686 |
| 365 | Ga0400486_32500 | 3300038742 | Bacteria | 12964 |
| 366 | Ga0400483_051191 | 3300039062 | Bacteria | 33178 |
| 367 | Ga0436365_0188102 | 3300039437 | Bacteria | 1808 |
| 368 | Ga0436365_1008718 | 3300039437 | Bacteria | 26666 |
| 369 | Ga0436365_1287200 | 3300039437 | Bacteria | 1639 |
| 370 | Ga0436360_0523611 | 3300039438 | Bacteria | 1085 |
| 371 | Ga0450911_000674 | 3300042115 | Bacteria | 10220 |
| 372 | Ga0450914_001479 | 3300042118 | Bacteria | 1484 |
| 373 | Ga0450917_000111 | 3300042120 | Bacteria | 5068 |
| 374 | Ga0450888_000489 | 3300042126 | Bacteria | 3748 |
| 375 | Ga0450892_000732 | 3300042130 | Bacteria | 3651 |
| 376 | Ga0450904_008366 | 3300042139 | Bacteria | 1022 |
| 377 | Ga0439459_0004349 | 3300042438 | Bacteria | 2278 |
| 378 | Ga0439464_0003570 | 3300042439 | Bacteria | 3935 |
| 379 | Ga0450893_0000735 | 3300042532 | Bacteria | 4786 |
| 380 | Ga0451577_0003441 | 3300042876 | Bacteria | 17626 |
| 381 | Ga0451577_0003691 | 3300042876 | Bacteria | 16761 |
| 382 | Ga0451577_0341112 | 3300042876 | Bacteria | 1359 |
| 383 | Ga0466965_0003446 | 3300044683 | Bacteria | 6937 |
| 384 | Ga0466965_0042398 | 3300044683 | Bacteria | 2245 |
| 385 | Ga0466964_0072282 | 3300044706 | Bacteria | 1461 |
| 386 | Ga0466964_0090233 | 3300044706 | Bacteria | 1332 |
| 387 | Ga0453684_0000136 | 3300044712 | Bacteria | 323402 |
| 388 | Ga0453684_0051158 | 3300044712 | Bacteria | 5421 |
| 389 | Ga0453684_0062516 | 3300044712 | Bacteria | 4768 |
| 390 | Ga0453684_0831041 | 3300044712 | Bacteria | 994 |
| 391 | Ga0466959_0063789 | 3300045049 | Bacteria | 2675 |
| 392 | Ga0451576_0000025 | 3300045051 | Bacteria | 427980 |
| 393 | Ga0495592_0000293 | 3300046454 | Bacteria | 42689 |
| 394 | Ga0495603_0008625 | 3300046455 | Bacteria | 6160 |
| 395 | Ga0495590_0024270 | 3300046457 | Bacteria | 2137 |
| 396 | Ga0495629_0087079 | 3300046459 | Bacteria | 2179 |
| 397 | Ga0495580_0031658 | 3300046472 | Bacteria | 3820 |
| 398 | Ga0495639_0003893 | 3300046475 | Bacteria | 6413 |
| 399 | Ga0495639_0025708 | 3300046475 | Bacteria | 2598 |
| 400 | Ga0495610_0015537 | 3300046512 | Bacteria | 4419 |
| 401 | Ga0495628_0011094 | 3300046516 | Bacteria | 7626 |
| 402 | Ga0495663_0001336 | 3300046525 | Bacteria | 7791 |
| 403 | Ga0495652_0014531 | 3300046529 | Bacteria | 7064 |
| 404 | Ga0495586_0070146 | 3300046535 | Bacteria | 1913 |
| 405 | Ga0495621_0067278 | 3300046539 | Bacteria | 1312 |
| 406 | Ga0495621_0074666 | 3300046539 | Bacteria | 1255 |
| 407 | Ga0495645_0003276 | 3300046543 | Bacteria | 10977 |
| 408 | Ga0495633_0001222 | 3300046558 | Bacteria | 20656 |
| 409 | Ga0495633_0006199 | 3300046558 | Bacteria | 7143 |
| 410 | Ga0495635_0201292 | 3300046663 | Bacteria | 1351 |
| 411 | Ga0495599_0000231 | 3300046678 | Bacteria | 35177 |
| 412 | Ga0495599_0006954 | 3300046678 | Bacteria | 6842 |
| 413 | Ga0495647_0001675 | 3300046681 | Bacteria | 6865 |
| 414 | Ga0495658_0012044 | 3300046683 | Bacteria | 4368 |
| 415 | Ga0495624_0132983 | 3300046690 | Bacteria | 1525 |
| 416 | Ga0495649_0062453 | 3300046694 | Bacteria | 2002 |
| 417 | Ga0495589_0056921 | 3300046794 | Bacteria | 1924 |
| 418 | Ga0495581_0077391 | 3300047315 | Bacteria | 1925 |
| 419 | Ga0495676_0119158 | 3300047321 | Bacteria | 1923 |
| 420 | Ga0495673_0000002 | 3300047469 | Bacteria | 1499170 |
| 421 | Ga0495686_0000871 | 3300047472 | Bacteria | 38467 |
| 422 | Ga0495686_0030557 | 3300047472 | Bacteria | 3498 |
| 423 | Ga0495686_0145205 | 3300047472 | Bacteria | 1397 |
| 424 | Ga0496101_0442662 | 3300048904 | Bacteria | 1025 |
| 425 | Ga0496101_0576035 | 3300048904 | Bacteria | 890 |
| 426 | Ga0496102_0005345 | 3300048905 | Bacteria | 10902 |
| 427 | Ga0496102_0018775 | 3300048905 | Bacteria | 6082 |
| 428 | Ga0496102_0095744 | 3300048905 | Bacteria | 2752 |
| 429 | Ga0496103_0122622 | 3300048906 | Bacteria | 1656 |
| 430 | Ga0496104_0005026 | 3300048907 | Bacteria | 11538 |
| 431 | Ga0496104_0569259 | 3300048907 | Bacteria | 1043 |
| 432 | Ga0496105_0000617 | 3300048908 | Bacteria | 23823 |
| 433 | Ga0496105_0181504 | 3300048908 | Bacteria | 1723 |
| 434 | Ga0496106_0331178 | 3300048909 | Bacteria | 1222 |
| 435 | Ga0496108_0090032 | 3300048911 | Bacteria | 2608 |
| 436 | Ga0496108_0193644 | 3300048911 | Bacteria | 1763 |
| 437 | Ga0496109_0032286 | 3300048912 | Bacteria | 4706 |
| 438 | Ga0496109_0091871 | 3300048912 | Bacteria | 2807 |
| 439 | Ga0496110_0258946 | 3300048913 | Bacteria | 1583 |
| 440 | Ga0496110_0435795 | 3300048913 | Bacteria | 1194 |
| 441 | Ga0496110_0470236 | 3300048913 | Bacteria | 1145 |
| 442 | Ga0496111_0031511 | 3300048914 | Bacteria | 3777 |
| 443 | Ga0496111_0081056 | 3300048914 | Bacteria | 2369 |
| 444 | Ga0496111_0283679 | 3300048914 | Bacteria | 1228 |
| 445 | Ga0496112_0161422 | 3300048915 | Bacteria | 2208 |
| 446 | Ga0496112_0204053 | 3300048915 | Bacteria | 1935 |
| 447 | Ga0496112_0466289 | 3300048915 | Bacteria | 1200 |
| 448 | Ga0496113_0068364 | 3300048916 | Bacteria | 2695 |
| 449 | Ga0496113_0364873 | 3300048916 | Bacteria | 1159 |
| 450 | Ga0496115_0024616 | 3300048918 | Bacteria | 4682 |
| 451 | Ga0496116_0000370 | 3300048919 | Bacteria | 67584 |
| 452 | Ga0496117_0000576 | 3300048920 | Bacteria | 60256 |
| 453 | Ga0496118_0000371 | 3300048921 | Bacteria | 75491 |
| 454 | Ga0496118_0017779 | 3300048921 | Bacteria | 6453 |
| 455 | Ga0496121_0004954 | 3300048924 | Bacteria | 17469 |
| 456 | Ga0496121_0024253 | 3300048924 | Bacteria | 5810 |
| 457 | Ga0496122_0061643 | 3300048925 | Bacteria | 2751 |
| 458 | Ga0496123_0180916 | 3300048926 | Bacteria | 1101 |
| 459 | Ga0496124_0081686 | 3300048927 | Bacteria | 2655 |
| 460 | Ga0495682_0000505 | 3300049460 | Bacteria | 27003 |
| 461 | Ga0501032_0000455 | 3300049569 | Bacteria | 32997 |
| 462 | Ga0501032_0167747 | 3300049569 | Bacteria | 1440 |
| 463 | Ga0501032_0410527 | 3300049569 | Bacteria | 869 |
| 464 | Ga0501033_0022775 | 3300049570 | Bacteria | 4723 |
| 465 | Ga0501034_0076986 | 3300049571 | Bacteria | 3342 |
| 466 | Ga0501036_0020101 | 3300049572 | Bacteria | 5606 |
| 467 | Ga0501036_0050044 | 3300049572 | Bacteria | 3539 |
| 468 | Ga0501037_0009754 | 3300049573 | Bacteria | 7050 |
| 469 | Ga0501037_0021919 | 3300049573 | Bacteria | 4729 |
| 470 | Ga0501038_0030061 | 3300049574 | Bacteria | 4810 |
| 471 | Ga0501038_0122249 | 3300049574 | Bacteria | 2145 |
| 472 | Ga0501039_0139837 | 3300049575 | Bacteria | 1902 |
| 473 | Ga0501039_0167430 | 3300049575 | Bacteria | 1728 |
| 474 | Ga0501040_0002457 | 3300049576 | Archaea | 11932 |
| 475 | Ga0501041_0000548 | 3300049577 | Bacteria | 19446 |
| 476 | Ga0501042_0151904 | 3300049578 | Bacteria | 1670 |
| 477 | Ga0501043_0009191 | 3300049579 | Bacteria | 7769 |
| 478 | Ga0501043_0117157 | 3300049579 | Bacteria | 2090 |
| 479 | Ga0501046_0008547 | 3300049580 | Bacteria | 8907 |
| 480 | Ga0501047_0084384 | 3300049581 | Bacteria | 3053 |
| 481 | Ga0501047_0120360 | 3300049581 | Bacteria | 2507 |
| 482 | Ga0501067_0000100 | 3300049583 | Bacteria | 49264 |
| 483 | Ga0501067_0038465 | 3300049583 | Bacteria | 2656 |
| 484 | Ga0501068_0082864 | 3300049584 | Bacteria | 1971 |
| 485 | Ga0501068_0315540 | 3300049584 | Bacteria | 1002 |
| 486 | Ga0501070_0367814 | 3300049586 | Bacteria | 1166 |
| 487 | Ga0501071_0026840 | 3300049587 | Bacteria | 4046 |
| 488 | Ga0501071_0162196 | 3300049587 | Bacteria | 1671 |
| 489 | Ga0501072_0130219 | 3300049588 | Bacteria | 2005 |
| 490 | Ga0501073_0022766 | 3300049589 | Bacteria | 4507 |
| 491 | Ga0501074_0014112 | 3300049590 | Bacteria | 5808 |
| 492 | Ga0501076_0000971 | 3300049592 | Bacteria | 18783 |
| 493 | Ga0501077_0026616 | 3300049593 | Bacteria | 3670 |
| 494 | Ga0501077_0125964 | 3300049593 | Bacteria | 1624 |
| 495 | Ga0501079_0000147 | 3300049741 | Bacteria | 38471 |
| 496 | Ga0501080_0003502 | 3300049742 | Bacteria | 13821 |
| 497 | Ga0501080_0020513 | 3300049742 | Bacteria | 6119 |
| 498 | Ga0501080_0050530 | 3300049742 | Bacteria | 3869 |
| 499 | Ga0501081_0018443 | 3300049743 | Bacteria | 4634 |
| 500 | Ga0501083_0315549 | 3300049744 | Bacteria | 1017 |
| 501 | Ga0501035_0166913 | 3300049822 | Bacteria | 1903 |
| 502 | Ga0501035_0198283 | 3300049822 | Bacteria | 1723 |
| 503 | Ga0501044_0013701 | 3300049823 | Bacteria | 8764 |
| 504 | Ga0501044_0186545 | 3300049823 | Bacteria | 2038 |
| 505 | Ga0501045_0018022 | 3300049824 | Bacteria | 5014 |
| 506 | Ga0501045_0118835 | 3300049824 | Bacteria | 1962 |
| 507 | nmdc:mga03683_288_c2 | 3300050489 | Bacteria | 14430 |
