F481605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 805 | 252 | 804 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300031235|Ga0265330_10392499|Ga0265330_103924991 |
| Length | 146 |
| Sequence | MSHEGIRIAPKDHEAVETEEARPLPRIAVTPEKVRVLITEGKGMEIDWADGHRSAWSFPWLREACPCATCVDLRKAEGRKPGQPKPKPANVLPMFTPSAHAVGRYAIQFNWQDGHSGGIYSWEYLRRVCQCPECTFASEEATGAPN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 131 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 132 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 134 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 135 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 139 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 140 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 142 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 156 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 159 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 160 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 230 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.75 |
| Metatranscriptomes | 0.12 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 2.48 |
| Rhizosphere | 96.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1006184 | 3300000546 | Unclassified | 1300 |
| 2 | JGI24743J22301_10055314 | 3300001991 | Unclassified | 812 |
| 3 | rootH2_10285490 | 3300003320 | Unclassified | 1097 |
| 4 | rootL2_10356678 | 3300003322 | Bacteria | 1390 |
| 5 | Ga0070658_10000142 | 3300005327 | Bacteria | 63262 |
| 6 | Ga0070658_10014001 | 3300005327 | Bacteria | 6440 |
| 7 | Ga0070658_10051815 | 3300005327 | Bacteria | 3326 |
| 8 | Ga0070658_10090710 | 3300005327 | Bacteria | 2518 |
| 9 | Ga0070658_10124843 | 3300005327 | Bacteria | 2142 |
| 10 | Ga0070658_10158097 | 3300005327 | Bacteria | 1900 |
| 11 | Ga0070658_10192532 | 3300005327 | Bacteria | 1719 |
| 12 | Ga0070658_10475198 | 3300005327 | Bacteria | 1078 |
| 13 | Ga0070658_11003223 | 3300005327 | Bacteria | 726 |
| 14 | Ga0070658_11182145 | 3300005327 | Unclassified | 665 |
| 15 | Ga0070676_10019001 | 3300005328 | Bacteria | 3818 |
| 16 | Ga0070683_100003012 | 3300005329 | Bacteria | 13527 |
| 17 | Ga0070683_100021519 | 3300005329 | Bacteria | 5755 |
| 18 | Ga0070683_100044078 | 3300005329 | Bacteria | 4112 |
| 19 | Ga0070683_100061847 | 3300005329 | Bacteria | 3481 |
| 20 | Ga0070683_100132588 | 3300005329 | Bacteria | 2358 |
| 21 | Ga0070683_100177481 | 3300005329 | Bacteria | 2022 |
| 22 | Ga0070683_100420913 | 3300005329 | Bacteria | 1274 |
| 23 | Ga0070683_100635777 | 3300005329 | Bacteria | 1022 |
| 24 | Ga0070683_100710150 | 3300005329 | Bacteria | 963 |
| 25 | Ga0070690_100164351 | 3300005330 | Bacteria | 1523 |
| 26 | Ga0070670_100002930 | 3300005331 | Bacteria | 14131 |
| 27 | Ga0070670_100020567 | 3300005331 | Bacteria | 5676 |
| 28 | Ga0068869_100000517 | 3300005334 | Bacteria | 21584 |
| 29 | Ga0068869_100062344 | 3300005334 | Bacteria | 2736 |
| 30 | Ga0070666_10012804 | 3300005335 | Bacteria | 5302 |
| 31 | Ga0070666_10052334 | 3300005335 | Bacteria | 2752 |
| 32 | Ga0070680_100024639 | 3300005336 | Bacteria | 4809 |
| 33 | Ga0070682_101526941 | 3300005337 | Unclassified | 575 |
| 34 | Ga0070682_101725761 | 3300005337 | Unclassified | 544 |
| 35 | Ga0068868_100027110 | 3300005338 | Bacteria | 4369 |
| 36 | Ga0068868_100047080 | 3300005338 | Bacteria | 3377 |
| 37 | Ga0068868_100325876 | 3300005338 | Bacteria | 1310 |
| 38 | Ga0070660_100003805 | 3300005339 | Bacteria | 10423 |
| 39 | Ga0070660_100010075 | 3300005339 | Bacteria | 6667 |
| 40 | Ga0070660_100049896 | 3300005339 | Bacteria | 3219 |
| 41 | Ga0070660_100050439 | 3300005339 | Bacteria | 3202 |
| 42 | Ga0070660_100559691 | 3300005339 | Bacteria | 954 |
| 43 | Ga0070661_100000910 | 3300005344 | Bacteria | 21220 |
| 44 | Ga0070661_100082658 | 3300005344 | Bacteria | 2372 |
| 45 | Ga0070661_100148660 | 3300005344 | Bacteria | 1770 |
| 46 | Ga0070661_100505212 | 3300005344 | Bacteria | 968 |
| 47 | Ga0070661_100583560 | 3300005344 | Unclassified | 902 |
| 48 | Ga0070692_10204663 | 3300005345 | Bacteria | 1158 |
| 49 | Ga0070692_10502226 | 3300005345 | Unclassified | 786 |
| 50 | Ga0070668_100113140 | 3300005347 | Bacteria | 2162 |
| 51 | Ga0070668_101428514 | 3300005347 | Bacteria | 631 |
| 52 | Ga0070675_100034701 | 3300005354 | Bacteria | 4095 |
| 53 | Ga0070671_100000458 | 3300005355 | Bacteria | 28366 |
| 54 | Ga0070671_100000915 | 3300005355 | Bacteria | 21547 |
| 55 | Ga0070671_100132125 | 3300005355 | Bacteria | 2103 |
| 56 | Ga0070673_100206950 | 3300005364 | Bacteria | 1692 |
| 57 | Ga0070673_100358621 | 3300005364 | Bacteria | 1295 |
| 58 | Ga0070673_100705982 | 3300005364 | Unclassified | 926 |
| 59 | Ga0070659_100002926 | 3300005366 | Bacteria | 12172 |
| 60 | Ga0070659_100048475 | 3300005366 | Bacteria | 3337 |
| 61 | Ga0070667_100067812 | 3300005367 | Bacteria | 3035 |
| 62 | Ga0070667_100074985 | 3300005367 | Bacteria | 2887 |
| 63 | Ga0070667_100078885 | 3300005367 | Bacteria | 2814 |
| 64 | Ga0070709_10222379 | 3300005434 | Bacteria | 1347 |
| 65 | Ga0070709_10391741 | 3300005434 | Unclassified | 1035 |
| 66 | Ga0070709_10509921 | 3300005434 | Unclassified | 915 |
| 67 | Ga0070714_100103847 | 3300005435 | Bacteria | 2507 |
| 68 | Ga0070714_100270563 | 3300005435 | Bacteria | 1575 |
| 69 | Ga0070713_100002026 | 3300005436 | Bacteria | 13095 |
| 70 | Ga0070713_100006331 | 3300005436 | Bacteria | 8201 |
| 71 | Ga0070713_100083713 | 3300005436 | Unclassified | 2727 |
| 72 | Ga0070713_100307943 | 3300005436 | Bacteria | 1460 |
| 73 | Ga0070663_100039784 | 3300005455 | Bacteria | 3288 |
| 74 | Ga0070663_100087286 | 3300005455 | Bacteria | 2305 |
| 75 | Ga0070663_100091871 | 3300005455 | Unclassified | 2250 |
| 76 | Ga0070663_100101520 | 3300005455 | Bacteria | 2147 |
| 77 | Ga0070663_100720848 | 3300005455 | Unclassified | 849 |
| 78 | Ga0070663_101845086 | 3300005455 | Bacteria | 542 |
| 79 | Ga0070678_100007527 | 3300005456 | Bacteria | 6467 |
| 80 | Ga0070678_100459640 | 3300005456 | Bacteria | 1116 |
| 81 | Ga0070681_10032775 | 3300005458 | Bacteria | 5216 |
| 82 | Ga0070681_10555344 | 3300005458 | Unclassified | 1062 |
| 83 | Ga0070681_10940690 | 3300005458 | Bacteria | 783 |
| 84 | Ga0068867_100919244 | 3300005459 | Unclassified | 788 |
| 85 | Ga0068867_101054227 | 3300005459 | Bacteria | 740 |
| 86 | Ga0070679_100003039 | 3300005530 | Bacteria | 15327 |
| 87 | Ga0070679_100013656 | 3300005530 | Bacteria | 7779 |
| 88 | Ga0070679_100066464 | 3300005530 | Bacteria | 3594 |
| 89 | Ga0070679_100511862 | 3300005530 | Bacteria | 1144 |
| 90 | Ga0070684_100011640 | 3300005535 | Bacteria | 7011 |
| 91 | Ga0070684_100034362 | 3300005535 | Unclassified | 4335 |
| 92 | Ga0070684_100104930 | 3300005535 | Bacteria | 2529 |
| 93 | Ga0070684_100116051 | 3300005535 | Bacteria | 2405 |
| 94 | Ga0070684_100124895 | 3300005535 | Bacteria | 2317 |
| 95 | Ga0070684_100809282 | 3300005535 | Bacteria | 876 |
| 96 | Ga0068853_100000018 | 3300005539 | Bacteria | 169680 |
| 97 | Ga0068853_100007063 | 3300005539 | Bacteria | 8980 |
| 98 | Ga0068853_100017080 | 3300005539 | Bacteria | 5985 |
| 99 | Ga0068853_100054488 | 3300005539 | Bacteria | 3446 |
| 100 | Ga0068853_100200276 | 3300005539 | Bacteria | 1817 |
| 101 | Ga0068853_100219206 | 3300005539 | Bacteria | 1737 |
| 102 | Ga0068853_100345218 | 3300005539 | Bacteria | 1384 |
| 103 | Ga0068853_101167926 | 3300005539 | Unclassified | 743 |
| 104 | Ga0068853_102306996 | 3300005539 | Unclassified | 521 |
| 105 | Ga0070672_100002005 | 3300005543 | Bacteria | 12791 |
| 106 | Ga0070665_100016489 | 3300005548 | Bacteria | 7407 |
| 107 | Ga0070665_100017091 | 3300005548 | Bacteria | 7277 |
| 108 | Ga0070665_100073342 | 3300005548 | Bacteria | 3429 |
| 109 | Ga0070665_100231116 | 3300005548 | Bacteria | 1849 |
| 110 | Ga0070665_100577924 | 3300005548 | Bacteria | 1136 |
| 111 | Ga0070665_100707005 | 3300005548 | Bacteria | 1021 |
| 112 | Ga0068855_100003707 | 3300005563 | Bacteria | 18676 |
| 113 | Ga0068855_100020184 | 3300005563 | Bacteria | 8001 |
| 114 | Ga0068855_100026998 | 3300005563 | Bacteria | 6870 |
| 115 | Ga0068855_100044675 | 3300005563 | Bacteria | 5243 |
| 116 | Ga0068855_100047496 | 3300005563 | Bacteria | 5071 |
| 117 | Ga0068855_100048851 | 3300005563 | Bacteria | 4992 |
| 118 | Ga0068855_100080886 | 3300005563 | Bacteria | 3767 |
| 119 | Ga0068855_100084463 | 3300005563 | Bacteria | 3675 |
| 120 | Ga0068855_100171851 | 3300005563 | Bacteria | 2454 |
| 121 | Ga0068855_100192999 | 3300005563 | Unclassified | 2296 |
| 122 | Ga0068855_100321459 | 3300005563 | Bacteria | 1710 |
| 123 | Ga0068855_100327545 | 3300005563 | Unclassified | 1691 |
| 124 | Ga0068855_100697128 | 3300005563 | Bacteria | 1087 |
| 125 | Ga0068857_100000749 | 3300005577 | Bacteria | 24206 |
| 126 | Ga0068857_100001413 | 3300005577 | Bacteria | 18985 |
| 127 | Ga0068857_100014218 | 3300005577 | Bacteria | 6933 |
| 128 | Ga0068857_100516036 | 3300005577 | Bacteria | 1123 |
| 129 | Ga0068854_100000042 | 3300005578 | Bacteria | 93095 |
| 130 | Ga0068854_100044701 | 3300005578 | Bacteria | 3146 |
| 131 | Ga0068854_100161709 | 3300005578 | Bacteria | 1735 |
| 132 | Ga0068854_100766669 | 3300005578 | Bacteria | 838 |
| 133 | Ga0068854_100884056 | 3300005578 | Unclassified | 784 |
| 134 | Ga0068856_100006392 | 3300005614 | Bacteria | 11558 |
| 135 | Ga0068856_100008572 | 3300005614 | Bacteria | 9940 |
| 136 | Ga0068856_100036870 | 3300005614 | Bacteria | 4795 |
| 137 | Ga0068856_100058871 | 3300005614 | Bacteria | 3794 |
| 138 | Ga0068856_100367671 | 3300005614 | Bacteria | 1457 |
| 139 | Ga0068856_100511148 | 3300005614 | Unclassified | 1222 |
| 140 | Ga0068856_100648613 | 3300005614 | Unclassified | 1076 |
| 141 | Ga0068856_100792783 | 3300005614 | Unclassified | 967 |
| 142 | Ga0068856_101143353 | 3300005614 | Unclassified | 795 |
| 143 | Ga0068852_100000714 | 3300005616 | Bacteria | 21728 |
| 144 | Ga0068852_100009322 | 3300005616 | Bacteria | 7283 |
| 145 | Ga0068852_100017448 | 3300005616 | Bacteria | 5633 |
| 146 | Ga0068852_100101081 | 3300005616 | Bacteria | 2603 |
| 147 | Ga0068852_100103064 | 3300005616 | Bacteria | 2580 |
| 148 | Ga0068852_100154020 | 3300005616 | Bacteria | 2140 |
| 149 | Ga0068852_100187369 | 3300005616 | Bacteria | 1950 |
| 150 | Ga0068852_100482028 | 3300005616 | Unclassified | 1233 |
| 151 | Ga0068852_100786678 | 3300005616 | Unclassified | 965 |
| 152 | Ga0068859_100038997 | 3300005617 | Bacteria | 4764 |
| 153 | Ga0068859_100110389 | 3300005617 | Bacteria | 2812 |
| 154 | Ga0068864_100000992 | 3300005618 | Bacteria | 23732 |
| 155 | Ga0068864_101889048 | 3300005618 | Bacteria | 603 |
| 156 | Ga0068866_10080976 | 3300005718 | Bacteria | 1743 |
| 157 | Ga0068851_10136152 | 3300005834 | Unclassified | 1332 |
| 158 | Ga0068851_10139335 | 3300005834 | Bacteria | 1318 |
| 159 | Ga0068851_10375748 | 3300005834 | Bacteria | 832 |
| 160 | Ga0068851_10467268 | 3300005834 | Unclassified | 752 |
| 161 | Ga0068851_10513008 | 3300005834 | Unclassified | 720 |
| 162 | Ga0068863_100008605 | 3300005841 | Bacteria | 9974 |
| 163 | Ga0068863_100068676 | 3300005841 | Bacteria | 3352 |
| 164 | Ga0068863_100666525 | 3300005841 | Bacteria | 1032 |
| 165 | Ga0068863_101968815 | 3300005841 | Bacteria | 594 |
| 166 | Ga0068858_100063440 | 3300005842 | Bacteria | 3419 |
| 167 | Ga0068858_100125789 | 3300005842 | Bacteria | 2400 |
| 168 | Ga0068858_100420384 | 3300005842 | Bacteria | 1285 |
| 169 | Ga0068860_100003788 | 3300005843 | Bacteria | 15557 |
| 170 | Ga0068860_100255708 | 3300005843 | Bacteria | 1706 |
| 171 | Ga0068862_100054466 | 3300005844 | Bacteria | 3425 |
| 172 | Ga0070717_11493671 | 3300006028 | Unclassified | 613 |
| 173 | Ga0070712_100767895 | 3300006175 | Bacteria | 826 |
| 174 | Ga0097621_100004302 | 3300006237 | Bacteria | 9892 |
| 175 | Ga0097621_100029015 | 3300006237 | Bacteria | 4366 |
| 176 | Ga0068871_100002034 | 3300006358 | Bacteria | 13704 |
| 177 | Ga0068871_100017601 | 3300006358 | Bacteria | 5412 |
| 178 | Ga0068871_100065138 | 3300006358 | Bacteria | 2984 |
| 179 | Ga0068865_100043149 | 3300006881 | Bacteria | 3080 |
| 180 | Ga0097620_100038995 | 3300006931 | Bacteria | 4764 |
| 181 | Ga0097620_100110393 | 3300006931 | Bacteria | 2812 |
| 182 | Ga0105240_10000284 | 3300009093 | Bacteria | 99440 |
| 183 | Ga0105240_10001593 | 3300009093 | Bacteria | 38568 |
| 184 | Ga0105240_10001640 | 3300009093 | Bacteria | 38024 |
| 185 | Ga0105240_10008641 | 3300009093 | Bacteria | 14552 |
| 186 | Ga0105240_10009569 | 3300009093 | Bacteria | 13718 |
| 187 | Ga0105240_10047123 | 3300009093 | Bacteria | 5456 |
| 188 | Ga0105240_10122136 | 3300009093 | Bacteria | 3135 |
| 189 | Ga0105240_10167381 | 3300009093 | Unclassified | 2606 |
| 190 | Ga0105240_10440799 | 3300009093 | Bacteria | 1459 |
| 191 | Ga0105240_11138913 | 3300009093 | Unclassified | 829 |
| 192 | Ga0105240_11171971 | 3300009093 | Bacteria | 815 |
| 193 | Ga0105240_11701418 | 3300009093 | Bacteria | 658 |
| 194 | Ga0105240_12502135 | 3300009093 | Bacteria | 534 |
| 195 | Ga0105245_10001856 | 3300009098 | Bacteria | 19233 |
| 196 | Ga0105245_10026871 | 3300009098 | Bacteria | 5068 |
| 197 | Ga0105245_10354412 | 3300009098 | Bacteria | 1455 |
| 198 | Ga0105245_10365177 | 3300009098 | Bacteria | 1434 |
| 199 | Ga0105247_10015372 | 3300009101 | Bacteria | 4585 |
| 200 | Ga0105247_10100415 | 3300009101 | Bacteria | 1849 |
| 201 | Ga0105241_10000265 | 3300009174 | Bacteria | 38968 |
| 202 | Ga0105241_10002773 | 3300009174 | Bacteria | 13121 |
| 203 | Ga0105241_10003506 | 3300009174 | Bacteria | 11669 |
| 204 | Ga0105241_10027355 | 3300009174 | Bacteria | 4247 |
| 205 | Ga0105241_10050443 | 3300009174 | Bacteria | 3171 |
| 206 | Ga0105241_10308077 | 3300009174 | Bacteria | 1361 |
| 207 | Ga0105241_10416495 | 3300009174 | Unclassified | 1181 |
| 208 | Ga0105241_10994579 | 3300009174 | Unclassified | 784 |
| 209 | Ga0105241_11241257 | 3300009174 | Unclassified | 707 |
| 210 | Ga0105248_10003308 | 3300009177 | Bacteria | 17887 |
| 211 | Ga0105248_10010912 | 3300009177 | Bacteria | 10025 |
| 212 | Ga0105248_10115613 | 3300009177 | Bacteria | 3026 |
| 213 | Ga0105248_10398651 | 3300009177 | Unclassified | 1549 |
| 214 | Ga0105248_10730943 | 3300009177 | Bacteria | 1117 |
| 215 | Ga0105237_10009543 | 3300009545 | Bacteria | 10390 |
| 216 | Ga0105237_10030905 | 3300009545 | Bacteria | 5434 |
| 217 | Ga0105237_10086789 | 3300009545 | Bacteria | 3119 |
| 218 | Ga0105237_10098112 | 3300009545 | Bacteria | 2921 |
| 219 | Ga0105237_10239765 | 3300009545 | Bacteria | 1814 |
| 220 | Ga0105237_10264097 | 3300009545 | Bacteria | 1724 |
| 221 | Ga0105237_10283365 | 3300009545 | Bacteria | 1660 |
| 222 | Ga0105237_10490760 | 3300009545 | Bacteria | 1235 |
| 223 | Ga0105237_10634632 | 3300009545 | Bacteria | 1075 |
| 224 | Ga0105238_10000338 | 3300009551 | Bacteria | 51021 |
| 225 | Ga0105238_10004902 | 3300009551 | Bacteria | 13240 |
| 226 | Ga0105238_10010228 | 3300009551 | Bacteria | 9408 |
| 227 | Ga0105238_10010638 | 3300009551 | Bacteria | 9241 |
| 228 | Ga0105238_10030278 | 3300009551 | Bacteria | 5509 |
| 229 | Ga0105238_10030933 | 3300009551 | Bacteria | 5448 |
| 230 | Ga0105238_10044082 | 3300009551 | Bacteria | 4512 |
| 231 | Ga0105238_10044390 | 3300009551 | Bacteria | 4494 |
| 232 | Ga0105238_10050443 | 3300009551 | Bacteria | 4189 |
| 233 | Ga0105238_10063776 | 3300009551 | Bacteria | 3685 |
| 234 | Ga0105238_10087015 | 3300009551 | Bacteria | 3112 |
| 235 | Ga0105238_10288267 | 3300009551 | Bacteria | 1624 |
| 236 | Ga0105238_10349520 | 3300009551 | Bacteria | 1467 |
| 237 | Ga0105238_10634566 | 3300009551 | Bacteria | 1078 |
| 238 | Ga0105238_11044752 | 3300009551 | Unclassified | 838 |
| 239 | Ga0105238_11145933 | 3300009551 | Unclassified | 801 |
| 240 | Ga0105249_10056784 | 3300009553 | Bacteria | 3584 |
| 241 | Ga0105249_10063775 | 3300009553 | Bacteria | 3386 |
| 242 | Ga0105249_10371438 | 3300009553 | Bacteria | 1454 |
| 243 | Ga0105249_10829172 | 3300009553 | Unclassified | 990 |
| 244 | Ga0105239_10002626 | 3300010375 | Bacteria | 22720 |
| 245 | Ga0105239_10028844 | 3300010375 | Bacteria | 6101 |
| 246 | Ga0105239_10058648 | 3300010375 | Bacteria | 4224 |
| 247 | Ga0105239_10099800 | 3300010375 | Bacteria | 3210 |
| 248 | Ga0105239_10119210 | 3300010375 | Bacteria | 2929 |
| 249 | Ga0105239_10149163 | 3300010375 | Bacteria | 2610 |
| 250 | Ga0105239_10243778 | 3300010375 | Bacteria | 2017 |
| 251 | Ga0105239_10928312 | 3300010375 | Bacteria | 999 |
| 252 | Ga0105246_10002388 | 3300011119 | Bacteria | 11333 |
| 253 | Ga0105246_10011686 | 3300011119 | Bacteria | 5455 |
| 254 | Ga0157373_10055052 | 3300013100 | Bacteria | 2826 |
| 255 | Ga0157373_10142263 | 3300013100 | Unclassified | 1687 |
| 256 | Ga0157373_10189746 | 3300013100 | Bacteria | 1448 |
| 257 | Ga0157373_10239460 | 3300013100 | Unclassified | 1283 |
| 258 | Ga0157371_10122087 | 3300013102 | Bacteria | 1852 |
| 259 | Ga0157371_10649794 | 3300013102 | Bacteria | 787 |
| 260 | Ga0157370_10000685 | 3300013104 | Bacteria | 42213 |
| 261 | Ga0157370_10014019 | 3300013104 | Bacteria | 8230 |
| 262 | Ga0157370_10015491 | 3300013104 | Bacteria | 7751 |
| 263 | Ga0157370_10019566 | 3300013104 | Bacteria | 6785 |
| 264 | Ga0157370_10031093 | 3300013104 | Bacteria | 5225 |
| 265 | Ga0157370_10040413 | 3300013104 | Bacteria | 4503 |
| 266 | Ga0157370_10069134 | 3300013104 | Bacteria | 3336 |
| 267 | Ga0157370_10103184 | 3300013104 | Unclassified | 2670 |
| 268 | Ga0157370_10480464 | 3300013104 | Bacteria | 1142 |
| 269 | Ga0157370_10808379 | 3300013104 | Unclassified | 853 |
| 270 | Ga0157369_10000699 | 3300013105 | Bacteria | 43315 |
| 271 | Ga0157369_10003649 | 3300013105 | Bacteria | 18261 |
| 272 | Ga0157369_10004476 | 3300013105 | Bacteria | 16465 |
| 273 | Ga0157369_10018778 | 3300013105 | Bacteria | 7750 |
| 274 | Ga0157369_10037519 | 3300013105 | Bacteria | 5305 |
| 275 | Ga0157369_10041216 | 3300013105 | Bacteria | 5040 |
| 276 | Ga0157369_10046148 | 3300013105 | Bacteria | 4736 |
| 277 | Ga0157369_10057696 | 3300013105 | Bacteria | 4187 |
| 278 | Ga0157369_10079960 | 3300013105 | Bacteria | 3501 |
| 279 | Ga0157369_10122762 | 3300013105 | Bacteria | 2755 |
| 280 | Ga0157369_10175135 | 3300013105 | Unclassified | 2259 |
| 281 | Ga0157369_10217831 | 3300013105 | Bacteria | 1999 |
| 282 | Ga0157369_10218622 | 3300013105 | Bacteria | 1995 |
| 283 | Ga0157369_10248502 | 3300013105 | Bacteria | 1857 |
| 284 | Ga0157369_10373482 | 3300013105 | Bacteria | 1480 |
| 285 | Ga0157369_10417235 | 3300013105 | Bacteria | 1391 |
| 286 | Ga0157369_10549034 | 3300013105 | Bacteria | 1194 |
| 287 | Ga0157369_11481404 | 3300013105 | Bacteria | 690 |
| 288 | Ga0157374_10003668 | 3300013296 | Bacteria | 12910 |
| 289 | Ga0157374_10004033 | 3300013296 | Bacteria | 12338 |
| 290 | Ga0157374_10005152 | 3300013296 | Bacteria | 10961 |
| 291 | Ga0157374_10012662 | 3300013296 | Bacteria | 7346 |
| 292 | Ga0157374_10053216 | 3300013296 | Bacteria | 3773 |
| 293 | Ga0157374_10064013 | 3300013296 | Bacteria | 3449 |
| 294 | Ga0157374_10152869 | 3300013296 | Bacteria | 2245 |
| 295 | Ga0157374_10551649 | 3300013296 | Bacteria | 1160 |
| 296 | Ga0157374_10789951 | 3300013296 | Bacteria | 965 |
| 297 | Ga0157374_11671468 | 3300013296 | Unclassified | 661 |
| 298 | Ga0157374_11993245 | 3300013296 | Bacteria | 607 |
| 299 | Ga0157378_10003077 | 3300013297 | Bacteria | 14820 |
| 300 | Ga0157378_10021015 | 3300013297 | Bacteria | 5742 |
| 301 | Ga0157378_10022074 | 3300013297 | Bacteria | 5600 |
| 302 | Ga0157378_10022330 | 3300013297 | Bacteria | 5570 |
| 303 | Ga0157378_10238993 | 3300013297 | Bacteria | 1734 |
| 304 | Ga0163162_10007199 | 3300013306 | Bacteria | 10806 |
| 305 | Ga0163162_10025177 | 3300013306 | Bacteria | 5882 |
| 306 | Ga0163162_10487348 | 3300013306 | Bacteria | 1364 |
| 307 | Ga0163162_10909387 | 3300013306 | Bacteria | 993 |
| 308 | Ga0157372_10003883 | 3300013307 | Bacteria | 16060 |
| 309 | Ga0157372_10026862 | 3300013307 | Bacteria | 6267 |
| 310 | Ga0157372_10032337 | 3300013307 | Bacteria | 5736 |
| 311 | Ga0157372_10069378 | 3300013307 | Bacteria | 3964 |
| 312 | Ga0157372_10112785 | 3300013307 | Bacteria | 3115 |
| 313 | Ga0157372_10141879 | 3300013307 | Bacteria | 2768 |
| 314 | Ga0157372_10174325 | 3300013307 | Bacteria | 2489 |
| 315 | Ga0157372_10230156 | 3300013307 | Unclassified | 2149 |
| 316 | Ga0157372_10249654 | 3300013307 | Unclassified | 2059 |
| 317 | Ga0157372_10268079 | 3300013307 | Bacteria | 1983 |
| 318 | Ga0157372_10393626 | 3300013307 | Bacteria | 1615 |
| 319 | Ga0157372_10477083 | 3300013307 | Bacteria | 1454 |
| 320 | Ga0157372_10504207 | 3300013307 | Bacteria | 1411 |
| 321 | Ga0157372_11201835 | 3300013307 | Bacteria | 876 |
| 322 | Ga0157375_10013492 | 3300013308 | Bacteria | 7275 |
| 323 | Ga0157375_10016797 | 3300013308 | Bacteria | 6589 |
| 324 | Ga0157375_10297394 | 3300013308 | Bacteria | 1778 |
| 325 | Ga0157375_10961360 | 3300013308 | Unclassified | 995 |
| 326 | Ga0157375_11348880 | 3300013308 | Bacteria | 839 |
| 327 | Ga0163163_10004242 | 3300014325 | Bacteria | 12216 |
| 328 | Ga0163163_10042935 | 3300014325 | Bacteria | 4430 |
| 329 | Ga0163163_10318921 | 3300014325 | Bacteria | 1608 |
| 330 | Ga0157377_10037796 | 3300014745 | Unclassified | 2662 |
| 331 | Ga0157379_10049522 | 3300014968 | Bacteria | 3752 |
| 332 | Ga0157379_10076244 | 3300014968 | Bacteria | 3002 |
| 333 | Ga0157379_10110996 | 3300014968 | Bacteria | 2463 |
| 334 | Ga0157379_10222997 | 3300014968 | Bacteria | 1708 |
| 335 | Ga0157376_10000803 | 3300014969 | Bacteria | 20616 |
| 336 | Ga0157376_10031107 | 3300014969 | Bacteria | 4270 |
| 337 | Ga0157376_10032165 | 3300014969 | Bacteria | 4209 |
| 338 | Ga0157376_10036467 | 3300014969 | Bacteria | 3984 |
| 339 | Ga0157376_10052320 | 3300014969 | Bacteria | 3395 |
| 340 | Ga0157376_10059462 | 3300014969 | Bacteria | 3204 |
| 341 | Ga0157376_10510007 | 3300014969 | Bacteria | 1183 |
| 342 | Ga0157376_10591281 | 3300014969 | Bacteria | 1104 |
| 343 | Ga0157376_11391671 | 3300014969 | Unclassified | 733 |
| 344 | Ga0157376_11702895 | 3300014969 | Unclassified | 666 |
| 345 | Ga0157376_11866536 | 3300014969 | Bacteria | 638 |
| 346 | Ga0163161_10015051 | 3300017792 | Bacteria | 5391 |
| 347 | Ga0213872_10042844 | 3300021361 | Bacteria | 2063 |
| 348 | Ga0207656_10044622 | 3300025321 | Bacteria | 1894 |
| 349 | Ga0207656_10053720 | 3300025321 | Bacteria | 1749 |
| 350 | Ga0207656_10057988 | 3300025321 | Bacteria | 1690 |
| 351 | Ga0207656_10100013 | 3300025321 | Bacteria | 1328 |
| 352 | Ga0207656_10114377 | 3300025321 | Bacteria | 1250 |
| 353 | Ga0207656_10182385 | 3300025321 | Bacteria | 1008 |
| 354 | Ga0207642_10220476 | 3300025899 | Bacteria | 1060 |
| 355 | Ga0207710_10005472 | 3300025900 | Bacteria | 5465 |
| 356 | Ga0207710_10310662 | 3300025900 | Bacteria | 798 |
| 357 | Ga0207688_10067264 | 3300025901 | Bacteria | 2027 |
| 358 | Ga0207680_10050119 | 3300025903 | Bacteria | 2489 |
| 359 | Ga0207680_10074192 | 3300025903 | Bacteria | 2118 |
| 360 | Ga0207647_10005646 | 3300025904 | Bacteria | 9137 |
| 361 | Ga0207647_10030028 | 3300025904 | Bacteria | 3511 |
| 362 | Ga0207647_10190870 | 3300025904 | Bacteria | 1187 |
| 363 | Ga0207645_10059026 | 3300025907 | Bacteria | 2450 |
| 364 | Ga0207705_10000329 | 3300025909 | Bacteria | 43054 |
| 365 | Ga0207705_10010673 | 3300025909 | Bacteria | 6670 |
| 366 | Ga0207705_10013575 | 3300025909 | Bacteria | 5880 |
| 367 | Ga0207705_10016110 | 3300025909 | Bacteria | 5363 |
| 368 | Ga0207705_10019060 | 3300025909 | Bacteria | 4908 |
| 369 | Ga0207705_10032962 | 3300025909 | Bacteria | 3702 |
| 370 | Ga0207705_10087426 | 3300025909 | Bacteria | 2279 |
| 371 | Ga0207705_10235828 | 3300025909 | Bacteria | 1393 |
| 372 | Ga0207705_11027771 | 3300025909 | Bacteria | 636 |
| 373 | Ga0207654_10002016 | 3300025911 | Bacteria | 10441 |
| 374 | Ga0207654_10005807 | 3300025911 | Bacteria | 6225 |
| 375 | Ga0207654_10113015 | 3300025911 | Bacteria | 1693 |
| 376 | Ga0207654_10139477 | 3300025911 | Bacteria | 1544 |
| 377 | Ga0207654_10401248 | 3300025911 | Bacteria | 953 |
| 378 | Ga0207707_10024675 | 3300025912 | Bacteria | 5261 |
| 379 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 380 | Ga0207695_10000098 | 3300025913 | Bacteria | 261213 |
| 381 | Ga0207695_10000331 | 3300025913 | Bacteria | 112894 |
| 382 | Ga0207695_10000823 | 3300025913 | Bacteria | 57486 |
| 383 | Ga0207695_10001323 | 3300025913 | Bacteria | 42002 |
| 384 | Ga0207695_10002473 | 3300025913 | Bacteria | 27235 |
| 385 | Ga0207695_10003432 | 3300025913 | Bacteria | 22366 |
| 386 | Ga0207695_10031120 | 3300025913 | Bacteria | 5859 |
| 387 | Ga0207695_10037287 | 3300025913 | Bacteria | 5246 |
| 388 | Ga0207695_10051687 | 3300025913 | Bacteria | 4312 |
| 389 | Ga0207695_10059854 | 3300025913 | Bacteria | 3947 |
| 390 | Ga0207695_10723352 | 3300025913 | Bacteria | 876 |
| 391 | Ga0207695_11246380 | 3300025913 | Bacteria | 624 |
| 392 | Ga0207671_10000655 | 3300025914 | Bacteria | 45327 |
| 393 | Ga0207671_10001346 | 3300025914 | Bacteria | 28731 |
| 394 | Ga0207671_10071130 | 3300025914 | Bacteria | 2594 |
| 395 | Ga0207671_10277182 | 3300025914 | Bacteria | 1322 |
| 396 | Ga0207671_10290504 | 3300025914 | Bacteria | 1291 |
| 397 | Ga0207671_10664821 | 3300025914 | Bacteria | 829 |
| 398 | Ga0207671_11183042 | 3300025914 | Bacteria | 599 |
| 399 | Ga0207693_10308120 | 3300025915 | Bacteria | 1240 |
| 400 | Ga0207660_10070179 | 3300025917 | Bacteria | 2546 |
| 401 | Ga0207657_10016204 | 3300025919 | Bacteria | 7194 |
| 402 | Ga0207657_10021566 | 3300025919 | Bacteria | 6058 |
| 403 | Ga0207657_10079770 | 3300025919 | Bacteria | 2753 |
| 404 | Ga0207657_10419998 | 3300025919 | Unclassified | 1051 |
| 405 | Ga0207657_10434674 | 3300025919 | Bacteria | 1031 |
| 406 | Ga0207649_10002070 | 3300025920 | Bacteria | 11409 |
| 407 | Ga0207649_10038694 | 3300025920 | Bacteria | 2889 |
| 408 | Ga0207649_10056860 | 3300025920 | Bacteria | 2444 |
| 409 | Ga0207649_10119311 | 3300025920 | Unclassified | 1776 |
| 410 | Ga0207649_10548066 | 3300025920 | Unclassified | 884 |
| 411 | Ga0207652_10004174 | 3300025921 | Bacteria | 11782 |
| 412 | Ga0207652_10017306 | 3300025921 | Bacteria | 5898 |
| 413 | Ga0207652_10190665 | 3300025921 | Bacteria | 1844 |
| 414 | Ga0207694_10000105 | 3300025924 | Bacteria | 89920 |
| 415 | Ga0207694_10000727 | 3300025924 | Bacteria | 29554 |
| 416 | Ga0207694_10004769 | 3300025924 | Bacteria | 10540 |
| 417 | Ga0207694_10038031 | 3300025924 | Bacteria | 3699 |
| 418 | Ga0207694_10052016 | 3300025924 | Bacteria | 3175 |
| 419 | Ga0207694_10114873 | 3300025924 | Unclassified | 2144 |
| 420 | Ga0207694_10190913 | 3300025924 | Unclassified | 1664 |
| 421 | Ga0207694_10210018 | 3300025924 | Bacteria | 1585 |
| 422 | Ga0207694_10247007 | 3300025924 | Unclassified | 1459 |
| 423 | Ga0207694_10616202 | 3300025924 | Bacteria | 913 |
| 424 | Ga0207694_10703596 | 3300025924 | Unclassified | 852 |
| 425 | Ga0207650_10006265 | 3300025925 | Bacteria | 8107 |
| 426 | Ga0207650_10189948 | 3300025925 | Bacteria | 1641 |
| 427 | Ga0207687_10011961 | 3300025927 | Bacteria | 5676 |
| 428 | Ga0207687_10016887 | 3300025927 | Bacteria | 4798 |
| 429 | Ga0207687_10037312 | 3300025927 | Bacteria | 3315 |
| 430 | Ga0207700_10002588 | 3300025928 | Bacteria | 10402 |
| 431 | Ga0207700_10093999 | 3300025928 | Bacteria | 2374 |
| 432 | Ga0207700_11335452 | 3300025928 | Bacteria | 638 |
| 433 | Ga0207644_10002739 | 3300025931 | Bacteria | 11352 |
| 434 | Ga0207644_10010986 | 3300025931 | Bacteria | 5980 |
| 435 | Ga0207644_10818648 | 3300025931 | Unclassified | 779 |
| 436 | Ga0207690_10000778 | 3300025932 | Bacteria | 20630 |
| 437 | Ga0207690_10022060 | 3300025932 | Bacteria | 3956 |
| 438 | Ga0207690_10092837 | 3300025932 | Bacteria | 2137 |
| 439 | Ga0207690_11473966 | 3300025932 | Bacteria | 569 |
| 440 | Ga0207706_10015144 | 3300025933 | Bacteria | 6979 |
| 441 | Ga0207665_10295203 | 3300025939 | Bacteria | 1210 |
| 442 | Ga0207691_10006334 | 3300025940 | Bacteria | 11428 |
| 443 | Ga0207711_10001943 | 3300025941 | Bacteria | 18756 |
| 444 | Ga0207711_10151664 | 3300025941 | Bacteria | 2092 |
| 445 | Ga0207711_10231355 | 3300025941 | Bacteria | 1693 |
| 446 | Ga0207711_10429853 | 3300025941 | Unclassified | 1229 |
| 447 | Ga0207689_10000311 | 3300025942 | Bacteria | 44900 |
| 448 | Ga0207689_10045853 | 3300025942 | Bacteria | 3614 |
| 449 | Ga0207661_10016768 | 3300025944 | Bacteria | 5408 |
| 450 | Ga0207661_10029655 | 3300025944 | Bacteria | 4205 |
| 451 | Ga0207661_10146793 | 3300025944 | Bacteria | 2036 |
| 452 | Ga0207661_10162825 | 3300025944 | Bacteria | 1936 |
| 453 | Ga0207661_10322875 | 3300025944 | Bacteria | 1388 |
| 454 | Ga0207661_11451253 | 3300025944 | Unclassified | 629 |
| 455 | Ga0207679_10093288 | 3300025945 | Bacteria | 2334 |
| 456 | Ga0207667_10002382 | 3300025949 | Bacteria | 23520 |
| 457 | Ga0207667_10004198 | 3300025949 | Bacteria | 17695 |
| 458 | Ga0207667_10016687 | 3300025949 | Bacteria | 8287 |
| 459 | Ga0207667_10022906 | 3300025949 | Bacteria | 6886 |
| 460 | Ga0207667_10023299 | 3300025949 | Bacteria | 6818 |
| 461 | Ga0207667_10035823 | 3300025949 | Bacteria | 5323 |
| 462 | Ga0207667_10076964 | 3300025949 | Bacteria | 3461 |
| 463 | Ga0207667_10105514 | 3300025949 | Unclassified | 2907 |
| 464 | Ga0207667_10165227 | 3300025949 | Bacteria | 2276 |
| 465 | Ga0207667_10166247 | 3300025949 | Bacteria | 2268 |
| 466 | Ga0207667_10212111 | 3300025949 | Bacteria | 1985 |
| 467 | Ga0207667_10524929 | 3300025949 | Bacteria | 1199 |
| 468 | Ga0207651_10675647 | 3300025960 | Bacteria | 908 |
| 469 | Ga0207712_10030704 | 3300025961 | Bacteria | 3614 |
| 470 | Ga0207712_10238350 | 3300025961 | Bacteria | 1464 |
| 471 | Ga0207712_10958470 | 3300025961 | Unclassified | 758 |
| 472 | Ga0207668_10463019 | 3300025972 | Bacteria | 1084 |
| 473 | Ga0207640_10000002 | 3300025981 | Bacteria | 524211 |
| 474 | Ga0207640_10125090 | 3300025981 | Bacteria | 1850 |
| 475 | Ga0207640_10177477 | 3300025981 | Bacteria | 1594 |
| 476 | Ga0207658_10034137 | 3300025986 | Bacteria | 3633 |
| 477 | Ga0207658_10072072 | 3300025986 | Bacteria | 2618 |
| 478 | Ga0207658_11046378 | 3300025986 | Bacteria | 745 |
| 479 | Ga0207677_10004327 | 3300026023 | Bacteria | 7608 |
| 480 | Ga0207677_10010143 | 3300026023 | Bacteria | 5322 |
| 481 | Ga0207677_10193841 | 3300026023 | Bacteria | 1609 |
| 482 | Ga0207703_10020790 | 3300026035 | Bacteria | 5135 |
| 483 | Ga0207703_10346469 | 3300026035 | Bacteria | 1367 |
| 484 | Ga0207703_10368582 | 3300026035 | Bacteria | 1326 |
| 485 | Ga0207639_10000011 | 3300026041 | Bacteria | 381897 |
| 486 | Ga0207639_10008592 | 3300026041 | Bacteria | 7007 |
| 487 | Ga0207639_10041090 | 3300026041 | Bacteria | 3457 |
| 488 | Ga0207639_10089034 | 3300026041 | Bacteria | 2465 |
| 489 | Ga0207639_10106486 | 3300026041 | Bacteria | 2276 |
| 490 | Ga0207639_10339644 | 3300026041 | Unclassified | 1338 |
| 491 | Ga0207639_10348409 | 3300026041 | Unclassified | 1322 |
| 492 | Ga0207639_10981926 | 3300026041 | Bacteria | 791 |
| 493 | Ga0207639_11442066 | 3300026041 | Bacteria | 646 |
| 494 | Ga0207678_10015022 | 3300026067 | Bacteria | 6813 |
| 495 | Ga0207678_10017514 | 3300026067 | Bacteria | 6291 |
| 496 | Ga0207678_10020198 | 3300026067 | Bacteria | 5849 |
| 497 | Ga0207678_10073882 | 3300026067 | Bacteria | 2922 |
| 498 | Ga0207678_10137316 | 3300026067 | Bacteria | 2086 |
| 499 | Ga0207678_10379015 | 3300026067 | Bacteria | 1223 |
| 500 | Ga0207678_10433328 | 3300026067 | Bacteria | 1141 |
| 501 | Ga0207678_10445444 | 3300026067 | Bacteria | 1125 |
| 502 | Ga0207678_10665378 | 3300026067 | Bacteria | 915 |
| 503 | Ga0207702_10000984 | 3300026078 | Bacteria | 29154 |
| 504 | Ga0207702_10023069 | 3300026078 | Bacteria | 5161 |
| 505 | Ga0207702_10024626 | 3300026078 | Bacteria | 4995 |
| 506 | Ga0207702_10046034 | 3300026078 | Bacteria | 3672 |
| 507 | Ga0207702_10310019 | 3300026078 | Bacteria | 1500 |
| 508 | Ga0207702_10715477 | 3300026078 | Bacteria | 987 |
| 509 | Ga0207702_10793783 | 3300026078 | Unclassified | 936 |
| 510 | Ga0207702_11703172 | 3300026078 | Unclassified | 623 |
| 511 | Ga0207641_10007496 | 3300026088 | Bacteria | 9082 |
| 512 | Ga0207641_10087653 | 3300026088 | Bacteria | 2716 |
| 513 | Ga0207641_11877094 | 3300026088 | Bacteria | 601 |
| 514 | Ga0207676_10001007 | 3300026095 | Bacteria | 21651 |
| 515 | Ga0207674_10000855 | 3300026116 | Bacteria | 39777 |
| 516 | Ga0207674_10000980 | 3300026116 | Bacteria | 37369 |
| 517 | Ga0207674_10018649 | 3300026116 | Bacteria | 7537 |
| 518 | Ga0207674_10820184 | 3300026116 | Unclassified | 897 |
| 519 | Ga0207683_10000538 | 3300026121 | Bacteria | 35079 |
| 520 | Ga0207683_10764963 | 3300026121 | Bacteria | 896 |
| 521 | Ga0207698_10000274 | 3300026142 | Bacteria | 31326 |
| 522 | Ga0207698_10006887 | 3300026142 | Bacteria | 7111 |
| 523 | Ga0207698_10048069 | 3300026142 | Bacteria | 3236 |
| 524 | Ga0207698_10174806 | 3300026142 | Bacteria | 1895 |
| 525 | Ga0207698_10205720 | 3300026142 | Bacteria | 1766 |
| 526 | Ga0207698_10386870 | 3300026142 | Unclassified | 1332 |
| 527 | Ga0207698_12136499 | 3300026142 | Unclassified | 573 |
| 528 | Ga0268266_10002567 | 3300028379 | Bacteria | 19261 |
| 529 | Ga0268266_10013530 | 3300028379 | Bacteria | 7026 |
| 530 | Ga0268266_10028613 | 3300028379 | Bacteria | 4736 |
| 531 | Ga0268266_10038595 | 3300028379 | Bacteria | 4065 |
| 532 | Ga0268266_10149580 | 3300028379 | Bacteria | 2103 |
| 533 | Ga0268266_10167568 | 3300028379 | Bacteria | 1991 |
| 534 | Ga0268265_10090122 | 3300028380 | Unclassified | 2449 |
| 535 | Ga0268264_10002880 | 3300028381 | Bacteria | 14976 |
| 536 | Ga0265323_10033302 | 3300028653 | Bacteria | 1909 |
| 537 | Ga0265336_10007866 | 3300028666 | Unclassified | 3771 |
| 538 | Ga0265338_10006276 | 3300028800 | Bacteria | 15204 |
| 539 | Ga0265338_10053262 | 3300028800 | Unclassified | 3622 |
| 540 | Ga0265338_10128248 | 3300028800 | Unclassified | 2008 |
| 541 | Ga0265324_10066237 | 3300029957 | Unclassified | 1232 |
| 542 | Ga0265324_10345234 | 3300029957 | Bacteria | 508 |
| 543 | Ga0265773_1034552 | 3300031018 | Bacteria | 558 |
| 544 | Ga0265330_10000373 | 3300031235 | Bacteria | 31405 |
| 545 | Ga0265330_10000946 | 3300031235 | Bacteria | 17895 |
| 546 | Ga0265330_10013349 | 3300031235 | Bacteria | 3830 |
| 547 | Ga0265330_10050775 | 3300031235 | Bacteria | 1819 |
| 548 | Ga0265330_10065596 | 3300031235 | Unclassified | 1576 |
| 549 | Ga0265330_10392499 | 3300031235 | Bacteria | 587 |
| 550 | Ga0265332_10020744 | 3300031238 | Bacteria | 2903 |
| 551 | Ga0265332_10437035 | 3300031238 | Bacteria | 541 |
| 552 | Ga0265328_10013516 | 3300031239 | Bacteria | 3229 |
| 553 | Ga0265328_10016020 | 3300031239 | Unclassified | 2925 |
| 554 | Ga0265320_10029314 | 3300031240 | Bacteria | 2848 |
| 555 | Ga0265325_10000560 | 3300031241 | Bacteria | 27013 |
| 556 | Ga0265325_10004041 | 3300031241 | Bacteria | 9367 |
| 557 | Ga0265325_10010053 | 3300031241 | Bacteria | 5496 |
| 558 | Ga0265325_10030207 | 3300031241 | Unclassified | 2907 |
| 559 | Ga0265325_10049112 | 3300031241 | Unclassified | 2179 |
| 560 | Ga0265325_10068856 | 3300031241 | Bacteria | 1780 |
| 561 | Ga0265329_10049328 | 3300031242 | Bacteria | 1342 |
| 562 | Ga0265329_10090407 | 3300031242 | Unclassified | 971 |
| 563 | Ga0265340_10009260 | 3300031247 | Bacteria | 5289 |
| 564 | Ga0265340_10019815 | 3300031247 | Bacteria | 3461 |
| 565 | Ga0265340_10059546 | 3300031247 | Bacteria | 1832 |
| 566 | Ga0265340_10140583 | 3300031247 | Unclassified | 1104 |
| 567 | Ga0265339_10000899 | 3300031249 | Bacteria | 22835 |
| 568 | Ga0265339_10001232 | 3300031249 | Bacteria | 19233 |
| 569 | Ga0265339_10009868 | 3300031249 | Bacteria | 5961 |
| 570 | Ga0265339_10094684 | 3300031249 | Bacteria | 1561 |
| 571 | Ga0265339_10146940 | 3300031249 | Bacteria | 1195 |
| 572 | Ga0265339_10183518 | 3300031249 | Bacteria | 1041 |
| 573 | Ga0265331_10065378 | 3300031250 | Bacteria | 1710 |
| 574 | Ga0265316_10000692 | 3300031344 | Bacteria | 37515 |
| 575 | Ga0265316_10001589 | 3300031344 | Bacteria | 24272 |
| 576 | Ga0265316_10009712 | 3300031344 | Bacteria | 8832 |
| 577 | Ga0265316_10017785 | 3300031344 | Bacteria | 6128 |
| 578 | Ga0265316_10023982 | 3300031344 | Bacteria | 5122 |
| 579 | Ga0265316_10030629 | 3300031344 | Unclassified | 4408 |
| 580 | Ga0265316_10030645 | 3300031344 | Bacteria | 4406 |
| 581 | Ga0265316_10042587 | 3300031344 | Bacteria | 3628 |
| 582 | Ga0265316_10375836 | 3300031344 | Bacteria | 1026 |
| 583 | Ga0265313_10000889 | 3300031595 | Bacteria | 30069 |
| 584 | Ga0265313_10001674 | 3300031595 | Bacteria | 20509 |
| 585 | Ga0265313_10009220 | 3300031595 | Bacteria | 6433 |
| 586 | Ga0265313_10033410 | 3300031595 | Unclassified | 2614 |
| 587 | Ga0265314_10000047 | 3300031711 | Bacteria | 194061 |
| 588 | Ga0265314_10030156 | 3300031711 | Bacteria | 4018 |
| 589 | Ga0265314_10151026 | 3300031711 | Bacteria | 1424 |
| 590 | Ga0265314_10273098 | 3300031711 | Bacteria | 960 |
| 591 | Ga0265314_10552543 | 3300031711 | Unclassified | 599 |
| 592 | Ga0265342_10000395 | 3300031712 | Bacteria | 48238 |
| 593 | Ga0265342_10001287 | 3300031712 | Bacteria | 23577 |
| 594 | Ga0265342_10025826 | 3300031712 | Bacteria | 3687 |
| 595 | Ga0265342_10064052 | 3300031712 | Bacteria | 2159 |
| 596 | Ga0265342_10073805 | 3300031712 | Bacteria | 1983 |
| 597 | Ga0265342_10078741 | 3300031712 | Bacteria | 1907 |
| 598 | Ga0265342_10123968 | 3300031712 | Bacteria | 1452 |
| 599 | Ga0265342_10139574 | 3300031712 | Unclassified | 1353 |
| 600 | Ga0265342_10661937 | 3300031712 | Unclassified | 524 |
| 601 | Ga0307510_10251889 | 3300033180 | Bacteria | 1253 |
| 602 | Ga0307510_10545474 | 3300033180 | Unclassified | 605 |
| 603 | Ga0373946_0268876 | 3300035171 | Bacteria | 836 |
| 604 | Ga0373935_0655080 | 3300035692 | Unclassified | 770 |
| 605 | Ga0373933_0287150 | 3300035724 | Unclassified | 1064 |
| 606 | Ga0373937_1799380 | 3300036401 | Bacteria | 559 |
| 607 | Ga0373925_0487716 | 3300037068 | Bacteria | 1011 |
| 608 | Ga0395900_1478532 | 3300037418 | Unclassified | 592 |
| 609 | Ga0436360_0610332 | 3300039438 | Bacteria | 4785 |
| 610 | Ga0436361_0337765 | 3300039447 | Bacteria | 6510 |
| 611 | Ga0466966_0047123 | 3300044684 | Bacteria | 2750 |
| 612 | Ga0466961_0389735 | 3300044693 | Bacteria | 846 |
| 613 | Ga0466963_0971671 | 3300044694 | Unclassified | 598 |
| 614 | Ga0466970_0570819 | 3300044765 | Unclassified | 655 |
| 615 | Ga0466967_0004403 | 3300045976 | Bacteria | 9489 |
| 616 | Ga0466967_0102326 | 3300045976 | Bacteria | 2620 |
| 617 | Ga0495603_0009966 | 3300046455 | Bacteria | 5750 |
| 618 | Ga0495590_0248597 | 3300046457 | Bacteria | 661 |
| 619 | Ga0495629_0004596 | 3300046459 | Bacteria | 10331 |
| 620 | Ga0495629_0013052 | 3300046459 | Bacteria | 6003 |
| 621 | Ga0495629_0111918 | 3300046459 | Bacteria | 1903 |
| 622 | Ga0495651_0010544 | 3300046462 | Bacteria | 7102 |
| 623 | Ga0495651_0057334 | 3300046462 | Bacteria | 2990 |
| 624 | Ga0495651_0268372 | 3300046462 | Unclassified | 1158 |
| 625 | Ga0495653_0112746 | 3300046463 | Bacteria | 1951 |
| 626 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 627 | Ga0495650_0010097 | 3300046471 | Bacteria | 5301 |
| 628 | Ga0495580_0068034 | 3300046472 | Bacteria | 2491 |
| 629 | Ga0495580_0104933 | 3300046472 | Bacteria | 1964 |
| 630 | Ga0495580_0192359 | 3300046472 | Bacteria | 1407 |
| 631 | Ga0495580_0262810 | 3300046472 | Bacteria | 1180 |
| 632 | Ga0495582_0001708 | 3300046473 | Bacteria | 12393 |
| 633 | Ga0495582_0064541 | 3300046473 | Unclassified | 2022 |
| 634 | Ga0495582_0155597 | 3300046473 | Bacteria | 1299 |
| 635 | Ga0495605_0048804 | 3300046474 | Bacteria | 2071 |
| 636 | Ga0495639_0039244 | 3300046475 | Bacteria | 2129 |
| 637 | Ga0495662_0010153 | 3300046476 | Bacteria | 4615 |
| 638 | Ga0495662_0420243 | 3300046476 | Unclassified | 656 |
| 639 | Ga0495664_0179703 | 3300046477 | Bacteria | 1283 |
| 640 | Ga0495664_0196812 | 3300046477 | Bacteria | 1221 |
| 641 | Ga0495664_0336460 | 3300046477 | Unclassified | 910 |
| 642 | Ga0495594_0002105 | 3300046499 | Bacteria | 10362 |
| 643 | Ga0495594_0025826 | 3300046499 | Bacteria | 3158 |
| 644 | Ga0495594_0114808 | 3300046499 | Unclassified | 1520 |
| 645 | Ga0495596_0098481 | 3300046500 | Bacteria | 1135 |
| 646 | Ga0495583_0052919 | 3300046506 | Bacteria | 1844 |
| 647 | Ga0495606_0093447 | 3300046507 | Bacteria | 1845 |
| 648 | Ga0495618_0160179 | 3300046514 | Bacteria | 1435 |
| 649 | Ga0495628_0133383 | 3300046516 | Bacteria | 1899 |
| 650 | Ga0495628_0161033 | 3300046516 | Bacteria | 1705 |
| 651 | Ga0495628_0563609 | 3300046516 | Unclassified | 817 |
| 652 | Ga0495630_0871451 | 3300046517 | Unclassified | 686 |
| 653 | Ga0495630_1055222 | 3300046517 | Bacteria | 617 |
| 654 | Ga0495631_0163961 | 3300046518 | Unclassified | 953 |
| 655 | Ga0495632_0316393 | 3300046519 | Bacteria | 690 |
| 656 | Ga0495643_0058683 | 3300046522 | Bacteria | 2047 |
| 657 | Ga0495644_0000075 | 3300046523 | Bacteria | 48572 |
| 658 | Ga0495648_0164735 | 3300046524 | Bacteria | 1142 |
| 659 | Ga0495648_0386790 | 3300046524 | Bacteria | 629 |
| 660 | Ga0495642_0190129 | 3300046528 | Bacteria | 894 |
| 661 | Ga0495642_0223351 | 3300046528 | Unclassified | 822 |
| 662 | Ga0495652_0022120 | 3300046529 | Bacteria | 5647 |
| 663 | Ga0495652_0030912 | 3300046529 | Bacteria | 4693 |
| 664 | Ga0495652_0118940 | 3300046529 | Bacteria | 2111 |
| 665 | Ga0495652_0233087 | 3300046529 | Bacteria | 1375 |
| 666 | Ga0495665_0000961 | 3300046531 | Bacteria | 15243 |
| 667 | Ga0495665_0101587 | 3300046531 | Bacteria | 1509 |
| 668 | Ga0495665_0102091 | 3300046531 | Bacteria | 1505 |
| 669 | Ga0495665_0148396 | 3300046531 | Unclassified | 1224 |
| 670 | Ga0495665_0214842 | 3300046531 | Unclassified | 995 |
| 671 | Ga0495640_0114801 | 3300046533 | Bacteria | 1755 |
| 672 | Ga0495640_0162704 | 3300046533 | Unclassified | 1429 |
| 673 | Ga0495640_0764773 | 3300046533 | Bacteria | 577 |
| 674 | Ga0495587_0012311 | 3300046536 | Bacteria | 5391 |
| 675 | Ga0495587_0090331 | 3300046536 | Bacteria | 1769 |
| 676 | Ga0495587_0097917 | 3300046536 | Unclassified | 1691 |
| 677 | Ga0495587_0545854 | 3300046536 | Unclassified | 640 |
| 678 | Ga0495609_0010193 | 3300046538 | Bacteria | 4517 |
| 679 | Ga0495609_0053100 | 3300046538 | Bacteria | 1802 |
| 680 | Ga0495645_0001164 | 3300046543 | Bacteria | 17908 |
| 681 | Ga0495645_0013696 | 3300046543 | Bacteria | 5746 |
| 682 | Ga0495645_0019830 | 3300046543 | Bacteria | 4845 |
| 683 | Ga0495645_0046501 | 3300046543 | Bacteria | 3163 |
| 684 | Ga0495645_0377211 | 3300046543 | Unclassified | 908 |
| 685 | Ga0495645_0551181 | 3300046543 | Bacteria | 715 |
| 686 | Ga0495667_0004747 | 3300046559 | Bacteria | 9191 |
| 687 | Ga0495667_0149335 | 3300046559 | Bacteria | 1505 |
| 688 | Ga0495668_0117896 | 3300046616 | Bacteria | 1452 |
| 689 | Ga0495634_0014390 | 3300046642 | Bacteria | 5706 |
| 690 | Ga0495625_0011712 | 3300046660 | Bacteria | 7130 |
| 691 | Ga0495625_0018413 | 3300046660 | Bacteria | 5455 |
| 692 | Ga0495625_0024754 | 3300046660 | Bacteria | 4562 |
| 693 | Ga0495625_0513842 | 3300046660 | Unclassified | 731 |
| 694 | Ga0495635_0062130 | 3300046663 | Bacteria | 2565 |
| 695 | Ga0495635_0103802 | 3300046663 | Bacteria | 1942 |
| 696 | Ga0495635_0126339 | 3300046663 | Bacteria | 1744 |
| 697 | Ga0495635_0377141 | 3300046663 | Bacteria | 944 |
| 698 | Ga0495588_0219771 | 3300046674 | Bacteria | 1003 |
| 699 | Ga0495599_0015216 | 3300046678 | Bacteria | 4771 |
| 700 | Ga0495623_0012464 | 3300046679 | Bacteria | 5501 |
| 701 | Ga0495623_0035344 | 3300046679 | Bacteria | 3203 |
| 702 | Ga0495623_0052952 | 3300046679 | Bacteria | 2564 |
| 703 | Ga0495646_0020802 | 3300046680 | Bacteria | 4149 |
| 704 | Ga0495647_0148756 | 3300046681 | Unclassified | 1003 |
| 705 | Ga0495658_0390538 | 3300046683 | Unclassified | 887 |
| 706 | Ga0495669_0028767 | 3300046684 | Unclassified | 2435 |
| 707 | Ga0495669_0375330 | 3300046684 | Bacteria | 688 |
| 708 | Ga0495613_0020679 | 3300046689 | Bacteria | 4906 |
| 709 | Ga0495613_0149849 | 3300046689 | Bacteria | 1664 |
| 710 | Ga0495613_0212728 | 3300046689 | Bacteria | 1359 |
| 711 | Ga0495613_0368034 | 3300046689 | Unclassified | 984 |
| 712 | Ga0495624_0628313 | 3300046690 | Unclassified | 639 |
| 713 | Ga0495670_0069173 | 3300046691 | Bacteria | 1785 |
| 714 | Ga0495649_0013111 | 3300046694 | Bacteria | 4791 |
| 715 | Ga0495649_0241179 | 3300046694 | Bacteria | 931 |
| 716 | Ga0495600_0002839 | 3300046809 | Bacteria | 10076 |
| 717 | Ga0495600_0056864 | 3300046809 | Bacteria | 2556 |
| 718 | Ga0495600_0099600 | 3300046809 | Bacteria | 1894 |
| 719 | Ga0495600_0121445 | 3300046809 | Bacteria | 1699 |
| 720 | Ga0495581_0047580 | 3300047315 | Bacteria | 2478 |
| 721 | Ga0495581_0052854 | 3300047315 | Bacteria | 2347 |
| 722 | Ga0495604_0006208 | 3300047317 | Bacteria | 9486 |
| 723 | Ga0495604_0017720 | 3300047317 | Bacteria | 5699 |
| 724 | Ga0495604_0042851 | 3300047317 | Bacteria | 3545 |
| 725 | Ga0495604_0760150 | 3300047317 | Bacteria | 612 |
| 726 | Ga0495674_0018433 | 3300047319 | Bacteria | 6497 |
| 727 | Ga0495674_0244802 | 3300047319 | Unclassified | 1477 |
| 728 | Ga0495674_0307893 | 3300047319 | Bacteria | 1293 |
| 729 | Ga0495674_0598427 | 3300047319 | Bacteria | 874 |
| 730 | Ga0495676_0001072 | 3300047321 | Bacteria | 23161 |
| 731 | Ga0495687_064633 | 3300047443 | Bacteria | 1493 |
| 732 | Ga0495675_0057328 | 3300047444 | Bacteria | 2470 |
| 733 | Ga0495677_0110072 | 3300047445 | Bacteria | 1047 |
| 734 | Ga0495685_106174 | 3300047447 | Bacteria | 926 |
| 735 | Ga0495684_0052900 | 3300047471 | Bacteria | 3099 |
| 736 | Ga0495684_0055291 | 3300047471 | Bacteria | 3027 |
| 737 | Ga0495684_0084614 | 3300047471 | Bacteria | 2406 |
| 738 | Ga0495684_0680074 | 3300047471 | Bacteria | 685 |
| 739 | Ga0495686_0002264 | 3300047472 | Bacteria | 18562 |
| 740 | Ga0495686_0003622 | 3300047472 | Bacteria | 13249 |
| 741 | Ga0495593_0032650 | 3300047673 | Bacteria | 2836 |
| 742 | Ga0495602_0145971 | 3300048088 | Bacteria | 1866 |
| 743 | Ga0495602_0491431 | 3300048088 | Unclassified | 859 |
| 744 | Ga0495602_0834098 | 3300048088 | Unclassified | 617 |
| 745 | Ga0495614_0025368 | 3300048089 | Bacteria | 2556 |
| 746 | Ga0496100_0523827 | 3300048903 | Bacteria | 915 |
| 747 | Ga0496102_0378084 | 3300048905 | Bacteria | 1333 |
| 748 | Ga0496104_0023290 | 3300048907 | Bacteria | 5693 |
| 749 | Ga0496104_0627734 | 3300048907 | Bacteria | 984 |
| 750 | Ga0496105_0028399 | 3300048908 | Bacteria | 4574 |
| 751 | Ga0496105_0197739 | 3300048908 | Bacteria | 1642 |
| 752 | Ga0496105_0246083 | 3300048908 | Bacteria | 1450 |
| 753 | Ga0496106_0441674 | 3300048909 | Bacteria | 1045 |
| 754 | Ga0496107_0452449 | 3300048910 | Bacteria | 954 |
| 755 | Ga0496112_0294601 | 3300048915 | Bacteria | 1568 |
| 756 | Ga0496112_0437099 | 3300048915 | Bacteria | 1247 |
| 757 | Ga0496113_0611012 | 3300048916 | Bacteria | 873 |
| 758 | Ga0496114_0204386 | 3300048917 | Bacteria | 1731 |
| 759 | Ga0496114_0353777 | 3300048917 | Bacteria | 1299 |
| 760 | Ga0496115_0109286 | 3300048918 | Unclassified | 2270 |
| 761 | Ga0496115_0112272 | 3300048918 | Bacteria | 2239 |
| 762 | Ga0496115_0180452 | 3300048918 | Bacteria | 1745 |
| 763 | Ga0496115_0714590 | 3300048918 | Unclassified | 786 |
| 764 | Ga0496115_0758318 | 3300048918 | Bacteria | 758 |
| 765 | Ga0496115_1349943 | 3300048918 | Bacteria | 529 |
| 766 | Ga0496126_0000029 | 3300048929 | Bacteria | 389370 |
| 767 | Ga0496126_0015123 | 3300048929 | Bacteria | 7772 |
| 768 | Ga0496126_0046844 | 3300048929 | Bacteria | 3962 |
| 769 | Ga0496126_0339958 | 3300048929 | Bacteria | 1230 |
| 770 | Ga0495682_0008913 | 3300049460 | Bacteria | 3936 |
| 771 | Ga0495682_0160113 | 3300049460 | Bacteria | 801 |
| 772 | Ga0501032_0022789 | 3300049569 | Bacteria | 4337 |
| 773 | Ga0501032_0052909 | 3300049569 | Bacteria | 2736 |
| 774 | Ga0501033_0132566 | 3300049570 | Bacteria | 1804 |
| 775 | Ga0501033_0626495 | 3300049570 | Bacteria | 736 |
| 776 | Ga0501034_0077473 | 3300049571 | Bacteria | 3330 |
| 777 | Ga0501036_0003869 | 3300049572 | Bacteria | 12010 |
| 778 | Ga0501037_0050421 | 3300049573 | Bacteria | 3046 |
| 779 | Ga0501037_0082324 | 3300049573 | Bacteria | 2332 |
| 780 | Ga0501037_0172500 | 3300049573 | Bacteria | 1537 |
| 781 | Ga0501038_0032815 | 3300049574 | Bacteria | 4577 |
| 782 | Ga0501038_0163971 | 3300049574 | Bacteria | 1804 |
| 783 | Ga0501038_0202752 | 3300049574 | Bacteria | 1591 |
| 784 | Ga0501043_0006418 | 3300049579 | Bacteria | 9445 |
| 785 | Ga0501047_0005103 | 3300049581 | Bacteria | 12320 |
| 786 | Ga0501047_0261777 | 3300049581 | Bacteria | 1577 |
| 787 | Ga0501070_0106465 | 3300049586 | Bacteria | 2318 |
| 788 | Ga0501070_0228564 | 3300049586 | Unclassified | 1525 |
| 789 | Ga0501073_0182751 | 3300049589 | Bacteria | 1451 |
| 790 | Ga0501073_0191207 | 3300049589 | Unclassified | 1416 |
| 791 | Ga0501073_1104112 | 3300049589 | Bacteria | 545 |
| 792 | Ga0501080_0068317 | 3300049742 | Bacteria | 3306 |
| 793 | Ga0501081_0886332 | 3300049743 | Bacteria | 673 |
| 794 | Ga0501035_0161724 | 3300049822 | Bacteria | 1937 |
| 795 | Ga0501035_0272362 | 3300049822 | Bacteria | 1432 |
| 796 | Ga0501044_0041402 | 3300049823 | Bacteria | 4795 |
| 797 | Ga0501044_0158418 | 3300049823 | Bacteria | 2242 |
| 798 | Ga0495601_0550310 | 3300053077 | Unclassified | 742 |
| 799 | Ga0495601_0789957 | 3300053077 | Bacteria | 603 |
| 800 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 801 | Ga0500595_105138 | 3300053119 | Bacteria | 806 |
| 802 | Ga0500595_206394 | 3300053119 | Unclassified | 541 |
| 803 | Ga0501084_0199585 | 3300054114 | Bacteria | 1688 |
| 804 | Ga0500661_002075 | 3300055283 | Bacteria | 3787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031235 | Ga0265330_10000373 | Ga0265330_1000037328 | 115 |
| 2 | 3300031241 | Ga0265325_10000560 | Ga0265325_100005605 | 115 |
| 3 | 3300031249 | Ga0265339_10000899 | Ga0265339_1000089913 | 115 |
| 4 | 3300031344 | Ga0265316_10000692 | Ga0265316_100006926 | 115 |
| 5 | 3300031595 | Ga0265313_10001674 | Ga0265313_1000167412 | 115 |
| 6 | 3300031712 | Ga0265342_10000395 | Ga0265342_100003959 | 115 |
| 7 | 3300028800 | Ga0265338_10006276 | Ga0265338_100062767 | 120 |
| 8 | 3300031235 | Ga0265330_10000946 | Ga0265330_1000094614 | 120 |
| 9 | 3300031241 | Ga0265325_10004041 | Ga0265325_100040415 | 120 |
| 10 | 3300031247 | Ga0265340_10009260 | Ga0265340_100092605 | 120 |
| 11 | 3300031249 | Ga0265339_10009868 | Ga0265339_100098685 | 120 |
| 12 | 3300031344 | Ga0265316_10017785 | Ga0265316_100177858 | 120 |
| 13 | 3300031712 | Ga0265342_10001287 | Ga0265342_1000128716 | 120 |
| 14 | 3300031595 | Ga0265313_10009220 | Ga0265313_100092205 | 125 |
| 15 | 3300031241 | Ga0265325_10030207 | Ga0265325_100302074 | 134 |
| 16 | 3300014969 | Ga0157376_10591281 | Ga0157376_105912813 | 135 |
| 17 | 3300031241 | Ga0265325_10010053 | Ga0265325_100100535 | 135 |
| 18 | 3300048929 | Ga0496126_0046844 | Ga0496126_0046844_2728_3135 | 135 |
| 19 | 3300005459 | Ga0068867_100919244 | Ga0068867_1009192441 | 136 |
| 20 | 3300031235 | Ga0265330_10065596 | Ga0265330_100655962 | 137 |
| 21 | 3300031247 | Ga0265340_10019815 | Ga0265340_100198153 | 137 |
| 22 | 3300031247 | Ga0265340_10140583 | Ga0265340_101405831 | 137 |
| 23 | 3300031344 | Ga0265316_10009712 | Ga0265316_1000971210 | 137 |
| 24 | 3300031344 | Ga0265316_10042587 | Ga0265316_100425872 | 137 |
| 25 | 3300031712 | Ga0265342_10139574 | Ga0265342_101395742 | 137 |
| 26 | 3300031235 | Ga0265330_10392499 | Ga0265330_103924991 | 138 |
| 27 | 3300031344 | Ga0265316_10030645 | Ga0265316_100306454 | 138 |
| 28 | 3300031711 | Ga0265314_10273098 | Ga0265314_102730982 | 138 |
| 29 | 3300031712 | Ga0265342_10064052 | Ga0265342_100640523 | 138 |
| 30 | 3300048903 | Ga0496100_0523827 | Ga0496100_0523827_89_508 | 139 |
| 31 | iso_pu_bacteria | 2884215851 | 2884219576 | 139 |
| 32 | 3300028666 | Ga0265336_10007866 | Ga0265336_100078662 | 140 |
| 33 | 3300005455 | Ga0070663_100720848 | Ga0070663_1007208482 | 141 |
| 34 | 3300005530 | Ga0070679_100003039 | Ga0070679_10000303911 | 141 |
| 35 | 3300005539 | Ga0068853_101167926 | Ga0068853_1011679261 | 141 |
| 36 | 3300005616 | Ga0068852_100101081 | Ga0068852_1001010813 | 141 |
| 37 | 3300006175 | Ga0070712_100767895 | Ga0070712_1007678951 | 141 |
| 38 | 3300013104 | Ga0157370_10069134 | Ga0157370_100691342 | 141 |
| 39 | 3300013105 | Ga0157369_10373482 | Ga0157369_103734822 | 141 |
| 40 | 3300013307 | Ga0157372_10174325 | Ga0157372_101743254 | 141 |
| 41 | 3300025915 | Ga0207693_10308120 | Ga0207693_103081201 | 141 |
| 42 | 3300025921 | Ga0207652_10004174 | Ga0207652_100041748 | 141 |
| 43 | 3300026041 | Ga0207639_10981926 | Ga0207639_109819262 | 141 |
| 44 | 3300026142 | Ga0207698_10048069 | Ga0207698_100480695 | 141 |
| 45 | 3300046462 | Ga0495651_0010544 | Ga0495651_0010544_3000_3428 | 141 |
| 46 | 3300046477 | Ga0495664_0179703 | Ga0495664_0179703_362_790 | 141 |
| 47 | 3300046516 | Ga0495628_0133383 | Ga0495628_0133383_213_641 | 141 |
| 48 | 3300046529 | Ga0495652_0022120 | Ga0495652_0022120_2587_3015 | 141 |
| 49 | 3300046536 | Ga0495587_0090331 | Ga0495587_0090331_969_1397 | 141 |
| 50 | 3300046543 | Ga0495645_0001164 | Ga0495645_0001164_12356_12784 | 141 |
| 51 | 3300046559 | Ga0495667_0149335 | Ga0495667_0149335_126_554 | 141 |
| 52 | 3300046663 | Ga0495635_0062130 | Ga0495635_0062130_611_1039 | 141 |
| 53 | 3300046679 | Ga0495623_0012464 | Ga0495623_0012464_4672_5100 | 141 |
| 54 | 3300046689 | Ga0495613_0149849 | Ga0495613_0149849_513_941 | 141 |
| 55 | 3300046809 | Ga0495600_0056864 | Ga0495600_0056864_1208_1636 | 141 |
| 56 | 3300047317 | Ga0495604_0006208 | Ga0495604_0006208_4262_4690 | 141 |
| 57 | 3300047444 | Ga0495675_0057328 | Ga0495675_0057328_1282_1710 | 141 |
| 58 | 3300047471 | Ga0495684_0052900 | Ga0495684_0052900_1599_2027 | 141 |
| 59 | 3300047472 | Ga0495686_0003622 | Ga0495686_0003622_6037_6462 | 141 |
| 60 | 3300048088 | Ga0495602_0145971 | Ga0495602_0145971_1105_1533 | 141 |
| 61 | 3300053077 | Ga0495601_0789957 | Ga0495601_0789957_106_534 | 141 |
| 62 | 3300005327 | Ga0070658_10158097 | Ga0070658_101580972 | 142 |
| 63 | 3300005327 | Ga0070658_10475198 | Ga0070658_104751983 | 142 |
| 64 | 3300005329 | Ga0070683_100044078 | Ga0070683_1000440785 | 142 |
| 65 | 3300005331 | Ga0070670_100020567 | Ga0070670_1000205676 | 142 |
| 66 | 3300005335 | Ga0070666_10052334 | Ga0070666_100523344 | 142 |
| 67 | 3300005336 | Ga0070680_100024639 | Ga0070680_1000246395 | 142 |
| 68 | 3300005339 | Ga0070660_100010075 | Ga0070660_1000100756 | 142 |
| 69 | 3300005344 | Ga0070661_100148660 | Ga0070661_1001486604 | 142 |
| 70 | 3300005347 | Ga0070668_101428514 | Ga0070668_1014285141 | 142 |
| 71 | 3300005355 | Ga0070671_100000915 | Ga0070671_10000091512 | 142 |
| 72 | 3300005364 | Ga0070673_100206950 | Ga0070673_1002069504 | 142 |
| 73 | 3300005367 | Ga0070667_100078885 | Ga0070667_1000788853 | 142 |
| 74 | 3300005434 | Ga0070709_10391741 | Ga0070709_103917412 | 142 |
| 75 | 3300005436 | Ga0070713_100006331 | Ga0070713_1000063317 | 142 |
| 76 | 3300005436 | Ga0070713_100307943 | Ga0070713_1003079432 | 142 |
| 77 | 3300005455 | Ga0070663_100039784 | Ga0070663_1000397843 | 142 |
| 78 | 3300005455 | Ga0070663_101845086 | Ga0070663_1018450861 | 142 |
| 79 | 3300005456 | Ga0070678_100459640 | Ga0070678_1004596403 | 142 |
| 80 | 3300005458 | Ga0070681_10032775 | Ga0070681_100327756 | 142 |
| 81 | 3300005530 | Ga0070679_100013656 | Ga0070679_1000136563 | 142 |
| 82 | 3300005535 | Ga0070684_100104930 | Ga0070684_1001049302 | 142 |
| 83 | 3300005539 | Ga0068853_100017080 | Ga0068853_1000170806 | 142 |
| 84 | 3300005548 | Ga0070665_100016489 | Ga0070665_1000164899 | 142 |
| 85 | 3300005563 | Ga0068855_100171851 | Ga0068855_1001718514 | 142 |
| 86 | 3300005577 | Ga0068857_100014218 | Ga0068857_1000142185 | 142 |
| 87 | 3300005578 | Ga0068854_100044701 | Ga0068854_1000447014 | 142 |
| 88 | 3300005841 | Ga0068863_100068676 | Ga0068863_1000686765 | 142 |
| 89 | 3300009093 | Ga0105240_10047123 | Ga0105240_100471235 | 142 |
| 90 | 3300009174 | Ga0105241_10308077 | Ga0105241_103080772 | 142 |
| 91 | 3300009545 | Ga0105237_10030905 | Ga0105237_100309056 | 142 |
| 92 | 3300009551 | Ga0105238_10044082 | Ga0105238_100440825 | 142 |
| 93 | 3300009553 | Ga0105249_10829172 | Ga0105249_108291721 | 142 |
| 94 | 3300013100 | Ga0157373_10142263 | Ga0157373_101422633 | 142 |
| 95 | 3300013104 | Ga0157370_10015491 | Ga0157370_100154917 | 142 |
| 96 | 3300013105 | Ga0157369_10079960 | Ga0157369_100799606 | 142 |
| 97 | 3300013296 | Ga0157374_10004033 | Ga0157374_1000403311 | 142 |
| 98 | 3300013307 | Ga0157372_10069378 | Ga0157372_100693786 | 142 |
| 99 | 3300013308 | Ga0157375_11348880 | Ga0157375_113488802 | 142 |
| 100 | 3300014325 | Ga0163163_10042935 | Ga0163163_100429353 | 142 |
| 101 | 3300014969 | Ga0157376_10032165 | Ga0157376_100321654 | 142 |
| 102 | 3300025903 | Ga0207680_10074192 | Ga0207680_100741924 | 142 |
| 103 | 3300025904 | Ga0207647_10005646 | Ga0207647_100056466 | 142 |
| 104 | 3300025909 | Ga0207705_10010673 | Ga0207705_100106735 | 142 |
| 105 | 3300025909 | Ga0207705_10019060 | Ga0207705_100190603 | 142 |
| 106 | 3300025912 | Ga0207707_10024675 | Ga0207707_100246755 | 142 |
| 107 | 3300025913 | Ga0207695_10059854 | Ga0207695_100598542 | 142 |
| 108 | 3300025914 | Ga0207671_10290504 | Ga0207671_102905042 | 142 |
| 109 | 3300025917 | Ga0207660_10070179 | Ga0207660_100701795 | 142 |
| 110 | 3300025919 | Ga0207657_10016204 | Ga0207657_100162045 | 142 |
| 111 | 3300025920 | Ga0207649_10119311 | Ga0207649_101193111 | 142 |
| 112 | 3300025921 | Ga0207652_10017306 | Ga0207652_100173063 | 142 |
| 113 | 3300025925 | Ga0207650_10189948 | Ga0207650_101899483 | 142 |
| 114 | 3300025928 | Ga0207700_10093999 | Ga0207700_100939993 | 142 |
| 115 | 3300025931 | Ga0207644_10002739 | Ga0207644_100027395 | 142 |
| 116 | 3300025932 | Ga0207690_10092837 | Ga0207690_100928375 | 142 |
| 117 | 3300025939 | Ga0207665_10295203 | Ga0207665_102952032 | 142 |
| 118 | 3300025944 | Ga0207661_10162825 | Ga0207661_101628254 | 142 |
| 119 | 3300025945 | Ga0207679_10093288 | Ga0207679_100932885 | 142 |
| 120 | 3300025949 | Ga0207667_10023299 | Ga0207667_100232996 | 142 |
| 121 | 3300025986 | Ga0207658_10072072 | Ga0207658_100720723 | 142 |
| 122 | 3300026041 | Ga0207639_11442066 | Ga0207639_114420661 | 142 |
| 123 | 3300026067 | Ga0207678_10017514 | Ga0207678_100175145 | 142 |
| 124 | 3300026116 | Ga0207674_10018649 | Ga0207674_100186496 | 142 |
| 125 | 3300026121 | Ga0207683_10764963 | Ga0207683_107649632 | 142 |
| 126 | 3300028379 | Ga0268266_10167568 | Ga0268266_101675682 | 142 |
| 127 | 3300031018 | Ga0265773_1034552 | Ga0265773_10345521 | 142 |
| 128 | 3300031712 | Ga0265342_10025826 | Ga0265342_100258262 | 142 |
| 129 | 3300033180 | Ga0307510_10251889 | Ga0307510_102518892 | 142 |
| 130 | 3300046459 | Ga0495629_0004596 | Ga0495629_0004596_7681_8109 | 142 |
| 131 | 3300046472 | Ga0495580_0192359 | Ga0495580_0192359_674_1165 | 142 |
| 132 | 3300046499 | Ga0495594_0002105 | Ga0495594_0002105_4588_5016 | 142 |
| 133 | 3300046499 | Ga0495594_0114808 | Ga0495594_0114808_762_1190 | 142 |
| 134 | 3300046516 | Ga0495628_0161033 | Ga0495628_0161033_1030_1458 | 142 |
| 135 | 3300046531 | Ga0495665_0102091 | Ga0495665_0102091_882_1310 | 142 |
| 136 | 3300046543 | Ga0495645_0013696 | Ga0495645_0013696_5142_5570 | 142 |
| 137 | 3300046543 | Ga0495645_0046501 | Ga0495645_0046501_1006_1434 | 142 |
| 138 | 3300046616 | Ga0495668_0117896 | Ga0495668_0117896_48_476 | 142 |
| 139 | 3300046674 | Ga0495588_0219771 | Ga0495588_0219771_95_523 | 142 |
| 140 | 3300046678 | Ga0495599_0015216 | Ga0495599_0015216_1754_2182 | 142 |
| 141 | 3300046690 | Ga0495624_0628313 | Ga0495624_0628313_177_605 | 142 |
| 142 | 3300046809 | Ga0495600_0121445 | Ga0495600_0121445_1085_1513 | 142 |
| 143 | 3300047317 | Ga0495604_0760150 | Ga0495604_0760150_35_463 | 142 |
| 144 | 3300047319 | Ga0495674_0018433 | Ga0495674_0018433_2076_2504 | 142 |
| 145 | 3300047471 | Ga0495684_0055291 | Ga0495684_0055291_177_605 | 142 |
| 146 | 3300047471 | Ga0495684_0084614 | Ga0495684_0084614_543_971 | 142 |
| 147 | 3300048915 | Ga0496112_0294601 | Ga0496112_0294601_226_654 | 142 |
| 148 | 3300049573 | Ga0501037_0050421 | Ga0501037_0050421_403_831 | 142 |
| 149 | 3300049574 | Ga0501038_0202752 | Ga0501038_0202752_971_1399 | 142 |
| 150 | 3300049581 | Ga0501047_0261777 | Ga0501047_0261777_745_1173 | 142 |
| 151 | 3300049586 | Ga0501070_0228564 | Ga0501070_0228564_175_603 | 142 |
| 152 | 3300049589 | Ga0501073_0191207 | Ga0501073_0191207_863_1291 | 142 |
| 153 | 3300000546 | LJNas_1006184 | LJNas_10061842 | 143 |
| 154 | 3300001991 | JGI24743J22301_10055314 | JGI24743J22301_100553141 | 143 |
| 155 | 3300003320 | rootH2_10285490 | rootH2_102854902 | 143 |
| 156 | 3300003322 | rootL2_10356678 | rootL2_103566782 | 143 |
| 157 | 3300005327 | Ga0070658_10000142 | Ga0070658_1000014215 | 143 |
| 158 | 3300005327 | Ga0070658_10014001 | Ga0070658_100140015 | 143 |
| 159 | 3300005327 | Ga0070658_10051815 | Ga0070658_100518153 | 143 |
| 160 | 3300005327 | Ga0070658_10090710 | Ga0070658_100907103 | 143 |
| 161 | 3300005327 | Ga0070658_10124843 | Ga0070658_101248432 | 143 |
| 162 | 3300005327 | Ga0070658_10192532 | Ga0070658_101925322 | 143 |
| 163 | 3300005327 | Ga0070658_11003223 | Ga0070658_110032232 | 143 |
| 164 | 3300005327 | Ga0070658_11182145 | Ga0070658_111821451 | 143 |
| 165 | 3300005328 | Ga0070676_10019001 | Ga0070676_100190011 | 143 |
| 166 | 3300005329 | Ga0070683_100003012 | Ga0070683_1000030125 | 143 |
| 167 | 3300005329 | Ga0070683_100021519 | Ga0070683_1000215194 | 143 |
| 168 | 3300005329 | Ga0070683_100061847 | Ga0070683_1000618473 | 143 |
| 169 | 3300005329 | Ga0070683_100132588 | Ga0070683_1001325882 | 143 |
| 170 | 3300005329 | Ga0070683_100177481 | Ga0070683_1001774812 | 143 |
| 171 | 3300005329 | Ga0070683_100420913 | Ga0070683_1004209131 | 143 |
| 172 | 3300005329 | Ga0070683_100635777 | Ga0070683_1006357772 | 143 |
| 173 | 3300005329 | Ga0070683_100710150 | Ga0070683_1007101501 | 143 |
| 174 | 3300005330 | Ga0070690_100164351 | Ga0070690_1001643512 | 143 |
| 175 | 3300005331 | Ga0070670_100002930 | Ga0070670_1000029308 | 143 |
| 176 | 3300005334 | Ga0068869_100000517 | Ga0068869_10000051715 | 143 |
| 177 | 3300005334 | Ga0068869_100062344 | Ga0068869_1000623443 | 143 |
| 178 | 3300005335 | Ga0070666_10012804 | Ga0070666_100128045 | 143 |
| 179 | 3300005337 | Ga0070682_101526941 | Ga0070682_1015269411 | 143 |
| 180 | 3300005337 | Ga0070682_101725761 | Ga0070682_1017257611 | 143 |
| 181 | 3300005338 | Ga0068868_100027110 | Ga0068868_1000271103 | 143 |
| 182 | 3300005338 | Ga0068868_100047080 | Ga0068868_1000470802 | 143 |
| 183 | 3300005338 | Ga0068868_100325876 | Ga0068868_1003258762 | 143 |
| 184 | 3300005339 | Ga0070660_100003805 | Ga0070660_1000038056 | 143 |
| 185 | 3300005339 | Ga0070660_100049896 | Ga0070660_1000498964 | 143 |
| 186 | 3300005339 | Ga0070660_100050439 | Ga0070660_1000504394 | 143 |
| 187 | 3300005339 | Ga0070660_100559691 | Ga0070660_1005596912 | 143 |
| 188 | 3300005344 | Ga0070661_100000910 | Ga0070661_1000009107 | 143 |
| 189 | 3300005344 | Ga0070661_100082658 | Ga0070661_1000826581 | 143 |
| 190 | 3300005344 | Ga0070661_100505212 | Ga0070661_1005052122 | 143 |
| 191 | 3300005344 | Ga0070661_100583560 | Ga0070661_1005835602 | 143 |
| 192 | 3300005345 | Ga0070692_10204663 | Ga0070692_102046632 | 143 |
| 193 | 3300005345 | Ga0070692_10502226 | Ga0070692_105022261 | 143 |
| 194 | 3300005347 | Ga0070668_100113140 | Ga0070668_1001131403 | 143 |
| 195 | 3300005354 | Ga0070675_100034701 | Ga0070675_1000347013 | 143 |
| 196 | 3300005355 | Ga0070671_100000458 | Ga0070671_10000045815 | 143 |
| 197 | 3300005355 | Ga0070671_100132125 | Ga0070671_1001321253 | 143 |
| 198 | 3300005364 | Ga0070673_100358621 | Ga0070673_1003586212 | 143 |
| 199 | 3300005364 | Ga0070673_100705982 | Ga0070673_1007059821 | 143 |
| 200 | 3300005366 | Ga0070659_100002926 | Ga0070659_1000029267 | 143 |
| 201 | 3300005366 | Ga0070659_100048475 | Ga0070659_1000484754 | 143 |
| 202 | 3300005367 | Ga0070667_100067812 | Ga0070667_1000678122 | 143 |
| 203 | 3300005367 | Ga0070667_100074985 | Ga0070667_1000749852 | 143 |
| 204 | 3300005434 | Ga0070709_10222379 | Ga0070709_102223791 | 143 |
| 205 | 3300005434 | Ga0070709_10509921 | Ga0070709_105099212 | 143 |
| 206 | 3300005435 | Ga0070714_100103847 | Ga0070714_1001038472 | 143 |
| 207 | 3300005435 | Ga0070714_100270563 | Ga0070714_1002705632 | 143 |
| 208 | 3300005436 | Ga0070713_100002026 | Ga0070713_10000202612 | 143 |
| 209 | 3300005436 | Ga0070713_100083713 | Ga0070713_1000837133 | 143 |
| 210 | 3300005455 | Ga0070663_100087286 | Ga0070663_1000872862 | 143 |
| 211 | 3300005455 | Ga0070663_100091871 | Ga0070663_1000918713 | 143 |
| 212 | 3300005455 | Ga0070663_100101520 | Ga0070663_1001015202 | 143 |
| 213 | 3300005456 | Ga0070678_100007527 | Ga0070678_1000075272 | 143 |
| 214 | 3300005458 | Ga0070681_10555344 | Ga0070681_105553442 | 143 |
| 215 | 3300005458 | Ga0070681_10940690 | Ga0070681_109406902 | 143 |
| 216 | 3300005459 | Ga0068867_101054227 | Ga0068867_1010542271 | 143 |
| 217 | 3300005530 | Ga0070679_100066464 | Ga0070679_1000664642 | 143 |
| 218 | 3300005530 | Ga0070679_100511862 | Ga0070679_1005118622 | 143 |
| 219 | 3300005535 | Ga0070684_100011640 | Ga0070684_1000116405 | 143 |
| 220 | 3300005535 | Ga0070684_100034362 | Ga0070684_1000343624 | 143 |
| 221 | 3300005535 | Ga0070684_100116051 | Ga0070684_1001160513 | 143 |
| 222 | 3300005535 | Ga0070684_100124895 | Ga0070684_1001248952 | 143 |
| 223 | 3300005535 | Ga0070684_100809282 | Ga0070684_1008092822 | 143 |
| 224 | 3300005539 | Ga0068853_100000018 | Ga0068853_10000001841 | 143 |
| 225 | 3300005539 | Ga0068853_100007063 | Ga0068853_1000070636 | 143 |
| 226 | 3300005539 | Ga0068853_100054488 | Ga0068853_1000544884 | 143 |
| 227 | 3300005539 | Ga0068853_100200276 | Ga0068853_1002002762 | 143 |
| 228 | 3300005539 | Ga0068853_100219206 | Ga0068853_1002192062 | 143 |
| 229 | 3300005539 | Ga0068853_100345218 | Ga0068853_1003452182 | 143 |
| 230 | 3300005539 | Ga0068853_102306996 | Ga0068853_1023069961 | 143 |
| 231 | 3300005543 | Ga0070672_100002005 | Ga0070672_1000020054 | 143 |
| 232 | 3300005548 | Ga0070665_100017091 | Ga0070665_1000170912 | 143 |
| 233 | 3300005548 | Ga0070665_100073342 | Ga0070665_1000733423 | 143 |
| 234 | 3300005548 | Ga0070665_100231116 | Ga0070665_1002311163 | 143 |
| 235 | 3300005548 | Ga0070665_100577924 | Ga0070665_1005779242 | 143 |
| 236 | 3300005548 | Ga0070665_100707005 | Ga0070665_1007070052 | 143 |
| 237 | 3300005563 | Ga0068855_100003707 | Ga0068855_1000037073 | 143 |
| 238 | 3300005563 | Ga0068855_100020184 | Ga0068855_1000201842 | 143 |
| 239 | 3300005563 | Ga0068855_100026998 | Ga0068855_1000269986 | 143 |
| 240 | 3300005563 | Ga0068855_100044675 | Ga0068855_1000446752 | 143 |
| 241 | 3300005563 | Ga0068855_100047496 | Ga0068855_1000474965 | 143 |
| 242 | 3300005563 | Ga0068855_100048851 | Ga0068855_1000488514 | 143 |
| 243 | 3300005563 | Ga0068855_100080886 | Ga0068855_1000808865 | 143 |
| 244 | 3300005563 | Ga0068855_100084463 | Ga0068855_1000844633 | 143 |
| 245 | 3300005563 | Ga0068855_100192999 | Ga0068855_1001929992 | 143 |
| 246 | 3300005563 | Ga0068855_100321459 | Ga0068855_1003214592 | 143 |
| 247 | 3300005563 | Ga0068855_100327545 | Ga0068855_1003275451 | 143 |
| 248 | 3300005563 | Ga0068855_100697128 | Ga0068855_1006971282 | 143 |
| 249 | 3300005577 | Ga0068857_100000749 | Ga0068857_1000007494 | 143 |
| 250 | 3300005577 | Ga0068857_100001413 | Ga0068857_10000141314 | 143 |
| 251 | 3300005577 | Ga0068857_100516036 | Ga0068857_1005160362 | 143 |
| 252 | 3300005578 | Ga0068854_100000042 | Ga0068854_10000004268 | 143 |
| 253 | 3300005578 | Ga0068854_100161709 | Ga0068854_1001617092 | 143 |
| 254 | 3300005578 | Ga0068854_100766669 | Ga0068854_1007666692 | 143 |
| 255 | 3300005578 | Ga0068854_100884056 | Ga0068854_1008840562 | 143 |
| 256 | 3300005614 | Ga0068856_100006392 | Ga0068856_1000063924 | 143 |
| 257 | 3300005614 | Ga0068856_100008572 | Ga0068856_1000085726 | 143 |
| 258 | 3300005614 | Ga0068856_100036870 | Ga0068856_1000368702 | 143 |
| 259 | 3300005614 | Ga0068856_100058871 | Ga0068856_1000588711 | 143 |
| 260 | 3300005614 | Ga0068856_100367671 | Ga0068856_1003676712 | 143 |
| 261 | 3300005614 | Ga0068856_100511148 | Ga0068856_1005111482 | 143 |
| 262 | 3300005614 | Ga0068856_100648613 | Ga0068856_1006486132 | 143 |
| 263 | 3300005614 | Ga0068856_100792783 | Ga0068856_1007927832 | 143 |
| 264 | 3300005614 | Ga0068856_101143353 | Ga0068856_1011433532 | 143 |
| 265 | 3300005616 | Ga0068852_100000714 | Ga0068852_1000007144 | 143 |
| 266 | 3300005616 | Ga0068852_100009322 | Ga0068852_1000093223 | 143 |
| 267 | 3300005616 | Ga0068852_100017448 | Ga0068852_1000174483 | 143 |
| 268 | 3300005616 | Ga0068852_100103064 | Ga0068852_1001030642 | 143 |
| 269 | 3300005616 | Ga0068852_100154020 | Ga0068852_1001540202 | 143 |
| 270 | 3300005616 | Ga0068852_100187369 | Ga0068852_1001873691 | 143 |
| 271 | 3300005616 | Ga0068852_100482028 | Ga0068852_1004820283 | 143 |
| 272 | 3300005616 | Ga0068852_100786678 | Ga0068852_1007866781 | 143 |
| 273 | 3300005617 | Ga0068859_100038997 | Ga0068859_1000389975 | 143 |
| 274 | 3300005617 | Ga0068859_100110389 | Ga0068859_1001103893 | 143 |
| 275 | 3300005618 | Ga0068864_100000992 | Ga0068864_1000009927 | 143 |
| 276 | 3300005618 | Ga0068864_101889048 | Ga0068864_1018890481 | 143 |
| 277 | 3300005718 | Ga0068866_10080976 | Ga0068866_100809762 | 143 |
| 278 | 3300005834 | Ga0068851_10136152 | Ga0068851_101361521 | 143 |
| 279 | 3300005834 | Ga0068851_10139335 | Ga0068851_101393352 | 143 |
| 280 | 3300005834 | Ga0068851_10375748 | Ga0068851_103757482 | 143 |
| 281 | 3300005834 | Ga0068851_10467268 | Ga0068851_104672681 | 143 |
| 282 | 3300005834 | Ga0068851_10513008 | Ga0068851_105130081 | 143 |
| 283 | 3300005841 | Ga0068863_100008605 | Ga0068863_1000086056 | 143 |
| 284 | 3300005841 | Ga0068863_100666525 | Ga0068863_1006665252 | 143 |
| 285 | 3300005841 | Ga0068863_101968815 | Ga0068863_1019688152 | 143 |
| 286 | 3300005842 | Ga0068858_100063440 | Ga0068858_1000634404 | 143 |
| 287 | 3300005842 | Ga0068858_100125789 | Ga0068858_1001257893 | 143 |
| 288 | 3300005842 | Ga0068858_100420384 | Ga0068858_1004203842 | 143 |
| 289 | 3300005843 | Ga0068860_100003788 | Ga0068860_1000037887 | 143 |
| 290 | 3300005843 | Ga0068860_100255708 | Ga0068860_1002557082 | 143 |
| 291 | 3300005844 | Ga0068862_100054466 | Ga0068862_1000544666 | 143 |
| 292 | 3300006028 | Ga0070717_11493671 | Ga0070717_114936712 | 143 |
| 293 | 3300006237 | Ga0097621_100004302 | Ga0097621_1000043023 | 143 |
| 294 | 3300006237 | Ga0097621_100029015 | Ga0097621_1000290154 | 143 |
| 295 | 3300006358 | Ga0068871_100002034 | Ga0068871_1000020349 | 143 |
| 296 | 3300006358 | Ga0068871_100017601 | Ga0068871_1000176015 | 143 |
| 297 | 3300006358 | Ga0068871_100065138 | Ga0068871_1000651382 | 143 |
| 298 | 3300006881 | Ga0068865_100043149 | Ga0068865_1000431493 | 143 |
| 299 | 3300006931 | Ga0097620_100038995 | Ga0097620_1000389952 | 143 |
| 300 | 3300006931 | Ga0097620_100110393 | Ga0097620_1001103932 | 143 |
| 301 | 3300009093 | Ga0105240_10000284 | Ga0105240_1000028412 | 143 |
| 302 | 3300009093 | Ga0105240_10001593 | Ga0105240_1000159329 | 143 |
| 303 | 3300009093 | Ga0105240_10001640 | Ga0105240_1000164015 | 143 |
| 304 | 3300009093 | Ga0105240_10008641 | Ga0105240_100086413 | 143 |
| 305 | 3300009093 | Ga0105240_10009569 | Ga0105240_100095695 | 143 |
| 306 | 3300009093 | Ga0105240_10122136 | Ga0105240_101221364 | 143 |
| 307 | 3300009093 | Ga0105240_10167381 | Ga0105240_101673813 | 143 |
| 308 | 3300009093 | Ga0105240_10440799 | Ga0105240_104407991 | 143 |
| 309 | 3300009093 | Ga0105240_11138913 | Ga0105240_111389131 | 143 |
| 310 | 3300009093 | Ga0105240_11171971 | Ga0105240_111719712 | 143 |
| 311 | 3300009093 | Ga0105240_11701418 | Ga0105240_117014182 | 143 |
| 312 | 3300009093 | Ga0105240_12502135 | Ga0105240_125021351 | 143 |
| 313 | 3300009098 | Ga0105245_10001856 | Ga0105245_100018569 | 143 |
| 314 | 3300009098 | Ga0105245_10026871 | Ga0105245_100268713 | 143 |
| 315 | 3300009098 | Ga0105245_10354412 | Ga0105245_103544121 | 143 |
| 316 | 3300009098 | Ga0105245_10365177 | Ga0105245_103651772 | 143 |
| 317 | 3300009101 | Ga0105247_10015372 | Ga0105247_100153724 | 143 |
| 318 | 3300009101 | Ga0105247_10100415 | Ga0105247_101004151 | 143 |
| 319 | 3300009174 | Ga0105241_10000265 | Ga0105241_1000026532 | 143 |
| 320 | 3300009174 | Ga0105241_10002773 | Ga0105241_100027739 | 143 |
| 321 | 3300009174 | Ga0105241_10003506 | Ga0105241_100035066 | 143 |
| 322 | 3300009174 | Ga0105241_10027355 | Ga0105241_100273552 | 143 |
| 323 | 3300009174 | Ga0105241_10050443 | Ga0105241_100504434 | 143 |
| 324 | 3300009174 | Ga0105241_10416495 | Ga0105241_104164952 | 143 |
| 325 | 3300009174 | Ga0105241_10994579 | Ga0105241_109945792 | 143 |
| 326 | 3300009174 | Ga0105241_11241257 | Ga0105241_112412572 | 143 |
| 327 | 3300009177 | Ga0105248_10003308 | Ga0105248_100033088 | 143 |
| 328 | 3300009177 | Ga0105248_10010912 | Ga0105248_100109129 | 143 |
| 329 | 3300009177 | Ga0105248_10115613 | Ga0105248_101156133 | 143 |
| 330 | 3300009177 | Ga0105248_10398651 | Ga0105248_103986513 | 143 |
| 331 | 3300009177 | Ga0105248_10730943 | Ga0105248_107309432 | 143 |
| 332 | 3300009545 | Ga0105237_10009543 | Ga0105237_100095433 | 143 |
| 333 | 3300009545 | Ga0105237_10086789 | Ga0105237_100867893 | 143 |
| 334 | 3300009545 | Ga0105237_10098112 | Ga0105237_100981124 | 143 |
| 335 | 3300009545 | Ga0105237_10239765 | Ga0105237_102397651 | 143 |
| 336 | 3300009545 | Ga0105237_10264097 | Ga0105237_102640972 | 143 |
| 337 | 3300009545 | Ga0105237_10283365 | Ga0105237_102833652 | 143 |
| 338 | 3300009545 | Ga0105237_10490760 | Ga0105237_104907601 | 143 |
| 339 | 3300009545 | Ga0105237_10634632 | Ga0105237_106346322 | 143 |
| 340 | 3300009551 | Ga0105238_10000338 | Ga0105238_1000033827 | 143 |
| 341 | 3300009551 | Ga0105238_10004902 | Ga0105238_100049028 | 143 |
| 342 | 3300009551 | Ga0105238_10010228 | Ga0105238_100102286 | 143 |
| 343 | 3300009551 | Ga0105238_10010638 | Ga0105238_100106386 | 143 |
| 344 | 3300009551 | Ga0105238_10030278 | Ga0105238_100302783 | 143 |
| 345 | 3300009551 | Ga0105238_10030933 | Ga0105238_100309336 | 143 |
| 346 | 3300009551 | Ga0105238_10044390 | Ga0105238_100443903 | 143 |
| 347 | 3300009551 | Ga0105238_10050443 | Ga0105238_100504432 | 143 |
| 348 | 3300009551 | Ga0105238_10063776 | Ga0105238_100637764 | 143 |
| 349 | 3300009551 | Ga0105238_10087015 | Ga0105238_100870153 | 143 |
| 350 | 3300009551 | Ga0105238_10288267 | Ga0105238_102882672 | 143 |
| 351 | 3300009551 | Ga0105238_10349520 | Ga0105238_103495203 | 143 |
| 352 | 3300009551 | Ga0105238_10634566 | Ga0105238_106345662 | 143 |
| 353 | 3300009551 | Ga0105238_11044752 | Ga0105238_110447521 | 143 |
| 354 | 3300009551 | Ga0105238_11145933 | Ga0105238_111459331 | 143 |
| 355 | 3300009553 | Ga0105249_10056784 | Ga0105249_100567844 | 143 |
| 356 | 3300009553 | Ga0105249_10063775 | Ga0105249_100637751 | 143 |
| 357 | 3300009553 | Ga0105249_10371438 | Ga0105249_103714382 | 143 |
| 358 | 3300010375 | Ga0105239_10002626 | Ga0105239_1000262616 | 143 |
| 359 | 3300010375 | Ga0105239_10028844 | Ga0105239_100288447 | 143 |
| 360 | 3300010375 | Ga0105239_10058648 | Ga0105239_100586483 | 143 |
| 361 | 3300010375 | Ga0105239_10099800 | Ga0105239_100998003 | 143 |
| 362 | 3300010375 | Ga0105239_10119210 | Ga0105239_101192103 | 143 |
| 363 | 3300010375 | Ga0105239_10149163 | Ga0105239_101491633 | 143 |
| 364 | 3300010375 | Ga0105239_10243778 | Ga0105239_102437782 | 143 |
| 365 | 3300010375 | Ga0105239_10928312 | Ga0105239_109283122 | 143 |
| 366 | 3300011119 | Ga0105246_10002388 | Ga0105246_100023885 | 143 |
| 367 | 3300011119 | Ga0105246_10011686 | Ga0105246_100116862 | 143 |
| 368 | 3300013100 | Ga0157373_10055052 | Ga0157373_100550524 | 143 |
| 369 | 3300013100 | Ga0157373_10189746 | Ga0157373_101897462 | 143 |
| 370 | 3300013100 | Ga0157373_10239460 | Ga0157373_102394602 | 143 |
| 371 | 3300013102 | Ga0157371_10122087 | Ga0157371_101220872 | 143 |
| 372 | 3300013102 | Ga0157371_10649794 | Ga0157371_106497942 | 143 |
| 373 | 3300013104 | Ga0157370_10000685 | Ga0157370_100006853 | 143 |
| 374 | 3300013104 | Ga0157370_10014019 | Ga0157370_100140196 | 143 |
| 375 | 3300013104 | Ga0157370_10019566 | Ga0157370_100195665 | 143 |
| 376 | 3300013104 | Ga0157370_10031093 | Ga0157370_100310932 | 143 |
| 377 | 3300013104 | Ga0157370_10040413 | Ga0157370_100404134 | 143 |
| 378 | 3300013104 | Ga0157370_10103184 | Ga0157370_101031844 | 143 |
| 379 | 3300013104 | Ga0157370_10480464 | Ga0157370_104804642 | 143 |
| 380 | 3300013104 | Ga0157370_10808379 | Ga0157370_108083792 | 143 |
| 381 | 3300013105 | Ga0157369_10000699 | Ga0157369_100006993 | 143 |
| 382 | 3300013105 | Ga0157369_10003649 | Ga0157369_1000364913 | 143 |
| 383 | 3300013105 | Ga0157369_10004476 | Ga0157369_100044769 | 143 |
| 384 | 3300013105 | Ga0157369_10018778 | Ga0157369_100187781 | 143 |
| 385 | 3300013105 | Ga0157369_10037519 | Ga0157369_100375195 | 143 |
| 386 | 3300013105 | Ga0157369_10041216 | Ga0157369_100412164 | 143 |
| 387 | 3300013105 | Ga0157369_10046148 | Ga0157369_100461484 | 143 |
| 388 | 3300013105 | Ga0157369_10057696 | Ga0157369_100576964 | 143 |
| 389 | 3300013105 | Ga0157369_10122762 | Ga0157369_101227624 | 143 |
| 390 | 3300013105 | Ga0157369_10175135 | Ga0157369_101751353 | 143 |
| 391 | 3300013105 | Ga0157369_10217831 | Ga0157369_102178314 | 143 |
| 392 | 3300013105 | Ga0157369_10218622 | Ga0157369_102186222 | 143 |
| 393 | 3300013105 | Ga0157369_10248502 | Ga0157369_102485023 | 143 |
| 394 | 3300013105 | Ga0157369_10417235 | Ga0157369_104172353 | 143 |
| 395 | 3300013105 | Ga0157369_10549034 | Ga0157369_105490342 | 143 |
| 396 | 3300013105 | Ga0157369_11481404 | Ga0157369_114814041 | 143 |
| 397 | 3300013296 | Ga0157374_10003668 | Ga0157374_100036689 | 143 |
| 398 | 3300013296 | Ga0157374_10005152 | Ga0157374_100051528 | 143 |
| 399 | 3300013296 | Ga0157374_10012662 | Ga0157374_100126623 | 143 |
| 400 | 3300013296 | Ga0157374_10053216 | Ga0157374_100532165 | 143 |
| 401 | 3300013296 | Ga0157374_10064013 | Ga0157374_100640133 | 143 |
| 402 | 3300013296 | Ga0157374_10152869 | Ga0157374_101528692 | 143 |
| 403 | 3300013296 | Ga0157374_10551649 | Ga0157374_105516493 | 143 |
| 404 | 3300013296 | Ga0157374_10789951 | Ga0157374_107899512 | 143 |
| 405 | 3300013296 | Ga0157374_11671468 | Ga0157374_116714681 | 143 |
| 406 | 3300013296 | Ga0157374_11993245 | Ga0157374_119932452 | 143 |
| 407 | 3300013297 | Ga0157378_10003077 | Ga0157378_100030773 | 143 |
| 408 | 3300013297 | Ga0157378_10021015 | Ga0157378_100210156 | 143 |
| 409 | 3300013297 | Ga0157378_10022074 | Ga0157378_100220745 | 143 |
| 410 | 3300013297 | Ga0157378_10022330 | Ga0157378_100223306 | 143 |
| 411 | 3300013297 | Ga0157378_10238993 | Ga0157378_102389932 | 143 |
| 412 | 3300013306 | Ga0163162_10007199 | Ga0163162_100071995 | 143 |
| 413 | 3300013306 | Ga0163162_10025177 | Ga0163162_100251774 | 143 |
| 414 | 3300013306 | Ga0163162_10487348 | Ga0163162_104873482 | 143 |
| 415 | 3300013306 | Ga0163162_10909387 | Ga0163162_109093872 | 143 |
| 416 | 3300013307 | Ga0157372_10003883 | Ga0157372_100038833 | 143 |
| 417 | 3300013307 | Ga0157372_10026862 | Ga0157372_100268627 | 143 |
| 418 | 3300013307 | Ga0157372_10032337 | Ga0157372_100323375 | 143 |
| 419 | 3300013307 | Ga0157372_10112785 | Ga0157372_101127853 | 143 |
| 420 | 3300013307 | Ga0157372_10141879 | Ga0157372_101418792 | 143 |
| 421 | 3300013307 | Ga0157372_10230156 | Ga0157372_102301562 | 143 |
| 422 | 3300013307 | Ga0157372_10249654 | Ga0157372_102496542 | 143 |
| 423 | 3300013307 | Ga0157372_10268079 | Ga0157372_102680792 | 143 |
| 424 | 3300013307 | Ga0157372_10393626 | Ga0157372_103936262 | 143 |
| 425 | 3300013307 | Ga0157372_10477083 | Ga0157372_104770832 | 143 |
| 426 | 3300013307 | Ga0157372_10504207 | Ga0157372_105042071 | 143 |
| 427 | 3300013307 | Ga0157372_11201835 | Ga0157372_112018352 | 143 |
| 428 | 3300013308 | Ga0157375_10013492 | Ga0157375_100134922 | 143 |
| 429 | 3300013308 | Ga0157375_10016797 | Ga0157375_100167974 | 143 |
| 430 | 3300013308 | Ga0157375_10297394 | Ga0157375_102973942 | 143 |
| 431 | 3300013308 | Ga0157375_10961360 | Ga0157375_109613602 | 143 |
| 432 | 3300014325 | Ga0163163_10004242 | Ga0163163_100042428 | 143 |
| 433 | 3300014325 | Ga0163163_10318921 | Ga0163163_103189212 | 143 |
| 434 | 3300014745 | Ga0157377_10037796 | Ga0157377_100377963 | 143 |
| 435 | 3300014968 | Ga0157379_10049522 | Ga0157379_100495224 | 143 |
| 436 | 3300014968 | Ga0157379_10076244 | Ga0157379_100762442 | 143 |
| 437 | 3300014968 | Ga0157379_10110996 | Ga0157379_101109963 | 143 |
| 438 | 3300014968 | Ga0157379_10222997 | Ga0157379_102229972 | 143 |
| 439 | 3300014969 | Ga0157376_10000803 | Ga0157376_1000080310 | 143 |
| 440 | 3300014969 | Ga0157376_10031107 | Ga0157376_100311073 | 143 |
| 441 | 3300014969 | Ga0157376_10036467 | Ga0157376_100364672 | 143 |
| 442 | 3300014969 | Ga0157376_10052320 | Ga0157376_100523203 | 143 |
| 443 | 3300014969 | Ga0157376_10059462 | Ga0157376_100594625 | 143 |
| 444 | 3300014969 | Ga0157376_10510007 | Ga0157376_105100072 | 143 |
| 445 | 3300014969 | Ga0157376_11391671 | Ga0157376_113916711 | 143 |
| 446 | 3300014969 | Ga0157376_11702895 | Ga0157376_117028951 | 143 |
| 447 | 3300014969 | Ga0157376_11866536 | Ga0157376_118665361 | 143 |
| 448 | 3300017792 | Ga0163161_10015051 | Ga0163161_100150515 | 143 |
| 449 | 3300021361 | Ga0213872_10042844 | Ga0213872_100428442 | 143 |
| 450 | 3300025321 | Ga0207656_10044622 | Ga0207656_100446221 | 143 |
| 451 | 3300025321 | Ga0207656_10053720 | Ga0207656_100537203 | 143 |
| 452 | 3300025321 | Ga0207656_10057988 | Ga0207656_100579882 | 143 |
| 453 | 3300025321 | Ga0207656_10100013 | Ga0207656_101000132 | 143 |
| 454 | 3300025321 | Ga0207656_10114377 | Ga0207656_101143771 | 143 |
| 455 | 3300025321 | Ga0207656_10182385 | Ga0207656_101823851 | 143 |
| 456 | 3300025899 | Ga0207642_10220476 | Ga0207642_102204762 | 143 |
| 457 | 3300025900 | Ga0207710_10005472 | Ga0207710_100054723 | 143 |
| 458 | 3300025900 | Ga0207710_10310662 | Ga0207710_103106622 | 143 |
| 459 | 3300025901 | Ga0207688_10067264 | Ga0207688_100672643 | 143 |
| 460 | 3300025903 | Ga0207680_10050119 | Ga0207680_100501193 | 143 |
| 461 | 3300025904 | Ga0207647_10030028 | Ga0207647_100300283 | 143 |
| 462 | 3300025904 | Ga0207647_10190870 | Ga0207647_101908701 | 143 |
| 463 | 3300025907 | Ga0207645_10059026 | Ga0207645_100590263 | 143 |
| 464 | 3300025909 | Ga0207705_10000329 | Ga0207705_1000032915 | 143 |
| 465 | 3300025909 | Ga0207705_10013575 | Ga0207705_100135753 | 143 |
| 466 | 3300025909 | Ga0207705_10016110 | Ga0207705_100161102 | 143 |
| 467 | 3300025909 | Ga0207705_10032962 | Ga0207705_100329624 | 143 |
| 468 | 3300025909 | Ga0207705_10087426 | Ga0207705_100874262 | 143 |
| 469 | 3300025909 | Ga0207705_10235828 | Ga0207705_102358282 | 143 |
| 470 | 3300025909 | Ga0207705_11027771 | Ga0207705_110277711 | 143 |
| 471 | 3300025911 | Ga0207654_10002016 | Ga0207654_100020168 | 143 |
| 472 | 3300025911 | Ga0207654_10005807 | Ga0207654_100058077 | 143 |
| 473 | 3300025911 | Ga0207654_10113015 | Ga0207654_101130152 | 143 |
| 474 | 3300025911 | Ga0207654_10139477 | Ga0207654_101394773 | 143 |
| 475 | 3300025911 | Ga0207654_10401248 | Ga0207654_104012482 | 143 |
| 476 | 3300025913 | Ga0207695_10000001 | Ga0207695_100000011058 | 143 |
| 477 | 3300025913 | Ga0207695_10000098 | Ga0207695_10000098117 | 143 |
| 478 | 3300025913 | Ga0207695_10000331 | Ga0207695_1000033191 | 143 |
| 479 | 3300025913 | Ga0207695_10000823 | Ga0207695_1000082335 | 143 |
| 480 | 3300025913 | Ga0207695_10001323 | Ga0207695_100013233 | 143 |
| 481 | 3300025913 | Ga0207695_10002473 | Ga0207695_1000247310 | 143 |
| 482 | 3300025913 | Ga0207695_10003432 | Ga0207695_100034326 | 143 |
| 483 | 3300025913 | Ga0207695_10031120 | Ga0207695_100311205 | 143 |
| 484 | 3300025913 | Ga0207695_10037287 | Ga0207695_100372875 | 143 |
| 485 | 3300025913 | Ga0207695_10051687 | Ga0207695_100516874 | 143 |
| 486 | 3300025913 | Ga0207695_10723352 | Ga0207695_107233522 | 143 |
| 487 | 3300025913 | Ga0207695_11246380 | Ga0207695_112463801 | 143 |
| 488 | 3300025914 | Ga0207671_10000655 | Ga0207671_1000065515 | 143 |
| 489 | 3300025914 | Ga0207671_10001346 | Ga0207671_100013466 | 143 |
| 490 | 3300025914 | Ga0207671_10071130 | Ga0207671_100711303 | 143 |
| 491 | 3300025914 | Ga0207671_10277182 | Ga0207671_102771822 | 143 |
| 492 | 3300025914 | Ga0207671_10664821 | Ga0207671_106648212 | 143 |
| 493 | 3300025914 | Ga0207671_11183042 | Ga0207671_111830421 | 143 |
| 494 | 3300025919 | Ga0207657_10021566 | Ga0207657_100215666 | 143 |
| 495 | 3300025919 | Ga0207657_10079770 | Ga0207657_100797704 | 143 |
| 496 | 3300025919 | Ga0207657_10419998 | Ga0207657_104199981 | 143 |
| 497 | 3300025919 | Ga0207657_10434674 | Ga0207657_104346742 | 143 |
| 498 | 3300025920 | Ga0207649_10002070 | Ga0207649_100020707 | 143 |
| 499 | 3300025920 | Ga0207649_10038694 | Ga0207649_100386942 | 143 |
| 500 | 3300025920 | Ga0207649_10056860 | Ga0207649_100568604 | 143 |
| 501 | 3300025920 | Ga0207649_10548066 | Ga0207649_105480662 | 143 |
| 502 | 3300025921 | Ga0207652_10190665 | Ga0207652_101906653 | 143 |
| 503 | 3300025924 | Ga0207694_10000105 | Ga0207694_1000010573 | 143 |
| 504 | 3300025924 | Ga0207694_10000727 | Ga0207694_1000072720 | 143 |
| 505 | 3300025924 | Ga0207694_10004769 | Ga0207694_100047695 | 143 |
| 506 | 3300025924 | Ga0207694_10038031 | Ga0207694_100380314 | 143 |
| 507 | 3300025924 | Ga0207694_10052016 | Ga0207694_100520162 | 143 |
| 508 | 3300025924 | Ga0207694_10114873 | Ga0207694_101148732 | 143 |
| 509 | 3300025924 | Ga0207694_10190913 | Ga0207694_101909133 | 143 |
| 510 | 3300025924 | Ga0207694_10210018 | Ga0207694_102100181 | 143 |
| 511 | 3300025924 | Ga0207694_10247007 | Ga0207694_102470071 | 143 |
| 512 | 3300025924 | Ga0207694_10616202 | Ga0207694_106162022 | 143 |
| 513 | 3300025924 | Ga0207694_10703596 | Ga0207694_107035961 | 143 |
| 514 | 3300025925 | Ga0207650_10006265 | Ga0207650_100062657 | 143 |
| 515 | 3300025927 | Ga0207687_10011961 | Ga0207687_100119613 | 143 |
| 516 | 3300025927 | Ga0207687_10016887 | Ga0207687_100168872 | 143 |
| 517 | 3300025927 | Ga0207687_10037312 | Ga0207687_100373122 | 143 |
| 518 | 3300025928 | Ga0207700_10002588 | Ga0207700_100025885 | 143 |
| 519 | 3300025928 | Ga0207700_11335452 | Ga0207700_113354521 | 143 |
| 520 | 3300025931 | Ga0207644_10010986 | Ga0207644_100109862 | 143 |
| 521 | 3300025931 | Ga0207644_10818648 | Ga0207644_108186481 | 143 |
| 522 | 3300025932 | Ga0207690_10000778 | Ga0207690_1000077815 | 143 |
| 523 | 3300025932 | Ga0207690_10022060 | Ga0207690_100220602 | 143 |
| 524 | 3300025932 | Ga0207690_11473966 | Ga0207690_114739661 | 143 |
| 525 | 3300025933 | Ga0207706_10015144 | Ga0207706_100151444 | 143 |
| 526 | 3300025940 | Ga0207691_10006334 | Ga0207691_100063345 | 143 |
| 527 | 3300025941 | Ga0207711_10001943 | Ga0207711_100019436 | 143 |
| 528 | 3300025941 | Ga0207711_10151664 | Ga0207711_101516642 | 143 |
| 529 | 3300025941 | Ga0207711_10231355 | Ga0207711_102313552 | 143 |
| 530 | 3300025941 | Ga0207711_10429853 | Ga0207711_104298532 | 143 |
| 531 | 3300025942 | Ga0207689_10000311 | Ga0207689_1000031119 | 143 |
| 532 | 3300025942 | Ga0207689_10045853 | Ga0207689_100458533 | 143 |
| 533 | 3300025944 | Ga0207661_10016768 | Ga0207661_100167684 | 143 |
| 534 | 3300025944 | Ga0207661_10029655 | Ga0207661_100296552 | 143 |
| 535 | 3300025944 | Ga0207661_10146793 | Ga0207661_101467932 | 143 |
| 536 | 3300025944 | Ga0207661_10322875 | Ga0207661_103228752 | 143 |
| 537 | 3300025944 | Ga0207661_11451253 | Ga0207661_114512531 | 143 |
| 538 | 3300025949 | Ga0207667_10002382 | Ga0207667_100023824 | 143 |
| 539 | 3300025949 | Ga0207667_10004198 | Ga0207667_1000419814 | 143 |
| 540 | 3300025949 | Ga0207667_10016687 | Ga0207667_100166872 | 143 |
| 541 | 3300025949 | Ga0207667_10022906 | Ga0207667_100229066 | 143 |
| 542 | 3300025949 | Ga0207667_10035823 | Ga0207667_100358235 | 143 |
| 543 | 3300025949 | Ga0207667_10076964 | Ga0207667_100769642 | 143 |
| 544 | 3300025949 | Ga0207667_10105514 | Ga0207667_101055144 | 143 |
| 545 | 3300025949 | Ga0207667_10165227 | Ga0207667_101652273 | 143 |
| 546 | 3300025949 | Ga0207667_10166247 | Ga0207667_101662472 | 143 |
| 547 | 3300025949 | Ga0207667_10212111 | Ga0207667_102121112 | 143 |
| 548 | 3300025949 | Ga0207667_10524929 | Ga0207667_105249292 | 143 |
| 549 | 3300025960 | Ga0207651_10675647 | Ga0207651_106756472 | 143 |
| 550 | 3300025961 | Ga0207712_10030704 | Ga0207712_100307043 | 143 |
| 551 | 3300025961 | Ga0207712_10238350 | Ga0207712_102383502 | 143 |
| 552 | 3300025961 | Ga0207712_10958470 | Ga0207712_109584701 | 143 |
| 553 | 3300025972 | Ga0207668_10463019 | Ga0207668_104630192 | 143 |
| 554 | 3300025981 | Ga0207640_10000002 | Ga0207640_10000002156 | 143 |
| 555 | 3300025981 | Ga0207640_10125090 | Ga0207640_101250902 | 143 |
| 556 | 3300025981 | Ga0207640_10177477 | Ga0207640_101774771 | 143 |
| 557 | 3300025986 | Ga0207658_10034137 | Ga0207658_100341373 | 143 |
| 558 | 3300025986 | Ga0207658_11046378 | Ga0207658_110463781 | 143 |
| 559 | 3300026023 | Ga0207677_10004327 | Ga0207677_100043273 | 143 |
| 560 | 3300026023 | Ga0207677_10010143 | Ga0207677_100101433 | 143 |
| 561 | 3300026023 | Ga0207677_10193841 | Ga0207677_101938411 | 143 |
| 562 | 3300026035 | Ga0207703_10020790 | Ga0207703_100207904 | 143 |
| 563 | 3300026035 | Ga0207703_10346469 | Ga0207703_103464693 | 143 |
| 564 | 3300026035 | Ga0207703_10368582 | Ga0207703_103685821 | 143 |
| 565 | 3300026041 | Ga0207639_10000011 | Ga0207639_1000001173 | 143 |
| 566 | 3300026041 | Ga0207639_10008592 | Ga0207639_100085923 | 143 |
| 567 | 3300026041 | Ga0207639_10041090 | Ga0207639_100410904 | 143 |
| 568 | 3300026041 | Ga0207639_10089034 | Ga0207639_100890342 | 143 |
| 569 | 3300026041 | Ga0207639_10106486 | Ga0207639_101064861 | 143 |
| 570 | 3300026041 | Ga0207639_10339644 | Ga0207639_103396442 | 143 |
| 571 | 3300026041 | Ga0207639_10348409 | Ga0207639_103484091 | 143 |
| 572 | 3300026067 | Ga0207678_10015022 | Ga0207678_100150225 | 143 |
| 573 | 3300026067 | Ga0207678_10020198 | Ga0207678_100201982 | 143 |
| 574 | 3300026067 | Ga0207678_10073882 | Ga0207678_100738824 | 143 |
| 575 | 3300026067 | Ga0207678_10137316 | Ga0207678_101373163 | 143 |
| 576 | 3300026067 | Ga0207678_10379015 | Ga0207678_103790153 | 143 |
| 577 | 3300026067 | Ga0207678_10433328 | Ga0207678_104333282 | 143 |
| 578 | 3300026067 | Ga0207678_10445444 | Ga0207678_104454441 | 143 |
| 579 | 3300026067 | Ga0207678_10665378 | Ga0207678_106653782 | 143 |
| 580 | 3300026078 | Ga0207702_10000984 | Ga0207702_100009849 | 143 |
| 581 | 3300026078 | Ga0207702_10023069 | Ga0207702_100230692 | 143 |
| 582 | 3300026078 | Ga0207702_10024626 | Ga0207702_100246264 | 143 |
| 583 | 3300026078 | Ga0207702_10046034 | Ga0207702_100460344 | 143 |
| 584 | 3300026078 | Ga0207702_10310019 | Ga0207702_103100192 | 143 |
| 585 | 3300026078 | Ga0207702_10715477 | Ga0207702_107154771 | 143 |
| 586 | 3300026078 | Ga0207702_10793783 | Ga0207702_107937832 | 143 |
| 587 | 3300026078 | Ga0207702_11703172 | Ga0207702_117031722 | 143 |
| 588 | 3300026088 | Ga0207641_10007496 | Ga0207641_100074967 | 143 |
| 589 | 3300026088 | Ga0207641_10087653 | Ga0207641_100876534 | 143 |
| 590 | 3300026088 | Ga0207641_11877094 | Ga0207641_118770942 | 143 |
| 591 | 3300026095 | Ga0207676_10001007 | Ga0207676_100010076 | 143 |
| 592 | 3300026116 | Ga0207674_10000855 | Ga0207674_1000085515 | 143 |
| 593 | 3300026116 | Ga0207674_10000980 | Ga0207674_100009804 | 143 |
| 594 | 3300026116 | Ga0207674_10820184 | Ga0207674_108201842 | 143 |
| 595 | 3300026121 | Ga0207683_10000538 | Ga0207683_1000053828 | 143 |
| 596 | 3300026142 | Ga0207698_10000274 | Ga0207698_1000027427 | 143 |
| 597 | 3300026142 | Ga0207698_10006887 | Ga0207698_100068877 | 143 |
| 598 | 3300026142 | Ga0207698_10174806 | Ga0207698_101748063 | 143 |
| 599 | 3300026142 | Ga0207698_10205720 | Ga0207698_102057203 | 143 |
| 600 | 3300026142 | Ga0207698_10386870 | Ga0207698_103868702 | 143 |
| 601 | 3300026142 | Ga0207698_12136499 | Ga0207698_121364991 | 143 |
| 602 | 3300028379 | Ga0268266_10002567 | Ga0268266_100025679 | 143 |
| 603 | 3300028379 | Ga0268266_10013530 | Ga0268266_100135302 | 143 |
| 604 | 3300028379 | Ga0268266_10028613 | Ga0268266_100286133 | 143 |
| 605 | 3300028379 | Ga0268266_10038595 | Ga0268266_100385952 | 143 |
| 606 | 3300028379 | Ga0268266_10149580 | Ga0268266_101495803 | 143 |
| 607 | 3300028380 | Ga0268265_10090122 | Ga0268265_100901221 | 143 |
| 608 | 3300028381 | Ga0268264_10002880 | Ga0268264_100028809 | 143 |
| 609 | 3300028653 | Ga0265323_10033302 | Ga0265323_100333023 | 143 |
| 610 | 3300028800 | Ga0265338_10053262 | Ga0265338_100532622 | 143 |
| 611 | 3300028800 | Ga0265338_10128248 | Ga0265338_101282482 | 143 |
| 612 | 3300029957 | Ga0265324_10066237 | Ga0265324_100662372 | 143 |
| 613 | 3300029957 | Ga0265324_10345234 | Ga0265324_103452341 | 143 |
| 614 | 3300031235 | Ga0265330_10013349 | Ga0265330_100133495 | 143 |
| 615 | 3300031235 | Ga0265330_10050775 | Ga0265330_100507751 | 143 |
| 616 | 3300031238 | Ga0265332_10020744 | Ga0265332_100207441 | 143 |
| 617 | 3300031238 | Ga0265332_10437035 | Ga0265332_104370351 | 143 |
| 618 | 3300031239 | Ga0265328_10013516 | Ga0265328_100135163 | 143 |
| 619 | 3300031239 | Ga0265328_10016020 | Ga0265328_100160203 | 143 |
| 620 | 3300031240 | Ga0265320_10029314 | Ga0265320_100293141 | 143 |
| 621 | 3300031241 | Ga0265325_10049112 | Ga0265325_100491122 | 143 |
| 622 | 3300031241 | Ga0265325_10068856 | Ga0265325_100688563 | 143 |
| 623 | 3300031242 | Ga0265329_10049328 | Ga0265329_100493283 | 143 |
| 624 | 3300031242 | Ga0265329_10090407 | Ga0265329_100904071 | 143 |
| 625 | 3300031247 | Ga0265340_10059546 | Ga0265340_100595463 | 143 |
| 626 | 3300031249 | Ga0265339_10001232 | Ga0265339_100012327 | 143 |
| 627 | 3300031249 | Ga0265339_10094684 | Ga0265339_100946842 | 143 |
| 628 | 3300031249 | Ga0265339_10146940 | Ga0265339_101469402 | 143 |
| 629 | 3300031249 | Ga0265339_10183518 | Ga0265339_101835181 | 143 |
| 630 | 3300031250 | Ga0265331_10065378 | Ga0265331_100653782 | 143 |
| 631 | 3300031344 | Ga0265316_10001589 | Ga0265316_1000158910 | 143 |
| 632 | 3300031344 | Ga0265316_10023982 | Ga0265316_100239822 | 143 |
| 633 | 3300031344 | Ga0265316_10030629 | Ga0265316_100306293 | 143 |
| 634 | 3300031344 | Ga0265316_10375836 | Ga0265316_103758362 | 143 |
| 635 | 3300031595 | Ga0265313_10000889 | Ga0265313_1000088924 | 143 |
| 636 | 3300031595 | Ga0265313_10033410 | Ga0265313_100334103 | 143 |
| 637 | 3300031711 | Ga0265314_10000047 | Ga0265314_100000472 | 143 |
| 638 | 3300031711 | Ga0265314_10030156 | Ga0265314_100301563 | 143 |
| 639 | 3300031711 | Ga0265314_10151026 | Ga0265314_101510261 | 143 |
| 640 | 3300031711 | Ga0265314_10552543 | Ga0265314_105525431 | 143 |
| 641 | 3300031712 | Ga0265342_10073805 | Ga0265342_100738053 | 143 |
| 642 | 3300031712 | Ga0265342_10078741 | Ga0265342_100787411 | 143 |
| 643 | 3300031712 | Ga0265342_10123968 | Ga0265342_101239682 | 143 |
| 644 | 3300031712 | Ga0265342_10661937 | Ga0265342_106619371 | 143 |
| 645 | 3300033180 | Ga0307510_10545474 | Ga0307510_105454742 | 143 |
| 646 | 3300035171 | Ga0373946_0268876 | Ga0373946_0268876_20_475 | 143 |
| 647 | 3300035692 | Ga0373935_0655080 | Ga0373935_0655080_295_750 | 143 |
| 648 | 3300035724 | Ga0373933_0287150 | Ga0373933_0287150_165_620 | 143 |
| 649 | 3300036401 | Ga0373937_1799380 | Ga0373937_1799380_25_480 | 143 |
| 650 | 3300037068 | Ga0373925_0487716 | Ga0373925_0487716_397_828 | 143 |
| 651 | 3300037418 | Ga0395900_1478532 | Ga0395900_1478532_59_499 | 143 |
| 652 | 3300039438 | Ga0436360_0610332 | Ga0436360_0610332_4265_4699 | 143 |
| 653 | 3300039447 | Ga0436361_0337765 | Ga0436361_0337765_846_1280 | 143 |
| 654 | 3300044684 | Ga0466966_0047123 | Ga0466966_0047123_120_560 | 143 |
| 655 | 3300044693 | Ga0466961_0389735 | Ga0466961_0389735_75_530 | 143 |
| 656 | 3300044694 | Ga0466963_0971671 | Ga0466963_0971671_38_493 | 143 |
| 657 | 3300044765 | Ga0466970_0570819 | Ga0466970_0570819_43_498 | 143 |
| 658 | 3300045976 | Ga0466967_0004403 | Ga0466967_0004403_8802_9257 | 143 |
| 659 | 3300045976 | Ga0466967_0102326 | Ga0466967_0102326_535_975 | 143 |
| 660 | 3300046455 | Ga0495603_0009966 | Ga0495603_0009966_495_935 | 143 |
| 661 | 3300046457 | Ga0495590_0248597 | Ga0495590_0248597_35_469 | 143 |
| 662 | 3300046459 | Ga0495629_0013052 | Ga0495629_0013052_4868_5323 | 143 |
| 663 | 3300046459 | Ga0495629_0111918 | Ga0495629_0111918_941_1396 | 143 |
| 664 | 3300046462 | Ga0495651_0057334 | Ga0495651_0057334_577_1026 | 143 |
| 665 | 3300046462 | Ga0495651_0268372 | Ga0495651_0268372_30_485 | 143 |
| 666 | 3300046463 | Ga0495653_0112746 | Ga0495653_0112746_1076_1525 | 143 |
| 667 | 3300046471 | Ga0495650_0000038 | Ga0495650_0000038_330863_331309 | 143 |
| 668 | 3300046471 | Ga0495650_0010097 | Ga0495650_0010097_4331_4762 | 143 |
| 669 | 3300046472 | Ga0495580_0068034 | Ga0495580_0068034_1383_1838 | 143 |
| 670 | 3300046472 | Ga0495580_0104933 | Ga0495580_0104933_718_1173 | 143 |
| 671 | 3300046472 | Ga0495580_0262810 | Ga0495580_0262810_585_1025 | 143 |
| 672 | 3300046473 | Ga0495582_0001708 | Ga0495582_0001708_8058_8507 | 143 |
| 673 | 3300046473 | Ga0495582_0064541 | Ga0495582_0064541_268_723 | 143 |
| 674 | 3300046473 | Ga0495582_0155597 | Ga0495582_0155597_20_475 | 143 |
| 675 | 3300046474 | Ga0495605_0048804 | Ga0495605_0048804_1452_1892 | 143 |
| 676 | 3300046475 | Ga0495639_0039244 | Ga0495639_0039244_660_1109 | 143 |
| 677 | 3300046476 | Ga0495662_0010153 | Ga0495662_0010153_3590_4039 | 143 |
| 678 | 3300046476 | Ga0495662_0420243 | Ga0495662_0420243_20_475 | 143 |
| 679 | 3300046477 | Ga0495664_0196812 | Ga0495664_0196812_414_863 | 143 |
| 680 | 3300046477 | Ga0495664_0336460 | Ga0495664_0336460_137_592 | 143 |
| 681 | 3300046499 | Ga0495594_0025826 | Ga0495594_0025826_1987_2427 | 143 |
| 682 | 3300046500 | Ga0495596_0098481 | Ga0495596_0098481_640_1080 | 143 |
| 683 | 3300046506 | Ga0495583_0052919 | Ga0495583_0052919_292_723 | 143 |
| 684 | 3300046507 | Ga0495606_0093447 | Ga0495606_0093447_650_1099 | 143 |
| 685 | 3300046514 | Ga0495618_0160179 | Ga0495618_0160179_47_502 | 143 |
| 686 | 3300046516 | Ga0495628_0563609 | Ga0495628_0563609_216_671 | 143 |
| 687 | 3300046517 | Ga0495630_0871451 | Ga0495630_0871451_177_632 | 143 |
| 688 | 3300046517 | Ga0495630_1055222 | Ga0495630_1055222_42_473 | 143 |
| 689 | 3300046518 | Ga0495631_0163961 | Ga0495631_0163961_459_899 | 143 |
| 690 | 3300046519 | Ga0495632_0316393 | Ga0495632_0316393_236_667 | 143 |
| 691 | 3300046522 | Ga0495643_0058683 | Ga0495643_0058683_694_1128 | 143 |
| 692 | 3300046523 | Ga0495644_0000075 | Ga0495644_0000075_25180_25620 | 143 |
| 693 | 3300046524 | Ga0495648_0164735 | Ga0495648_0164735_349_789 | 143 |
| 694 | 3300046524 | Ga0495648_0386790 | Ga0495648_0386790_43_474 | 143 |
| 695 | 3300046528 | Ga0495642_0190129 | Ga0495642_0190129_50_505 | 143 |
| 696 | 3300046528 | Ga0495642_0223351 | Ga0495642_0223351_176_625 | 143 |
| 697 | 3300046529 | Ga0495652_0030912 | Ga0495652_0030912_102_551 | 143 |
| 698 | 3300046529 | Ga0495652_0118940 | Ga0495652_0118940_312_767 | 143 |
| 699 | 3300046529 | Ga0495652_0233087 | Ga0495652_0233087_823_1254 | 143 |
| 700 | 3300046531 | Ga0495665_0000961 | Ga0495665_0000961_4049_4498 | 143 |
| 701 | 3300046531 | Ga0495665_0101587 | Ga0495665_0101587_395_829 | 143 |
| 702 | 3300046531 | Ga0495665_0148396 | Ga0495665_0148396_550_1005 | 143 |
| 703 | 3300046531 | Ga0495665_0214842 | Ga0495665_0214842_330_785 | 143 |
| 704 | 3300046533 | Ga0495640_0114801 | Ga0495640_0114801_1150_1599 | 143 |
| 705 | 3300046533 | Ga0495640_0162704 | Ga0495640_0162704_808_1263 | 143 |
| 706 | 3300046533 | Ga0495640_0764773 | Ga0495640_0764773_17_448 | 143 |
| 707 | 3300046536 | Ga0495587_0012311 | Ga0495587_0012311_3833_4282 | 143 |
| 708 | 3300046536 | Ga0495587_0097917 | Ga0495587_0097917_68_523 | 143 |
| 709 | 3300046536 | Ga0495587_0545854 | Ga0495587_0545854_97_552 | 143 |
| 710 | 3300046538 | Ga0495609_0010193 | Ga0495609_0010193_2644_3093 | 143 |
| 711 | 3300046538 | Ga0495609_0053100 | Ga0495609_0053100_1064_1504 | 143 |
| 712 | 3300046543 | Ga0495645_0019830 | Ga0495645_0019830_2283_2738 | 143 |
| 713 | 3300046543 | Ga0495645_0377211 | Ga0495645_0377211_432_887 | 143 |
| 714 | 3300046543 | Ga0495645_0551181 | Ga0495645_0551181_193_624 | 143 |
| 715 | 3300046559 | Ga0495667_0004747 | Ga0495667_0004747_6397_6846 | 143 |
| 716 | 3300046642 | Ga0495634_0014390 | Ga0495634_0014390_2574_3023 | 143 |
| 717 | 3300046660 | Ga0495625_0011712 | Ga0495625_0011712_3949_4392 | 143 |
| 718 | 3300046660 | Ga0495625_0018413 | Ga0495625_0018413_251_691 | 143 |
| 719 | 3300046660 | Ga0495625_0024754 | Ga0495625_0024754_881_1312 | 143 |
| 720 | 3300046660 | Ga0495625_0513842 | Ga0495625_0513842_189_620 | 143 |
| 721 | 3300046663 | Ga0495635_0103802 | Ga0495635_0103802_838_1287 | 143 |
| 722 | 3300046663 | Ga0495635_0126339 | Ga0495635_0126339_295_750 | 143 |
| 723 | 3300046663 | Ga0495635_0377141 | Ga0495635_0377141_422_853 | 143 |
| 724 | 3300046679 | Ga0495623_0035344 | Ga0495623_0035344_2691_3140 | 143 |
| 725 | 3300046679 | Ga0495623_0052952 | Ga0495623_0052952_1228_1683 | 143 |
| 726 | 3300046680 | Ga0495646_0020802 | Ga0495646_0020802_1757_2206 | 143 |
| 727 | 3300046681 | Ga0495647_0148756 | Ga0495647_0148756_128_583 | 143 |
| 728 | 3300046683 | Ga0495658_0390538 | Ga0495658_0390538_241_696 | 143 |
| 729 | 3300046684 | Ga0495669_0028767 | Ga0495669_0028767_1663_2118 | 143 |
| 730 | 3300046684 | Ga0495669_0375330 | Ga0495669_0375330_19_450 | 143 |
| 731 | 3300046689 | Ga0495613_0020679 | Ga0495613_0020679_3469_3918 | 143 |
| 732 | 3300046689 | Ga0495613_0212728 | Ga0495613_0212728_782_1237 | 143 |
| 733 | 3300046689 | Ga0495613_0368034 | Ga0495613_0368034_487_942 | 143 |
| 734 | 3300046691 | Ga0495670_0069173 | Ga0495670_0069173_1268_1708 | 143 |
| 735 | 3300046694 | Ga0495649_0013111 | Ga0495649_0013111_340_774 | 143 |
| 736 | 3300046694 | Ga0495649_0241179 | Ga0495649_0241179_282_716 | 143 |
| 737 | 3300046809 | Ga0495600_0002839 | Ga0495600_0002839_6234_6683 | 143 |
| 738 | 3300046809 | Ga0495600_0099600 | Ga0495600_0099600_582_1037 | 143 |
| 739 | 3300047315 | Ga0495581_0047580 | Ga0495581_0047580_1615_2064 | 143 |
| 740 | 3300047315 | Ga0495581_0052854 | Ga0495581_0052854_1123_1578 | 143 |
| 741 | 3300047317 | Ga0495604_0017720 | Ga0495604_0017720_3763_4212 | 143 |
| 742 | 3300047317 | Ga0495604_0042851 | Ga0495604_0042851_180_611 | 143 |
| 743 | 3300047319 | Ga0495674_0244802 | Ga0495674_0244802_957_1412 | 143 |
| 744 | 3300047319 | Ga0495674_0307893 | Ga0495674_0307893_163_594 | 143 |
| 745 | 3300047319 | Ga0495674_0598427 | Ga0495674_0598427_384_818 | 143 |
| 746 | 3300047321 | Ga0495676_0001072 | Ga0495676_0001072_9564_10013 | 143 |
| 747 | 3300047443 | Ga0495687_064633 | Ga0495687_064633_150_584 | 143 |
| 748 | 3300047445 | Ga0495677_0110072 | Ga0495677_0110072_151_600 | 143 |
| 749 | 3300047447 | Ga0495685_106174 | Ga0495685_106174_414_854 | 143 |
| 750 | 3300047471 | Ga0495684_0680074 | Ga0495684_0680074_67_522 | 143 |
| 751 | 3300047472 | Ga0495686_0002264 | Ga0495686_0002264_13593_14039 | 143 |
| 752 | 3300047673 | Ga0495593_0032650 | Ga0495593_0032650_897_1346 | 143 |
| 753 | 3300048088 | Ga0495602_0491431 | Ga0495602_0491431_72_527 | 143 |
| 754 | 3300048088 | Ga0495602_0834098 | Ga0495602_0834098_129_584 | 143 |
| 755 | 3300048089 | Ga0495614_0025368 | Ga0495614_0025368_2006_2455 | 143 |
| 756 | 3300048905 | Ga0496102_0378084 | Ga0496102_0378084_764_1219 | 143 |
| 757 | 3300048907 | Ga0496104_0023290 | Ga0496104_0023290_97_552 | 143 |
| 758 | 3300048907 | Ga0496104_0627734 | Ga0496104_0627734_41_496 | 143 |
| 759 | 3300048908 | Ga0496105_0028399 | Ga0496105_0028399_3041_3496 | 143 |
| 760 | 3300048908 | Ga0496105_0197739 | Ga0496105_0197739_965_1420 | 143 |
| 761 | 3300048908 | Ga0496105_0246083 | Ga0496105_0246083_1007_1438 | 143 |
| 762 | 3300048909 | Ga0496106_0441674 | Ga0496106_0441674_216_671 | 143 |
| 763 | 3300048910 | Ga0496107_0452449 | Ga0496107_0452449_256_711 | 143 |
| 764 | 3300048915 | Ga0496112_0437099 | Ga0496112_0437099_762_1217 | 143 |
| 765 | 3300048916 | Ga0496113_0611012 | Ga0496113_0611012_376_831 | 143 |
| 766 | 3300048917 | Ga0496114_0204386 | Ga0496114_0204386_387_842 | 143 |
| 767 | 3300048917 | Ga0496114_0353777 | Ga0496114_0353777_170_601 | 143 |
| 768 | 3300048918 | Ga0496115_0109286 | Ga0496115_0109286_1636_2091 | 143 |
| 769 | 3300048918 | Ga0496115_0112272 | Ga0496115_0112272_619_1074 | 143 |
| 770 | 3300048918 | Ga0496115_0180452 | Ga0496115_0180452_447_902 | 143 |
| 771 | 3300048918 | Ga0496115_0714590 | Ga0496115_0714590_179_634 | 143 |
| 772 | 3300048918 | Ga0496115_0758318 | Ga0496115_0758318_244_675 | 143 |
| 773 | 3300048918 | Ga0496115_1349943 | Ga0496115_1349943_84_515 | 143 |
| 774 | 3300048929 | Ga0496126_0000029 | Ga0496126_0000029_24989_25426 | 143 |
| 775 | 3300048929 | Ga0496126_0015123 | Ga0496126_0015123_4014_4445 | 143 |
| 776 | 3300048929 | Ga0496126_0339958 | Ga0496126_0339958_629_1060 | 143 |
| 777 | 3300049460 | Ga0495682_0008913 | Ga0495682_0008913_994_1425 | 143 |
| 778 | 3300049460 | Ga0495682_0160113 | Ga0495682_0160113_258_701 | 143 |
| 779 | 3300049569 | Ga0501032_0022789 | Ga0501032_0022789_1922_2353 | 143 |
| 780 | 3300049569 | Ga0501032_0052909 | Ga0501032_0052909_1817_2248 | 143 |
| 781 | 3300049570 | Ga0501033_0132566 | Ga0501033_0132566_649_1080 | 143 |
| 782 | 3300049570 | Ga0501033_0626495 | Ga0501033_0626495_28_459 | 143 |
| 783 | 3300049571 | Ga0501034_0077473 | Ga0501034_0077473_1859_2290 | 143 |
| 784 | 3300049572 | Ga0501036_0003869 | Ga0501036_0003869_11490_11921 | 143 |
| 785 | 3300049573 | Ga0501037_0082324 | Ga0501037_0082324_1204_1635 | 143 |
| 786 | 3300049573 | Ga0501037_0172500 | Ga0501037_0172500_42_473 | 143 |
| 787 | 3300049574 | Ga0501038_0032815 | Ga0501038_0032815_2440_2871 | 143 |
| 788 | 3300049574 | Ga0501038_0163971 | Ga0501038_0163971_1348_1779 | 143 |
| 789 | 3300049579 | Ga0501043_0006418 | Ga0501043_0006418_1774_2205 | 143 |
| 790 | 3300049581 | Ga0501047_0005103 | Ga0501047_0005103_10308_10739 | 143 |
| 791 | 3300049586 | Ga0501070_0106465 | Ga0501070_0106465_878_1309 | 143 |
| 792 | 3300049589 | Ga0501073_0182751 | Ga0501073_0182751_62_493 | 143 |
| 793 | 3300049589 | Ga0501073_1104112 | Ga0501073_1104112_67_498 | 143 |
| 794 | 3300049742 | Ga0501080_0068317 | Ga0501080_0068317_881_1312 | 143 |
| 795 | 3300049743 | Ga0501081_0886332 | Ga0501081_0886332_42_473 | 143 |
| 796 | 3300049822 | Ga0501035_0161724 | Ga0501035_0161724_1403_1834 | 143 |
| 797 | 3300049822 | Ga0501035_0272362 | Ga0501035_0272362_405_836 | 143 |
| 798 | 3300049823 | Ga0501044_0041402 | Ga0501044_0041402_3504_3935 | 143 |
| 799 | 3300049823 | Ga0501044_0158418 | Ga0501044_0158418_106_537 | 143 |
| 800 | 3300053077 | Ga0495601_0550310 | Ga0495601_0550310_220_675 | 143 |
| 801 | 3300053119 | Ga0500595_000004 | Ga0500595_000004_84425_84862 | 143 |
| 802 | 3300053119 | Ga0500595_105138 | Ga0500595_105138_212_643 | 143 |
| 803 | 3300053119 | Ga0500595_206394 | Ga0500595_206394_34_465 | 143 |
| 804 | 3300054114 | Ga0501084_0199585 | Ga0501084_0199585_70_501 | 143 |
| 805 | 3300055283 | Ga0500661_002075 | Ga0500661_002075_140_583 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v6x-assembly2.cif.gz_B | crystal structure of the trna binding domain of pyrrolysyl-trna synthetase mutant (32a ntd) bound to trna(pyl) | 0.856 | 31 | 57 |
| 5ud5-assembly2.cif.gz_B | crystal structure of the trna binding domain of pyrrolysyl-trna synthetase bound to trna(pyl) | 0.8467 | 31 | 57 |
| 5tum-assembly1.cif.gz_A | crystal structure of tetracycline destructase tet(56) | 0.8454 | 30 | 56 |
| 5tum-assembly2.cif.gz_B | crystal structure of tetracycline destructase tet(56) | 0.8433 | 30 | 57 |
| 5tul-assembly1.cif.gz_A | crystal structure of tetracycline destructase tet(55) | 0.8264 | 30 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C7J3I8_1_244_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8257 | 30 | 57 | 2.130.10.10 |
| 3luuA00 | Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; | 0.8084 | 25 | 133 | 3.30.2020.30 |
| af_Q9HBG6_233_372_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8001 | 33 | 57 | 2.130.10.10 |
| af_Q07468_253_583_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.7902 | 31 | 57 | 1.25.40.10 |
| 3luuA00 | Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; | 0.7749 | 25 | 133 | 3.30.2020.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P6WEE0-F1-model_v4 | Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein | 0.9279 | 27 | 140 |
GO:0046872
|
| AF-A0A4Q1S9B9-F1-model_v4 | DUF971 domain-containing protein | 0.9084 | 1 | 143 |
GO:0046872
|
| AF-A0A2V9QN49-F1-model_v4 | DUF971 domain-containing protein | 0.9041 | 28 | 142 |
GO:0046872
|
| AF-A0A2V9N5C0-F1-model_v4 | DUF971 domain-containing protein | 0.9032 | 24 | 142 |
GO:0046872
|
| AF-A0A2V9QZL6-F1-model_v4 | DUF971 domain-containing protein | 0.9018 | 26 | 142 |
GO:0046872
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar