F481612

General Info

Members Datasets Scaffolds Average Seq Length
805 581 546 255

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0000136|Ga0453684_0000136_80941_81825
Length 294
Sequence MHRGMRGGRLSQRNIRAYAVRIDGTASPPSRGDTMLSNKTALITGSTSGIGEGIARAFAQAGANIILNGFGDAAQIEALRAEIASAHGVRVRYDGADMSKPVQIEAMMAAAIGEFGAIDVLVNNAGIQHVAPVDEFPTAKWDAIIAINLCSAFHTTRLALPGMKQRGWGRIVNVASAHALVASPFKSAYVAAKHGIAGLTKTVALEVAQAGVTVNAICPGYVRTPLVEKQIPDTARARGITEEQVVKDVMLAAQPTKKFVTVEQVAALARFLCSDDAASITGAMLPIDGGWAAQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231008 Pseudomonas sp. GM21 Isolate Nodule
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
9 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
10 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
11 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
12 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
13 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
14 2547132374 Acidovorax radicis N35 Isolate Unclassified
15 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
16 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
17 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
18 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
19 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
20 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
21 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
22 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
23 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
24 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
25 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
26 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
27 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
28 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
29 2643221570 Acidovorax sp. Root568 Isolate Unclassified
30 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
31 2643221609 Acidovorax sp. Root217 Isolate Unclassified
32 2643221611 Acidovorax sp. Root219 Isolate Unclassified
33 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
34 2643221638 Duganella sp. Root336D2 Isolate Unclassified
35 2643221652 Acidovorax sp. Root402 Isolate Unclassified
36 2643221660 Methylibium sp. Root1272 Isolate Unclassified
37 2643221717 Acidovorax sp. Root267 Isolate Unclassified
38 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
39 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
40 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
41 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
42 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
43 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
44 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
45 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
46 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
47 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
48 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
49 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
50 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
51 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
52 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
53 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
54 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
55 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
56 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
57 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
58 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
59 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
60 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
61 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
62 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
63 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
64 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
65 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
66 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
67 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
68 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
69 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
70 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
71 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
72 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
73 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
74 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
75 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
76 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
77 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
78 2904424332 Duganella sp. 1411 Isolate Rhizosphere
79 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
80 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
81 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
82 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
83 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
84 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
85 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
86 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
87 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
88 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
89 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
90 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
91 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
92 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
93 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
94 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
95 2919476304 Duganella sp. 3397 Isolate Unclassified
96 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
97 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
98 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
99 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
100 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
101 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
102 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
103 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
104 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
105 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
106 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
107 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
108 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
109 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
110 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
111 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
112 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
113 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
114 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
115 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
116 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
117 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
118 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
119 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
120 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
121 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
122 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
123 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
124 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
125 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
126 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
127 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
128 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
129 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
130 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
131 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
132 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
133 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
134 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
135 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
136 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
137 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
138 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
139 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
140 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
141 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
142 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
143 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
144 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
145 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
146 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
147 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
148 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
149 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
150 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
151 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
152 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
153 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
154 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
155 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
156 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
157 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
158 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
159 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
160 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
161 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
162 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
163 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
164 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
165 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
166 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
167 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
168 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
169 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
170 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
171 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
172 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
173 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
174 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
175 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
176 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
177 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
178 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
179 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
180 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
181 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
182 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
183 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
184 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
185 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
186 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
187 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
188 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
189 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
190 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
191 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
192 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
193 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
194 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
195 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
196 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
197 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
198 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
199 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
200 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
201 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
202 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
203 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
204 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
205 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
206 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
207 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
208 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
209 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
210 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
211 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
212 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
213 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
214 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
215 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
216 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
217 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
218 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
219 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
220 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
221 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
222 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
223 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
224 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
225 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
226 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
227 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
228 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
229 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
230 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
231 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
232 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
233 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
234 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
235 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
236 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
237 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
238 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
239 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
240 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
241 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
242 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
243 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
244 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
245 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
246 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
247 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
248 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
249 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
250 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
251 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
252 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
253 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
254 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
255 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
256 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
257 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
258 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
259 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
260 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
261 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
262 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
263 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
264 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
265 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
266 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
267 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
268 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
269 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
270 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
271 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
272 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
273 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
274 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
275 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
276 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
277 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
278 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
279 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
280 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
281 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
282 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
283 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
284 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
285 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
286 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
287 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
288 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
289 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
290 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
291 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
292 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
293 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
294 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
295 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
296 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
297 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
298 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
299 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
300 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
301 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
302 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
303 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
304 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
305 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
306 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
307 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
308 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
309 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
310 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
311 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
312 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
313 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
314 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
315 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
316 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
317 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
318 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
319 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
320 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
321 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
322 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
323 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
324 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
325 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
326 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
327 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
328 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
329 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
330 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
331 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
332 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
333 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
334 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
335 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
336 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
337 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
338 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
339 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
340 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
341 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
342 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
343 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
344 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
345 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
346 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
347 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
348 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
349 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
350 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
351 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
352 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
353 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
354 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
355 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
356 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
357 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
358 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
359 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
360 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
361 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
362 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
363 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
364 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
365 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
366 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
367 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
368 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
369 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
370 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
371 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
372 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
373 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
374 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
375 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
376 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
377 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
378 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
380 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
381 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
382 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
383 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
384 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
385 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
427 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
432 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
433 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
434 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
435 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
436 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
437 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
438 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
439 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
440 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
441 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
442 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
443 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
444 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
445 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
446 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
447 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
448 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
449 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
450 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
451 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
452 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
453 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
454 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
455 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
456 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
457 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
458 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
459 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
460 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
461 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
462 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
463 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
464 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
465 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
466 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
467 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
468 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
469 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
470 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
471 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
472 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
473 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
474 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
475 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
476 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
477 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
478 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
479 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
480 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
481 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
482 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
483 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
484 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
485 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
486 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
487 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
488 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
489 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
490 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
491 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
492 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
493 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
494 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
495 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
496 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
497 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
498 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
499 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
500 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
501 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
502 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
503 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
504 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
505 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
506 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
507 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
508 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
509 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
510 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
511 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
512 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
513 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
514 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
515 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
516 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
517 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
518 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
519 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
520 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
521 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
522 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
523 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
524 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
525 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
526 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
527 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
528 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
531 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
532 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
533 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
535 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
536 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
537 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
538 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
539 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
540 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
541 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
542 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
543 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
544 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
545 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
546 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
547 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
548 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
549 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
550 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
551 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
552 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
554 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
555 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
556 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
557 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
558 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
559 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
560 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
561 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
562 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
563 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
564 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
565 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
566 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
567 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
568 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
569 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
570 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
571 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
572 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
573 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
574 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
576 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
578 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
579 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
580 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
581 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.33
Metatranscriptomes 0.5
Isolates 32.17

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 8.07
Nodule 26.46
Rhizoplane 3.6
Rhizosphere 54.29
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1053217 2162886007 Bacteria 937
2 JGI24739J22299_10021846 3300001989 Bacteria 2274
3 JGI25152J39213_1003305 3300002773 Bacteria 5566
4 JGI25150J39212_1001863 3300002774 Bacteria 5566
5 JGI25159J45721_1003478 3300002987 Bacteria 5558
6 JGI25159J45721_1005737 3300002987 Bacteria 3844
7 JGI25151J46595_10000429 3300003187 Bacteria 41718
8 JGI25151J46595_10009456 3300003187 Bacteria 4614
9 JGI25153J46596_10009233 3300003215 Bacteria 4614
10 JGI25160J50197_1006724 3300003354 Bacteria 4614
11 JGI25161J50226_1002548 3300003374 Bacteria 4610
12 JGI25404J52841_10004368 3300003659 Bacteria 2859
13 Ga0055526_1009636 3300003771 Bacteria 4614
14 Ga0055537_1003708 3300003773 Bacteria 4614
15 Ga0055524_1007517 3300003775 Bacteria 4614
16 Ga0055534_1003816 3300003784 Bacteria 4614
17 Ga0055528_1007964 3300003790 Bacteria 4614
18 Ga0055531_10010117 3300003794 Bacteria 4734
19 Ga0058692_1000031 3300003856 Bacteria 188488
20 Ga0055543_1001596 3300004625 Bacteria 8706
21 Ga0065165_1006794 3300005262 Bacteria 5845
22 Ga0065704_10136423 3300005289 Bacteria 1566
23 Ga0065715_10270724 3300005293 Bacteria 1112
24 Ga0065715_10358234 3300005293 Bacteria 940
25 Ga0065707_10218408 3300005295 Bacteria 1235
26 Ga0070658_10002319 3300005327 Bacteria 15978
27 Ga0070683_100066981 3300005329 Bacteria 3344
28 Ga0070690_100085605 3300005330 Bacteria 2068
29 Ga0070690_100245131 3300005330 Bacteria 1265
30 Ga0070670_100002932 3300005331 Bacteria 14123
31 Ga0070670_100254601 3300005331 Bacteria 1530
32 Ga0070680_100060440 3300005336 Bacteria 3101
33 Ga0070680_100100163 3300005336 Bacteria 2405
34 Ga0068868_100180245 3300005338 Bacteria 1752
35 Ga0068868_100300150 3300005338 Bacteria 1364
36 Ga0070689_100118202 3300005340 Bacteria 2115
37 Ga0070689_100378338 3300005340 Bacteria 1193
38 Ga0070661_100004790 3300005344 Bacteria 9318
39 Ga0070661_100009092 3300005344 Bacteria 6872
40 Ga0070668_100001538 3300005347 Bacteria 16641
41 Ga0070675_100068054 3300005354 Bacteria 2948
42 Ga0070674_100048218 3300005356 Bacteria 2923
43 Ga0070673_100084974 3300005364 Bacteria 2575
44 Ga0070688_100069052 3300005365 Bacteria 2255
45 Ga0070688_100199772 3300005365 Bacteria 1398
46 Ga0070667_100043458 3300005367 Bacteria 3771
47 Ga0070694_100041430 3300005444 Bacteria 3073
48 Ga0070678_100181311 3300005456 Bacteria 1724
49 Ga0070678_100229328 3300005456 Bacteria 1547
50 Ga0070678_100422966 3300005456 Bacteria 1162
51 Ga0070662_100041549 3300005457 Bacteria 3281
52 Ga0070662_100413343 3300005457 Bacteria 1115
53 Ga0068867_100012518 3300005459 Bacteria 6003
54 Ga0068867_100034317 3300005459 Bacteria 3677
55 Ga0068867_100106014 3300005459 Bacteria 2152
56 Ga0070685_10002961 3300005466 Bacteria 8670
57 Ga0070706_100055825 3300005467 Bacteria 3646
58 Ga0070706_100603723 3300005467 Bacteria 1020
59 Ga0070698_100046656 3300005471 Bacteria 4430
60 Ga0070699_100115877 3300005518 Bacteria 2354
61 Ga0070684_100007310 3300005535 Bacteria 8582
62 Ga0070697_100096800 3300005536 Bacteria 2449
63 Ga0068853_100048814 3300005539 Bacteria 3636
64 Ga0068853_100059078 3300005539 Bacteria 3312
65 Ga0068853_100110335 3300005539 Bacteria 2443
66 Ga0068853_100279474 3300005539 Bacteria 1539
67 Ga0068853_100309546 3300005539 Bacteria 1462
68 Ga0070672_100001670 3300005543 Bacteria 13824
69 Ga0070672_100016821 3300005543 Bacteria 5246
70 Ga0070672_100374412 3300005543 Bacteria 1217
71 Ga0070686_100097071 3300005544 Bacteria 1983
72 Ga0070695_100329651 3300005545 Bacteria 1137
73 Ga0070695_100425536 3300005545 Bacteria 1012
74 Ga0070696_100126591 3300005546 Bacteria 1854
75 Ga0070696_100154102 3300005546 Bacteria 1689
76 Ga0070665_100005441 3300005548 Bacteria 13132
77 Ga0070665_100031591 3300005548 Bacteria 5330
78 Ga0070704_100076128 3300005549 Bacteria 2453
79 Ga0070704_100120331 3300005549 Bacteria 2016
80 Ga0068855_100000006 3300005563 Bacteria 298092
81 Ga0068855_100023209 3300005563 Bacteria 7432
82 Ga0068855_100069804 3300005563 Bacteria 4088
83 Ga0068855_100113643 3300005563 Bacteria 3106
84 Ga0068855_100694064 3300005563 Bacteria 1090
85 Ga0070664_100058712 3300005564 Bacteria 3272
86 Ga0068857_100011595 3300005577 Bacteria 7669
87 Ga0068854_100057311 3300005578 Bacteria 2810
88 Ga0068854_100340607 3300005578 Bacteria 1224
89 Ga0068856_100024483 3300005614 Bacteria 5878
90 Ga0068856_100307339 3300005614 Bacteria 1603
91 Ga0068852_100001922 3300005616 Bacteria 14156
92 Ga0068852_100014664 3300005616 Bacteria 6043
93 Ga0068852_100055850 3300005616 Bacteria 3410
94 Ga0068852_100067802 3300005616 Bacteria 3120
95 Ga0068852_100391162 3300005616 Bacteria 1366
96 Ga0068859_100004020 3300005617 Bacteria 14992
97 Ga0068859_100028791 3300005617 Bacteria 5570
98 Ga0068859_100216912 3300005617 Bacteria 2001
99 Ga0068859_100613945 3300005617 Bacteria 1180
100 Ga0068859_101148735 3300005617 Bacteria 855
101 Ga0068864_100001391 3300005618 Bacteria 20051
102 Ga0068864_100002912 3300005618 Bacteria 14157
103 Ga0068864_100267773 3300005618 Bacteria 1591
104 Ga0068861_100000210 3300005719 Bacteria 31407
105 Ga0068851_10086788 3300005834 Bacteria 1642
106 Ga0068870_10042500 3300005840 Bacteria 2367
107 Ga0068863_100002813 3300005841 Bacteria 17226
108 Ga0068863_100006041 3300005841 Bacteria 11881
109 Ga0068863_100019035 3300005841 Bacteria 6572
110 Ga0068858_100045566 3300005842 Bacteria 4065
111 Ga0068860_100004339 3300005843 Bacteria 14497
112 Ga0068860_100004940 3300005843 Bacteria 13590
113 Ga0068860_100140989 3300005843 Bacteria 2317
114 Ga0068860_100292283 3300005843 Bacteria 1595
115 Ga0068862_100004054 3300005844 Bacteria 12418
116 Ga0068862_100195797 3300005844 Bacteria 1820
117 Ga0081455_10000479 3300005937 Bacteria 51768
118 Ga0081455_10045769 3300005937 Bacteria 3804
119 Ga0081540_1064076 3300005983 Bacteria 1736
120 Ga0081539_10001648 3300005985 Bacteria 36250
121 Ga0081539_10017784 3300005985 Bacteria 4968
122 Ga0070717_10431301 3300006028 Bacteria 1186
123 Ga0075365_10106496 3300006038 Bacteria 1924
124 Ga0075368_10035856 3300006042 Bacteria 1937
125 Ga0075368_10092812 3300006042 Bacteria 1235
126 Ga0075363_100020064 3300006048 Bacteria 3349
127 Ga0075363_100026566 3300006048 Bacteria 2963
128 Ga0075362_10000592 3300006177 Bacteria 10626
129 Ga0075362_10005194 3300006177 Bacteria 4745
130 Ga0075367_10000751 3300006178 Bacteria 12637
131 Ga0075367_10152724 3300006178 Bacteria 1433
132 Ga0075369_10000268 3300006186 Bacteria 15479
133 Ga0075366_10057364 3300006195 Bacteria 2314
134 Ga0097621_100134741 3300006237 Bacteria 2106
135 Ga0075370_10038622 3300006353 Bacteria 2687
136 Ga0075370_10069612 3300006353 Bacteria 2011
137 Ga0075370_10220538 3300006353 Bacteria 1121
138 Ga0068871_100124136 3300006358 Bacteria 2184
139 Ga0075433_10291310 3300006852 Bacteria 1446
140 Ga0075434_100058662 3300006871 Bacteria 3825
141 Ga0075429_100079383 3300006880 Bacteria 2861
142 Ga0068865_100025074 3300006881 Bacteria 3919
143 Ga0075436_100011403 3300006914 Bacteria 6103
144 Ga0075436_100014247 3300006914 Bacteria 5444
145 Ga0097620_100004020 3300006931 Bacteria 14992
146 Ga0097620_100028791 3300006931 Bacteria 5570
147 Ga0097620_100216899 3300006931 Bacteria 2001
148 Ga0097620_100613990 3300006931 Bacteria 1180
149 Ga0097620_101148542 3300006931 Bacteria 855
150 Ga0079104_1014959 3300006946 Bacteria 2320
151 Ga0075435_100007808 3300007076 Bacteria 7650
152 Ga0105244_10079869 3300009036 Bacteria 1620
153 Ga0105240_10000080 3300009093 Bacteria 195633
154 Ga0111539_10220614 3300009094 Bacteria 2208
155 Ga0111539_10261159 3300009094 Bacteria 2016
156 Ga0111539_10522854 3300009094 Bacteria 1382
157 Ga0114129_10240633 3300009147 Bacteria 2433
158 Ga0105241_10003718 3300009174 Bacteria 11328
159 Ga0105241_10424753 3300009174 Bacteria 1170
160 Ga0105242_10155099 3300009176 Bacteria 2000
161 Ga0105237_10008317 3300009545 Bacteria 11257
162 Ga0105237_10013907 3300009545 Bacteria 8421
163 Ga0105237_10297551 3300009545 Bacteria 1617
164 Ga0105238_10000677 3300009551 Bacteria 35835
165 Ga0105238_10009692 3300009551 Bacteria 9642
166 Ga0105238_10048290 3300009551 Bacteria 4291
167 Ga0105238_10166261 3300009551 Bacteria 2182
168 Ga0105238_10244661 3300009551 Bacteria 1771
169 Ga0105249_10194867 3300009553 Bacteria 1980
170 Ga0105249_10603599 3300009553 Bacteria 1152
171 Ga0105239_10001550 3300010375 Bacteria 30371
172 Ga0105239_10025620 3300010375 Bacteria 6494
173 Ga0105239_10117384 3300010375 Bacteria 2953
174 Ga0105239_10388697 3300010375 Bacteria 1578
175 Ga0105239_10393998 3300010375 Bacteria 1567
176 Ga0105239_10654371 3300010375 Bacteria 1200
177 Ga0105246_10009952 3300011119 Bacteria 5866
178 Ga0157346_1001597 3300012480 Bacteria 1093
179 Ga0157373_10018460 3300013100 Bacteria 5078
180 Ga0157371_10114508 3300013102 Bacteria 1915
181 Ga0157371_10124379 3300013102 Bacteria 1834
182 Ga0157371_10147773 3300013102 Bacteria 1676
183 Ga0157370_10092714 3300013104 Bacteria 2835
184 Ga0157370_10281549 3300013104 Bacteria 1536
185 Ga0157369_10003606 3300013105 Bacteria 18398
186 Ga0157369_10006059 3300013105 Bacteria 14033
187 Ga0157369_10044850 3300013105 Bacteria 4811
188 Ga0157369_10591869 3300013105 Bacteria 1145
189 Ga0157378_10009890 3300013297 Bacteria 8312
190 Ga0157375_10015650 3300013308 Bacteria 6793
191 Ga0163163_10000041 3300014325 Bacteria 142066
192 Ga0163163_10001081 3300014325 Bacteria 23120
193 Ga0163163_10020198 3300014325 Bacteria 6269
194 Ga0163163_10198315 3300014325 Bacteria 2055
195 Ga0157380_10090380 3300014326 Bacteria 2526
196 Ga0157379_10003245 3300014968 Bacteria 13798
197 Ga0157379_10079007 3300014968 Bacteria 2947
198 Ga0157379_10261222 3300014968 Bacteria 1573
199 Ga0157379_10480958 3300014968 Bacteria 1149
200 Ga0157376_10053276 3300014969 Bacteria 3368
201 Ga0182006_1003007 3300015261 Bacteria 8869
202 Ga0182006_1018903 3300015261 Bacteria 2907
203 Ga0183362_10001 3300015683 Bacteria 2046624
204 Ga0213876_10001143 3300021384 Bacteria 16854
205 Ga0213876_10154618 3300021384 Bacteria 1220
206 Ga0213875_10122254 3300021388 Bacteria 1216
207 Ga0209436_114655 3300025208 Bacteria 1241
208 Ga0207425_1001080 3300025245 Bacteria 12404
209 Ga0209129_1000023 3300025258 Bacteria 420646
210 Ga0209565_1000125 3300025263 Bacteria 110485
211 Ga0209673_1002969 3300025273 Bacteria 10598
212 Ga0209130_1000069 3300025284 Bacteria 179177
213 Ga0209675_1000427 3300025291 Bacteria 34021
214 Ga0209025_1000282 3300025294 Bacteria 115627
215 Ga0209025_1000316 3300025294 Bacteria 107447
216 Ga0209564_1000270 3300025295 Bacteria 108503
217 Ga0209758_1000064 3300025297 Bacteria 311812
218 Ga0209050_1002684 3300025298 Bacteria 14503
219 Ga0209256_1000020 3300025299 Bacteria 542402
220 Ga0207426_1000001 3300025302 Bacteria 1341301
221 Ga0209051_1002758 3300025303 Bacteria 12132
222 Ga0209051_1022726 3300025303 Bacteria 2630
223 Ga0209257_1002269 3300025304 Bacteria 19614
224 Ga0207642_10123973 3300025899 Bacteria 1337
225 Ga0207643_10048399 3300025908 Bacteria 2408
226 Ga0207705_10001097 3300025909 Bacteria 21979
227 Ga0207684_10300634 3300025910 Bacteria 1384
228 Ga0207684_10606527 3300025910 Bacteria 935
229 Ga0207654_10139725 3300025911 Bacteria 1543
230 Ga0207707_10016035 3300025912 Bacteria 6534
231 Ga0207695_10000004 3300025913 Bacteria 1288665
232 Ga0207695_10003360 3300025913 Bacteria 22614
233 Ga0207695_10303832 3300025913 Bacteria 1487
234 Ga0207695_10435464 3300025913 Bacteria 1195
235 Ga0207695_10453034 3300025913 Bacteria 1166
236 Ga0207671_10052369 3300025914 Bacteria 3025
237 Ga0207671_10070925 3300025914 Bacteria 2598
238 Ga0207671_10081624 3300025914 Bacteria 2425
239 Ga0207662_10329665 3300025918 Bacteria 1021
240 Ga0207649_10016306 3300025920 Bacteria 4186
241 Ga0207649_10546663 3300025920 Bacteria 886
242 Ga0207652_10068548 3300025921 Bacteria 3078
243 Ga0207681_10028880 3300025923 Bacteria 3596
244 Ga0207681_10159531 3300025923 Bacteria 1698
245 Ga0207694_10000014 3300025924 Bacteria 374435
246 Ga0207694_10007643 3300025924 Bacteria 8188
247 Ga0207694_10008420 3300025924 Bacteria 7783
248 Ga0207694_10078789 3300025924 Bacteria 2583
249 Ga0207694_10132622 3300025924 Bacteria 1998
250 Ga0207650_10031394 3300025925 Bacteria 3836
251 Ga0207650_10406962 3300025925 Bacteria 1127
252 Ga0207659_10034680 3300025926 Bacteria 3482
253 Ga0207659_10334682 3300025926 Bacteria 1252
254 Ga0207706_10412605 3300025933 Bacteria 1170
255 Ga0207686_10322658 3300025934 Bacteria 1154
256 Ga0207709_10186550 3300025935 Bacteria 1469
257 Ga0207670_10386106 3300025936 Bacteria 1116
258 Ga0207669_10271296 3300025937 Bacteria 1274
259 Ga0207704_10141287 3300025938 Bacteria 1685
260 Ga0207691_10010252 3300025940 Bacteria 8990
261 Ga0207691_10028031 3300025940 Bacteria 5277
262 Ga0207691_10057154 3300025940 Bacteria 3552
263 Ga0207691_10249669 3300025940 Bacteria 1532
264 Ga0207691_10711330 3300025940 Bacteria 847
265 Ga0207711_10069135 3300025941 Bacteria 3060
266 Ga0207711_10234899 3300025941 Bacteria 1680
267 Ga0207661_10497714 3300025944 Bacteria 1113
268 Ga0207679_10193858 3300025945 Bacteria 1692
269 Ga0207679_10226009 3300025945 Bacteria 1577
270 Ga0207679_10294590 3300025945 Bacteria 1396
271 Ga0207667_10000202 3300025949 Bacteria 86408
272 Ga0207667_10005447 3300025949 Bacteria 15517
273 Ga0207651_10378739 3300025960 Bacteria 1199
274 Ga0207668_10003142 3300025972 Bacteria 9665
275 Ga0207668_10073153 3300025972 Bacteria 2455
276 Ga0207640_10436875 3300025981 Bacteria 1075
277 Ga0207640_10483535 3300025981 Bacteria 1027
278 Ga0207640_10492857 3300025981 Bacteria 1019
279 Ga0207658_10003586 3300025986 Bacteria 10963
280 Ga0207658_10115692 3300025986 Bacteria 2129
281 Ga0207677_10128286 3300026023 Bacteria 1921
282 Ga0207677_10354238 3300026023 Bacteria 1231
283 Ga0207703_10048586 3300026035 Bacteria 3426
284 Ga0207703_10072360 3300026035 Bacteria 2849
285 Ga0207639_10062145 3300026041 Bacteria 2886
286 Ga0207639_10242054 3300026041 Bacteria 1569
287 Ga0207702_10210097 3300026078 Bacteria 1809
288 Ga0207641_10003697 3300026088 Bacteria 13474
289 Ga0207641_10010598 3300026088 Bacteria 7563
290 Ga0207641_10014858 3300026088 Bacteria 6382
291 Ga0207641_10257139 3300026088 Bacteria 1633
292 Ga0207641_10299875 3300026088 Bacteria 1517
293 Ga0207648_10000442 3300026089 Bacteria 45913
294 Ga0207648_10016794 3300026089 Bacteria 6675
295 Ga0207648_10174590 3300026089 Bacteria 1900
296 Ga0207648_10297682 3300026089 Bacteria 1446
297 Ga0207676_10174433 3300026095 Bacteria 1876
298 Ga0207676_10215106 3300026095 Bacteria 1708
299 Ga0207676_10614417 3300026095 Bacteria 1045
300 Ga0207674_10013821 3300026116 Bacteria 8931
301 Ga0207674_10034700 3300026116 Bacteria 5271
302 Ga0207675_100000633 3300026118 Bacteria 34481
303 Ga0207675_100169465 3300026118 Bacteria 2086
304 Ga0207675_100782575 3300026118 Bacteria 967
305 Ga0207683_10118547 3300026121 Bacteria 2374
306 Ga0207683_10148835 3300026121 Bacteria 2112
307 Ga0207683_10267661 3300026121 Bacteria 1561
308 Ga0207683_10546619 3300026121 Bacteria 1071
309 Ga0207698_10003027 3300026142 Bacteria 10076
310 Ga0207698_10021921 3300026142 Bacteria 4428
311 Ga0207698_10058457 3300026142 Bacteria 2988
312 Ga0209281_1000190 3300027111 Bacteria 140658
313 Ga0209371_1000004 3300027312 Bacteria 1098197
314 Ga0268266_10018802 3300028379 Bacteria 5888
315 Ga0268265_10003872 3300028380 Bacteria 10569
316 Ga0268265_10119814 3300028380 Bacteria 2166
317 Ga0268265_10399006 3300028380 Bacteria 1271
318 Ga0268264_10002795 3300028381 Bacteria 15247
319 Ga0268264_10006716 3300028381 Bacteria 9669
320 Ga0268264_10489755 3300028381 Bacteria 1197
321 Ga0268256_1000005 3300030500 Bacteria 1082342
322 Ga0265332_10198066 3300031238 Bacteria 835
323 Ga0307508_10001988 3300031616 Bacteria 22347
324 Ga0316575_10083463 3300031665 Bacteria 1290
325 Ga0316576_10391552 3300031727 Bacteria 1031
326 Ga0307516_10052976 3300031730 Bacteria 3970
327 Ga0307516_10345959 3300031730 Bacteria 1153
328 Ga0307405_10306417 3300031731 Bacteria 1207
329 Ga0307412_10002067 3300031911 Bacteria 11137
330 Ga0307412_10093720 3300031911 Bacteria 2107
331 Ga0307409_100018422 3300031995 Bacteria 4695
332 Ga0307414_10015522 3300032004 Bacteria 4598
333 Ga0307414_10152700 3300032004 Bacteria 1824
334 Ga0307411_10000177 3300032005 Bacteria 20429
335 Ga0373926_0000848 3300035083 Bacteria 8714
336 Ga0373944_0007159 3300035089 Bacteria 2983
337 Ga0373923_0022370 3300035111 Bacteria 2479
338 Ga0373936_0017975 3300035113 Bacteria 2727
339 Ga0373936_0022446 3300035113 Bacteria 2457
340 Ga0373945_0002899 3300035116 Bacteria 5387
341 Ga0373954_0003556 3300035118 Bacteria 6623
342 Ga0373943_0007874 3300035170 Bacteria 4782
343 Ga0373946_0006412 3300035171 Bacteria 4265
344 Ga0316574_0042754 3300035398 Bacteria 2798
345 Ga0373924_0047336 3300035410 Bacteria 1774
346 Ga0373935_0080692 3300035692 Bacteria 2113
347 Ga0373927_0005282 3300035695 Bacteria 8932
348 Ga0373937_0028390 3300036401 Bacteria 5063
349 Ga0373925_0128015 3300037068 Bacteria 1977
350 Ga0373925_0231858 3300037068 Bacteria 1476
351 Ga0395899_0001843 3300037312 Bacteria 17548
352 Ga0395899_0255571 3300037312 Bacteria 1201
353 Ga0395900_0050886 3300037418 Bacteria 4267
354 Ga0395900_0084466 3300037418 Bacteria 3262
355 Ga0395905_0000240 3300037471 Bacteria 83076
356 Ga0395905_0057254 3300037471 Bacteria 3646
357 Ga0395905_0105782 3300037471 Bacteria 2642
358 Ga0395905_0132923 3300037471 Bacteria 2340
359 Ga0395905_0147579 3300037471 Bacteria 2213
360 Ga0395905_0253586 3300037471 Bacteria 1643
361 Ga0436364_0448854 3300037853 Bacteria 1765
362 Ga0436364_1128088 3300037853 Bacteria 1630
363 Ga0395901_0008600 3300038443 Bacteria 10318
364 Ga0395901_0126475 3300038443 Bacteria 2686
365 Ga0400486_32500 3300038742 Bacteria 12964
366 Ga0400483_051191 3300039062 Bacteria 33178
367 Ga0436365_0188102 3300039437 Bacteria 1808
368 Ga0436365_1008718 3300039437 Bacteria 26666
369 Ga0436365_1287200 3300039437 Bacteria 1639
370 Ga0436360_0523611 3300039438 Bacteria 1085
371 Ga0450911_000674 3300042115 Bacteria 10220
372 Ga0450914_001479 3300042118 Bacteria 1484
373 Ga0450917_000111 3300042120 Bacteria 5068
374 Ga0450888_000489 3300042126 Bacteria 3748
375 Ga0450892_000732 3300042130 Bacteria 3651
376 Ga0450904_008366 3300042139 Bacteria 1022
377 Ga0439459_0004349 3300042438 Bacteria 2278
378 Ga0439464_0003570 3300042439 Bacteria 3935
379 Ga0450893_0000735 3300042532 Bacteria 4786
380 Ga0451577_0003441 3300042876 Bacteria 17626
381 Ga0451577_0003691 3300042876 Bacteria 16761
382 Ga0451577_0341112 3300042876 Bacteria 1359
383 Ga0466965_0003446 3300044683 Bacteria 6937
384 Ga0466965_0042398 3300044683 Bacteria 2245
385 Ga0466964_0072282 3300044706 Bacteria 1461
386 Ga0466964_0090233 3300044706 Bacteria 1332
387 Ga0453684_0000136 3300044712 Bacteria 323402
388 Ga0453684_0051158 3300044712 Bacteria 5421
389 Ga0453684_0062516 3300044712 Bacteria 4768
390 Ga0453684_0831041 3300044712 Bacteria 994
391 Ga0466959_0063789 3300045049 Bacteria 2675
392 Ga0451576_0000025 3300045051 Bacteria 427980
393 Ga0495592_0000293 3300046454 Bacteria 42689
394 Ga0495603_0008625 3300046455 Bacteria 6160
395 Ga0495590_0024270 3300046457 Bacteria 2137
396 Ga0495629_0087079 3300046459 Bacteria 2179
397 Ga0495580_0031658 3300046472 Bacteria 3820
398 Ga0495639_0003893 3300046475 Bacteria 6413
399 Ga0495639_0025708 3300046475 Bacteria 2598
400 Ga0495610_0015537 3300046512 Bacteria 4419
401 Ga0495628_0011094 3300046516 Bacteria 7626
402 Ga0495663_0001336 3300046525 Bacteria 7791
403 Ga0495652_0014531 3300046529 Bacteria 7064
404 Ga0495586_0070146 3300046535 Bacteria 1913
405 Ga0495621_0067278 3300046539 Bacteria 1312
406 Ga0495621_0074666 3300046539 Bacteria 1255
407 Ga0495645_0003276 3300046543 Bacteria 10977
408 Ga0495633_0001222 3300046558 Bacteria 20656
409 Ga0495633_0006199 3300046558 Bacteria 7143
410 Ga0495635_0201292 3300046663 Bacteria 1351
411 Ga0495599_0000231 3300046678 Bacteria 35177
412 Ga0495599_0006954 3300046678 Bacteria 6842
413 Ga0495647_0001675 3300046681 Bacteria 6865
414 Ga0495658_0012044 3300046683 Bacteria 4368
415 Ga0495624_0132983 3300046690 Bacteria 1525
416 Ga0495649_0062453 3300046694 Bacteria 2002
417 Ga0495589_0056921 3300046794 Bacteria 1924
418 Ga0495581_0077391 3300047315 Bacteria 1925
419 Ga0495676_0119158 3300047321 Bacteria 1923
420 Ga0495673_0000002 3300047469 Bacteria 1499170
421 Ga0495686_0000871 3300047472 Bacteria 38467
422 Ga0495686_0030557 3300047472 Bacteria 3498
423 Ga0495686_0145205 3300047472 Bacteria 1397
424 Ga0496101_0442662 3300048904 Bacteria 1025
425 Ga0496101_0576035 3300048904 Bacteria 890
426 Ga0496102_0005345 3300048905 Bacteria 10902
427 Ga0496102_0018775 3300048905 Bacteria 6082
428 Ga0496102_0095744 3300048905 Bacteria 2752
429 Ga0496103_0122622 3300048906 Bacteria 1656
430 Ga0496104_0005026 3300048907 Bacteria 11538
431 Ga0496104_0569259 3300048907 Bacteria 1043
432 Ga0496105_0000617 3300048908 Bacteria 23823
433 Ga0496105_0181504 3300048908 Bacteria 1723
434 Ga0496106_0331178 3300048909 Bacteria 1222
435 Ga0496108_0090032 3300048911 Bacteria 2608
436 Ga0496108_0193644 3300048911 Bacteria 1763
437 Ga0496109_0032286 3300048912 Bacteria 4706
438 Ga0496109_0091871 3300048912 Bacteria 2807
439 Ga0496110_0258946 3300048913 Bacteria 1583
440 Ga0496110_0435795 3300048913 Bacteria 1194
441 Ga0496110_0470236 3300048913 Bacteria 1145
442 Ga0496111_0031511 3300048914 Bacteria 3777
443 Ga0496111_0081056 3300048914 Bacteria 2369
444 Ga0496111_0283679 3300048914 Bacteria 1228
445 Ga0496112_0161422 3300048915 Bacteria 2208
446 Ga0496112_0204053 3300048915 Bacteria 1935
447 Ga0496112_0466289 3300048915 Bacteria 1200
448 Ga0496113_0068364 3300048916 Bacteria 2695
449 Ga0496113_0364873 3300048916 Bacteria 1159
450 Ga0496115_0024616 3300048918 Bacteria 4682
451 Ga0496116_0000370 3300048919 Bacteria 67584
452 Ga0496117_0000576 3300048920 Bacteria 60256
453 Ga0496118_0000371 3300048921 Bacteria 75491
454 Ga0496118_0017779 3300048921 Bacteria 6453
455 Ga0496121_0004954 3300048924 Bacteria 17469
456 Ga0496121_0024253 3300048924 Bacteria 5810
457 Ga0496122_0061643 3300048925 Bacteria 2751
458 Ga0496123_0180916 3300048926 Bacteria 1101
459 Ga0496124_0081686 3300048927 Bacteria 2655
460 Ga0495682_0000505 3300049460 Bacteria 27003
461 Ga0501032_0000455 3300049569 Bacteria 32997
462 Ga0501032_0167747 3300049569 Bacteria 1440
463 Ga0501032_0410527 3300049569 Bacteria 869
464 Ga0501033_0022775 3300049570 Bacteria 4723
465 Ga0501034_0076986 3300049571 Bacteria 3342
466 Ga0501036_0020101 3300049572 Bacteria 5606
467 Ga0501036_0050044 3300049572 Bacteria 3539
468 Ga0501037_0009754 3300049573 Bacteria 7050
469 Ga0501037_0021919 3300049573 Bacteria 4729
470 Ga0501038_0030061 3300049574 Bacteria 4810
471 Ga0501038_0122249 3300049574 Bacteria 2145
472 Ga0501039_0139837 3300049575 Bacteria 1902
473 Ga0501039_0167430 3300049575 Bacteria 1728
474 Ga0501040_0002457 3300049576 Archaea 11932
475 Ga0501041_0000548 3300049577 Bacteria 19446
476 Ga0501042_0151904 3300049578 Bacteria 1670
477 Ga0501043_0009191 3300049579 Bacteria 7769
478 Ga0501043_0117157 3300049579 Bacteria 2090
479 Ga0501046_0008547 3300049580 Bacteria 8907
480 Ga0501047_0084384 3300049581 Bacteria 3053
481 Ga0501047_0120360 3300049581 Bacteria 2507
482 Ga0501067_0000100 3300049583 Bacteria 49264
483 Ga0501067_0038465 3300049583 Bacteria 2656
484 Ga0501068_0082864 3300049584 Bacteria 1971
485 Ga0501068_0315540 3300049584 Bacteria 1002
486 Ga0501070_0367814 3300049586 Bacteria 1166
487 Ga0501071_0026840 3300049587 Bacteria 4046
488 Ga0501071_0162196 3300049587 Bacteria 1671
489 Ga0501072_0130219 3300049588 Bacteria 2005
490 Ga0501073_0022766 3300049589 Bacteria 4507
491 Ga0501074_0014112 3300049590 Bacteria 5808
492 Ga0501076_0000971 3300049592 Bacteria 18783
493 Ga0501077_0026616 3300049593 Bacteria 3670
494 Ga0501077_0125964 3300049593 Bacteria 1624
495 Ga0501079_0000147 3300049741 Bacteria 38471
496 Ga0501080_0003502 3300049742 Bacteria 13821
497 Ga0501080_0020513 3300049742 Bacteria 6119
498 Ga0501080_0050530 3300049742 Bacteria 3869
499 Ga0501081_0018443 3300049743 Bacteria 4634
500 Ga0501083_0315549 3300049744 Bacteria 1017
501 Ga0501035_0166913 3300049822 Bacteria 1903
502 Ga0501035_0198283 3300049822 Bacteria 1723
503 Ga0501044_0013701 3300049823 Bacteria 8764
504 Ga0501044_0186545 3300049823 Bacteria 2038
505 Ga0501045_0018022 3300049824 Bacteria 5014
506 Ga0501045_0118835 3300049824 Bacteria 1962
507 nmdc:mga03683_288_c2 3300050489 Bacteria 14430
508 nmdc:mga03683_321_c2 3300050489 Bacteria 8139
509 nmdc:mga03n38_14834_c1 3300050490 Bacteria 2997
510 nmdc:mga03n38_59030_c1 3300050490 Bacteria 1740
511 nmdc:mga03n38_99601_c1 3300050490 Bacteria 1400
512 nmdc:mga0k408_202673_c1 3300050493 Bacteria 1184
513 nmdc:mga0k408_300415_c1 3300050493 Bacteria 958
514 nmdc:mga0k408_98519_c1 3300050493 Bacteria 1723
515 nmdc:mga06z11_22064_c1 3300050494 Bacteria 2967
516 nmdc:mga04h51_21402_c1 3300050495 Bacteria 1945
517 nmdc:mga07m45_204907_c1 3300050496 Bacteria 1147
518 nmdc:mga05p37_285320_c1 3300050507 Bacteria 1967
519 nmdc:mga05p37_679072_c1 3300050507 Bacteria 1148
520 nmdc:mga06r32_457210_c1 3300050510 Bacteria 1256
521 nmdc:mga08y16_470344_c1 3300050511 Bacteria 1280
522 nmdc:mga0n895_148411_c1 3300050512 Bacteria 2374
523 nmdc:mga0n895_196284_c1 3300050512 Bacteria 2049
524 nmdc:mga0n895_60300_c1 3300050512 Bacteria 3744
525 nmdc:mga0rr50_31415_c1 3300050513 Bacteria 3771
526 nmdc:mga08x19_128439_c1 3300050514 Bacteria 1703
527 nmdc:mga08x19_3651_c1 3300050514 Bacteria 7348
528 nmdc:mga0sz30_3615_c1 3300050516 Bacteria 5578
529 nmdc:mga0sz30_7748_c1 3300050516 Bacteria 3624
530 Ga0495595_0110564 3300053084 Bacteria 1332
531 Ga0495619_0022890 3300053085 Bacteria 4000
532 Ga0495619_0032309 3300053085 Bacteria 3396
533 Ga0500568_0012280 3300053139 Bacteria 3945
534 Ga0500568_0043457 3300053139 Bacteria 1796
535 Ga0500552_000157 3300053733 Bacteria 5908
536 Ga0501084_0003530 3300054114 Bacteria 12696
537 Ga0500661_005526 3300055283 Bacteria 2359
538 Ga0587084_012452 3300059477 Bacteria 1152
539 Ga0587077_029854 3300059493 Bacteria 1031
540 Ga0587085_012040 3300059506 Bacteria 1179
541 Ga0587069_002460 3300059642 Bacteria 1870
542 Ga0501082_0028643 3300060353 Bacteria 4798
543 Ga0501082_0198207 3300060353 Bacteria 1747
544 Ga0501082_0327382 3300060353 Bacteria 1335
545 Ga0501082_0607327 3300060353 Bacteria 957
546 Ga0501082_0633150 3300060353 Bacteria 936

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0018775 Ga0496102_0018775_4319_5101 213
2 3300048915 Ga0496112_0161422 Ga0496112_0161422_735_1517 213
3 3300048916 Ga0496113_0364873 Ga0496113_0364873_330_1112 213
4 3300031911 Ga0307412_10093720 Ga0307412_100937202 214
5 3300005347 Ga0070668_100001538 Ga0070668_10000153813 215
6 3300005356 Ga0070674_100048218 Ga0070674_1000482183 215
7 3300005459 Ga0068867_100106014 Ga0068867_1001060143 215
8 3300009094 Ga0111539_10522854 Ga0111539_105228542 215
9 3300014326 Ga0157380_10090380 Ga0157380_100903803 215
10 3300025923 Ga0207681_10159531 Ga0207681_101595311 215
11 3300025937 Ga0207669_10271296 Ga0207669_102712962 215
12 3300025940 Ga0207691_10057154 Ga0207691_100571543 215
13 3300025972 Ga0207668_10003142 Ga0207668_100031429 215
14 3300026089 Ga0207648_10174590 Ga0207648_101745901 215
15 3300028380 Ga0268265_10119814 Ga0268265_101198143 215
16 3300050511 nmdc:mga08y16_470344_c1 nmdc:mga08y16_470344_c1_435_1217 215
17 3300005549 Ga0070704_100076128 Ga0070704_1000761282 216
18 3300049576 Ga0501040_0002457 Ga0501040_0002457_5546_6325 217
19 3300006038 Ga0075365_10106496 Ga0075365_101064962 218
20 3300006880 Ga0075429_100079383 Ga0075429_1000793832 218
21 3300050507 nmdc:mga05p37_679072_c1 nmdc:mga05p37_679072_c1_141_947 218
22 3300050510 nmdc:mga06r32_457210_c1 nmdc:mga06r32_457210_c1_38_844 218
23 3300042438 Ga0439459_0004349 Ga0439459_0004349_82_849 222
24 iso_pu_bacteria 2921296804 2921303909 222
25 3300042118 Ga0450914_001479 Ga0450914_001479_633_1403 223
26 3300042120 Ga0450917_000111 Ga0450917_000111_4048_4818 223
27 3300042126 Ga0450888_000489 Ga0450888_000489_2588_3358 223
28 3300042130 Ga0450892_000732 Ga0450892_000732_2589_3359 223
29 3300042532 Ga0450893_0000735 Ga0450893_0000735_1639_2409 223
30 3300032004 Ga0307414_10015522 Ga0307414_100155223 224
31 3300032005 Ga0307411_10000177 Ga0307411_1000017719 224
32 3300009174 Ga0105241_10424753 Ga0105241_104247532 226
33 3300025910 Ga0207684_10606527 Ga0207684_106065272 226
34 iso_pu_bacteria 2508501050 2508727647 226
35 3300037471 Ga0395905_0105782 Ga0395905_0105782_20_790 227
36 3300053139 Ga0500568_0012280 Ga0500568_0012280_1812_2594 227
37 3300031995 Ga0307409_100018422 Ga0307409_1000184223 229
38 3300055283 Ga0500661_005526 Ga0500661_005526_1048_1830 229
39 3300049584 Ga0501068_0315540 Ga0501068_0315540_151_924 230
40 iso_pu_bacteria 2904479285 2904480721 230
41 iso_pu_bacteria 2919704043 2919704705 230
42 iso_pu_bacteria 2511231008 2511275974 231
43 iso_pu_bacteria 2919456309 2919460541 231
44 3300005841 Ga0068863_100019035 Ga0068863_1000190352 232
45 3300006237 Ga0097621_100134741 Ga0097621_1001347412 232
46 3300009551 Ga0105238_10009692 Ga0105238_100096926 232
47 3300014969 Ga0157376_10053276 Ga0157376_100532762 232
48 3300025924 Ga0207694_10007643 Ga0207694_100076436 232
49 3300026088 Ga0207641_10257139 Ga0207641_102571392 232
50 iso_pu_bacteria 2510065057 2510302744 232
51 iso_pu_bacteria 2511231052 2511497800 232
52 iso_pu_bacteria 2512047086 2512528809 232
53 iso_pu_bacteria 2513237086 2513584545 232
54 iso_pu_bacteria 2513237091 2513616441 232
55 iso_pu_bacteria 2513237140 2513885301 232
56 iso_pu_bacteria 2513237143 2513901990 232
57 iso_pu_bacteria 2516653046 2516896553 232
58 iso_pu_bacteria 2537561587 2537877184 232
59 iso_pu_bacteria 2551306084 2551681407 232
60 iso_pu_bacteria 2551306085 2551686228 232
61 iso_pu_bacteria 2551306086 2551693977 232
62 iso_pu_bacteria 2551306087 2551704173 232
63 iso_pu_bacteria 2551306089 2551709568 232
64 iso_pu_bacteria 2551306090 2551715841 232
65 iso_pu_bacteria 2551306091 2551725061 232
66 iso_pu_bacteria 2551306092 2551735627 232
67 iso_pu_bacteria 2551306093 2551745806 232
68 iso_pu_bacteria 2599185305 2599958604 232
69 iso_pu_bacteria 2818991439 2819559259 232
70 iso_pu_bacteria 2841859092 2841862331 232
71 iso_pu_bacteria 2842515876 2842519115 232
72 iso_pu_bacteria 2855825444 2855828619 232
73 iso_pu_bacteria 2855839649 2855843740 232
74 iso_pu_bacteria 2858800743 2858807015 232
75 iso_pu_bacteria 2915986958 2915988495 232
76 iso_pu_bacteria 2915993759 2915994228 232
77 iso_pu_bacteria 2916000859 2916006243 232
78 iso_pu_bacteria 2916007675 2916011325 232
79 iso_pu_bacteria 2916014648 2916021532 232
80 iso_pu_bacteria 2916021584 2916028146 232
81 iso_pu_bacteria 2916028427 2916035062 232
82 iso_pu_bacteria 2916035215 2916038250 232
83 iso_pu_bacteria 2916041962 2916044978 232
84 iso_pu_bacteria 2916048683 2916054532 232
85 iso_pu_bacteria 2916055098 2916061163 232
86 iso_pu_bacteria 2916068649 2916070762 232
87 iso_pu_bacteria 2916076590 2916082947 232
88 iso_pu_bacteria 2921201388 2921203206 232
89 iso_pu_bacteria 2921208531 2921210118 232
90 iso_pu_bacteria 2921237296 2921240575 232
91 iso_pu_bacteria 2921244191 2921245778 232
92 iso_pu_bacteria 2921257292 2921260090 232
93 iso_pu_bacteria 2921263974 2921269982 232
94 iso_pu_bacteria 2921282425 2921283080 232
95 iso_pu_bacteria 2921289301 2921296784 232
96 iso_pu_bacteria 2924144063 2924148512 232
97 iso_pu_bacteria 2924150972 2924154717 232
98 iso_pu_bacteria 2924158325 2924164377 232
99 iso_pu_bacteria 2924165586 2924168394 232
100 iso_pu_bacteria 2924172951 2924178757 232
101 iso_pu_bacteria 2924179722 2924182081 232
102 iso_pu_bacteria 2924186466 2924188956 232
103 iso_pu_bacteria 2924193448 2924195807 232
104 iso_pu_bacteria 2924200457 2924202922 232
105 iso_pu_bacteria 2924207177 2924209956 232
106 iso_pu_bacteria 2924214083 2924217335 232
107 iso_pu_bacteria 2924221636 2924228297 232
108 iso_pu_bacteria 2924228884 2924235360 232
109 iso_pu_bacteria 2933011516 2933014712 232
110 iso_pu_bacteria 2937002841 2937005835 232
111 iso_pu_bacteria 2937009748 2937014328 232
112 iso_pu_bacteria 2937016420 2937021931 232
113 iso_pu_bacteria 2937023124 2937023987 232
114 iso_pu_bacteria 2937042894 2937049000 232
115 iso_pu_bacteria 2937049772 2937056418 232
116 iso_pu_bacteria 2937056579 2937056884 232
117 iso_pu_bacteria 2937063883 2937066055 232
118 iso_pu_bacteria 2937071275 2937075370 232
119 iso_pu_bacteria 2937091812 2937092613 232
120 iso_pu_bacteria 2937098957 2937100480 232
121 iso_pu_bacteria 2937106411 2937110495 232
122 iso_pu_bacteria 2937113482 2937118808 232
123 iso_pu_bacteria 2937119839 2937125847 232
124 iso_pu_bacteria 2937126314 2937131026 232
125 iso_pu_bacteria 2957382221 2957383033 232
126 iso_pu_bacteria 2957388812 2957391991 232
127 iso_pu_bacteria 2957395598 2957396234 232
128 iso_pu_bacteria 2957402308 2957402915 232
129 iso_pu_bacteria 2957408893 2957410687 232
130 iso_pu_bacteria 2957415311 2957416027 232
131 iso_pu_bacteria 2957422303 2957423392 232
132 iso_pu_bacteria 2957430029 2957430506 232
133 iso_pu_bacteria 2957443900 2957445240 232
134 iso_pu_bacteria 2957450854 2957454928 232
135 iso_pu_bacteria 2957457609 2957461778 232
136 iso_pu_bacteria 2957464669 2957464809 232
137 iso_pu_bacteria 2957471148 2957477905 232
138 iso_pu_bacteria 2957478035 2957484344 232
139 iso_pu_bacteria 2957484790 2957489988 232
140 iso_pu_bacteria 2957491536 2957491673 232
141 iso_pu_bacteria 2957498199 2957501662 232
142 iso_pu_bacteria 2957505466 2957510284 232
143 iso_pu_bacteria 2960584000 2960585044 232
144 iso_pu_bacteria 2960597568 2960598487 232
145 iso_pu_bacteria 2960603979 2960604553 232
146 iso_pu_bacteria 2960610863 2960614268 232
147 iso_pu_bacteria 2960617483 2960621867 232
148 iso_pu_bacteria 2960624210 2960630381 232
149 iso_pu_bacteria 2960637947 2960642832 232
150 iso_pu_bacteria 2960645483 2960645623 232
151 iso_pu_bacteria 2960652885 2960660095 232
152 iso_pu_bacteria 2960660292 2960661969 232
153 iso_pu_bacteria 2960667422 2960669791 232
154 iso_pu_bacteria 2960674078 2960677794 232
155 iso_pu_bacteria 2960687367 2960692964 232
156 iso_pu_bacteria 2964607997 2964610744 232
157 iso_pu_bacteria 2964615318 2964621673 232
158 iso_pu_bacteria 2964621998 2964624224 232
159 iso_pu_bacteria 2964628898 2964629908 232
160 iso_pu_bacteria 2964636051 2964639507 232
161 iso_pu_bacteria 2964643177 2964647942 232
162 iso_pu_bacteria 2964649959 2964655550 232
163 iso_pu_bacteria 2964656573 2964657987 232
164 iso_pu_bacteria 2964663802 2964664650 232
165 iso_pu_bacteria 2964670856 2964674150 232
166 iso_pu_bacteria 2964678106 2964678417 232
167 iso_pu_bacteria 2964685014 2964689260 232
168 iso_pu_bacteria 2964691889 2964696074 232
169 iso_pu_bacteria 2964698721 2964704962 232
170 iso_pu_bacteria 2964705432 2964709609 232
171 iso_pu_bacteria 2964712639 2964717591 232
172 iso_pu_bacteria 2964719344 2964720985 232
173 iso_pu_bacteria 2967664464 2967665640 232
174 iso_pu_bacteria 2967671571 2967677104 232
175 iso_pu_bacteria 2967678726 2967685673 232
176 iso_pu_bacteria 2967693043 2967697848 232
177 iso_pu_bacteria 2967699805 2967704421 232
178 iso_pu_bacteria 2967706974 2967714128 232
179 iso_pu_bacteria 2967714385 2967720925 232
180 iso_pu_bacteria 2967721400 2967725158 232
181 iso_pu_bacteria 2967735183 2967741859 232
182 iso_pu_bacteria 2967742019 2967748911 232
183 iso_pu_bacteria 2967748971 2967750877 232
184 iso_pu_bacteria 2967755722 2967761706 232
185 iso_pu_bacteria 2967762386 2967765991 232
186 iso_pu_bacteria 2967769361 2967772258 232
187 iso_pu_bacteria 2967775926 2967781978 232
188 iso_pu_bacteria 2970019648 2970023577 232
189 iso_pu_bacteria 2970033650 2970038279 232
190 iso_pu_bacteria 2970040964 2970042164 232
191 iso_pu_bacteria 2970047711 2970054843 232
192 iso_pu_bacteria 2970054988 2970061224 232
193 iso_pu_bacteria 2970061556 2970062938 232
194 iso_pu_bacteria 2970068827 2970071326 232
195 iso_pu_bacteria 2970076120 2970080292 232
196 iso_pu_bacteria 2970082768 2970085732 232
197 iso_pu_bacteria 2970088815 2970094722 232
198 iso_pu_bacteria 2970095765 2970097324 232
199 iso_pu_bacteria 2970102677 2970105865 232
200 iso_pu_bacteria 2970109326 2970116110 232
201 iso_pu_bacteria 2970116247 2970119639 232
202 iso_pu_bacteria 2970129317 2970134906 232
203 iso_pu_bacteria 2970136068 2970140927 232
204 iso_pu_bacteria 2970149975 2970153160 232
205 iso_pu_bacteria 2970156795 2970162978 232
206 iso_pu_bacteria 2970164137 2970164672 232
207 iso_pu_bacteria 2970170962 2970174338 232
208 iso_pu_bacteria 2970177841 2970182386 232
209 iso_pu_bacteria 2970184632 2970191258 232
210 iso_pu_bacteria 2970191845 2970194702 232
211 iso_pu_bacteria 2977516862 2977518771 232
212 iso_pu_bacteria 2977523885 2977526652 232
213 iso_pu_bacteria 2977537788 2977541295 232
214 iso_pu_bacteria 2977551784 2977557901 232
215 iso_pu_bacteria 2977558990 2977559543 232
216 iso_pu_bacteria 2977565890 2977569187 232
217 iso_pu_bacteria 2977572785 2977578697 232
218 iso_pu_bacteria 2977579622 2977585642 232
219 iso_pu_bacteria 2979100975 2979104114 232
220 iso_pu_bacteria 2984509177 2984511316 232
221 iso_pu_bacteria 2984518228 2984522323 232
222 iso_pu_bacteria 2984537506 2984541625 232
223 iso_pu_bacteria 2984601300 2984603898 232
224 iso_pu_bacteria 648276728 648740953 232
225 iso_pu_bacteria 8003992118 8003996300 232
226 3300046539 Ga0495621_0074666 Ga0495621_0074666_58_825 233
227 3300050490 nmdc:mga03n38_14834_c1 nmdc:mga03n38_14834_c1_1699_2469 233
228 3300002773 JGI25152J39213_1003305 JGI25152J39213_10033054 234
229 3300002774 JGI25150J39212_1001863 JGI25150J39212_10018634 234
230 3300002987 JGI25159J45721_1003478 JGI25159J45721_10034783 234
231 3300002987 JGI25159J45721_1005737 JGI25159J45721_10057374 234
232 3300003187 JGI25151J46595_10009456 JGI25151J46595_100094562 234
233 3300003215 JGI25153J46596_10009233 JGI25153J46596_100092332 234
234 3300003354 JGI25160J50197_1006724 JGI25160J50197_10067242 234
235 3300003374 JGI25161J50226_1002548 JGI25161J50226_10025482 234
236 3300003771 Ga0055526_1009636 Ga0055526_10096362 234
237 3300003773 Ga0055537_1003708 Ga0055537_10037082 234
238 3300003775 Ga0055524_1007517 Ga0055524_10075172 234
239 3300003784 Ga0055534_1003816 Ga0055534_10038163 234
240 3300003790 Ga0055528_1007964 Ga0055528_10079642 234
241 3300003794 Ga0055531_10010117 Ga0055531_100101174 234
242 3300004625 Ga0055543_1001596 Ga0055543_10015964 234
243 3300005262 Ga0065165_1006794 Ga0065165_10067944 234
244 3300013104 Ga0157370_10092714 Ga0157370_100927143 234
245 3300015683 Ga0183362_10001 Ga0183362_100011438 234
246 3300025208 Ga0209436_114655 Ga0209436_1146552 234
247 3300025245 Ga0207425_1001080 Ga0207425_10010808 234
248 3300025258 Ga0209129_1000023 Ga0209129_1000023139 234
249 3300025263 Ga0209565_1000125 Ga0209565_100012565 234
250 3300025273 Ga0209673_1002969 Ga0209673_10029698 234
251 3300025284 Ga0209130_1000069 Ga0209130_1000069142 234
252 3300025291 Ga0209675_1000427 Ga0209675_100042726 234
253 3300025294 Ga0209025_1000316 Ga0209025_100031682 234
254 3300025295 Ga0209564_1000270 Ga0209564_100027033 234
255 3300025297 Ga0209758_1000064 Ga0209758_100006440 234
256 3300025299 Ga0209256_1000020 Ga0209256_1000020411 234
257 3300025302 Ga0207426_1000001 Ga0207426_10000011046 234
258 3300025303 Ga0209051_1022726 Ga0209051_10227263 234
259 3300025304 Ga0209257_1002269 Ga0209257_100226917 234
260 3300025913 Ga0207695_10453034 Ga0207695_104530342 234
261 3300037471 Ga0395905_0132923 Ga0395905_0132923_984_1754 234
262 3300037471 Ga0395905_0147579 Ga0395905_0147579_850_1620 234
263 3300042139 Ga0450904_008366 Ga0450904_008366_211_981 234
264 3300042439 Ga0439464_0003570 Ga0439464_0003570_748_1518 234
265 3300042876 Ga0451577_0003441 Ga0451577_0003441_11090_11860 234
266 3300044683 Ga0466965_0042398 Ga0466965_0042398_907_1677 234
267 3300044712 Ga0453684_0062516 Ga0453684_0062516_3736_4506 234
268 iso_pu_bacteria 2513237305 2514421685 234
269 iso_pu_bacteria 2547132374 2548498417 234
270 iso_pu_bacteria 2597489875 2597811238 234
271 iso_pu_bacteria 2599185301 2599940685 234
272 iso_pu_bacteria 2643221570 2643867016 234
273 iso_pu_bacteria 2643221609 2644062973 234
274 iso_pu_bacteria 2643221611 2644070913 234
275 iso_pu_bacteria 2643221627 2644157841 234
276 iso_pu_bacteria 2643221652 2644294882 234
277 iso_pu_bacteria 2643221660 2644339954 234
278 iso_pu_bacteria 2643221717 2644646376 234
279 iso_pu_bacteria 2721755686 2723578153 234
280 iso_pu_bacteria 2747842428 2747948277 234
281 iso_pu_bacteria 2775506901 2776261001 234
282 iso_pu_bacteria 2791355123 2792745440 234
283 iso_pu_bacteria 2821443989 2821446739 234
284 iso_pu_bacteria 2821443989 2821450104 234
285 iso_pu_bacteria 2842391507 2842393225 234
286 iso_pu_bacteria 2842718218 2842721074 234
287 iso_pu_bacteria 2844533157 2844534708 234
288 iso_pu_bacteria 2844533157 2844536670 234
289 iso_pu_bacteria 2856349417 2856355238 234
290 iso_pu_bacteria 2871488783 2871489506 234
291 iso_pu_bacteria 2871495908 2871496325 234
292 iso_pu_bacteria 2874220319 2874221423 234
293 iso_pu_bacteria 2878753008 2878754089 234
294 iso_pu_bacteria 2878760144 2878760554 234
295 iso_pu_bacteria 2878767105 2878767517 234
296 iso_pu_bacteria 2881147464 2881150967 234
297 iso_pu_bacteria 2881155292 2881158519 234
298 iso_pu_bacteria 2881161766 2881166668 234
299 iso_pu_bacteria 2881845957 2881851316 234
300 iso_pu_bacteria 2881853255 2881855397 234
301 iso_pu_bacteria 2881861095 2881864139 234
302 iso_pu_bacteria 2882912400 2882917656 234
303 iso_pu_bacteria 2885305155 2885308754 234
304 iso_pu_bacteria 2885318864 2885324413 234
305 iso_pu_bacteria 2885326080 2885326450 234
306 iso_pu_bacteria 2885334103 2885334804 234
307 iso_pu_bacteria 2885342637 2885347553 234
308 iso_pu_bacteria 2885350715 2885356752 234
309 iso_pu_bacteria 2893066018 2893067954 234
310 iso_pu_bacteria 2894023352 2894026586 234
311 iso_pu_bacteria 2903492973 2903494608 234
312 iso_pu_bacteria 2903540706 2903541119 234
313 iso_pu_bacteria 2919089067 2919091916 234
314 iso_pu_bacteria 2924784321 2924788829 234
315 iso_pu_bacteria 2931380184 2931380950 234
316 iso_pu_bacteria 2937994558 2937994972 234
317 iso_pu_bacteria 2958165035 2958165452 234
318 iso_pu_bacteria 2961127735 2961136229 234
319 iso_pu_bacteria 2961163497 2961163910 234
320 iso_pu_bacteria 2961170736 2961171721 234
321 iso_pu_bacteria 2965018300 2965018715 234
322 iso_pu_bacteria 2967996073 2967996574 234
323 iso_pu_bacteria 2968003550 2968010215 234
324 iso_pu_bacteria 2968171901 2968172316 234
325 iso_pu_bacteria 2970503327 2970504317 234
326 iso_pu_bacteria 2970554993 2970555406 234
327 iso_pu_bacteria 2974320154 2974323984 234
328 iso_pu_bacteria 2977821940 2977823304 234
329 iso_pu_bacteria 2977828996 2977831940 234
330 iso_pu_bacteria 2979808191 2979808954 234
331 iso_pu_bacteria 2987659509 2987659922 234
332 iso_pu_bacteria 2990710928 2990713008 234
333 iso_pu_bacteria 3000135777 3000140849 234
334 iso_pu_bacteria 3004188549 3004188969 234
335 iso_pu_bacteria 8004374579 8004375665 234
336 3300005539 Ga0068853_100059078 Ga0068853_1000590783 235
337 3300005616 Ga0068852_100001922 Ga0068852_1000019226 235
338 3300005616 Ga0068852_100067802 Ga0068852_1000678022 235
339 3300009545 Ga0105237_10297551 Ga0105237_102975512 235
340 3300009551 Ga0105238_10000677 Ga0105238_1000067721 235
341 3300010375 Ga0105239_10001550 Ga0105239_1000155019 235
342 3300013105 Ga0157369_10006059 Ga0157369_1000605915 235
343 3300025913 Ga0207695_10435464 Ga0207695_104354642 235
344 3300025914 Ga0207671_10081624 Ga0207671_100816242 235
345 3300025924 Ga0207694_10000014 Ga0207694_10000014309 235
346 3300026041 Ga0207639_10062145 Ga0207639_100621453 235
347 3300026142 Ga0207698_10003027 Ga0207698_100030277 235
348 3300026142 Ga0207698_10058457 Ga0207698_100584572 235
349 3300049581 Ga0501047_0084384 Ga0501047_0084384_626_1444 235
350 iso_pu_bacteria 2597490356 2599105891 235
351 iso_pu_bacteria 2775506901 2776258379 235
352 iso_pu_bacteria 2846952575 2846955676 235
353 iso_pu_bacteria 2848858292 2848862339 235
354 3300001989 JGI24739J22299_10021846 JGI24739J22299_100218462 236
355 3300003856 Ga0058692_1000031 Ga0058692_100003118 236
356 3300005344 Ga0070661_100009092 Ga0070661_1000090926 236
357 3300005563 Ga0068855_100000006 Ga0068855_100000006241 236
358 3300006946 Ga0079104_1014959 Ga0079104_10149591 236
359 3300009036 Ga0105244_10079869 Ga0105244_100798692 236
360 3300009093 Ga0105240_10000080 Ga0105240_1000008057 236
361 3300009094 Ga0111539_10220614 Ga0111539_102206142 236
362 3300014968 Ga0157379_10079007 Ga0157379_100790073 236
363 3300025913 Ga0207695_10000004 Ga0207695_10000004637 236
364 3300025918 Ga0207662_10329665 Ga0207662_103296651 236
365 3300025920 Ga0207649_10016306 Ga0207649_100163062 236
366 3300025949 Ga0207667_10000202 Ga0207667_1000020238 236
367 3300027111 Ga0209281_1000190 Ga0209281_1000190106 236
368 3300027312 Ga0209371_1000004 Ga0209371_1000004160 236
369 3300030500 Ga0268256_1000005 Ga0268256_1000005885 236
370 3300035118 Ga0373954_0003556 Ga0373954_0003556_4424_5206 236
371 3300046454 Ga0495592_0000293 Ga0495592_0000293_38679_39461 236
372 3300046516 Ga0495628_0011094 Ga0495628_0011094_3004_3786 236
373 3300046529 Ga0495652_0014531 Ga0495652_0014531_3182_3964 236
374 3300046543 Ga0495645_0003276 Ga0495645_0003276_9949_10731 236
375 3300046678 Ga0495599_0000231 Ga0495599_0000231_19132_19914 236
376 3300046678 Ga0495599_0006954 Ga0495599_0006954_2212_2994 236
377 3300046794 Ga0495589_0056921 Ga0495589_0056921_646_1461 236
378 3300047469 Ga0495673_0000002 Ga0495673_0000002_272641_273423 236
379 3300047472 Ga0495686_0145205 Ga0495686_0145205_114_890 236
380 3300048913 Ga0496110_0470236 Ga0496110_0470236_123_953 236
381 3300048914 Ga0496111_0283679 Ga0496111_0283679_224_1051 236
382 3300049460 Ga0495682_0000505 Ga0495682_0000505_1255_2076 236
383 3300049588 Ga0501072_0130219 Ga0501072_0130219_94_870 236
384 3300049593 Ga0501077_0125964 Ga0501077_0125964_820_1599 236
385 3300049744 Ga0501083_0315549 Ga0501083_0315549_73_849 236
386 3300050516 nmdc:mga0sz30_7748_c1 nmdc:mga0sz30_7748_c1_193_975 236
387 3300006178 Ga0075367_10152724 Ga0075367_101527241 237
388 3300025298 Ga0209050_1002684 Ga0209050_100268413 237
389 3300031665 Ga0316575_10083463 Ga0316575_100834632 237
390 3300038742 Ga0400486_32500 Ga0400486_32500_2054_2833 237
391 3300039062 Ga0400483_051191 Ga0400483_051191_31135_31914 237
392 3300039438 Ga0436360_0523611 Ga0436360_0523611_259_1038 237
393 3300046525 Ga0495663_0001336 Ga0495663_0001336_4999_5781 237
394 3300046558 Ga0495633_0006199 Ga0495633_0006199_4280_5062 237
395 3300047472 Ga0495686_0000871 Ga0495686_0000871_2667_3446 237
396 3300048919 Ga0496116_0000370 Ga0496116_0000370_1637_2419 237
397 3300048921 Ga0496118_0017779 Ga0496118_0017779_2323_3105 237
398 3300048924 Ga0496121_0004954 Ga0496121_0004954_2545_3327 237
399 3300048924 Ga0496121_0024253 Ga0496121_0024253_880_1662 237
400 3300049569 Ga0501032_0410527 Ga0501032_0410527_73_852 237
401 3300049574 Ga0501038_0122249 Ga0501038_0122249_1292_2071 237
402 3300049575 Ga0501039_0167430 Ga0501039_0167430_901_1680 237
403 3300049579 Ga0501043_0117157 Ga0501043_0117157_47_826 237
404 3300049581 Ga0501047_0120360 Ga0501047_0120360_1357_2136 237
405 3300049583 Ga0501067_0038465 Ga0501067_0038465_501_1283 237
406 3300049589 Ga0501073_0022766 Ga0501073_0022766_3592_4374 237
407 3300049742 Ga0501080_0050530 Ga0501080_0050530_811_1590 237
408 3300049822 Ga0501035_0198283 Ga0501035_0198283_359_1138 237
409 3300049823 Ga0501044_0186545 Ga0501044_0186545_47_826 237
410 3300050494 nmdc:mga06z11_22064_c1 nmdc:mga06z11_22064_c1_2074_2904 237
411 3300060353 Ga0501082_0028643 Ga0501082_0028643_3277_4056 237
412 3300060353 Ga0501082_0198207 Ga0501082_0198207_366_1169 237
413 3300060353 Ga0501082_0633150 Ga0501082_0633150_97_879 237
414 2162886007 SwRhRL2b_contig_1053217 SwRhRL2b_0128.00008660 238
415 3300003187 JGI25151J46595_10000429 JGI25151J46595_100004297 238
416 3300003659 JGI25404J52841_10004368 JGI25404J52841_100043682 238
417 3300005289 Ga0065704_10136423 Ga0065704_101364232 238
418 3300005293 Ga0065715_10270724 Ga0065715_102707242 238
419 3300005293 Ga0065715_10358234 Ga0065715_103582341 238
420 3300005295 Ga0065707_10218408 Ga0065707_102184082 238
421 3300005327 Ga0070658_10002319 Ga0070658_1000231912 238
422 3300005329 Ga0070683_100066981 Ga0070683_1000669812 238
423 3300005330 Ga0070690_100085605 Ga0070690_1000856052 238
424 3300005330 Ga0070690_100245131 Ga0070690_1002451312 238
425 3300005331 Ga0070670_100002932 Ga0070670_1000029327 238
426 3300005331 Ga0070670_100254601 Ga0070670_1002546012 238
427 3300005336 Ga0070680_100060440 Ga0070680_1000604404 238
428 3300005336 Ga0070680_100100163 Ga0070680_1001001631 238
429 3300005338 Ga0068868_100180245 Ga0068868_1001802452 238
430 3300005338 Ga0068868_100300150 Ga0068868_1003001501 238
431 3300005340 Ga0070689_100118202 Ga0070689_1001182022 238
432 3300005340 Ga0070689_100378338 Ga0070689_1003783382 238
433 3300005344 Ga0070661_100004790 Ga0070661_1000047907 238
434 3300005354 Ga0070675_100068054 Ga0070675_1000680543 238
435 3300005364 Ga0070673_100084974 Ga0070673_1000849741 238
436 3300005365 Ga0070688_100069052 Ga0070688_1000690522 238
437 3300005365 Ga0070688_100199772 Ga0070688_1001997722 238
438 3300005367 Ga0070667_100043458 Ga0070667_1000434583 238
439 3300005444 Ga0070694_100041430 Ga0070694_1000414302 238
440 3300005456 Ga0070678_100181311 Ga0070678_1001813112 238
441 3300005456 Ga0070678_100229328 Ga0070678_1002293281 238
442 3300005456 Ga0070678_100422966 Ga0070678_1004229661 238
443 3300005457 Ga0070662_100041549 Ga0070662_1000415491 238
444 3300005457 Ga0070662_100413343 Ga0070662_1004133431 238
445 3300005459 Ga0068867_100012518 Ga0068867_1000125182 238
446 3300005459 Ga0068867_100034317 Ga0068867_1000343172 238
447 3300005466 Ga0070685_10002961 Ga0070685_100029616 238
448 3300005467 Ga0070706_100055825 Ga0070706_1000558253 238
449 3300005467 Ga0070706_100603723 Ga0070706_1006037231 238
450 3300005471 Ga0070698_100046656 Ga0070698_1000466565 238
451 3300005518 Ga0070699_100115877 Ga0070699_1001158771 238
452 3300005535 Ga0070684_100007310 Ga0070684_1000073102 238
453 3300005536 Ga0070697_100096800 Ga0070697_1000968002 238
454 3300005539 Ga0068853_100048814 Ga0068853_1000488143 238
455 3300005539 Ga0068853_100110335 Ga0068853_1001103353 238
456 3300005539 Ga0068853_100279474 Ga0068853_1002794742 238
457 3300005539 Ga0068853_100309546 Ga0068853_1003095462 238
458 3300005543 Ga0070672_100001670 Ga0070672_1000016706 238
459 3300005543 Ga0070672_100016821 Ga0070672_1000168215 238
460 3300005543 Ga0070672_100374412 Ga0070672_1003744121 238
461 3300005544 Ga0070686_100097071 Ga0070686_1000970712 238
462 3300005545 Ga0070695_100329651 Ga0070695_1003296511 238
463 3300005545 Ga0070695_100425536 Ga0070695_1004255361 238
464 3300005546 Ga0070696_100126591 Ga0070696_1001265912 238
465 3300005546 Ga0070696_100154102 Ga0070696_1001541022 238
466 3300005548 Ga0070665_100005441 Ga0070665_10000544113 238
467 3300005548 Ga0070665_100031591 Ga0070665_1000315915 238
468 3300005549 Ga0070704_100120331 Ga0070704_1001203312 238
469 3300005563 Ga0068855_100023209 Ga0068855_1000232093 238
470 3300005563 Ga0068855_100069804 Ga0068855_1000698044 238
471 3300005563 Ga0068855_100113643 Ga0068855_1001136432 238
472 3300005563 Ga0068855_100694064 Ga0068855_1006940641 238
473 3300005564 Ga0070664_100058712 Ga0070664_1000587122 238
474 3300005577 Ga0068857_100011595 Ga0068857_1000115956 238
475 3300005578 Ga0068854_100057311 Ga0068854_1000573112 238
476 3300005578 Ga0068854_100340607 Ga0068854_1003406072 238
477 3300005614 Ga0068856_100024483 Ga0068856_1000244836 238
478 3300005614 Ga0068856_100307339 Ga0068856_1003073392 238
479 3300005616 Ga0068852_100014664 Ga0068852_1000146642 238
480 3300005616 Ga0068852_100055850 Ga0068852_1000558502 238
481 3300005616 Ga0068852_100391162 Ga0068852_1003911622 238
482 3300005617 Ga0068859_100004020 Ga0068859_1000040203 238
483 3300005617 Ga0068859_100028791 Ga0068859_1000287914 238
484 3300005617 Ga0068859_100216912 Ga0068859_1002169121 238
485 3300005617 Ga0068859_100613945 Ga0068859_1006139452 238
486 3300005617 Ga0068859_101148735 Ga0068859_1011487351 238
487 3300005618 Ga0068864_100001391 Ga0068864_10000139110 238
488 3300005618 Ga0068864_100002912 Ga0068864_1000029128 238
489 3300005618 Ga0068864_100267773 Ga0068864_1002677732 238
490 3300005719 Ga0068861_100000210 Ga0068861_10000021029 238
491 3300005834 Ga0068851_10086788 Ga0068851_100867882 238
492 3300005840 Ga0068870_10042500 Ga0068870_100425002 238
493 3300005841 Ga0068863_100002813 Ga0068863_10000281312 238
494 3300005841 Ga0068863_100006041 Ga0068863_1000060412 238
495 3300005842 Ga0068858_100045566 Ga0068858_1000455663 238
496 3300005843 Ga0068860_100004339 Ga0068860_10000433913 238
497 3300005843 Ga0068860_100004940 Ga0068860_10000494016 238
498 3300005843 Ga0068860_100140989 Ga0068860_1001409893 238
499 3300005843 Ga0068860_100292283 Ga0068860_1002922832 238
500 3300005844 Ga0068862_100004054 Ga0068862_10000405413 238
501 3300005844 Ga0068862_100195797 Ga0068862_1001957972 238
502 3300005937 Ga0081455_10000479 Ga0081455_1000047923 238
503 3300005937 Ga0081455_10045769 Ga0081455_100457695 238
504 3300005983 Ga0081540_1064076 Ga0081540_10640762 238
505 3300005985 Ga0081539_10001648 Ga0081539_1000164853 238
506 3300005985 Ga0081539_10017784 Ga0081539_100177843 238
507 3300006028 Ga0070717_10431301 Ga0070717_104313012 238
508 3300006042 Ga0075368_10035856 Ga0075368_100358562 238
509 3300006042 Ga0075368_10092812 Ga0075368_100928122 238
510 3300006048 Ga0075363_100020064 Ga0075363_1000200642 238
511 3300006048 Ga0075363_100026566 Ga0075363_1000265662 238
512 3300006177 Ga0075362_10000592 Ga0075362_100005923 238
513 3300006177 Ga0075362_10005194 Ga0075362_100051946 238
514 3300006178 Ga0075367_10000751 Ga0075367_100007513 238
515 3300006186 Ga0075369_10000268 Ga0075369_1000026811 238
516 3300006195 Ga0075366_10057364 Ga0075366_100573643 238
517 3300006353 Ga0075370_10038622 Ga0075370_100386223 238
518 3300006353 Ga0075370_10069612 Ga0075370_100696122 238
519 3300006353 Ga0075370_10220538 Ga0075370_102205381 238
520 3300006358 Ga0068871_100124136 Ga0068871_1001241362 238
521 3300006852 Ga0075433_10291310 Ga0075433_102913102 238
522 3300006871 Ga0075434_100058662 Ga0075434_1000586621 238
523 3300006881 Ga0068865_100025074 Ga0068865_1000250742 238
524 3300006914 Ga0075436_100011403 Ga0075436_1000114035 238
525 3300006914 Ga0075436_100014247 Ga0075436_1000142472 238
526 3300006931 Ga0097620_100004020 Ga0097620_1000040203 238
527 3300006931 Ga0097620_100028791 Ga0097620_1000287914 238
528 3300006931 Ga0097620_100216899 Ga0097620_1002168991 238
529 3300006931 Ga0097620_100613990 Ga0097620_1006139902 238
530 3300006931 Ga0097620_101148542 Ga0097620_1011485421 238
531 3300007076 Ga0075435_100007808 Ga0075435_1000078089 238
532 3300009094 Ga0111539_10261159 Ga0111539_102611592 238
533 3300009147 Ga0114129_10240633 Ga0114129_102406333 238
534 3300009174 Ga0105241_10003718 Ga0105241_100037186 238
535 3300009176 Ga0105242_10155099 Ga0105242_101550991 238
536 3300009545 Ga0105237_10008317 Ga0105237_1000831712 238
537 3300009545 Ga0105237_10013907 Ga0105237_100139077 238
538 3300009551 Ga0105238_10048290 Ga0105238_100482903 238
539 3300009551 Ga0105238_10166261 Ga0105238_101662613 238
540 3300009551 Ga0105238_10244661 Ga0105238_102446612 238
541 3300009553 Ga0105249_10194867 Ga0105249_101948672 238
542 3300009553 Ga0105249_10603599 Ga0105249_106035992 238
543 3300010375 Ga0105239_10025620 Ga0105239_100256207 238
544 3300010375 Ga0105239_10117384 Ga0105239_101173841 238
545 3300010375 Ga0105239_10388697 Ga0105239_103886972 238
546 3300010375 Ga0105239_10393998 Ga0105239_103939982 238
547 3300010375 Ga0105239_10654371 Ga0105239_106543711 238
548 3300011119 Ga0105246_10009952 Ga0105246_100099525 238
549 3300012480 Ga0157346_1001597 Ga0157346_10015971 238
550 3300013100 Ga0157373_10018460 Ga0157373_100184604 238
551 3300013102 Ga0157371_10114508 Ga0157371_101145082 238
552 3300013102 Ga0157371_10124379 Ga0157371_101243792 238
553 3300013102 Ga0157371_10147773 Ga0157371_101477732 238
554 3300013104 Ga0157370_10281549 Ga0157370_102815492 238
555 3300013105 Ga0157369_10003606 Ga0157369_1000360613 238
556 3300013105 Ga0157369_10044850 Ga0157369_100448503 238
557 3300013105 Ga0157369_10591869 Ga0157369_105918691 238
558 3300013297 Ga0157378_10009890 Ga0157378_100098907 238
559 3300013308 Ga0157375_10015650 Ga0157375_100156506 238
560 3300014325 Ga0163163_10000041 Ga0163163_10000041114 238
561 3300014325 Ga0163163_10001081 Ga0163163_1000108115 238
562 3300014325 Ga0163163_10020198 Ga0163163_100201986 238
563 3300014325 Ga0163163_10198315 Ga0163163_101983153 238
564 3300014968 Ga0157379_10003245 Ga0157379_100032456 238
565 3300014968 Ga0157379_10261222 Ga0157379_102612222 238
566 3300014968 Ga0157379_10480958 Ga0157379_104809581 238
567 3300015261 Ga0182006_1003007 Ga0182006_10030079 238
568 3300015261 Ga0182006_1018903 Ga0182006_10189034 238
569 3300021384 Ga0213876_10001143 Ga0213876_100011431 238
570 3300021384 Ga0213876_10154618 Ga0213876_101546182 238
571 3300021388 Ga0213875_10122254 Ga0213875_101222542 238
572 3300025294 Ga0209025_1000282 Ga0209025_100028247 238
573 3300025303 Ga0209051_1002758 Ga0209051_10027588 238
574 3300025899 Ga0207642_10123973 Ga0207642_101239732 238
575 3300025908 Ga0207643_10048399 Ga0207643_100483992 238
576 3300025909 Ga0207705_10001097 Ga0207705_100010972 238
577 3300025910 Ga0207684_10300634 Ga0207684_103006342 238
578 3300025911 Ga0207654_10139725 Ga0207654_101397252 238
579 3300025912 Ga0207707_10016035 Ga0207707_100160355 238
580 3300025913 Ga0207695_10003360 Ga0207695_100033608 238
581 3300025913 Ga0207695_10303832 Ga0207695_103038322 238
582 3300025914 Ga0207671_10052369 Ga0207671_100523694 238
583 3300025914 Ga0207671_10070925 Ga0207671_100709252 238
584 3300025920 Ga0207649_10546663 Ga0207649_105466631 238
585 3300025921 Ga0207652_10068548 Ga0207652_100685483 238
586 3300025923 Ga0207681_10028880 Ga0207681_100288802 238
587 3300025924 Ga0207694_10008420 Ga0207694_100084208 238
588 3300025924 Ga0207694_10078789 Ga0207694_100787892 238
589 3300025924 Ga0207694_10132622 Ga0207694_101326222 238
590 3300025925 Ga0207650_10031394 Ga0207650_100313943 238
591 3300025925 Ga0207650_10406962 Ga0207650_104069621 238
592 3300025926 Ga0207659_10034680 Ga0207659_100346803 238
593 3300025926 Ga0207659_10334682 Ga0207659_103346822 238
594 3300025933 Ga0207706_10412605 Ga0207706_104126051 238
595 3300025934 Ga0207686_10322658 Ga0207686_103226581 238
596 3300025935 Ga0207709_10186550 Ga0207709_101865502 238
597 3300025936 Ga0207670_10386106 Ga0207670_103861062 238
598 3300025938 Ga0207704_10141287 Ga0207704_101412872 238
599 3300025940 Ga0207691_10010252 Ga0207691_100102524 238
600 3300025940 Ga0207691_10028031 Ga0207691_100280315 238
601 3300025940 Ga0207691_10249669 Ga0207691_102496692 238
602 3300025940 Ga0207691_10711330 Ga0207691_107113301 238
603 3300025941 Ga0207711_10069135 Ga0207711_100691353 238
604 3300025941 Ga0207711_10234899 Ga0207711_102348992 238
605 3300025944 Ga0207661_10497714 Ga0207661_104977141 238
606 3300025945 Ga0207679_10193858 Ga0207679_101938581 238
607 3300025945 Ga0207679_10226009 Ga0207679_102260092 238
608 3300025945 Ga0207679_10294590 Ga0207679_102945902 238
609 3300025949 Ga0207667_10005447 Ga0207667_1000544712 238
610 3300025960 Ga0207651_10378739 Ga0207651_103787392 238
611 3300025972 Ga0207668_10073153 Ga0207668_100731534 238
612 3300025981 Ga0207640_10436875 Ga0207640_104368752 238
613 3300025981 Ga0207640_10483535 Ga0207640_104835352 238
614 3300025981 Ga0207640_10492857 Ga0207640_104928572 238
615 3300025986 Ga0207658_10003586 Ga0207658_100035866 238
616 3300025986 Ga0207658_10115692 Ga0207658_101156922 238
617 3300026023 Ga0207677_10128286 Ga0207677_101282862 238
618 3300026023 Ga0207677_10354238 Ga0207677_103542382 238
619 3300026035 Ga0207703_10048586 Ga0207703_100485862 238
620 3300026035 Ga0207703_10072360 Ga0207703_100723603 238
621 3300026041 Ga0207639_10242054 Ga0207639_102420541 238
622 3300026078 Ga0207702_10210097 Ga0207702_102100972 238
623 3300026088 Ga0207641_10003697 Ga0207641_100036979 238
624 3300026088 Ga0207641_10010598 Ga0207641_100105981 238
625 3300026088 Ga0207641_10014858 Ga0207641_100148585 238
626 3300026088 Ga0207641_10299875 Ga0207641_102998751 238
627 3300026089 Ga0207648_10000442 Ga0207648_100004422 238
628 3300026089 Ga0207648_10016794 Ga0207648_100167942 238
629 3300026089 Ga0207648_10297682 Ga0207648_102976822 238
630 3300026095 Ga0207676_10174433 Ga0207676_101744332 238
631 3300026095 Ga0207676_10215106 Ga0207676_102151062 238
632 3300026095 Ga0207676_10614417 Ga0207676_106144172 238
633 3300026116 Ga0207674_10013821 Ga0207674_100138216 238
634 3300026116 Ga0207674_10034700 Ga0207674_100347005 238
635 3300026118 Ga0207675_100000633 Ga0207675_1000006338 238
636 3300026118 Ga0207675_100169465 Ga0207675_1001694652 238
637 3300026118 Ga0207675_100782575 Ga0207675_1007825751 238
638 3300026121 Ga0207683_10118547 Ga0207683_101185472 238
639 3300026121 Ga0207683_10148835 Ga0207683_101488352 238
640 3300026121 Ga0207683_10267661 Ga0207683_102676612 238
641 3300026121 Ga0207683_10546619 Ga0207683_105466191 238
642 3300026142 Ga0207698_10021921 Ga0207698_100219212 238
643 3300028379 Ga0268266_10018802 Ga0268266_100188026 238
644 3300028380 Ga0268265_10003872 Ga0268265_100038724 238
645 3300028380 Ga0268265_10399006 Ga0268265_103990061 238
646 3300028381 Ga0268264_10002795 Ga0268264_100027959 238
647 3300028381 Ga0268264_10006716 Ga0268264_100067169 238
648 3300028381 Ga0268264_10489755 Ga0268264_104897552 238
649 3300031238 Ga0265332_10198066 Ga0265332_101980661 238
650 3300031616 Ga0307508_10001988 Ga0307508_1000198818 238
651 3300031727 Ga0316576_10391552 Ga0316576_103915522 238
652 3300031730 Ga0307516_10052976 Ga0307516_100529762 238
653 3300031730 Ga0307516_10345959 Ga0307516_103459592 238
654 3300031731 Ga0307405_10306417 Ga0307405_103064171 238
655 3300031911 Ga0307412_10002067 Ga0307412_100020679 238
656 3300032004 Ga0307414_10152700 Ga0307414_101527002 238
657 3300035083 Ga0373926_0000848 Ga0373926_0000848_2568_3362 238
658 3300035089 Ga0373944_0007159 Ga0373944_0007159_96_890 238
659 3300035111 Ga0373923_0022370 Ga0373923_0022370_1172_1966 238
660 3300035113 Ga0373936_0017975 Ga0373936_0017975_1030_1812 238
661 3300035113 Ga0373936_0022446 Ga0373936_0022446_810_1604 238
662 3300035116 Ga0373945_0002899 Ga0373945_0002899_1209_2003 238
663 3300035170 Ga0373943_0007874 Ga0373943_0007874_310_1104 238
664 3300035171 Ga0373946_0006412 Ga0373946_0006412_776_1570 238
665 3300035398 Ga0316574_0042754 Ga0316574_0042754_1201_1983 238
666 3300035410 Ga0373924_0047336 Ga0373924_0047336_314_1108 238
667 3300035692 Ga0373935_0080692 Ga0373935_0080692_151_945 238
668 3300035695 Ga0373927_0005282 Ga0373927_0005282_4551_5345 238
669 3300036401 Ga0373937_0028390 Ga0373937_0028390_872_1654 238
670 3300037068 Ga0373925_0128015 Ga0373925_0128015_1143_1925 238
671 3300037068 Ga0373925_0231858 Ga0373925_0231858_660_1454 238
672 3300037312 Ga0395899_0001843 Ga0395899_0001843_9971_10762 238
673 3300037312 Ga0395899_0255571 Ga0395899_0255571_380_1162 238
674 3300037418 Ga0395900_0050886 Ga0395900_0050886_3146_3937 238
675 3300037418 Ga0395900_0084466 Ga0395900_0084466_35_817 238
676 3300037471 Ga0395905_0000240 Ga0395905_0000240_7986_8774 238
677 3300037471 Ga0395905_0057254 Ga0395905_0057254_2659_3441 238
678 3300037471 Ga0395905_0253586 Ga0395905_0253586_712_1494 238
679 3300037853 Ga0436364_0448854 Ga0436364_0448854_648_1433 238
680 3300037853 Ga0436364_1128088 Ga0436364_1128088_345_1130 238
681 3300038443 Ga0395901_0008600 Ga0395901_0008600_4098_4880 238
682 3300038443 Ga0395901_0126475 Ga0395901_0126475_1727_2518 238
683 3300039437 Ga0436365_0188102 Ga0436365_0188102_292_1077 238
684 3300039437 Ga0436365_1008718 Ga0436365_1008718_23943_24728 238
685 3300039437 Ga0436365_1287200 Ga0436365_1287200_796_1581 238
686 3300042115 Ga0450911_000674 Ga0450911_000674_7241_8023 238
687 3300042876 Ga0451577_0003691 Ga0451577_0003691_8184_8969 238
688 3300042876 Ga0451577_0341112 Ga0451577_0341112_188_970 238
689 3300044683 Ga0466965_0003446 Ga0466965_0003446_5798_6586 238
690 3300044706 Ga0466964_0072282 Ga0466964_0072282_161_949 238
691 3300044706 Ga0466964_0090233 Ga0466964_0090233_293_1081 238
692 3300044712 Ga0453684_0000136 Ga0453684_0000136_80941_81825 238
693 3300044712 Ga0453684_0051158 Ga0453684_0051158_892_1677 238
694 3300044712 Ga0453684_0831041 Ga0453684_0831041_14_796 238
695 3300045049 Ga0466959_0063789 Ga0466959_0063789_921_1709 238
696 3300045051 Ga0451576_0000025 Ga0451576_0000025_346066_346950 238
697 3300046455 Ga0495603_0008625 Ga0495603_0008625_3374_4168 238
698 3300046457 Ga0495590_0024270 Ga0495590_0024270_842_1624 238
699 3300046459 Ga0495629_0087079 Ga0495629_0087079_514_1296 238
700 3300046472 Ga0495580_0031658 Ga0495580_0031658_3004_3798 238
701 3300046475 Ga0495639_0003893 Ga0495639_0003893_2585_3379 238
702 3300046475 Ga0495639_0025708 Ga0495639_0025708_1776_2561 238
703 3300046512 Ga0495610_0015537 Ga0495610_0015537_1298_2080 238
704 3300046535 Ga0495586_0070146 Ga0495586_0070146_150_944 238
705 3300046539 Ga0495621_0067278 Ga0495621_0067278_206_988 238
706 3300046558 Ga0495633_0001222 Ga0495633_0001222_10323_11105 238
707 3300046663 Ga0495635_0201292 Ga0495635_0201292_274_1056 238
708 3300046681 Ga0495647_0001675 Ga0495647_0001675_5560_6354 238
709 3300046683 Ga0495658_0012044 Ga0495658_0012044_3479_4273 238
710 3300046690 Ga0495624_0132983 Ga0495624_0132983_370_1155 238
711 3300046694 Ga0495649_0062453 Ga0495649_0062453_88_870 238
712 3300047315 Ga0495581_0077391 Ga0495581_0077391_882_1667 238
713 3300047321 Ga0495676_0119158 Ga0495676_0119158_1086_1880 238
714 3300047472 Ga0495686_0030557 Ga0495686_0030557_576_1361 238
715 3300048904 Ga0496101_0442662 Ga0496101_0442662_124_906 238
716 3300048904 Ga0496101_0576035 Ga0496101_0576035_40_825 238
717 3300048905 Ga0496102_0005345 Ga0496102_0005345_8154_8981 238
718 3300048905 Ga0496102_0095744 Ga0496102_0095744_1772_2557 238
719 3300048906 Ga0496103_0122622 Ga0496103_0122622_163_990 238
720 3300048907 Ga0496104_0005026 Ga0496104_0005026_1817_2602 238
721 3300048907 Ga0496104_0569259 Ga0496104_0569259_22_807 238
722 3300048908 Ga0496105_0000617 Ga0496105_0000617_868_1653 238
723 3300048908 Ga0496105_0181504 Ga0496105_0181504_875_1657 238
724 3300048909 Ga0496106_0331178 Ga0496106_0331178_351_1136 238
725 3300048911 Ga0496108_0090032 Ga0496108_0090032_1539_2366 238
726 3300048911 Ga0496108_0193644 Ga0496108_0193644_968_1750 238
727 3300048912 Ga0496109_0032286 Ga0496109_0032286_2359_3144 238
728 3300048912 Ga0496109_0091871 Ga0496109_0091871_45_827 238
729 3300048913 Ga0496110_0258946 Ga0496110_0258946_507_1292 238
730 3300048913 Ga0496110_0435795 Ga0496110_0435795_266_1051 238
731 3300048914 Ga0496111_0031511 Ga0496111_0031511_2935_3720 238
732 3300048914 Ga0496111_0081056 Ga0496111_0081056_1250_2032 238
733 3300048915 Ga0496112_0204053 Ga0496112_0204053_87_869 238
734 3300048915 Ga0496112_0466289 Ga0496112_0466289_268_1053 238
735 3300048916 Ga0496113_0068364 Ga0496113_0068364_348_1133 238
736 3300048918 Ga0496115_0024616 Ga0496115_0024616_1627_2412 238
737 3300048920 Ga0496117_0000576 Ga0496117_0000576_57760_58542 238
738 3300048921 Ga0496118_0000371 Ga0496118_0000371_72396_73178 238
739 3300048925 Ga0496122_0061643 Ga0496122_0061643_1452_2234 238
740 3300048926 Ga0496123_0180916 Ga0496123_0180916_139_921 238
741 3300048927 Ga0496124_0081686 Ga0496124_0081686_354_1136 238
742 3300049569 Ga0501032_0000455 Ga0501032_0000455_14605_15390 238
743 3300049569 Ga0501032_0167747 Ga0501032_0167747_138_920 238
744 3300049570 Ga0501033_0022775 Ga0501033_0022775_868_1650 238
745 3300049571 Ga0501034_0076986 Ga0501034_0076986_572_1354 238
746 3300049572 Ga0501036_0020101 Ga0501036_0020101_3439_4221 238
747 3300049572 Ga0501036_0050044 Ga0501036_0050044_813_1598 238
748 3300049573 Ga0501037_0009754 Ga0501037_0009754_5323_6108 238
749 3300049573 Ga0501037_0021919 Ga0501037_0021919_2654_3436 238
750 3300049574 Ga0501038_0030061 Ga0501038_0030061_1347_2129 238
751 3300049575 Ga0501039_0139837 Ga0501039_0139837_718_1500 238
752 3300049577 Ga0501041_0000548 Ga0501041_0000548_2596_3378 238
753 3300049578 Ga0501042_0151904 Ga0501042_0151904_506_1288 238
754 3300049579 Ga0501043_0009191 Ga0501043_0009191_1448_2230 238
755 3300049580 Ga0501046_0008547 Ga0501046_0008547_4893_5675 238
756 3300049583 Ga0501067_0000100 Ga0501067_0000100_38207_38992 238
757 3300049584 Ga0501068_0082864 Ga0501068_0082864_35_820 238
758 3300049586 Ga0501070_0367814 Ga0501070_0367814_260_1042 238
759 3300049587 Ga0501071_0026840 Ga0501071_0026840_747_1529 238
760 3300049587 Ga0501071_0162196 Ga0501071_0162196_532_1314 238
761 3300049590 Ga0501074_0014112 Ga0501074_0014112_3454_4236 238
762 3300049592 Ga0501076_0000971 Ga0501076_0000971_17119_17901 238
763 3300049593 Ga0501077_0026616 Ga0501077_0026616_1498_2283 238
764 3300049741 Ga0501079_0000147 Ga0501079_0000147_3179_3961 238
765 3300049742 Ga0501080_0003502 Ga0501080_0003502_4050_4835 238
766 3300049742 Ga0501080_0020513 Ga0501080_0020513_2336_3118 238
767 3300049743 Ga0501081_0018443 Ga0501081_0018443_2506_3288 238
768 3300049822 Ga0501035_0166913 Ga0501035_0166913_39_821 238
769 3300049823 Ga0501044_0013701 Ga0501044_0013701_4925_5710 238
770 3300049824 Ga0501045_0018022 Ga0501045_0018022_3292_4074 238
771 3300049824 Ga0501045_0118835 Ga0501045_0118835_347_1129 238
772 3300050489 nmdc:mga03683_288_c2 nmdc:mga03683_288_c2_5070_5852 238
773 3300050489 nmdc:mga03683_321_c2 nmdc:mga03683_321_c2_1394_2176 238
774 3300050490 nmdc:mga03n38_59030_c1 nmdc:mga03n38_59030_c1_552_1334 238
775 3300050490 nmdc:mga03n38_99601_c1 nmdc:mga03n38_99601_c1_594_1376 238
776 3300050493 nmdc:mga0k408_202673_c1 nmdc:mga0k408_202673_c1_65_847 238
777 3300050493 nmdc:mga0k408_300415_c1 nmdc:mga0k408_300415_c1_14_805 238
778 3300050493 nmdc:mga0k408_98519_c1 nmdc:mga0k408_98519_c1_769_1551 238
779 3300050495 nmdc:mga04h51_21402_c1 nmdc:mga04h51_21402_c1_209_991 238
780 3300050496 nmdc:mga07m45_204907_c1 nmdc:mga07m45_204907_c1_223_1005 238
781 3300050507 nmdc:mga05p37_285320_c1 nmdc:mga05p37_285320_c1_926_1708 238
782 3300050512 nmdc:mga0n895_148411_c1 nmdc:mga0n895_148411_c1_317_1099 238
783 3300050512 nmdc:mga0n895_196284_c1 nmdc:mga0n895_196284_c1_1254_2039 238
784 3300050512 nmdc:mga0n895_60300_c1 nmdc:mga0n895_60300_c1_2707_3489 238
785 3300050513 nmdc:mga0rr50_31415_c1 nmdc:mga0rr50_31415_c1_2609_3403 238
786 3300050514 nmdc:mga08x19_128439_c1 nmdc:mga08x19_128439_c1_838_1620 238
787 3300050514 nmdc:mga08x19_3651_c1 nmdc:mga08x19_3651_c1_1555_2337 238
788 3300050516 nmdc:mga0sz30_3615_c1 nmdc:mga0sz30_3615_c1_2937_3719 238
789 3300053084 Ga0495595_0110564 Ga0495595_0110564_265_1047 238
790 3300053085 Ga0495619_0022890 Ga0495619_0022890_1202_1984 238
791 3300053085 Ga0495619_0032309 Ga0495619_0032309_1087_1869 238
792 3300053139 Ga0500568_0043457 Ga0500568_0043457_265_1047 238
793 3300053733 Ga0500552_000157 Ga0500552_000157_4762_5544 238
794 3300054114 Ga0501084_0003530 Ga0501084_0003530_9141_9923 238
795 3300059477 Ga0587084_012452 Ga0587084_012452_61_843 238
796 3300059493 Ga0587077_029854 Ga0587077_029854_11_793 238
797 3300059506 Ga0587085_012040 Ga0587085_012040_53_835 238
798 3300059642 Ga0587069_002460 Ga0587069_002460_212_994 238
799 3300060353 Ga0501082_0327382 Ga0501082_0327382_509_1291 238
800 3300060353 Ga0501082_0607327 Ga0501082_0607327_87_869 238
801 iso_pu_bacteria 2643221554 2643790591 238
802 iso_pu_bacteria 2643221603 2644028953 238
803 iso_pu_bacteria 2643221638 2644211531 238
804 iso_pu_bacteria 2904424332 2904425519 238
805 iso_pu_bacteria 2919476304 2919480298 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

39

235

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

292

0.9

PF08659

KR

KR domain

39

218

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wmb-assembly1.cif.gz_A crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase 0.9216 1 238
1wmb-assembly1.cif.gz_A crystal structure of nad dependent d-3-hydroxybutylate dehydrogenase 0.9178 1 238
2ztv-assembly1.cif.gz_C the binary complex of d-3-hydroxybutyrate dehydrogenase with nad+ 0.911 1 235
2ztv-assembly1.cif.gz_D the binary complex of d-3-hydroxybutyrate dehydrogenase with nad+ 0.9024 1 235
5yss-assembly1.cif.gz_D crystal structure of aminocaproic acid cyclase in complex with nad (+) 0.9021 1 235
ID Description Score Start End Superfamily
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.924 2 141 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9131 1 141 3.40.50.720
af_Q9T0G0_32_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8974 2 141 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8888 2 87 3.40.50.720
af_Q7Z5J1_16_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8866 2 141 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2X3E2L3-F1-model_v4 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) 0.9615 2 141 GO:0003858
GO:0008667
GO:0019290
AF-A0A7X3R6H7-F1-model_v4 SDR family oxidoreductase 0.9492 2 141 GO:0016020
GO:0016491
AF-A0A0B7J3D6-F1-model_v4 D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30) 0.9482 1 119 GO:0003858
AF-A0A2X3L570-F1-model_v4 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (EC 1.1.1.127) 0.9467 2 133 GO:0047001
AF-A0A7Y1ZER1-F1-model_v4 SDR family oxidoreductase 0.9454 2 137 GO:0008667
GO:0019290

Feature Viewer

pLDDT pTM Quality
88.97 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map