| 508 | nmdc:mga03683_321_c2 | 3300050489 | Bacteria | 8139 |
| 509 | nmdc:mga03n38_14834_c1 | 3300050490 | Bacteria | 2997 |
| 510 | nmdc:mga03n38_59030_c1 | 3300050490 | Bacteria | 1740 |
| 511 | nmdc:mga03n38_99601_c1 | 3300050490 | Bacteria | 1400 |
| 512 | nmdc:mga0k408_202673_c1 | 3300050493 | Bacteria | 1184 |
| 513 | nmdc:mga0k408_300415_c1 | 3300050493 | Bacteria | 958 |
| 514 | nmdc:mga0k408_98519_c1 | 3300050493 | Bacteria | 1723 |
| 515 | nmdc:mga06z11_22064_c1 | 3300050494 | Bacteria | 2967 |
| 516 | nmdc:mga04h51_21402_c1 | 3300050495 | Bacteria | 1945 |
| 517 | nmdc:mga07m45_204907_c1 | 3300050496 | Bacteria | 1147 |
| 518 | nmdc:mga05p37_285320_c1 | 3300050507 | Bacteria | 1967 |
| 519 | nmdc:mga05p37_679072_c1 | 3300050507 | Bacteria | 1148 |
| 520 | nmdc:mga06r32_457210_c1 | 3300050510 | Bacteria | 1256 |
| 521 | nmdc:mga08y16_470344_c1 | 3300050511 | Bacteria | 1280 |
| 522 | nmdc:mga0n895_148411_c1 | 3300050512 | Bacteria | 2374 |
| 523 | nmdc:mga0n895_196284_c1 | 3300050512 | Bacteria | 2049 |
| 524 | nmdc:mga0n895_60300_c1 | 3300050512 | Bacteria | 3744 |
| 525 | nmdc:mga0rr50_31415_c1 | 3300050513 | Bacteria | 3771 |
| 526 | nmdc:mga08x19_128439_c1 | 3300050514 | Bacteria | 1703 |
| 527 | nmdc:mga08x19_3651_c1 | 3300050514 | Bacteria | 7348 |
| 528 | nmdc:mga0sz30_3615_c1 | 3300050516 | Bacteria | 5578 |
| 529 | nmdc:mga0sz30_7748_c1 | 3300050516 | Bacteria | 3624 |
| 530 | Ga0495595_0110564 | 3300053084 | Bacteria | 1332 |
| 531 | Ga0495619_0022890 | 3300053085 | Bacteria | 4000 |
| 532 | Ga0495619_0032309 | 3300053085 | Bacteria | 3396 |
| 533 | Ga0500568_0012280 | 3300053139 | Bacteria | 3945 |
| 534 | Ga0500568_0043457 | 3300053139 | Bacteria | 1796 |
| 535 | Ga0500552_000157 | 3300053733 | Bacteria | 5908 |
| 536 | Ga0501084_0003530 | 3300054114 | Bacteria | 12696 |
| 537 | Ga0500661_005526 | 3300055283 | Bacteria | 2359 |
| 538 | Ga0587084_012452 | 3300059477 | Bacteria | 1152 |
| 539 | Ga0587077_029854 | 3300059493 | Bacteria | 1031 |
| 540 | Ga0587085_012040 | 3300059506 | Bacteria | 1179 |
| 541 | Ga0587069_002460 | 3300059642 | Bacteria | 1870 |
| 542 | Ga0501082_0028643 | 3300060353 | Bacteria | 4798 |
| 543 | Ga0501082_0198207 | 3300060353 | Bacteria | 1747 |
| 544 | Ga0501082_0327382 | 3300060353 | Bacteria | 1335 |
| 545 | Ga0501082_0607327 | 3300060353 | Bacteria | 957 |
| 546 | Ga0501082_0633150 | 3300060353 | Bacteria | 936 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0018775 | Ga0496102_0018775_4319_5101 | 213 |
| 2 | 3300048915 | Ga0496112_0161422 | Ga0496112_0161422_735_1517 | 213 |
| 3 | 3300048916 | Ga0496113_0364873 | Ga0496113_0364873_330_1112 | 213 |
| 4 | 3300031911 | Ga0307412_10093720 | Ga0307412_100937202 | 214 |
| 5 | 3300005347 | Ga0070668_100001538 | Ga0070668_10000153813 | 215 |
| 6 | 3300005356 | Ga0070674_100048218 | Ga0070674_1000482183 | 215 |
| 7 | 3300005459 | Ga0068867_100106014 | Ga0068867_1001060143 | 215 |
| 8 | 3300009094 | Ga0111539_10522854 | Ga0111539_105228542 | 215 |
| 9 | 3300014326 | Ga0157380_10090380 | Ga0157380_100903803 | 215 |
| 10 | 3300025923 | Ga0207681_10159531 | Ga0207681_101595311 | 215 |
| 11 | 3300025937 | Ga0207669_10271296 | Ga0207669_102712962 | 215 |
| 12 | 3300025940 | Ga0207691_10057154 | Ga0207691_100571543 | 215 |
| 13 | 3300025972 | Ga0207668_10003142 | Ga0207668_100031429 | 215 |
| 14 | 3300026089 | Ga0207648_10174590 | Ga0207648_101745901 | 215 |
| 15 | 3300028380 | Ga0268265_10119814 | Ga0268265_101198143 | 215 |
| 16 | 3300050511 | nmdc:mga08y16_470344_c1 | nmdc:mga08y16_470344_c1_435_1217 | 215 |
| 17 | 3300005549 | Ga0070704_100076128 | Ga0070704_1000761282 | 216 |
| 18 | 3300049576 | Ga0501040_0002457 | Ga0501040_0002457_5546_6325 | 217 |
| 19 | 3300006038 | Ga0075365_10106496 | Ga0075365_101064962 | 218 |
| 20 | 3300006880 | Ga0075429_100079383 | Ga0075429_1000793832 | 218 |
| 21 | 3300050507 | nmdc:mga05p37_679072_c1 | nmdc:mga05p37_679072_c1_141_947 | 218 |
| 22 | 3300050510 | nmdc:mga06r32_457210_c1 | nmdc:mga06r32_457210_c1_38_844 | 218 |
| 23 | 3300042438 | Ga0439459_0004349 | Ga0439459_0004349_82_849 | 222 |
| 24 | iso_pu_bacteria | 2921296804 | 2921303909 | 222 |
| 25 | 3300042118 | Ga0450914_001479 | Ga0450914_001479_633_1403 | 223 |
| 26 | 3300042120 | Ga0450917_000111 | Ga0450917_000111_4048_4818 | 223 |
| 27 | 3300042126 | Ga0450888_000489 | Ga0450888_000489_2588_3358 | 223 |
| 28 | 3300042130 | Ga0450892_000732 | Ga0450892_000732_2589_3359 | 223 |
| 29 | 3300042532 | Ga0450893_0000735 | Ga0450893_0000735_1639_2409 | 223 |
| 30 | 3300032004 | Ga0307414_10015522 | Ga0307414_100155223 | 224 |
| 31 | 3300032005 | Ga0307411_10000177 | Ga0307411_1000017719 | 224 |
| 32 | 3300009174 | Ga0105241_10424753 | Ga0105241_104247532 | 226 |
| 33 | 3300025910 | Ga0207684_10606527 | Ga0207684_106065272 | 226 |
| 34 | iso_pu_bacteria | 2508501050 | 2508727647 | 226 |
| 35 | 3300037471 | Ga0395905_0105782 | Ga0395905_0105782_20_790 | 227 |
| 36 | 3300053139 | Ga0500568_0012280 | Ga0500568_0012280_1812_2594 | 227 |
| 37 | 3300031995 | Ga0307409_100018422 | Ga0307409_1000184223 | 229 |
| 38 | 3300055283 | Ga0500661_005526 | Ga0500661_005526_1048_1830 | 229 |
| 39 | 3300049584 | Ga0501068_0315540 | Ga0501068_0315540_151_924 | 230 |
| 40 | iso_pu_bacteria | 2904479285 | 2904480721 | 230 |
| 41 | iso_pu_bacteria | 2919704043 | 2919704705 | 230 |
| 42 | iso_pu_bacteria | 2511231008 | 2511275974 | 231 |
| 43 | iso_pu_bacteria | 2919456309 | 2919460541 | 231 |
| 44 | 3300005841 | Ga0068863_100019035 | Ga0068863_1000190352 | 232 |
| 45 | 3300006237 | Ga0097621_100134741 | Ga0097621_1001347412 | 232 |
| 46 | 3300009551 | Ga0105238_10009692 | Ga0105238_100096926 | 232 |
| 47 | 3300014969 | Ga0157376_10053276 | Ga0157376_100532762 | 232 |
| 48 | 3300025924 | Ga0207694_10007643 | Ga0207694_100076436 | 232 |
| 49 | 3300026088 | Ga0207641_10257139 | Ga0207641_102571392 | 232 |
| 50 | iso_pu_bacteria | 2510065057 | 2510302744 | 232 |
| 51 | iso_pu_bacteria | 2511231052 | 2511497800 | 232 |
| 52 | iso_pu_bacteria | 2512047086 | 2512528809 | 232 |
| 53 | iso_pu_bacteria | 2513237086 | 2513584545 | 232 |
| 54 | iso_pu_bacteria | 2513237091 | 2513616441 | 232 |
| 55 | iso_pu_bacteria | 2513237140 | 2513885301 | 232 |
| 56 | iso_pu_bacteria | 2513237143 | 2513901990 | 232 |
| 57 | iso_pu_bacteria | 2516653046 | 2516896553 | 232 |
| 58 | iso_pu_bacteria | 2537561587 | 2537877184 | 232 |
| 59 | iso_pu_bacteria | 2551306084 | 2551681407 | 232 |
| 60 | iso_pu_bacteria | 2551306085 | 2551686228 | 232 |
| 61 | iso_pu_bacteria | 2551306086 | 2551693977 | 232 |
| 62 | iso_pu_bacteria | 2551306087 | 2551704173 | 232 |
| 63 | iso_pu_bacteria | 2551306089 | 2551709568 | 232 |
| 64 | iso_pu_bacteria | 2551306090 | 2551715841 | 232 |
| 65 | iso_pu_bacteria | 2551306091 | 2551725061 | 232 |
| 66 | iso_pu_bacteria | 2551306092 | 2551735627 | 232 |
| 67 | iso_pu_bacteria | 2551306093 | 2551745806 | 232 |
| 68 | iso_pu_bacteria | 2599185305 | 2599958604 | 232 |
| 69 | iso_pu_bacteria | 2818991439 | 2819559259 | 232 |
| 70 | iso_pu_bacteria | 2841859092 | 2841862331 | 232 |
| 71 | iso_pu_bacteria | 2842515876 | 2842519115 | 232 |
| 72 | iso_pu_bacteria | 2855825444 | 2855828619 | 232 |
| 73 | iso_pu_bacteria | 2855839649 | 2855843740 | 232 |
| 74 | iso_pu_bacteria | 2858800743 | 2858807015 | 232 |
| 75 | iso_pu_bacteria | 2915986958 | 2915988495 | 232 |
| 76 | iso_pu_bacteria | 2915993759 | 2915994228 | 232 |
| 77 | iso_pu_bacteria | 2916000859 | 2916006243 | 232 |
| 78 | iso_pu_bacteria | 2916007675 | 2916011325 | 232 |
| 79 | iso_pu_bacteria | 2916014648 | 2916021532 | 232 |
| 80 | iso_pu_bacteria | 2916021584 | 2916028146 | 232 |
| 81 | iso_pu_bacteria | 2916028427 | 2916035062 | 232 |
| 82 | iso_pu_bacteria | 2916035215 | 2916038250 | 232 |
| 83 | iso_pu_bacteria | 2916041962 | 2916044978 | 232 |
| 84 | iso_pu_bacteria | 2916048683 | 2916054532 | 232 |
| 85 | iso_pu_bacteria | 2916055098 | 2916061163 | 232 |
| 86 | iso_pu_bacteria | 2916068649 | 2916070762 | 232 |
| 87 | iso_pu_bacteria | 2916076590 | 2916082947 | 232 |
| 88 | iso_pu_bacteria | 2921201388 | 2921203206 | 232 |
| 89 | iso_pu_bacteria | 2921208531 | 2921210118 | 232 |
| 90 | iso_pu_bacteria | 2921237296 | 2921240575 | 232 |
| 91 | iso_pu_bacteria | 2921244191 | 2921245778 | 232 |
| 92 | iso_pu_bacteria | 2921257292 | 2921260090 | 232 |
| 93 | iso_pu_bacteria | 2921263974 | 2921269982 | 232 |
| 94 | iso_pu_bacteria | 2921282425 | 2921283080 | 232 |
| 95 | iso_pu_bacteria | 2921289301 | 2921296784 | 232 |
| 96 | iso_pu_bacteria | 2924144063 | 2924148512 | 232 |
| 97 | iso_pu_bacteria | 2924150972 | 2924154717 | 232 |
| 98 | iso_pu_bacteria | 2924158325 | 2924164377 | 232 |
| 99 | iso_pu_bacteria | 2924165586 | 2924168394 | 232 |
| 100 | iso_pu_bacteria | 2924172951 | 2924178757 | 232 |
| 101 | iso_pu_bacteria | 2924179722 | 2924182081 | 232 |
| 102 | iso_pu_bacteria | 2924186466 | 2924188956 | 232 |
| 103 | iso_pu_bacteria | 2924193448 | 2924195807 | 232 |
| 104 | iso_pu_bacteria | 2924200457 | 2924202922 | 232 |
| 105 | iso_pu_bacteria | 2924207177 | 2924209956 | 232 |
| 106 | iso_pu_bacteria | 2924214083 | 2924217335 | 232 |
| 107 | iso_pu_bacteria | 2924221636 | 2924228297 | 232 |
| 108 | iso_pu_bacteria | 2924228884 | 2924235360 | 232 |
| 109 | iso_pu_bacteria | 2933011516 | 2933014712 | 232 |
| 110 | iso_pu_bacteria | 2937002841 | 2937005835 | 232 |
| 111 | iso_pu_bacteria | 2937009748 | 2937014328 | 232 |
| 112 | iso_pu_bacteria | 2937016420 | 2937021931 | 232 |
| 113 | iso_pu_bacteria | 2937023124 | 2937023987 | 232 |
| 114 | iso_pu_bacteria | 2937042894 | 2937049000 | 232 |
| 115 | iso_pu_bacteria | 2937049772 | 2937056418 | 232 |
| 116 | iso_pu_bacteria | 2937056579 | 2937056884 | 232 |
| 117 | iso_pu_bacteria | 2937063883 | 2937066055 | 232 |
| 118 | iso_pu_bacteria | 2937071275 | 2937075370 | 232 |
| 119 | iso_pu_bacteria | 2937091812 | 2937092613 | 232 |
| 120 | iso_pu_bacteria | 2937098957 | 2937100480 | 232 |
| 121 | iso_pu_bacteria | 2937106411 | 2937110495 | 232 |
| 122 | iso_pu_bacteria | 2937113482 | 2937118808 | 232 |
| 123 | iso_pu_bacteria | 2937119839 | 2937125847 | 232 |
| 124 | iso_pu_bacteria | 2937126314 | 2937131026 | 232 |
| 125 | iso_pu_bacteria | 2957382221 | 2957383033 | 232 |
| 126 | iso_pu_bacteria | 2957388812 | 2957391991 | 232 |
| 127 | iso_pu_bacteria | 2957395598 | 2957396234 | 232 |
| 128 | iso_pu_bacteria | 2957402308 | 2957402915 | 232 |
| 129 | iso_pu_bacteria | 2957408893 | 2957410687 | 232 |
| 130 | iso_pu_bacteria | 2957415311 | 2957416027 | 232 |
| 131 | iso_pu_bacteria | 2957422303 | 2957423392 | 232 |
| 132 | iso_pu_bacteria | 2957430029 | 2957430506 | 232 |
| 133 | iso_pu_bacteria | 2957443900 | 2957445240 | 232 |
| 134 | iso_pu_bacteria | 2957450854 | 2957454928 | 232 |
| 135 | iso_pu_bacteria | 2957457609 | 2957461778 | 232 |
| 136 | iso_pu_bacteria | 2957464669 | 2957464809 | 232 |
| 137 | iso_pu_bacteria | 2957471148 | 2957477905 | 232 |
| 138 | iso_pu_bacteria | 2957478035 | 2957484344 | 232 |
| 139 | iso_pu_bacteria | 2957484790 | 2957489988 | 232 |
| 140 | iso_pu_bacteria | 2957491536 | 2957491673 | 232 |
| 141 | iso_pu_bacteria | 2957498199 | 2957501662 | 232 |
| 142 | iso_pu_bacteria | 2957505466 | 2957510284 | 232 |
| 143 | iso_pu_bacteria | 2960584000 | 2960585044 | 232 |
| 144 | iso_pu_bacteria | 2960597568 | 2960598487 | 232 |
| 145 | iso_pu_bacteria | 2960603979 | 2960604553 | 232 |
| 146 | iso_pu_bacteria | 2960610863 | 2960614268 | 232 |
| 147 | iso_pu_bacteria | 2960617483 | 2960621867 | 232 |
| 148 | iso_pu_bacteria | 2960624210 | 2960630381 | 232 |
| 149 | iso_pu_bacteria | 2960637947 | 2960642832 | 232 |
| 150 | iso_pu_bacteria | 2960645483 | 2960645623 | 232 |
| 151 | iso_pu_bacteria | 2960652885 | 2960660095 | 232 |
| 152 | iso_pu_bacteria | 2960660292 | 2960661969 | 232 |
| 153 | iso_pu_bacteria | 2960667422 | 2960669791 | 232 |
| 154 | iso_pu_bacteria | 2960674078 | 2960677794 | 232 |
| 155 | iso_pu_bacteria | 2960687367 | 2960692964 | 232 |
| 156 | iso_pu_bacteria | 2964607997 | 2964610744 | 232 |
| 157 | iso_pu_bacteria | 2964615318 | 2964621673 | 232 |
| 158 | iso_pu_bacteria | 2964621998 | 2964624224 | 232 |
| 159 | iso_pu_bacteria | 2964628898 | 2964629908 | 232 |
| 160 | iso_pu_bacteria | 2964636051 | 2964639507 | 232 |
| 161 | iso_pu_bacteria | 2964643177 | 2964647942 | 232 |
| 162 | iso_pu_bacteria | 2964649959 | 2964655550 | 232 |
| 163 | iso_pu_bacteria | 2964656573 | 2964657987 | 232 |
| 164 | iso_pu_bacteria | 2964663802 | 2964664650 | 232 |
| 165 | iso_pu_bacteria | 2964670856 | 2964674150 | 232 |
| 166 | iso_pu_bacteria | 2964678106 | 2964678417 | 232 |
| 167 | iso_pu_bacteria | 2964685014 | 2964689260 | 232 |
| 168 | iso_pu_bacteria | 2964691889 | 2964696074 | 232 |
| 169 | iso_pu_bacteria | 2964698721 | 2964704962 | 232 |
| 170 | iso_pu_bacteria | 2964705432 | 2964709609 | 232 |
| 171 | iso_pu_bacteria | 2964712639 | 2964717591 | 232 |
| 172 | iso_pu_bacteria | 2964719344 | 2964720985 | 232 |
| 173 | iso_pu_bacteria | 2967664464 | 2967665640 | 232 |
| 174 | iso_pu_bacteria | 2967671571 | 2967677104 | 232 |
| 175 | iso_pu_bacteria | 2967678726 | 2967685673 | 232 |
| 176 | iso_pu_bacteria | 2967693043 | 2967697848 | 232 |
| 177 | iso_pu_bacteria | 2967699805 | 2967704421 | 232 |
| 178 | iso_pu_bacteria | 2967706974 | 2967714128 | 232 |
| 179 | iso_pu_bacteria | 2967714385 | 2967720925 | 232 |
| 180 | iso_pu_bacteria | 2967721400 | 2967725158 | 232 |
| 181 | iso_pu_bacteria | 2967735183 | 2967741859 | 232 |
| 182 | iso_pu_bacteria | 2967742019 | 2967748911 | 232 |
| 183 | iso_pu_bacteria | 2967748971 | 2967750877 | 232 |
| 184 | iso_pu_bacteria | 2967755722 | 2967761706 | 232 |
| 185 | iso_pu_bacteria | 2967762386 | 2967765991 | 232 |
| 186 | iso_pu_bacteria | 2967769361 | 2967772258 | 232 |
| 187 | iso_pu_bacteria | 2967775926 | 2967781978 | 232 |
| 188 | iso_pu_bacteria | 2970019648 | 2970023577 | 232 |
| 189 | iso_pu_bacteria | 2970033650 | 2970038279 | 232 |
| 190 | iso_pu_bacteria | 2970040964 | 2970042164 | 232 |
| 191 | iso_pu_bacteria | 2970047711 | 2970054843 | 232 |
| 192 | iso_pu_bacteria | 2970054988 | 2970061224 | 232 |
| 193 | iso_pu_bacteria | 2970061556 | 2970062938 | 232 |
| 194 | iso_pu_bacteria | 2970068827 | 2970071326 | 232 |
| 195 | iso_pu_bacteria | 2970076120 | 2970080292 | 232 |
| 196 | iso_pu_bacteria | 2970082768 | 2970085732 | 232 |
| 197 | iso_pu_bacteria | 2970088815 | 2970094722 | 232 |
| 198 | iso_pu_bacteria | 2970095765 | 2970097324 | 232 |
| 199 | iso_pu_bacteria | 2970102677 | 2970105865 | 232 |
| 200 | iso_pu_bacteria | 2970109326 | 2970116110 | 232 |
| 201 | iso_pu_bacteria | 2970116247 | 2970119639 | 232 |
| 202 | iso_pu_bacteria | 2970129317 | 2970134906 | 232 |
| 203 | iso_pu_bacteria | 2970136068 | 2970140927 | 232 |
| 204 | iso_pu_bacteria | 2970149975 | 2970153160 | 232 |
| 205 | iso_pu_bacteria | 2970156795 | 2970162978 | 232 |
| 206 | iso_pu_bacteria | 2970164137 | 2970164672 | 232 |
| 207 | iso_pu_bacteria | 2970170962 | 2970174338 | 232 |
| 208 | iso_pu_bacteria | 2970177841 | 2970182386 | 232 |
| 209 | iso_pu_bacteria | 2970184632 | 2970191258 | 232 |
| 210 | iso_pu_bacteria | 2970191845 | 2970194702 | 232 |
| 211 | iso_pu_bacteria | 2977516862 | 2977518771 | 232 |
| 212 | iso_pu_bacteria | 2977523885 | 2977526652 | 232 |
| 213 | iso_pu_bacteria | 2977537788 | 2977541295 | 232 |
| 214 | iso_pu_bacteria | 2977551784 | 2977557901 | 232 |
| 215 | iso_pu_bacteria | 2977558990 | 2977559543 | 232 |
| 216 | iso_pu_bacteria | 2977565890 | 2977569187 | 232 |
| 217 | iso_pu_bacteria | 2977572785 | 2977578697 | 232 |
| 218 | iso_pu_bacteria | 2977579622 | 2977585642 | 232 |
| 219 | iso_pu_bacteria | 2979100975 | 2979104114 | 232 |
| 220 | iso_pu_bacteria | 2984509177 | 2984511316 | 232 |
| 221 | iso_pu_bacteria | 2984518228 | 2984522323 | 232 |
| 222 | iso_pu_bacteria | 2984537506 | 2984541625 | 232 |
| 223 | iso_pu_bacteria | 2984601300 | 2984603898 | 232 |
| 224 | iso_pu_bacteria | 648276728 | 648740953 | 232 |
| 225 | iso_pu_bacteria | 8003992118 | 8003996300 | 232 |
| 226 | 3300046539 | Ga0495621_0074666 | Ga0495621_0074666_58_825 | 233 |
| 227 | 3300050490 | nmdc:mga03n38_14834_c1 | nmdc:mga03n38_14834_c1_1699_2469 | 233 |
| 228 | 3300002773 | JGI25152J39213_1003305 | JGI25152J39213_10033054 | 234 |
| 229 | 3300002774 | JGI25150J39212_1001863 | JGI25150J39212_10018634 | 234 |
| 230 | 3300002987 | JGI25159J45721_1003478 | JGI25159J45721_10034783 | 234 |
| 231 | 3300002987 | JGI25159J45721_1005737 | JGI25159J45721_10057374 | 234 |
| 232 | 3300003187 | JGI25151J46595_10009456 | JGI25151J46595_100094562 | 234 |
| 233 | 3300003215 | JGI25153J46596_10009233 | JGI25153J46596_100092332 | 234 |
| 234 | 3300003354 | JGI25160J50197_1006724 | JGI25160J50197_10067242 | 234 |
| 235 | 3300003374 | JGI25161J50226_1002548 | JGI25161J50226_10025482 | 234 |
| 236 | 3300003771 | Ga0055526_1009636 | Ga0055526_10096362 | 234 |
| 237 | 3300003773 | Ga0055537_1003708 | Ga0055537_10037082 | 234 |
| 238 | 3300003775 | Ga0055524_1007517 | Ga0055524_10075172 | 234 |
| 239 | 3300003784 | Ga0055534_1003816 | Ga0055534_10038163 | 234 |
| 240 | 3300003790 | Ga0055528_1007964 | Ga0055528_10079642 | 234 |
| 241 | 3300003794 | Ga0055531_10010117 | Ga0055531_100101174 | 234 |
| 242 | 3300004625 | Ga0055543_1001596 | Ga0055543_10015964 | 234 |
| 243 | 3300005262 | Ga0065165_1006794 | Ga0065165_10067944 | 234 |
| 244 | 3300013104 | Ga0157370_10092714 | Ga0157370_100927143 | 234 |
| 245 | 3300015683 | Ga0183362_10001 | Ga0183362_100011438 | 234 |
| 246 | 3300025208 | Ga0209436_114655 | Ga0209436_1146552 | 234 |
| 247 | 3300025245 | Ga0207425_1001080 | Ga0207425_10010808 | 234 |
| 248 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023139 | 234 |
| 249 | 3300025263 | Ga0209565_1000125 | Ga0209565_100012565 | 234 |
| 250 | 3300025273 | Ga0209673_1002969 | Ga0209673_10029698 | 234 |
| 251 | 3300025284 | Ga0209130_1000069 | Ga0209130_1000069142 | 234 |
| 252 | 3300025291 | Ga0209675_1000427 | Ga0209675_100042726 | 234 |
| 253 | 3300025294 | Ga0209025_1000316 | Ga0209025_100031682 | 234 |
| 254 | 3300025295 | Ga0209564_1000270 | Ga0209564_100027033 | 234 |
| 255 | 3300025297 | Ga0209758_1000064 | Ga0209758_100006440 | 234 |
| 256 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020411 | 234 |
| 257 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011046 | 234 |
| 258 | 3300025303 | Ga0209051_1022726 | Ga0209051_10227263 | 234 |
| 259 | 3300025304 | Ga0209257_1002269 | Ga0209257_100226917 | 234 |
| 260 | 3300025913 | Ga0207695_10453034 | Ga0207695_104530342 | 234 |
| 261 | 3300037471 | Ga0395905_0132923 | Ga0395905_0132923_984_1754 | 234 |
| 262 | 3300037471 | Ga0395905_0147579 | Ga0395905_0147579_850_1620 | 234 |
| 263 | 3300042139 | Ga0450904_008366 | Ga0450904_008366_211_981 | 234 |
| 264 | 3300042439 | Ga0439464_0003570 | Ga0439464_0003570_748_1518 | 234 |
| 265 | 3300042876 | Ga0451577_0003441 | Ga0451577_0003441_11090_11860 | 234 |
| 266 | 3300044683 | Ga0466965_0042398 | Ga0466965_0042398_907_1677 | 234 |
| 267 | 3300044712 | Ga0453684_0062516 | Ga0453684_0062516_3736_4506 | 234 |
| 268 | iso_pu_bacteria | 2513237305 | 2514421685 | 234 |
| 269 | iso_pu_bacteria | 2547132374 | 2548498417 | 234 |
| 270 | iso_pu_bacteria | 2597489875 | 2597811238 | 234 |
| 271 | iso_pu_bacteria | 2599185301 | 2599940685 | 234 |
| 272 | iso_pu_bacteria | 2643221570 | 2643867016 | 234 |
| 273 | iso_pu_bacteria | 2643221609 | 2644062973 | 234 |
| 274 | iso_pu_bacteria | 2643221611 | 2644070913 | 234 |
| 275 | iso_pu_bacteria | 2643221627 | 2644157841 | 234 |
| 276 | iso_pu_bacteria | 2643221652 | 2644294882 | 234 |
| 277 | iso_pu_bacteria | 2643221660 | 2644339954 | 234 |
| 278 | iso_pu_bacteria | 2643221717 | 2644646376 | 234 |
| 279 | iso_pu_bacteria | 2721755686 | 2723578153 | 234 |
| 280 | iso_pu_bacteria | 2747842428 | 2747948277 | 234 |
| 281 | iso_pu_bacteria | 2775506901 | 2776261001 | 234 |
| 282 | iso_pu_bacteria | 2791355123 | 2792745440 | 234 |
| 283 | iso_pu_bacteria | 2821443989 | 2821446739 | 234 |
| 284 | iso_pu_bacteria | 2821443989 | 2821450104 | 234 |
| 285 | iso_pu_bacteria | 2842391507 | 2842393225 | 234 |
| 286 | iso_pu_bacteria | 2842718218 | 2842721074 | 234 |
| 287 | iso_pu_bacteria | 2844533157 | 2844534708 | 234 |
| 288 | iso_pu_bacteria | 2844533157 | 2844536670 | 234 |
| 289 | iso_pu_bacteria | 2856349417 | 2856355238 | 234 |
| 290 | iso_pu_bacteria | 2871488783 | 2871489506 | 234 |
| 291 | iso_pu_bacteria | 2871495908 | 2871496325 | 234 |
| 292 | iso_pu_bacteria | 2874220319 | 2874221423 | 234 |
| 293 | iso_pu_bacteria | 2878753008 | 2878754089 | 234 |
| 294 | iso_pu_bacteria | 2878760144 | 2878760554 | 234 |
| 295 | iso_pu_bacteria | 2878767105 | 2878767517 | 234 |
| 296 | iso_pu_bacteria | 2881147464 | 2881150967 | 234 |
| 297 | iso_pu_bacteria | 2881155292 | 2881158519 | 234 |
| 298 | iso_pu_bacteria | 2881161766 | 2881166668 | 234 |
| 299 | iso_pu_bacteria | 2881845957 | 2881851316 | 234 |
| 300 | iso_pu_bacteria | 2881853255 | 2881855397 | 234 |
| 301 | iso_pu_bacteria | 2881861095 | 2881864139 | 234 |
| 302 | iso_pu_bacteria | 2882912400 | 2882917656 | 234 |
| 303 | iso_pu_bacteria | 2885305155 | 2885308754 | 234 |
| 304 | iso_pu_bacteria | 2885318864 | 2885324413 | 234 |
| 305 | iso_pu_bacteria | 2885326080 | 2885326450 | 234 |
| 306 | iso_pu_bacteria | 2885334103 | 2885334804 | 234 |
| 307 | iso_pu_bacteria | 2885342637 | 2885347553 | 234 |
| 308 | iso_pu_bacteria | 2885350715 | 2885356752 | 234 |
| 309 | iso_pu_bacteria | 2893066018 | 2893067954 | 234 |
| 310 | iso_pu_bacteria | 2894023352 | 2894026586 | 234 |
| 311 | iso_pu_bacteria | 2903492973 | 2903494608 | 234 |
| 312 | iso_pu_bacteria | 2903540706 | 2903541119 | 234 |
| 313 | iso_pu_bacteria | 2919089067 | 2919091916 | 234 |
| 314 | iso_pu_bacteria | 2924784321 | 2924788829 | 234 |
| 315 | iso_pu_bacteria | 2931380184 | 2931380950 | 234 |
| 316 | iso_pu_bacteria | 2937994558 | 2937994972 | 234 |
| 317 | iso_pu_bacteria | 2958165035 | 2958165452 | 234 |
| 318 | iso_pu_bacteria | 2961127735 | 2961136229 | 234 |
| 319 | iso_pu_bacteria | 2961163497 | 2961163910 | 234 |
| 320 | iso_pu_bacteria | 2961170736 | 2961171721 | 234 |
| 321 | iso_pu_bacteria | 2965018300 | 2965018715 | 234 |
| 322 | iso_pu_bacteria | 2967996073 | 2967996574 | 234 |
| 323 | iso_pu_bacteria | 2968003550 | 2968010215 | 234 |
| 324 | iso_pu_bacteria | 2968171901 | 2968172316 | 234 |
| 325 | iso_pu_bacteria | 2970503327 | 2970504317 | 234 |
| 326 | iso_pu_bacteria | 2970554993 | 2970555406 | 234 |
| 327 | iso_pu_bacteria | 2974320154 | 2974323984 | 234 |
| 328 | iso_pu_bacteria | 2977821940 | 2977823304 | 234 |
| 329 | iso_pu_bacteria | 2977828996 | 2977831940 | 234 |
| 330 | iso_pu_bacteria | 2979808191 | 2979808954 | 234 |
| 331 | iso_pu_bacteria | 2987659509 | 2987659922 | 234 |
| 332 | iso_pu_bacteria | 2990710928 | 2990713008 | 234 |
| 333 | iso_pu_bacteria | 3000135777 | 3000140849 | 234 |
| 334 | iso_pu_bacteria | 3004188549 | 3004188969 | 234 |
| 335 | iso_pu_bacteria | 8004374579 | 8004375665 | 234 |
| 336 | 3300005539 | Ga0068853_100059078 | Ga0068853_1000590783 | 235 |
| 337 | 3300005616 | Ga0068852_100001922 | Ga0068852_1000019226 | 235 |
| 338 | 3300005616 | Ga0068852_100067802 | Ga0068852_1000678022 | 235 |
| 339 | 3300009545 | Ga0105237_10297551 | Ga0105237_102975512 | 235 |
| 340 | 3300009551 | Ga0105238_10000677 | Ga0105238_1000067721 | 235 |
| 341 | 3300010375 | Ga0105239_10001550 | Ga0105239_1000155019 | 235 |
| 342 | 3300013105 | Ga0157369_10006059 | Ga0157369_1000605915 | 235 |
| 343 | 3300025913 | Ga0207695_10435464 | Ga0207695_104354642 | 235 |
| 344 | 3300025914 | Ga0207671_10081624 | Ga0207671_100816242 | 235 |
| 345 | 3300025924 | Ga0207694_10000014 | Ga0207694_10000014309 | 235 |
| 346 | 3300026041 | Ga0207639_10062145 | Ga0207639_100621453 | 235 |
| 347 | 3300026142 | Ga0207698_10003027 | Ga0207698_100030277 | 235 |
| 348 | 3300026142 | Ga0207698_10058457 | Ga0207698_100584572 | 235 |
| 349 | 3300049581 | Ga0501047_0084384 | Ga0501047_0084384_626_1444 | 235 |
| 350 | iso_pu_bacteria | 2597490356 | 2599105891 | 235 |
| 351 | iso_pu_bacteria | 2775506901 | 2776258379 | 235 |
| 352 | iso_pu_bacteria | 2846952575 | 2846955676 | 235 |
| 353 | iso_pu_bacteria | 2848858292 | 2848862339 | 235 |
| 354 | 3300001989 | JGI24739J22299_10021846 | JGI24739J22299_100218462 | 236 |
| 355 | 3300003856 | Ga0058692_1000031 | Ga0058692_100003118 | 236 |
| 356 | 3300005344 | Ga0070661_100009092 | Ga0070661_1000090926 | 236 |
| 357 | 3300005563 | Ga0068855_100000006 | Ga0068855_100000006241 | 236 |
| 358 | 3300006946 | Ga0079104_1014959 | Ga0079104_10149591 | 236 |
| 359 | 3300009036 | Ga0105244_10079869 | Ga0105244_100798692 | 236 |
| 360 | 3300009093 | Ga0105240_10000080 | Ga0105240_1000008057 | 236 |
| 361 | 3300009094 | Ga0111539_10220614 | Ga0111539_102206142 | 236 |
| 362 | 3300014968 | Ga0157379_10079007 | Ga0157379_100790073 | 236 |
| 363 | 3300025913 | Ga0207695_10000004 | Ga0207695_10000004637 | 236 |
| 364 | 3300025918 | Ga0207662_10329665 | Ga0207662_103296651 | 236 |
| 365 | 3300025920 | Ga0207649_10016306 | Ga0207649_100163062 | 236 |
| 366 | 3300025949 | Ga0207667_10000202 | Ga0207667_1000020238 | 236 |
| 367 | 3300027111 | Ga0209281_1000190 | Ga0209281_1000190106 | 236 |
| 368 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004160 | 236 |
| 369 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005885 | 236 |
| 370 | 3300035118 | Ga0373954_0003556 | Ga0373954_0003556_4424_5206 | 236 |
| 371 | 3300046454 | Ga0495592_0000293 | Ga0495592_0000293_38679_39461 | 236 |
| 372 | 3300046516 | Ga0495628_0011094 | Ga0495628_0011094_3004_3786 | 236 |
| 373 | 3300046529 | Ga0495652_0014531 | Ga0495652_0014531_3182_3964 | 236 |
| 374 | 3300046543 | Ga0495645_0003276 | Ga0495645_0003276_9949_10731 | 236 |
| 375 | 3300046678 | Ga0495599_0000231 | Ga0495599_0000231_19132_19914 | 236 |
| 376 | 3300046678 | Ga0495599_0006954 | Ga0495599_0006954_2212_2994 | 236 |
| 377 | 3300046794 | Ga0495589_0056921 | Ga0495589_0056921_646_1461 | 236 |
| 378 | 3300047469 | Ga0495673_0000002 | Ga0495673_0000002_272641_273423 | 236 |
| 379 | 3300047472 | Ga0495686_0145205 | Ga0495686_0145205_114_890 | 236 |
| 380 | 3300048913 | Ga0496110_0470236 | Ga0496110_0470236_123_953 | 236 |
| 381 | 3300048914 | Ga0496111_0283679 | Ga0496111_0283679_224_1051 | 236 |
| 382 | 3300049460 | Ga0495682_0000505 | Ga0495682_0000505_1255_2076 | 236 |
| 383 | 3300049588 | Ga0501072_0130219 | Ga0501072_0130219_94_870 | 236 |
| 384 | 3300049593 | Ga0501077_0125964 | Ga0501077_0125964_820_1599 | 236 |
| 385 | 3300049744 | Ga0501083_0315549 | Ga0501083_0315549_73_849 | 236 |
| 386 | 3300050516 | nmdc:mga0sz30_7748_c1 | nmdc:mga0sz30_7748_c1_193_975 | 236 |
| 387 | 3300006178 | Ga0075367_10152724 | Ga0075367_101527241 | 237 |
| 388 | 3300025298 | Ga0209050_1002684 | Ga0209050_100268413 | 237 |
| 389 | 3300031665 | Ga0316575_10083463 | Ga0316575_100834632 | 237 |
| 390 | 3300038742 | Ga0400486_32500 | Ga0400486_32500_2054_2833 | 237 |
| 391 | 3300039062 | Ga0400483_051191 | Ga0400483_051191_31135_31914 | 237 |
| 392 | 3300039438 | Ga0436360_0523611 | Ga0436360_0523611_259_1038 | 237 |
| 393 | 3300046525 | Ga0495663_0001336 | Ga0495663_0001336_4999_5781 | 237 |
| 394 | 3300046558 | Ga0495633_0006199 | Ga0495633_0006199_4280_5062 | 237 |
| 395 | 3300047472 | Ga0495686_0000871 | Ga0495686_0000871_2667_3446 | 237 |
| 396 | 3300048919 | Ga0496116_0000370 | Ga0496116_0000370_1637_2419 | 237 |
| 397 | 3300048921 | Ga0496118_0017779 | Ga0496118_0017779_2323_3105 | 237 |
| 398 | 3300048924 | Ga0496121_0004954 | Ga0496121_0004954_2545_3327 | 237 |
| 399 | 3300048924 | Ga0496121_0024253 | Ga0496121_0024253_880_1662 | 237 |
| 400 | 3300049569 | Ga0501032_0410527 | Ga0501032_0410527_73_852 | 237 |
| 401 | 3300049574 | Ga0501038_0122249 | Ga0501038_0122249_1292_2071 | 237 |
| 402 | 3300049575 | Ga0501039_0167430 | Ga0501039_0167430_901_1680 | 237 |
| 403 | 3300049579 | Ga0501043_0117157 | Ga0501043_0117157_47_826 | 237 |
| 404 | 3300049581 | Ga0501047_0120360 | Ga0501047_0120360_1357_2136 | 237 |
| 405 | 3300049583 | Ga0501067_0038465 | Ga0501067_0038465_501_1283 | 237 |
| 406 | 3300049589 | Ga0501073_0022766 | Ga0501073_0022766_3592_4374 | 237 |
| 407 | 3300049742 | Ga0501080_0050530 | Ga0501080_0050530_811_1590 | 237 |
| 408 | 3300049822 | Ga0501035_0198283 | Ga0501035_0198283_359_1138 | 237 |
| 409 | 3300049823 | Ga0501044_0186545 | Ga0501044_0186545_47_826 | 237 |
| 410 | 3300050494 | nmdc:mga06z11_22064_c1 | nmdc:mga06z11_22064_c1_2074_2904 | 237 |
| 411 | 3300060353 | Ga0501082_0028643 | Ga0501082_0028643_3277_4056 | 237 |
| 412 | 3300060353 | Ga0501082_0198207 | Ga0501082_0198207_366_1169 | 237 |
| 413 | 3300060353 | Ga0501082_0633150 | Ga0501082_0633150_97_879 | 237 |
| 414 | 2162886007 | SwRhRL2b_contig_1053217 | SwRhRL2b_0128.00008660 | 238 |
| 415 | 3300003187 | JGI25151J46595_10000429 | JGI25151J46595_100004297 | 238 |
| 416 | 3300003659 | JGI25404J52841_10004368 | JGI25404J52841_100043682 | 238 |
| 417 | 3300005289 | Ga0065704_10136423 | Ga0065704_101364232 | 238 |
| 418 | 3300005293 | Ga0065715_10270724 | Ga0065715_102707242 | 238 |
| 419 | 3300005293 | Ga0065715_10358234 | Ga0065715_103582341 | 238 |
| 420 | 3300005295 | Ga0065707_10218408 | Ga0065707_102184082 | 238 |
| 421 | 3300005327 | Ga0070658_10002319 | Ga0070658_1000231912 | 238 |
| 422 | 3300005329 | Ga0070683_100066981 | Ga0070683_1000669812 | 238 |
| 423 | 3300005330 | Ga0070690_100085605 | Ga0070690_1000856052 | 238 |
| 424 | 3300005330 | Ga0070690_100245131 | Ga0070690_1002451312 | 238 |
| 425 | 3300005331 | Ga0070670_100002932 | Ga0070670_1000029327 | 238 |
| 426 | 3300005331 | Ga0070670_100254601 | Ga0070670_1002546012 | 238 |
| 427 | 3300005336 | Ga0070680_100060440 | Ga0070680_1000604404 | 238 |
| 428 | 3300005336 | Ga0070680_100100163 | Ga0070680_1001001631 | 238 |
| 429 | 3300005338 | Ga0068868_100180245 | Ga0068868_1001802452 | 238 |
| 430 | 3300005338 | Ga0068868_100300150 | Ga0068868_1003001501 | 238 |
| 431 | 3300005340 | Ga0070689_100118202 | Ga0070689_1001182022 | 238 |
| 432 | 3300005340 | Ga0070689_100378338 | Ga0070689_1003783382 | 238 |
| 433 | 3300005344 | Ga0070661_100004790 | Ga0070661_1000047907 | 238 |
| 434 | 3300005354 | Ga0070675_100068054 | Ga0070675_1000680543 | 238 |
| 435 | 3300005364 | Ga0070673_100084974 | Ga0070673_1000849741 | 238 |
| 436 | 3300005365 | Ga0070688_100069052 | Ga0070688_1000690522 | 238 |
| 437 | 3300005365 | Ga0070688_100199772 | Ga0070688_1001997722 | 238 |
| 438 | 3300005367 | Ga0070667_100043458 | Ga0070667_1000434583 | 238 |
| 439 | 3300005444 | Ga0070694_100041430 | Ga0070694_1000414302 | 238 |
| 440 | 3300005456 | Ga0070678_100181311 | Ga0070678_1001813112 | 238 |
| 441 | 3300005456 | Ga0070678_100229328 | Ga0070678_1002293281 | 238 |
| 442 | 3300005456 | Ga0070678_100422966 | Ga0070678_1004229661 | 238 |
| 443 | 3300005457 | Ga0070662_100041549 | Ga0070662_1000415491 | 238 |
| 444 | 3300005457 | Ga0070662_100413343 | Ga0070662_1004133431 | 238 |
| 445 | 3300005459 | Ga0068867_100012518 | Ga0068867_1000125182 | 238 |
| 446 | 3300005459 | Ga0068867_100034317 | Ga0068867_1000343172 | 238 |
| 447 | 3300005466 | Ga0070685_10002961 | Ga0070685_100029616 | 238 |
| 448 | 3300005467 | Ga0070706_100055825 | Ga0070706_1000558253 | 238 |
| 449 | 3300005467 | Ga0070706_100603723 | Ga0070706_1006037231 | 238 |
| 450 | 3300005471 | Ga0070698_100046656 | Ga0070698_1000466565 | 238 |
| 451 | 3300005518 | Ga0070699_100115877 | Ga0070699_1001158771 | 238 |
| 452 | 3300005535 | Ga0070684_100007310 | Ga0070684_1000073102 | 238 |
| 453 | 3300005536 | Ga0070697_100096800 | Ga0070697_1000968002 | 238 |
| 454 | 3300005539 | Ga0068853_100048814 | Ga0068853_1000488143 | 238 |
| 455 | 3300005539 | Ga0068853_100110335 | Ga0068853_1001103353 | 238 |
| 456 | 3300005539 | Ga0068853_100279474 | Ga0068853_1002794742 | 238 |
| 457 | 3300005539 | Ga0068853_100309546 | Ga0068853_1003095462 | 238 |
| 458 | 3300005543 | Ga0070672_100001670 | Ga0070672_1000016706 | 238 |
| 459 | 3300005543 | Ga0070672_100016821 | Ga0070672_1000168215 | 238 |
| 460 | 3300005543 | Ga0070672_100374412 | Ga0070672_1003744121 | 238 |
| 461 | 3300005544 | Ga0070686_100097071 | Ga0070686_1000970712 | 238 |
| 462 | 3300005545 | Ga0070695_100329651 | Ga0070695_1003296511 | 238 |
| 463 | 3300005545 | Ga0070695_100425536 | Ga0070695_1004255361 | 238 |
| 464 | 3300005546 | Ga0070696_100126591 | Ga0070696_1001265912 | 238 |
| 465 | 3300005546 | Ga0070696_100154102 | Ga0070696_1001541022 | 238 |
| 466 | 3300005548 | Ga0070665_100005441 | Ga0070665_10000544113 | 238 |
| 467 | 3300005548 | Ga0070665_100031591 | Ga0070665_1000315915 | 238 |
| 468 | 3300005549 | Ga0070704_100120331 | Ga0070704_1001203312 | 238 |
| 469 | 3300005563 | Ga0068855_100023209 | Ga0068855_1000232093 | 238 |
| 470 | 3300005563 | Ga0068855_100069804 | Ga0068855_1000698044 | 238 |
| 471 | 3300005563 | Ga0068855_100113643 | Ga0068855_1001136432 | 238 |
| 472 | 3300005563 | Ga0068855_100694064 | Ga0068855_1006940641 | 238 |
| 473 | 3300005564 | Ga0070664_100058712 | Ga0070664_1000587122 | 238 |
| 474 | 3300005577 | Ga0068857_100011595 | Ga0068857_1000115956 | 238 |
| 475 | 3300005578 | Ga0068854_100057311 | Ga0068854_1000573112 | 238 |
| 476 | 3300005578 | Ga0068854_100340607 | Ga0068854_1003406072 | 238 |
| 477 | 3300005614 | Ga0068856_100024483 | Ga0068856_1000244836 | 238 |
| 478 | 3300005614 | Ga0068856_100307339 | Ga0068856_1003073392 | 238 |
| 479 | 3300005616 | Ga0068852_100014664 | Ga0068852_1000146642 | 238 |
| 480 | 3300005616 | Ga0068852_100055850 | Ga0068852_1000558502 | 238 |
| 481 | 3300005616 | Ga0068852_100391162 | Ga0068852_1003911622 | 238 |
| 482 | 3300005617 | Ga0068859_100004020 | Ga0068859_1000040203 | 238 |
| 483 | 3300005617 | Ga0068859_100028791 | Ga0068859_1000287914 | 238 |
| 484 | 3300005617 | Ga0068859_100216912 | Ga0068859_1002169121 | 238 |
| 485 | 3300005617 | Ga0068859_100613945 | Ga0068859_1006139452 | 238 |
| 486 | 3300005617 | Ga0068859_101148735 | Ga0068859_1011487351 | 238 |
| 487 | 3300005618 | Ga0068864_100001391 | Ga0068864_10000139110 | 238 |
| 488 | 3300005618 | Ga0068864_100002912 | Ga0068864_1000029128 | 238 |
| 489 | 3300005618 | Ga0068864_100267773 | Ga0068864_1002677732 | 238 |
| 490 | 3300005719 | Ga0068861_100000210 | Ga0068861_10000021029 | 238 |
| 491 | 3300005834 | Ga0068851_10086788 | Ga0068851_100867882 | 238 |
| 492 | 3300005840 | Ga0068870_10042500 | Ga0068870_100425002 | 238 |
| 493 | 3300005841 | Ga0068863_100002813 | Ga0068863_10000281312 | 238 |
| 494 | 3300005841 | Ga0068863_100006041 | Ga0068863_1000060412 | 238 |
| 495 | 3300005842 | Ga0068858_100045566 | Ga0068858_1000455663 | 238 |
| 496 | 3300005843 | Ga0068860_100004339 | Ga0068860_10000433913 | 238 |
| 497 | 3300005843 | Ga0068860_100004940 | Ga0068860_10000494016 | 238 |
| 498 | 3300005843 | Ga0068860_100140989 | Ga0068860_1001409893 | 238 |
| 499 | 3300005843 | Ga0068860_100292283 | Ga0068860_1002922832 | 238 |
| 500 | 3300005844 | Ga0068862_100004054 | Ga0068862_10000405413 | 238 |
| 501 | 3300005844 | Ga0068862_100195797 | Ga0068862_1001957972 | 238 |
| 502 | 3300005937 | Ga0081455_10000479 | Ga0081455_1000047923 | 238 |
| 503 | 3300005937 | Ga0081455_10045769 | Ga0081455_100457695 | 238 |
| 504 | 3300005983 | Ga0081540_1064076 | Ga0081540_10640762 | 238 |
| 505 | 3300005985 | Ga0081539_10001648 | Ga0081539_1000164853 | 238 |
| 506 | 3300005985 | Ga0081539_10017784 | Ga0081539_100177843 | 238 |
| 507 | 3300006028 | Ga0070717_10431301 | Ga0070717_104313012 | 238 |
| 508 | 3300006042 | Ga0075368_10035856 | Ga0075368_100358562 | 238 |
| 509 | 3300006042 | Ga0075368_10092812 | Ga0075368_100928122 | 238 |
| 510 | 3300006048 | Ga0075363_100020064 | Ga0075363_1000200642 | 238 |
| 511 | 3300006048 | Ga0075363_100026566 | Ga0075363_1000265662 | 238 |
| 512 | 3300006177 | Ga0075362_10000592 | Ga0075362_100005923 | 238 |
| 513 | 3300006177 | Ga0075362_10005194 | Ga0075362_100051946 | 238 |
| 514 | 3300006178 | Ga0075367_10000751 | Ga0075367_100007513 | 238 |
| 515 | 3300006186 | Ga0075369_10000268 | Ga0075369_1000026811 | 238 |
| 516 | 3300006195 | Ga0075366_10057364 | Ga0075366_100573643 | 238 |
| 517 | 3300006353 | Ga0075370_10038622 | Ga0075370_100386223 | 238 |
| 518 | 3300006353 | Ga0075370_10069612 | Ga0075370_100696122 | 238 |
| 519 | 3300006353 | Ga0075370_10220538 | Ga0075370_102205381 | 238 |
| 520 | 3300006358 | Ga0068871_100124136 | Ga0068871_1001241362 | 238 |
| 521 | 3300006852 | Ga0075433_10291310 | Ga0075433_102913102 | 238 |
| 522 | 3300006871 | Ga0075434_100058662 | Ga0075434_1000586621 | 238 |
| 523 | 3300006881 | Ga0068865_100025074 | Ga0068865_1000250742 | 238 |
| 524 | 3300006914 | Ga0075436_100011403 | Ga0075436_1000114035 | 238 |
| 525 | 3300006914 | Ga0075436_100014247 | Ga0075436_1000142472 | 238 |
| 526 | 3300006931 | Ga0097620_100004020 | Ga0097620_1000040203 | 238 |
| 527 | 3300006931 | Ga0097620_100028791 | Ga0097620_1000287914 | 238 |
| 528 | 3300006931 | Ga0097620_100216899 | Ga0097620_1002168991 | 238 |
| 529 | 3300006931 | Ga0097620_100613990 | Ga0097620_1006139902 | 238 |
| 530 | 3300006931 | Ga0097620_101148542 | Ga0097620_1011485421 | 238 |
| 531 | 3300007076 | Ga0075435_100007808 | Ga0075435_1000078089 | 238 |
| 532 | 3300009094 | Ga0111539_10261159 | Ga0111539_102611592 | 238 |
| 533 | 3300009147 | Ga0114129_10240633 | Ga0114129_102406333 | 238 |
| 534 | 3300009174 | Ga0105241_10003718 | Ga0105241_100037186 | 238 |
| 535 | 3300009176 | Ga0105242_10155099 | Ga0105242_101550991 | 238 |
| 536 | 3300009545 | Ga0105237_10008317 | Ga0105237_1000831712 | 238 |
| 537 | 3300009545 | Ga0105237_10013907 | Ga0105237_100139077 | 238 |
| 538 | 3300009551 | Ga0105238_10048290 | Ga0105238_100482903 | 238 |
| 539 | 3300009551 | Ga0105238_10166261 | Ga0105238_101662613 | 238 |
| 540 | 3300009551 | Ga0105238_10244661 | Ga0105238_102446612 | 238 |
| 541 | 3300009553 | Ga0105249_10194867 | Ga0105249_101948672 | 238 |
| 542 | 3300009553 | Ga0105249_10603599 | Ga0105249_106035992 | 238 |
| 543 | 3300010375 | Ga0105239_10025620 | Ga0105239_100256207 | 238 |
| 544 | 3300010375 | Ga0105239_10117384 | Ga0105239_101173841 | 238 |
| 545 | 3300010375 | Ga0105239_10388697 | Ga0105239_103886972 | 238 |
| 546 | 3300010375 | Ga0105239_10393998 | Ga0105239_103939982 | 238 |
| 547 | 3300010375 | Ga0105239_10654371 | Ga0105239_106543711 | 238 |
| 548 | 3300011119 | Ga0105246_10009952 | Ga0105246_100099525 | 238 |
| 549 | 3300012480 | Ga0157346_1001597 | Ga0157346_10015971 | 238 |
| 550 | 3300013100 | Ga0157373_10018460 | Ga0157373_100184604 | 238 |
| 551 | 3300013102 | Ga0157371_10114508 | Ga0157371_101145082 | 238 |
| 552 | 3300013102 | Ga0157371_10124379 | Ga0157371_101243792 | 238 |
| 553 | 3300013102 | Ga0157371_10147773 | Ga0157371_101477732 | 238 |
| 554 | 3300013104 | Ga0157370_10281549 | Ga0157370_102815492 | 238 |
| 555 | 3300013105 | Ga0157369_10003606 | Ga0157369_1000360613 | 238 |
| 556 | 3300013105 | Ga0157369_10044850 | Ga0157369_100448503 | 238 |
| 557 | 3300013105 | Ga0157369_10591869 | Ga0157369_105918691 | 238 |
| 558 | 3300013297 | Ga0157378_10009890 | Ga0157378_100098907 | 238 |
| 559 | 3300013308 | Ga0157375_10015650 | Ga0157375_100156506 | 238 |
| 560 | 3300014325 | Ga0163163_10000041 | Ga0163163_10000041114 | 238 |
| 561 | 3300014325 | Ga0163163_10001081 | Ga0163163_1000108115 | 238 |
| 562 | 3300014325 | Ga0163163_10020198 | Ga0163163_100201986 | 238 |
| 563 | 3300014325 | Ga0163163_10198315 | Ga0163163_101983153 | 238 |
| 564 | 3300014968 | Ga0157379_10003245 | Ga0157379_100032456 | 238 |
| 565 | 3300014968 | Ga0157379_10261222 | Ga0157379_102612222 | 238 |
| 566 | 3300014968 | Ga0157379_10480958 | Ga0157379_104809581 | 238 |
| 567 | 3300015261 | Ga0182006_1003007 | Ga0182006_10030079 | 238 |
| 568 | 3300015261 | Ga0182006_1018903 | Ga0182006_10189034 | 238 |
| 569 | 3300021384 | Ga0213876_10001143 | Ga0213876_100011431 | 238 |
| 570 | 3300021384 | Ga0213876_10154618 | Ga0213876_101546182 | 238 |
| 571 | 3300021388 | Ga0213875_10122254 | Ga0213875_101222542 | 238 |
| 572 | 3300025294 | Ga0209025_1000282 | Ga0209025_100028247 | 238 |
| 573 | 3300025303 | Ga0209051_1002758 | Ga0209051_10027588 | 238 |
| 574 | 3300025899 | Ga0207642_10123973 | Ga0207642_101239732 | 238 |
| 575 | 3300025908 | Ga0207643_10048399 | Ga0207643_100483992 | 238 |
| 576 | 3300025909 | Ga0207705_10001097 | Ga0207705_100010972 | 238 |
| 577 | 3300025910 | Ga0207684_10300634 | Ga0207684_103006342 | 238 |
| 578 | 3300025911 | Ga0207654_10139725 | Ga0207654_101397252 | 238 |
| 579 | 3300025912 | Ga0207707_10016035 | Ga0207707_100160355 | 238 |
| 580 | 3300025913 | Ga0207695_10003360 | Ga0207695_100033608 | 238 |
| 581 | 3300025913 | Ga0207695_10303832 | Ga0207695_103038322 | 238 |
| 582 | 3300025914 | Ga0207671_10052369 | Ga0207671_100523694 | 238 |
| 583 | 3300025914 | Ga0207671_10070925 | Ga0207671_100709252 | 238 |
| 584 | 3300025920 | Ga0207649_10546663 | Ga0207649_105466631 | 238 |
| 585 | 3300025921 | Ga0207652_10068548 | Ga0207652_100685483 | 238 |
| 586 | 3300025923 | Ga0207681_10028880 | Ga0207681_100288802 | 238 |
| 587 | 3300025924 | Ga0207694_10008420 | Ga0207694_100084208 | 238 |
| 588 | 3300025924 | Ga0207694_10078789 | Ga0207694_100787892 | 238 |
| 589 | 3300025924 | Ga0207694_10132622 | Ga0207694_101326222 | 238 |
| 590 | 3300025925 | Ga0207650_10031394 | Ga0207650_100313943 | 238 |
| 591 | 3300025925 | Ga0207650_10406962 | Ga0207650_104069621 | 238 |
| 592 | 3300025926 | Ga0207659_10034680 | Ga0207659_100346803 | 238 |
| 593 | 3300025926 | Ga0207659_10334682 | Ga0207659_103346822 | 238 |
| 594 | 3300025933 | Ga0207706_10412605 | Ga0207706_104126051 | 238 |
| 595 | 3300025934 | Ga0207686_10322658 | Ga0207686_103226581 | 238 |
| 596 | 3300025935 | Ga0207709_10186550 | Ga0207709_101865502 | 238 |
| 597 | 3300025936 | Ga0207670_10386106 | Ga0207670_103861062 | 238 |
| 598 | 3300025938 | Ga0207704_10141287 | Ga0207704_101412872 | 238 |
| 599 | 3300025940 | Ga0207691_10010252 | Ga0207691_100102524 | 238 |
| 600 | 3300025940 | Ga0207691_10028031 | Ga0207691_100280315 | 238 |
| 601 | 3300025940 | Ga0207691_10249669 | Ga0207691_102496692 | 238 |
| 602 | 3300025940 | Ga0207691_10711330 | Ga0207691_107113301 | 238 |
| 603 | 3300025941 | Ga0207711_10069135 | Ga0207711_100691353 | 238 |
| 604 | 3300025941 | Ga0207711_10234899 | Ga0207711_102348992 | 238 |
| 605 | 3300025944 | Ga0207661_10497714 | Ga0207661_104977141 | 238 |
| 606 | 3300025945 | Ga0207679_10193858 | Ga0207679_101938581 | 238 |
| 607 | 3300025945 | Ga0207679_10226009 | Ga0207679_102260092 | 238 |
| 608 | 3300025945 | Ga0207679_10294590 | Ga0207679_102945902 | 238 |
| 609 | 3300025949 | Ga0207667_10005447 | Ga0207667_1000544712 | 238 |
| 610 | 3300025960 | Ga0207651_10378739 | Ga0207651_103787392 | 238 |
| 611 | 3300025972 | Ga0207668_10073153 | Ga0207668_100731534 | 238 |
| 612 | 3300025981 | Ga0207640_10436875 | Ga0207640_104368752 | 238 |
| 613 | 3300025981 | Ga0207640_10483535 | Ga0207640_104835352 | 238 |
| 614 | 3300025981 | Ga0207640_10492857 | Ga0207640_104928572 | 238 |
| 615 | 3300025986 | Ga0207658_10003586 | Ga0207658_100035866 | 238 |
| 616 | 3300025986 | Ga0207658_10115692 | Ga0207658_101156922 | 238 |
| 617 | 3300026023 | Ga0207677_10128286 | Ga0207677_101282862 | 238 |
| 618 | 3300026023 | Ga0207677_10354238 | Ga0207677_103542382 | 238 |
| 619 | 3300026035 | Ga0207703_10048586 | Ga0207703_100485862 | 238 |
| 620 | 3300026035 | Ga0207703_10072360 | Ga0207703_100723603 | 238 |
| 621 | 3300026041 | Ga0207639_10242054 | Ga0207639_102420541 | 238 |
| 622 | 3300026078 | Ga0207702_10210097 | Ga0207702_102100972 | 238 |
| 623 | 3300026088 | Ga0207641_10003697 | Ga0207641_100036979 | 238 |
| 624 | 3300026088 | Ga0207641_10010598 | Ga0207641_100105981 | 238 |
| 625 | 3300026088 | Ga0207641_10014858 | Ga0207641_100148585 | 238 |
| 626 | 3300026088 | Ga0207641_10299875 | Ga0207641_102998751 | 238 |
| 627 | 3300026089 | Ga0207648_10000442 | Ga0207648_100004422 | 238 |
| 628 | 3300026089 | Ga0207648_10016794 | Ga0207648_100167942 | 238 |
| 629 | 3300026089 | Ga0207648_10297682 | Ga0207648_102976822 | 238 |
| 630 | 3300026095 | Ga0207676_10174433 | Ga0207676_101744332 | 238 |
| 631 | 3300026095 | Ga0207676_10215106 | Ga0207676_102151062 | 238 |
| 632 | 3300026095 | Ga0207676_10614417 | Ga0207676_106144172 | 238 |
| 633 | 3300026116 | Ga0207674_10013821 | Ga0207674_100138216 | 238 |
| 634 | 3300026116 | Ga0207674_10034700 | Ga0207674_100347005 | 238 |
| 635 | 3300026118 | Ga0207675_100000633 | Ga0207675_1000006338 | 238 |
| 636 | 3300026118 | Ga0207675_100169465 | Ga0207675_1001694652 | 238 |
| 637 | 3300026118 | Ga0207675_100782575 | Ga0207675_1007825751 | 238 |
| 638 | 3300026121 | Ga0207683_10118547 | Ga0207683_101185472 | 238 |
| 639 | 3300026121 | Ga0207683_10148835 | Ga0207683_101488352 | 238 |
| 640 | 3300026121 | Ga0207683_10267661 | Ga0207683_102676612 | 238 |
| 641 | 3300026121 | Ga0207683_10546619 | Ga0207683_105466191 | 238 |
| 642 | 3300026142 | Ga0207698_10021921 | Ga0207698_100219212 | 238 |
| 643 | 3300028379 | Ga0268266_10018802 | Ga0268266_100188026 | 238 |
| 644 | 3300028380 | Ga0268265_10003872 | Ga0268265_100038724 | 238 |
| 645 | 3300028380 | Ga0268265_10399006 | Ga0268265_103990061 | 238 |
| 646 | 3300028381 | Ga0268264_10002795 | Ga0268264_100027959 | 238 |
| 647 | 3300028381 | Ga0268264_10006716 | Ga0268264_100067169 | 238 |
| 648 | 3300028381 | Ga0268264_10489755 | Ga0268264_104897552 | 238 |
| 649 | 3300031238 | Ga0265332_10198066 | Ga0265332_101980661 | 238 |
| 650 | 3300031616 | Ga0307508_10001988 | Ga0307508_1000198818 | 238 |
| 651 | 3300031727 | Ga0316576_10391552 | Ga0316576_103915522 | 238 |
| 652 | 3300031730 | Ga0307516_10052976 | Ga0307516_100529762 | 238 |
| 653 | 3300031730 | Ga0307516_10345959 | Ga0307516_103459592 | 238 |
| 654 | 3300031731 | Ga0307405_10306417 | Ga0307405_103064171 | 238 |
| 655 | 3300031911 | Ga0307412_10002067 | Ga0307412_100020679 | 238 |
| 656 | 3300032004 | Ga0307414_10152700 | Ga0307414_101527002 | 238 |
| 657 | 3300035083 | Ga0373926_0000848 | Ga0373926_0000848_2568_3362 | 238 |
| 658 | 3300035089 | Ga0373944_0007159 | Ga0373944_0007159_96_890 | 238 |
| 659 | 3300035111 | Ga0373923_0022370 | Ga0373923_0022370_1172_1966 | 238 |
| 660 | 3300035113 | Ga0373936_0017975 | Ga0373936_0017975_1030_1812 | 238 |
| 661 | 3300035113 | Ga0373936_0022446 | Ga0373936_0022446_810_1604 | 238 |
| 662 | 3300035116 | Ga0373945_0002899 | Ga0373945_0002899_1209_2003 | 238 |
| 663 | 3300035170 | Ga0373943_0007874 | Ga0373943_0007874_310_1104 | 238 |
| 664 | 3300035171 | Ga0373946_0006412 | Ga0373946_0006412_776_1570 | 238 |
| 665 | 3300035398 | Ga0316574_0042754 | Ga0316574_0042754_1201_1983 | 238 |
| 666 | 3300035410 | Ga0373924_0047336 | Ga0373924_0047336_314_1108 | 238 |
| 667 | 3300035692 | Ga0373935_0080692 | Ga0373935_0080692_151_945 | 238 |
| 668 | 3300035695 | Ga0373927_0005282 | Ga0373927_0005282_4551_5345 | 238 |
| 669 | 3300036401 | Ga0373937_0028390 | Ga0373937_0028390_872_1654 | 238 |
| 670 | 3300037068 | Ga0373925_0128015 | Ga0373925_0128015_1143_1925 | 238 |
| 671 | 3300037068 | Ga0373925_0231858 | Ga0373925_0231858_660_1454 | 238 |
| 672 | 3300037312 | Ga0395899_0001843 | Ga0395899_0001843_9971_10762 | 238 |
| 673 | 3300037312 | Ga0395899_0255571 | Ga0395899_0255571_380_1162 | 238 |
| 674 | 3300037418 | Ga0395900_0050886 | Ga0395900_0050886_3146_3937 | 238 |
| 675 | 3300037418 | Ga0395900_0084466 | Ga0395900_0084466_35_817 | 238 |
| 676 | 3300037471 | Ga0395905_0000240 | Ga0395905_0000240_7986_8774 | 238 |
| 677 | 3300037471 | Ga0395905_0057254 | Ga0395905_0057254_2659_3441 | 238 |
| 678 | 3300037471 | Ga0395905_0253586 | Ga0395905_0253586_712_1494 | 238 |
| 679 | 3300037853 | Ga0436364_0448854 | Ga0436364_0448854_648_1433 | 238 |
| 680 | 3300037853 | Ga0436364_1128088 | Ga0436364_1128088_345_1130 | 238 |
| 681 | 3300038443 | Ga0395901_0008600 | Ga0395901_0008600_4098_4880 | 238 |
| 682 | 3300038443 | Ga0395901_0126475 | Ga0395901_0126475_1727_2518 | 238 |
| 683 | 3300039437 | Ga0436365_0188102 | Ga0436365_0188102_292_1077 | 238 |
| 684 | 3300039437 | Ga0436365_1008718 | Ga0436365_1008718_23943_24728 | 238 |
| 685 | 3300039437 | Ga0436365_1287200 | Ga0436365_1287200_796_1581 | 238 |
| 686 | 3300042115 | Ga0450911_000674 | Ga0450911_000674_7241_8023 | 238 |
| 687 | 3300042876 | Ga0451577_0003691 | Ga0451577_0003691_8184_8969 | 238 |
| 688 | 3300042876 | Ga0451577_0341112 | Ga0451577_0341112_188_970 | 238 |
| 689 | 3300044683 | Ga0466965_0003446 | Ga0466965_0003446_5798_6586 | 238 |
| 690 | 3300044706 | Ga0466964_0072282 | Ga0466964_0072282_161_949 | 238 |
| 691 | 3300044706 | Ga0466964_0090233 | Ga0466964_0090233_293_1081 | 238 |
| 692 | 3300044712 | Ga0453684_0000136 | Ga0453684_0000136_80941_81825 | 238 |
| 693 | 3300044712 | Ga0453684_0051158 | Ga0453684_0051158_892_1677 | 238 |
| 694 | 3300044712 | Ga0453684_0831041 | Ga0453684_0831041_14_796 | 238 |
| 695 | 3300045049 | Ga0466959_0063789 | Ga0466959_0063789_921_1709 | 238 |
| 696 | 3300045051 | Ga0451576_0000025 | Ga0451576_0000025_346066_346950 | 238 |
| 697 | 3300046455 | Ga0495603_0008625 | Ga0495603_0008625_3374_4168 | 238 |
| 698 | 3300046457 | Ga0495590_0024270 | Ga0495590_0024270_842_1624 | 238 |
| 699 | 3300046459 | Ga0495629_0087079 | Ga0495629_0087079_514_1296 | 238 |
| 700 | 3300046472 | Ga0495580_0031658 | Ga0495580_0031658_3004_3798 | 238 |
| 701 | 3300046475 | Ga0495639_0003893 | Ga0495639_0003893_2585_3379 | 238 |
| 702 | 3300046475 | Ga0495639_0025708 | Ga0495639_0025708_1776_2561 | 238 |
| 703 | 3300046512 | Ga0495610_0015537 | Ga0495610_0015537_1298_2080 | 238 |
| 704 | 3300046535 | Ga0495586_0070146 | Ga0495586_0070146_150_944 | 238 |
| 705 | 3300046539 | Ga0495621_0067278 | Ga0495621_0067278_206_988 | 238 |
| 706 | 3300046558 | Ga0495633_0001222 | Ga0495633_0001222_10323_11105 | 238 |
| 707 | 3300046663 | Ga0495635_0201292 | Ga0495635_0201292_274_1056 | 238 |
| 708 | 3300046681 | Ga0495647_0001675 | Ga0495647_0001675_5560_6354 | 238 |
| 709 | 3300046683 | Ga0495658_0012044 | Ga0495658_0012044_3479_4273 | 238 |
| 710 | 3300046690 | Ga0495624_0132983 | Ga0495624_0132983_370_1155 | 238 |
| 711 | 3300046694 | Ga0495649_0062453 | Ga0495649_0062453_88_870 | 238 |
| 712 | 3300047315 | Ga0495581_0077391 | Ga0495581_0077391_882_1667 | 238 |
| 713 | 3300047321 | Ga0495676_0119158 | Ga0495676_0119158_1086_1880 | 238 |
| 714 | 3300047472 | Ga0495686_0030557 | Ga0495686_0030557_576_1361 | 238 |
| 715 | 3300048904 | Ga0496101_0442662 | Ga0496101_0442662_124_906 | 238 |
| 716 | 3300048904 | Ga0496101_0576035 | Ga0496101_0576035_40_825 | 238 |
| 717 | 3300048905 | Ga0496102_0005345 | Ga0496102_0005345_8154_8981 | 238 |
| 718 | 3300048905 | Ga0496102_0095744 | Ga0496102_0095744_1772_2557 | 238 |
| 719 | 3300048906 | Ga0496103_0122622 | Ga0496103_0122622_163_990 | 238 |
| 720 | 3300048907 | Ga0496104_0005026 | Ga0496104_0005026_1817_2602 | 238 |
| 721 | 3300048907 | Ga0496104_0569259 | Ga0496104_0569259_22_807 | 238 |
| 722 | 3300048908 | Ga0496105_0000617 | Ga0496105_0000617_868_1653 | 238 |
| 723 | 3300048908 | Ga0496105_0181504 | Ga0496105_0181504_875_1657 | 238 |
| 724 | 3300048909 | Ga0496106_0331178 | Ga0496106_0331178_351_1136 | 238 |
| 725 | 3300048911 | Ga0496108_0090032 | Ga0496108_0090032_1539_2366 | 238 |
| 726 | 3300048911 | Ga0496108_0193644 | Ga0496108_0193644_968_1750 | 238 |
| 727 | 3300048912 | Ga0496109_0032286 | Ga0496109_0032286_2359_3144 | 238 |
| 728 | 3300048912 | Ga0496109_0091871 | Ga0496109_0091871_45_827 | 238 |
| 729 | 3300048913 | Ga0496110_0258946 | Ga0496110_0258946_507_1292 | 238 |
| 730 | 3300048913 | Ga0496110_0435795 | Ga0496110_0435795_266_1051 | 238 |
| 731 | 3300048914 | Ga0496111_0031511 | Ga0496111_0031511_2935_3720 | 238 |
| 732 | 3300048914 | Ga0496111_0081056 | Ga0496111_0081056_1250_2032 | 238 |
| 733 | 3300048915 | Ga0496112_0204053 | Ga0496112_0204053_87_869 | 238 |
| 734 | 3300048915 | Ga0496112_0466289 | Ga0496112_0466289_268_1053 | 238 |
| 735 | 3300048916 | Ga0496113_0068364 | Ga0496113_0068364_348_1133 | 238 |
| 736 | 3300048918 | Ga0496115_0024616 | Ga0496115_0024616_1627_2412 | 238 |
| 737 | 3300048920 | Ga0496117_0000576 | Ga0496117_0000576_57760_58542 | 238 |
| 738 | 3300048921 | Ga0496118_0000371 | Ga0496118_0000371_72396_73178 | 238 |
| 739 | 3300048925 | Ga0496122_0061643 | Ga0496122_0061643_1452_2234 | 238 |
| 740 | 3300048926 | Ga0496123_0180916 | Ga0496123_0180916_139_921 | 238 |
| 741 | 3300048927 | Ga0496124_0081686 | Ga0496124_0081686_354_1136 | 238 |
| 742 | 3300049569 | Ga0501032_0000455 | Ga0501032_0000455_14605_15390 | 238 |
| 743 | 3300049569 | Ga0501032_0167747 | Ga0501032_0167747_138_920 | 238 |
| 744 | 3300049570 | Ga0501033_0022775 | Ga0501033_0022775_868_1650 | 238 |
| 745 | 3300049571 | Ga0501034_0076986 | Ga0501034_0076986_572_1354 | 238 |
| 746 | 3300049572 | Ga0501036_0020101 | Ga0501036_0020101_3439_4221 | 238 |
| 747 | 3300049572 | Ga0501036_0050044 | Ga0501036_0050044_813_1598 | 238 |
| 748 | 3300049573 | Ga0501037_0009754 | Ga0501037_0009754_5323_6108 | 238 |
| 749 | 3300049573 | Ga0501037_0021919 | Ga0501037_0021919_2654_3436 | 238 |
| 750 | 3300049574 | Ga0501038_0030061 | Ga0501038_0030061_1347_2129 | 238 |
| 751 | 3300049575 | Ga0501039_0139837 | Ga0501039_0139837_718_1500 | 238 |
| 752 | 3300049577 | Ga0501041_0000548 | Ga0501041_0000548_2596_3378 | 238 |
| 753 | 3300049578 | Ga0501042_0151904 | Ga0501042_0151904_506_1288 | 238 |
| 754 | 3300049579 | Ga0501043_0009191 | Ga0501043_0009191_1448_2230 | 238 |
| 755 | 3300049580 | Ga0501046_0008547 | Ga0501046_0008547_4893_5675 | 238 |
| 756 | 3300049583 | Ga0501067_0000100 | Ga0501067_0000100_38207_38992 | 238 |
| 757 | 3300049584 | Ga0501068_0082864 | Ga0501068_0082864_35_820 | 238 |
| 758 | 3300049586 | Ga0501070_0367814 | Ga0501070_0367814_260_1042 | 238 |
| 759 | 3300049587 | Ga0501071_0026840 | Ga0501071_0026840_747_1529 | 238 |
| 760 | 3300049587 | Ga0501071_0162196 | Ga0501071_0162196_532_1314 | 238 |
| 761 | 3300049590 | Ga0501074_0014112 | Ga0501074_0014112_3454_4236 | 238 |
| 762 | 3300049592 | Ga0501076_0000971 | Ga0501076_0000971_17119_17901 | 238 |
| 763 | 3300049593 | Ga0501077_0026616 | Ga0501077_0026616_1498_2283 | 238 |
| 764 | 3300049741 | Ga0501079_0000147 | Ga0501079_0000147_3179_3961 | 238 |
| 765 | 3300049742 | Ga0501080_0003502 | Ga0501080_0003502_4050_4835 | 238 |
| 766 | 3300049742 | Ga0501080_0020513 | Ga0501080_0020513_2336_3118 | 238 |
| 767 | 3300049743 | Ga0501081_0018443 | Ga0501081_0018443_2506_3288 | 238 |
| 768 | 3300049822 | Ga0501035_0166913 | Ga0501035_0166913_39_821 | 238 |
| 769 | 3300049823 | Ga0501044_0013701 | Ga0501044_0013701_4925_5710 | 238 |
| 770 | 3300049824 | Ga0501045_0018022 | Ga0501045_0018022_3292_4074 | 238 |
| 771 | 3300049824 | Ga0501045_0118835 | Ga0501045_0118835_347_1129 | 238 |
| 772 | 3300050489 | nmdc:mga03683_288_c2 | nmdc:mga03683_288_c2_5070_5852 | 238 |
| 773 | 3300050489 | nmdc:mga03683_321_c2 | nmdc:mga03683_321_c2_1394_2176 | 238 |
| 774 | 3300050490 | nmdc:mga03n38_59030_c1 | nmdc:mga03n38_59030_c1_552_1334 | 238 |
| 775 | 3300050490 | nmdc:mga03n38_99601_c1 | nmdc:mga03n38_99601_c1_594_1376 | 238 |
| 776 | 3300050493 | nmdc:mga0k408_202673_c1 | nmdc:mga0k408_202673_c1_65_847 | 238 |
| 777 | 3300050493 | nmdc:mga0k408_300415_c1 | nmdc:mga0k408_300415_c1_14_805 | 238 |
| 778 | 3300050493 | nmdc:mga0k408_98519_c1 | nmdc:mga0k408_98519_c1_769_1551 | 238 |
| 779 | 3300050495 | nmdc:mga04h51_21402_c1 | nmdc:mga04h51_21402_c1_209_991 | 238 |
| 780 | 3300050496 | nmdc:mga07m45_204907_c1 | nmdc:mga07m45_204907_c1_223_1005 | 238 |
| 781 | 3300050507 | nmdc:mga05p37_285320_c1 | nmdc:mga05p37_285320_c1_926_1708 | 238 |
| 782 | 3300050512 | nmdc:mga0n895_148411_c1 | nmdc:mga0n895_148411_c1_317_1099 | 238 |
| 783 | 3300050512 | nmdc:mga0n895_196284_c1 | nmdc:mga0n895_196284_c1_1254_2039 | 238 |
| 784 | 3300050512 | nmdc:mga0n895_60300_c1 | nmdc:mga0n895_60300_c1_2707_3489 | 238 |
| 785 | 3300050513 | nmdc:mga0rr50_31415_c1 | nmdc:mga0rr50_31415_c1_2609_3403 | 238 |
| 786 | 3300050514 | nmdc:mga08x19_128439_c1 | nmdc:mga08x19_128439_c1_838_1620 | 238 |
| 787 | 3300050514 | nmdc:mga08x19_3651_c1 | nmdc:mga08x19_3651_c1_1555_2337 | 238 |
| 788 | 3300050516 | nmdc:mga0sz30_3615_c1 | nmdc:mga0sz30_3615_c1_2937_3719 | 238 |
| 789 | 3300053084 | Ga0495595_0110564 | Ga0495595_0110564_265_1047 | 238 |
| 790 | 3300053085 | Ga0495619_0022890 | Ga0495619_0022890_1202_1984 | 238 |
| 791 | 3300053085 | Ga0495619_0032309 | Ga0495619_0032309_1087_1869 | 238 |
| 792 | 3300053139 | Ga0500568_0043457 | Ga0500568_0043457_265_1047 | 238 |
| 793 | 3300053733 | Ga0500552_000157 | Ga0500552_000157_4762_5544 | 238 |
| 794 | 3300054114 | Ga0501084_0003530 | Ga0501084_0003530_9141_9923 | 238 |
| 795 | 3300059477 | Ga0587084_012452 | Ga0587084_012452_61_843 | 238 |
| 796 | 3300059493 | Ga0587077_029854 | Ga0587077_029854_11_793 | 238 |
| 797 | 3300059506 | Ga0587085_012040 | Ga0587085_012040_53_835 | 238 |
| 798 | 3300059642 | Ga0587069_002460 | Ga0587069_002460_212_994 | 238 |
| 799 | 3300060353 | Ga0501082_0327382 | Ga0501082_0327382_509_1291 | 238 |
| 800 | 3300060353 | Ga0501082_0607327 | Ga0501082_0607327_87_869 | 238 |
| 801 | iso_pu_bacteria | 2643221554 | 2643790591 | 238 |
| 802 | iso_pu_bacteria | 2643221603 | 2644028953 | 238 |
| 803 | iso_pu_bacteria | 2643221638 | 2644211531 | 238 |
| 804 | iso_pu_bacteria | 2904424332 | 2904425519 | 238 |
| 805 | iso_pu_bacteria | 2919476304 | 2919480298 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wmb-assembly1.cif.gz_A | crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase | 0.9216 | 1 | 238 |
| 1wmb-assembly1.cif.gz_A | crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase | 0.9178 | 1 | 238 |
| 2ztv-assembly1.cif.gz_C | the binary complex of d-3-hydroxybutyrate dehydrogenase with nad+ | 0.911 | 1 | 235 |
| 2ztv-assembly1.cif.gz_D | the binary complex of d-3-hydroxybutyrate dehydrogenase with nad+ | 0.9024 | 1 | 235 |
| 5yss-assembly1.cif.gz_D | crystal structure of aminocaproic acid cyclase in complex with nad (+) | 0.9021 | 1 | 235 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0N7KIR0_69_250_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.924 | 2 | 141 | 3.40.50.720 |
| af_A0A0P0Y501_3_211_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9131 | 1 | 141 | 3.40.50.720 |
| af_Q9T0G0_32_314_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8974 | 2 | 141 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8888 | 2 | 87 | 3.40.50.720 |
| af_Q7Z5J1_16_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8866 | 2 | 141 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X3E2L3-F1-model_v4 | D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) | 0.9615 | 2 | 141 |
GO:0003858
GO:0008667 GO:0019290 |
| AF-A0A7X3R6H7-F1-model_v4 | SDR family oxidoreductase | 0.9492 | 2 | 141 |
GO:0016020
GO:0016491 |
| AF-A0A0B7J3D6-F1-model_v4 | D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) | 0.9482 | 1 | 119 |
GO:0003858
|
| AF-A0A2X3L570-F1-model_v4 | 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (EC 1.1.1.127) | 0.9467 | 2 | 133 |
GO:0047001
|
| AF-A0A7Y1ZER1-F1-model_v4 | SDR family oxidoreductase | 0.9454 | 2 | 137 |
GO:0008667
GO:0019290 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar