F481605

General Info

Members Datasets Scaffolds Average Seq Length
805 252 804 147

Family's Representative Sequence

Representative Sequence 3300031235|Ga0265330_10392499|Ga0265330_103924991
Length 146
Sequence MSHEGIRIAPKDHEAVETEEARPLPRIAVTPEKVRVLITEGKGMEIDWADGHRSAWSFPWLREACPCATCVDLRKAEGRKPGQPKPKPANVLPMFTPSAHAVGRYAIQFNWQDGHSGGIYSWEYLRRVCQCPECTFASEEATGAPN

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
138 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.12
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 2.48
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1006184 3300000546 Unclassified 1300
2 JGI24743J22301_10055314 3300001991 Unclassified 812
3 rootH2_10285490 3300003320 Unclassified 1097
4 rootL2_10356678 3300003322 Bacteria 1390
5 Ga0070658_10000142 3300005327 Bacteria 63262
6 Ga0070658_10014001 3300005327 Bacteria 6440
7 Ga0070658_10051815 3300005327 Bacteria 3326
8 Ga0070658_10090710 3300005327 Bacteria 2518
9 Ga0070658_10124843 3300005327 Bacteria 2142
10 Ga0070658_10158097 3300005327 Bacteria 1900
11 Ga0070658_10192532 3300005327 Bacteria 1719
12 Ga0070658_10475198 3300005327 Bacteria 1078
13 Ga0070658_11003223 3300005327 Bacteria 726
14 Ga0070658_11182145 3300005327 Unclassified 665
15 Ga0070676_10019001 3300005328 Bacteria 3818
16 Ga0070683_100003012 3300005329 Bacteria 13527
17 Ga0070683_100021519 3300005329 Bacteria 5755
18 Ga0070683_100044078 3300005329 Bacteria 4112
19 Ga0070683_100061847 3300005329 Bacteria 3481
20 Ga0070683_100132588 3300005329 Bacteria 2358
21 Ga0070683_100177481 3300005329 Bacteria 2022
22 Ga0070683_100420913 3300005329 Bacteria 1274
23 Ga0070683_100635777 3300005329 Bacteria 1022
24 Ga0070683_100710150 3300005329 Bacteria 963
25 Ga0070690_100164351 3300005330 Bacteria 1523
26 Ga0070670_100002930 3300005331 Bacteria 14131
27 Ga0070670_100020567 3300005331 Bacteria 5676
28 Ga0068869_100000517 3300005334 Bacteria 21584
29 Ga0068869_100062344 3300005334 Bacteria 2736
30 Ga0070666_10012804 3300005335 Bacteria 5302
31 Ga0070666_10052334 3300005335 Bacteria 2752
32 Ga0070680_100024639 3300005336 Bacteria 4809
33 Ga0070682_101526941 3300005337 Unclassified 575
34 Ga0070682_101725761 3300005337 Unclassified 544
35 Ga0068868_100027110 3300005338 Bacteria 4369
36 Ga0068868_100047080 3300005338 Bacteria 3377
37 Ga0068868_100325876 3300005338 Bacteria 1310
38 Ga0070660_100003805 3300005339 Bacteria 10423
39 Ga0070660_100010075 3300005339 Bacteria 6667
40 Ga0070660_100049896 3300005339 Bacteria 3219
41 Ga0070660_100050439 3300005339 Bacteria 3202
42 Ga0070660_100559691 3300005339 Bacteria 954
43 Ga0070661_100000910 3300005344 Bacteria 21220
44 Ga0070661_100082658 3300005344 Bacteria 2372
45 Ga0070661_100148660 3300005344 Bacteria 1770
46 Ga0070661_100505212 3300005344 Bacteria 968
47 Ga0070661_100583560 3300005344 Unclassified 902
48 Ga0070692_10204663 3300005345 Bacteria 1158
49 Ga0070692_10502226 3300005345 Unclassified 786
50 Ga0070668_100113140 3300005347 Bacteria 2162
51 Ga0070668_101428514 3300005347 Bacteria 631
52 Ga0070675_100034701 3300005354 Bacteria 4095
53 Ga0070671_100000458 3300005355 Bacteria 28366
54 Ga0070671_100000915 3300005355 Bacteria 21547
55 Ga0070671_100132125 3300005355 Bacteria 2103
56 Ga0070673_100206950 3300005364 Bacteria 1692
57 Ga0070673_100358621 3300005364 Bacteria 1295
58 Ga0070673_100705982 3300005364 Unclassified 926
59 Ga0070659_100002926 3300005366 Bacteria 12172
60 Ga0070659_100048475 3300005366 Bacteria 3337
61 Ga0070667_100067812 3300005367 Bacteria 3035
62 Ga0070667_100074985 3300005367 Bacteria 2887
63 Ga0070667_100078885 3300005367 Bacteria 2814
64 Ga0070709_10222379 3300005434 Bacteria 1347
65 Ga0070709_10391741 3300005434 Unclassified 1035
66 Ga0070709_10509921 3300005434 Unclassified 915
67 Ga0070714_100103847 3300005435 Bacteria 2507
68 Ga0070714_100270563 3300005435 Bacteria 1575
69 Ga0070713_100002026 3300005436 Bacteria 13095
70 Ga0070713_100006331 3300005436 Bacteria 8201
71 Ga0070713_100083713 3300005436 Unclassified 2727
72 Ga0070713_100307943 3300005436 Bacteria 1460
73 Ga0070663_100039784 3300005455 Bacteria 3288
74 Ga0070663_100087286 3300005455 Bacteria 2305
75 Ga0070663_100091871 3300005455 Unclassified 2250
76 Ga0070663_100101520 3300005455 Bacteria 2147
77 Ga0070663_100720848 3300005455 Unclassified 849
78 Ga0070663_101845086 3300005455 Bacteria 542
79 Ga0070678_100007527 3300005456 Bacteria 6467
80 Ga0070678_100459640 3300005456 Bacteria 1116
81 Ga0070681_10032775 3300005458 Bacteria 5216
82 Ga0070681_10555344 3300005458 Unclassified 1062
83 Ga0070681_10940690 3300005458 Bacteria 783
84 Ga0068867_100919244 3300005459 Unclassified 788
85 Ga0068867_101054227 3300005459 Bacteria 740
86 Ga0070679_100003039 3300005530 Bacteria 15327
87 Ga0070679_100013656 3300005530 Bacteria 7779
88 Ga0070679_100066464 3300005530 Bacteria 3594
89 Ga0070679_100511862 3300005530 Bacteria 1144
90 Ga0070684_100011640 3300005535 Bacteria 7011
91 Ga0070684_100034362 3300005535 Unclassified 4335
92 Ga0070684_100104930 3300005535 Bacteria 2529
93 Ga0070684_100116051 3300005535 Bacteria 2405
94 Ga0070684_100124895 3300005535 Bacteria 2317
95 Ga0070684_100809282 3300005535 Bacteria 876
96 Ga0068853_100000018 3300005539 Bacteria 169680
97 Ga0068853_100007063 3300005539 Bacteria 8980
98 Ga0068853_100017080 3300005539 Bacteria 5985
99 Ga0068853_100054488 3300005539 Bacteria 3446
100 Ga0068853_100200276 3300005539 Bacteria 1817
101 Ga0068853_100219206 3300005539 Bacteria 1737
102 Ga0068853_100345218 3300005539 Bacteria 1384
103 Ga0068853_101167926 3300005539 Unclassified 743
104 Ga0068853_102306996 3300005539 Unclassified 521
105 Ga0070672_100002005 3300005543 Bacteria 12791
106 Ga0070665_100016489 3300005548 Bacteria 7407
107 Ga0070665_100017091 3300005548 Bacteria 7277
108 Ga0070665_100073342 3300005548 Bacteria 3429
109 Ga0070665_100231116 3300005548 Bacteria 1849
110 Ga0070665_100577924 3300005548 Bacteria 1136
111 Ga0070665_100707005 3300005548 Bacteria 1021
112 Ga0068855_100003707 3300005563 Bacteria 18676
113 Ga0068855_100020184 3300005563 Bacteria 8001
114 Ga0068855_100026998 3300005563 Bacteria 6870
115 Ga0068855_100044675 3300005563 Bacteria 5243
116 Ga0068855_100047496 3300005563 Bacteria 5071
117 Ga0068855_100048851 3300005563 Bacteria 4992
118 Ga0068855_100080886 3300005563 Bacteria 3767
119 Ga0068855_100084463 3300005563 Bacteria 3675
120 Ga0068855_100171851 3300005563 Bacteria 2454
121 Ga0068855_100192999 3300005563 Unclassified 2296
122 Ga0068855_100321459 3300005563 Bacteria 1710
123 Ga0068855_100327545 3300005563 Unclassified 1691
124 Ga0068855_100697128 3300005563 Bacteria 1087
125 Ga0068857_100000749 3300005577 Bacteria 24206
126 Ga0068857_100001413 3300005577 Bacteria 18985
127 Ga0068857_100014218 3300005577 Bacteria 6933
128 Ga0068857_100516036 3300005577 Bacteria 1123
129 Ga0068854_100000042 3300005578 Bacteria 93095
130 Ga0068854_100044701 3300005578 Bacteria 3146
131 Ga0068854_100161709 3300005578 Bacteria 1735
132 Ga0068854_100766669 3300005578 Bacteria 838
133 Ga0068854_100884056 3300005578 Unclassified 784
134 Ga0068856_100006392 3300005614 Bacteria 11558
135 Ga0068856_100008572 3300005614 Bacteria 9940
136 Ga0068856_100036870 3300005614 Bacteria 4795
137 Ga0068856_100058871 3300005614 Bacteria 3794
138 Ga0068856_100367671 3300005614 Bacteria 1457
139 Ga0068856_100511148 3300005614 Unclassified 1222
140 Ga0068856_100648613 3300005614 Unclassified 1076
141 Ga0068856_100792783 3300005614 Unclassified 967
142 Ga0068856_101143353 3300005614 Unclassified 795
143 Ga0068852_100000714 3300005616 Bacteria 21728
144 Ga0068852_100009322 3300005616 Bacteria 7283
145 Ga0068852_100017448 3300005616 Bacteria 5633
146 Ga0068852_100101081 3300005616 Bacteria 2603
147 Ga0068852_100103064 3300005616 Bacteria 2580
148 Ga0068852_100154020 3300005616 Bacteria 2140
149 Ga0068852_100187369 3300005616 Bacteria 1950
150 Ga0068852_100482028 3300005616 Unclassified 1233
151 Ga0068852_100786678 3300005616 Unclassified 965
152 Ga0068859_100038997 3300005617 Bacteria 4764
153 Ga0068859_100110389 3300005617 Bacteria 2812
154 Ga0068864_100000992 3300005618 Bacteria 23732
155 Ga0068864_101889048 3300005618 Bacteria 603
156 Ga0068866_10080976 3300005718 Bacteria 1743
157 Ga0068851_10136152 3300005834 Unclassified 1332
158 Ga0068851_10139335 3300005834 Bacteria 1318
159 Ga0068851_10375748 3300005834 Bacteria 832
160 Ga0068851_10467268 3300005834 Unclassified 752
161 Ga0068851_10513008 3300005834 Unclassified 720
162 Ga0068863_100008605 3300005841 Bacteria 9974
163 Ga0068863_100068676 3300005841 Bacteria 3352
164 Ga0068863_100666525 3300005841 Bacteria 1032
165 Ga0068863_101968815 3300005841 Bacteria 594
166 Ga0068858_100063440 3300005842 Bacteria 3419
167 Ga0068858_100125789 3300005842 Bacteria 2400
168 Ga0068858_100420384 3300005842 Bacteria 1285
169 Ga0068860_100003788 3300005843 Bacteria 15557
170 Ga0068860_100255708 3300005843 Bacteria 1706
171 Ga0068862_100054466 3300005844 Bacteria 3425
172 Ga0070717_11493671 3300006028 Unclassified 613
173 Ga0070712_100767895 3300006175 Bacteria 826
174 Ga0097621_100004302 3300006237 Bacteria 9892
175 Ga0097621_100029015 3300006237 Bacteria 4366
176 Ga0068871_100002034 3300006358 Bacteria 13704
177 Ga0068871_100017601 3300006358 Bacteria 5412
178 Ga0068871_100065138 3300006358 Bacteria 2984
179 Ga0068865_100043149 3300006881 Bacteria 3080
180 Ga0097620_100038995 3300006931 Bacteria 4764
181 Ga0097620_100110393 3300006931 Bacteria 2812
182 Ga0105240_10000284 3300009093 Bacteria 99440
183 Ga0105240_10001593 3300009093 Bacteria 38568
184 Ga0105240_10001640 3300009093 Bacteria 38024
185 Ga0105240_10008641 3300009093 Bacteria 14552
186 Ga0105240_10009569 3300009093 Bacteria 13718
187 Ga0105240_10047123 3300009093 Bacteria 5456
188 Ga0105240_10122136 3300009093 Bacteria 3135
189 Ga0105240_10167381 3300009093 Unclassified 2606
190 Ga0105240_10440799 3300009093 Bacteria 1459
191 Ga0105240_11138913 3300009093 Unclassified 829
192 Ga0105240_11171971 3300009093 Bacteria 815
193 Ga0105240_11701418 3300009093 Bacteria 658
194 Ga0105240_12502135 3300009093 Bacteria 534
195 Ga0105245_10001856 3300009098 Bacteria 19233
196 Ga0105245_10026871 3300009098 Bacteria 5068
197 Ga0105245_10354412 3300009098 Bacteria 1455
198 Ga0105245_10365177 3300009098 Bacteria 1434
199 Ga0105247_10015372 3300009101 Bacteria 4585
200 Ga0105247_10100415 3300009101 Bacteria 1849
201 Ga0105241_10000265 3300009174 Bacteria 38968
202 Ga0105241_10002773 3300009174 Bacteria 13121
203 Ga0105241_10003506 3300009174 Bacteria 11669
204 Ga0105241_10027355 3300009174 Bacteria 4247
205 Ga0105241_10050443 3300009174 Bacteria 3171
206 Ga0105241_10308077 3300009174 Bacteria 1361
207 Ga0105241_10416495 3300009174 Unclassified 1181
208 Ga0105241_10994579 3300009174 Unclassified 784
209 Ga0105241_11241257 3300009174 Unclassified 707
210 Ga0105248_10003308 3300009177 Bacteria 17887
211 Ga0105248_10010912 3300009177 Bacteria 10025
212 Ga0105248_10115613 3300009177 Bacteria 3026
213 Ga0105248_10398651 3300009177 Unclassified 1549
214 Ga0105248_10730943 3300009177 Bacteria 1117
215 Ga0105237_10009543 3300009545 Bacteria 10390
216 Ga0105237_10030905 3300009545 Bacteria 5434
217 Ga0105237_10086789 3300009545 Bacteria 3119
218 Ga0105237_10098112 3300009545 Bacteria 2921
219 Ga0105237_10239765 3300009545 Bacteria 1814
220 Ga0105237_10264097 3300009545 Bacteria 1724
221 Ga0105237_10283365 3300009545 Bacteria 1660
222 Ga0105237_10490760 3300009545 Bacteria 1235
223 Ga0105237_10634632 3300009545 Bacteria 1075
224 Ga0105238_10000338 3300009551 Bacteria 51021
225 Ga0105238_10004902 3300009551 Bacteria 13240
226 Ga0105238_10010228 3300009551 Bacteria 9408
227 Ga0105238_10010638 3300009551 Bacteria 9241
228 Ga0105238_10030278 3300009551 Bacteria 5509
229 Ga0105238_10030933 3300009551 Bacteria 5448
230 Ga0105238_10044082 3300009551 Bacteria 4512
231 Ga0105238_10044390 3300009551 Bacteria 4494
232 Ga0105238_10050443 3300009551 Bacteria 4189
233 Ga0105238_10063776 3300009551 Bacteria 3685
234 Ga0105238_10087015 3300009551 Bacteria 3112
235 Ga0105238_10288267 3300009551 Bacteria 1624
236 Ga0105238_10349520 3300009551 Bacteria 1467
237 Ga0105238_10634566 3300009551 Bacteria 1078
238 Ga0105238_11044752 3300009551 Unclassified 838
239 Ga0105238_11145933 3300009551 Unclassified 801
240 Ga0105249_10056784 3300009553 Bacteria 3584
241 Ga0105249_10063775 3300009553 Bacteria 3386
242 Ga0105249_10371438 3300009553 Bacteria 1454
243 Ga0105249_10829172 3300009553 Unclassified 990
244 Ga0105239_10002626 3300010375 Bacteria 22720
245 Ga0105239_10028844 3300010375 Bacteria 6101
246 Ga0105239_10058648 3300010375 Bacteria 4224
247 Ga0105239_10099800 3300010375 Bacteria 3210
248 Ga0105239_10119210 3300010375 Bacteria 2929
249 Ga0105239_10149163 3300010375 Bacteria 2610
250 Ga0105239_10243778 3300010375 Bacteria 2017
251 Ga0105239_10928312 3300010375 Bacteria 999
252 Ga0105246_10002388 3300011119 Bacteria 11333
253 Ga0105246_10011686 3300011119 Bacteria 5455
254 Ga0157373_10055052 3300013100 Bacteria 2826
255 Ga0157373_10142263 3300013100 Unclassified 1687
256 Ga0157373_10189746 3300013100 Bacteria 1448
257 Ga0157373_10239460 3300013100 Unclassified 1283
258 Ga0157371_10122087 3300013102 Bacteria 1852
259 Ga0157371_10649794 3300013102 Bacteria 787
260 Ga0157370_10000685 3300013104 Bacteria 42213
261 Ga0157370_10014019 3300013104 Bacteria 8230
262 Ga0157370_10015491 3300013104 Bacteria 7751
263 Ga0157370_10019566 3300013104 Bacteria 6785
264 Ga0157370_10031093 3300013104 Bacteria 5225
265 Ga0157370_10040413 3300013104 Bacteria 4503
266 Ga0157370_10069134 3300013104 Bacteria 3336
267 Ga0157370_10103184 3300013104 Unclassified 2670
268 Ga0157370_10480464 3300013104 Bacteria 1142
269 Ga0157370_10808379 3300013104 Unclassified 853
270 Ga0157369_10000699 3300013105 Bacteria 43315
271 Ga0157369_10003649 3300013105 Bacteria 18261
272 Ga0157369_10004476 3300013105 Bacteria 16465
273 Ga0157369_10018778 3300013105 Bacteria 7750
274 Ga0157369_10037519 3300013105 Bacteria 5305
275 Ga0157369_10041216 3300013105 Bacteria 5040
276 Ga0157369_10046148 3300013105 Bacteria 4736
277 Ga0157369_10057696 3300013105 Bacteria 4187
278 Ga0157369_10079960 3300013105 Bacteria 3501
279 Ga0157369_10122762 3300013105 Bacteria 2755
280 Ga0157369_10175135 3300013105 Unclassified 2259
281 Ga0157369_10217831 3300013105 Bacteria 1999
282 Ga0157369_10218622 3300013105 Bacteria 1995
283 Ga0157369_10248502 3300013105 Bacteria 1857
284 Ga0157369_10373482 3300013105 Bacteria 1480
285 Ga0157369_10417235 3300013105 Bacteria 1391
286 Ga0157369_10549034 3300013105 Bacteria 1194
287 Ga0157369_11481404 3300013105 Bacteria 690
288 Ga0157374_10003668 3300013296 Bacteria 12910
289 Ga0157374_10004033 3300013296 Bacteria 12338
290 Ga0157374_10005152 3300013296 Bacteria 10961
291 Ga0157374_10012662 3300013296 Bacteria 7346
292 Ga0157374_10053216 3300013296 Bacteria 3773
293 Ga0157374_10064013 3300013296 Bacteria 3449
294 Ga0157374_10152869 3300013296 Bacteria 2245
295 Ga0157374_10551649 3300013296 Bacteria 1160
296 Ga0157374_10789951 3300013296 Bacteria 965
297 Ga0157374_11671468 3300013296 Unclassified 661
298 Ga0157374_11993245 3300013296 Bacteria 607
299 Ga0157378_10003077 3300013297 Bacteria 14820
300 Ga0157378_10021015 3300013297 Bacteria 5742
301 Ga0157378_10022074 3300013297 Bacteria 5600
302 Ga0157378_10022330 3300013297 Bacteria 5570
303 Ga0157378_10238993 3300013297 Bacteria 1734
304 Ga0163162_10007199 3300013306 Bacteria 10806
305 Ga0163162_10025177 3300013306 Bacteria 5882
306 Ga0163162_10487348 3300013306 Bacteria 1364
307 Ga0163162_10909387 3300013306 Bacteria 993
308 Ga0157372_10003883 3300013307 Bacteria 16060
309 Ga0157372_10026862 3300013307 Bacteria 6267
310 Ga0157372_10032337 3300013307 Bacteria 5736
311 Ga0157372_10069378 3300013307 Bacteria 3964
312 Ga0157372_10112785 3300013307 Bacteria 3115
313 Ga0157372_10141879 3300013307 Bacteria 2768
314 Ga0157372_10174325 3300013307 Bacteria 2489
315 Ga0157372_10230156 3300013307 Unclassified 2149
316 Ga0157372_10249654 3300013307 Unclassified 2059
317 Ga0157372_10268079 3300013307 Bacteria 1983
318 Ga0157372_10393626 3300013307 Bacteria 1615
319 Ga0157372_10477083 3300013307 Bacteria 1454
320 Ga0157372_10504207 3300013307 Bacteria 1411
321 Ga0157372_11201835 3300013307 Bacteria 876
322 Ga0157375_10013492 3300013308 Bacteria 7275
323 Ga0157375_10016797 3300013308 Bacteria 6589
324 Ga0157375_10297394 3300013308 Bacteria 1778
325 Ga0157375_10961360 3300013308 Unclassified 995
326 Ga0157375_11348880 3300013308 Bacteria 839
327 Ga0163163_10004242 3300014325 Bacteria 12216
328 Ga0163163_10042935 3300014325 Bacteria 4430
329 Ga0163163_10318921 3300014325 Bacteria 1608
330 Ga0157377_10037796 3300014745 Unclassified 2662
331 Ga0157379_10049522 3300014968 Bacteria 3752
332 Ga0157379_10076244 3300014968 Bacteria 3002
333 Ga0157379_10110996 3300014968 Bacteria 2463
334 Ga0157379_10222997 3300014968 Bacteria 1708
335 Ga0157376_10000803 3300014969 Bacteria 20616
336 Ga0157376_10031107 3300014969 Bacteria 4270
337 Ga0157376_10032165 3300014969 Bacteria 4209
338 Ga0157376_10036467 3300014969 Bacteria 3984
339 Ga0157376_10052320 3300014969 Bacteria 3395
340 Ga0157376_10059462 3300014969 Bacteria 3204
341 Ga0157376_10510007 3300014969 Bacteria 1183
342 Ga0157376_10591281 3300014969 Bacteria 1104
343 Ga0157376_11391671 3300014969 Unclassified 733
344 Ga0157376_11702895 3300014969 Unclassified 666
345 Ga0157376_11866536 3300014969 Bacteria 638
346 Ga0163161_10015051 3300017792 Bacteria 5391
347 Ga0213872_10042844 3300021361 Bacteria 2063
348 Ga0207656_10044622 3300025321 Bacteria 1894
349 Ga0207656_10053720 3300025321 Bacteria 1749
350 Ga0207656_10057988 3300025321 Bacteria 1690
351 Ga0207656_10100013 3300025321 Bacteria 1328
352 Ga0207656_10114377 3300025321 Bacteria 1250
353 Ga0207656_10182385 3300025321 Bacteria 1008
354 Ga0207642_10220476 3300025899 Bacteria 1060
355 Ga0207710_10005472 3300025900 Bacteria 5465
356 Ga0207710_10310662 3300025900 Bacteria 798
357 Ga0207688_10067264 3300025901 Bacteria 2027
358 Ga0207680_10050119 3300025903 Bacteria 2489
359 Ga0207680_10074192 3300025903 Bacteria 2118
360 Ga0207647_10005646 3300025904 Bacteria 9137
361 Ga0207647_10030028 3300025904 Bacteria 3511
362 Ga0207647_10190870 3300025904 Bacteria 1187
363 Ga0207645_10059026 3300025907 Bacteria 2450
364 Ga0207705_10000329 3300025909 Bacteria 43054
365 Ga0207705_10010673 3300025909 Bacteria 6670
366 Ga0207705_10013575 3300025909 Bacteria 5880
367 Ga0207705_10016110 3300025909 Bacteria 5363
368 Ga0207705_10019060 3300025909 Bacteria 4908
369 Ga0207705_10032962 3300025909 Bacteria 3702
370 Ga0207705_10087426 3300025909 Bacteria 2279
371 Ga0207705_10235828 3300025909 Bacteria 1393
372 Ga0207705_11027771 3300025909 Bacteria 636
373 Ga0207654_10002016 3300025911 Bacteria 10441
374 Ga0207654_10005807 3300025911 Bacteria 6225
375 Ga0207654_10113015 3300025911 Bacteria 1693
376 Ga0207654_10139477 3300025911 Bacteria 1544
377 Ga0207654_10401248 3300025911 Bacteria 953
378 Ga0207707_10024675 3300025912 Bacteria 5261
379 Ga0207695_10000001 3300025913 Bacteria 2888630
380 Ga0207695_10000098 3300025913 Bacteria 261213
381 Ga0207695_10000331 3300025913 Bacteria 112894
382 Ga0207695_10000823 3300025913 Bacteria 57486
383 Ga0207695_10001323 3300025913 Bacteria 42002
384 Ga0207695_10002473 3300025913 Bacteria 27235
385 Ga0207695_10003432 3300025913 Bacteria 22366
386 Ga0207695_10031120 3300025913 Bacteria 5859
387 Ga0207695_10037287 3300025913 Bacteria 5246
388 Ga0207695_10051687 3300025913 Bacteria 4312
389 Ga0207695_10059854 3300025913 Bacteria 3947
390 Ga0207695_10723352 3300025913 Bacteria 876
391 Ga0207695_11246380 3300025913 Bacteria 624
392 Ga0207671_10000655 3300025914 Bacteria 45327
393 Ga0207671_10001346 3300025914 Bacteria 28731
394 Ga0207671_10071130 3300025914 Bacteria 2594
395 Ga0207671_10277182 3300025914 Bacteria 1322
396 Ga0207671_10290504 3300025914 Bacteria 1291
397 Ga0207671_10664821 3300025914 Bacteria 829
398 Ga0207671_11183042 3300025914 Bacteria 599
399 Ga0207693_10308120 3300025915 Bacteria 1240
400 Ga0207660_10070179 3300025917 Bacteria 2546
401 Ga0207657_10016204 3300025919 Bacteria 7194
402 Ga0207657_10021566 3300025919 Bacteria 6058
403 Ga0207657_10079770 3300025919 Bacteria 2753
404 Ga0207657_10419998 3300025919 Unclassified 1051
405 Ga0207657_10434674 3300025919 Bacteria 1031
406 Ga0207649_10002070 3300025920 Bacteria 11409
407 Ga0207649_10038694 3300025920 Bacteria 2889
408 Ga0207649_10056860 3300025920 Bacteria 2444
409 Ga0207649_10119311 3300025920 Unclassified 1776
410 Ga0207649_10548066 3300025920 Unclassified 884
411 Ga0207652_10004174 3300025921 Bacteria 11782
412 Ga0207652_10017306 3300025921 Bacteria 5898
413 Ga0207652_10190665 3300025921 Bacteria 1844
414 Ga0207694_10000105 3300025924 Bacteria 89920
415 Ga0207694_10000727 3300025924 Bacteria 29554
416 Ga0207694_10004769 3300025924 Bacteria 10540
417 Ga0207694_10038031 3300025924 Bacteria 3699
418 Ga0207694_10052016 3300025924 Bacteria 3175
419 Ga0207694_10114873 3300025924 Unclassified 2144
420 Ga0207694_10190913 3300025924 Unclassified 1664
421 Ga0207694_10210018 3300025924 Bacteria 1585
422 Ga0207694_10247007 3300025924 Unclassified 1459
423 Ga0207694_10616202 3300025924 Bacteria 913
424 Ga0207694_10703596 3300025924 Unclassified 852
425 Ga0207650_10006265 3300025925 Bacteria 8107
426 Ga0207650_10189948 3300025925 Bacteria 1641
427 Ga0207687_10011961 3300025927 Bacteria 5676
428 Ga0207687_10016887 3300025927 Bacteria 4798
429 Ga0207687_10037312 3300025927 Bacteria 3315
430 Ga0207700_10002588 3300025928 Bacteria 10402
431 Ga0207700_10093999 3300025928 Bacteria 2374
432 Ga0207700_11335452 3300025928 Bacteria 638
433 Ga0207644_10002739 3300025931 Bacteria 11352
434 Ga0207644_10010986 3300025931 Bacteria 5980
435 Ga0207644_10818648 3300025931 Unclassified 779
436 Ga0207690_10000778 3300025932 Bacteria 20630
437 Ga0207690_10022060 3300025932 Bacteria 3956
438 Ga0207690_10092837 3300025932 Bacteria 2137
439 Ga0207690_11473966 3300025932 Bacteria 569
440 Ga0207706_10015144 3300025933 Bacteria 6979
441 Ga0207665_10295203 3300025939 Bacteria 1210
442 Ga0207691_10006334 3300025940 Bacteria 11428
443 Ga0207711_10001943 3300025941 Bacteria 18756
444 Ga0207711_10151664 3300025941 Bacteria 2092
445 Ga0207711_10231355 3300025941 Bacteria 1693
446 Ga0207711_10429853 3300025941 Unclassified 1229
447 Ga0207689_10000311 3300025942 Bacteria 44900
448 Ga0207689_10045853 3300025942 Bacteria 3614
449 Ga0207661_10016768 3300025944 Bacteria 5408
450 Ga0207661_10029655 3300025944 Bacteria 4205
451 Ga0207661_10146793 3300025944 Bacteria 2036
452 Ga0207661_10162825 3300025944 Bacteria 1936
453 Ga0207661_10322875 3300025944 Bacteria 1388
454 Ga0207661_11451253 3300025944 Unclassified 629
455 Ga0207679_10093288 3300025945 Bacteria 2334
456 Ga0207667_10002382 3300025949 Bacteria 23520
457 Ga0207667_10004198 3300025949 Bacteria 17695
458 Ga0207667_10016687 3300025949 Bacteria 8287
459 Ga0207667_10022906 3300025949 Bacteria 6886
460 Ga0207667_10023299 3300025949 Bacteria 6818
461 Ga0207667_10035823 3300025949 Bacteria 5323
462 Ga0207667_10076964 3300025949 Bacteria 3461
463 Ga0207667_10105514 3300025949 Unclassified 2907
464 Ga0207667_10165227 3300025949 Bacteria 2276
465 Ga0207667_10166247 3300025949 Bacteria 2268
466 Ga0207667_10212111 3300025949 Bacteria 1985
467 Ga0207667_10524929 3300025949 Bacteria 1199
468 Ga0207651_10675647 3300025960 Bacteria 908
469 Ga0207712_10030704 3300025961 Bacteria 3614
470 Ga0207712_10238350 3300025961 Bacteria 1464
471 Ga0207712_10958470 3300025961 Unclassified 758
472 Ga0207668_10463019 3300025972 Bacteria 1084
473 Ga0207640_10000002 3300025981 Bacteria 524211
474 Ga0207640_10125090 3300025981 Bacteria 1850
475 Ga0207640_10177477 3300025981 Bacteria 1594
476 Ga0207658_10034137 3300025986 Bacteria 3633
477 Ga0207658_10072072 3300025986 Bacteria 2618
478 Ga0207658_11046378 3300025986 Bacteria 745
479 Ga0207677_10004327 3300026023 Bacteria 7608
480 Ga0207677_10010143 3300026023 Bacteria 5322
481 Ga0207677_10193841 3300026023 Bacteria 1609
482 Ga0207703_10020790 3300026035 Bacteria 5135
483 Ga0207703_10346469 3300026035 Bacteria 1367
484 Ga0207703_10368582 3300026035 Bacteria 1326
485 Ga0207639_10000011 3300026041 Bacteria 381897
486 Ga0207639_10008592 3300026041 Bacteria 7007
487 Ga0207639_10041090 3300026041 Bacteria 3457
488 Ga0207639_10089034 3300026041 Bacteria 2465
489 Ga0207639_10106486 3300026041 Bacteria 2276
490 Ga0207639_10339644 3300026041 Unclassified 1338
491 Ga0207639_10348409 3300026041 Unclassified 1322
492 Ga0207639_10981926 3300026041 Bacteria 791
493 Ga0207639_11442066 3300026041 Bacteria 646
494 Ga0207678_10015022 3300026067 Bacteria 6813
495 Ga0207678_10017514 3300026067 Bacteria 6291
496 Ga0207678_10020198 3300026067 Bacteria 5849
497 Ga0207678_10073882 3300026067 Bacteria 2922
498 Ga0207678_10137316 3300026067 Bacteria 2086
499 Ga0207678_10379015 3300026067 Bacteria 1223
500 Ga0207678_10433328 3300026067 Bacteria 1141
501 Ga0207678_10445444 3300026067 Bacteria 1125
502 Ga0207678_10665378 3300026067 Bacteria 915
503 Ga0207702_10000984 3300026078 Bacteria 29154
504 Ga0207702_10023069 3300026078 Bacteria 5161
505 Ga0207702_10024626 3300026078 Bacteria 4995
506 Ga0207702_10046034 3300026078 Bacteria 3672
507 Ga0207702_10310019 3300026078 Bacteria 1500
508 Ga0207702_10715477 3300026078 Bacteria 987
509 Ga0207702_10793783 3300026078 Unclassified 936
510 Ga0207702_11703172 3300026078 Unclassified 623
511 Ga0207641_10007496 3300026088 Bacteria 9082
512 Ga0207641_10087653 3300026088 Bacteria 2716
513 Ga0207641_11877094 3300026088 Bacteria 601
514 Ga0207676_10001007 3300026095 Bacteria 21651
515 Ga0207674_10000855 3300026116 Bacteria 39777
516 Ga0207674_10000980 3300026116 Bacteria 37369
517 Ga0207674_10018649 3300026116 Bacteria 7537
518 Ga0207674_10820184 3300026116 Unclassified 897
519 Ga0207683_10000538 3300026121 Bacteria 35079
520 Ga0207683_10764963 3300026121 Bacteria 896
521 Ga0207698_10000274 3300026142 Bacteria 31326
522 Ga0207698_10006887 3300026142 Bacteria 7111
523 Ga0207698_10048069 3300026142 Bacteria 3236
524 Ga0207698_10174806 3300026142 Bacteria 1895
525 Ga0207698_10205720 3300026142 Bacteria 1766
526 Ga0207698_10386870 3300026142 Unclassified 1332
527 Ga0207698_12136499 3300026142 Unclassified 573
528 Ga0268266_10002567 3300028379 Bacteria 19261
529 Ga0268266_10013530 3300028379 Bacteria 7026
530 Ga0268266_10028613 3300028379 Bacteria 4736
531 Ga0268266_10038595 3300028379 Bacteria 4065
532 Ga0268266_10149580 3300028379 Bacteria 2103
533 Ga0268266_10167568 3300028379 Bacteria 1991
534 Ga0268265_10090122 3300028380 Unclassified 2449
535 Ga0268264_10002880 3300028381 Bacteria 14976
536 Ga0265323_10033302 3300028653 Bacteria 1909
537 Ga0265336_10007866 3300028666 Unclassified 3771
538 Ga0265338_10006276 3300028800 Bacteria 15204
539 Ga0265338_10053262 3300028800 Unclassified 3622
540 Ga0265338_10128248 3300028800 Unclassified 2008
541 Ga0265324_10066237 3300029957 Unclassified 1232
542 Ga0265324_10345234 3300029957 Bacteria 508
543 Ga0265773_1034552 3300031018 Bacteria 558
544 Ga0265330_10000373 3300031235 Bacteria 31405
545 Ga0265330_10000946 3300031235 Bacteria 17895
546 Ga0265330_10013349 3300031235 Bacteria 3830
547 Ga0265330_10050775 3300031235 Bacteria 1819
548 Ga0265330_10065596 3300031235 Unclassified 1576
549 Ga0265330_10392499 3300031235 Bacteria 587
550 Ga0265332_10020744 3300031238 Bacteria 2903
551 Ga0265332_10437035 3300031238 Bacteria 541
552 Ga0265328_10013516 3300031239 Bacteria 3229
553 Ga0265328_10016020 3300031239 Unclassified 2925
554 Ga0265320_10029314 3300031240 Bacteria 2848
555 Ga0265325_10000560 3300031241 Bacteria 27013
556 Ga0265325_10004041 3300031241 Bacteria 9367
557 Ga0265325_10010053 3300031241 Bacteria 5496
558 Ga0265325_10030207 3300031241 Unclassified 2907
559 Ga0265325_10049112 3300031241 Unclassified 2179
560 Ga0265325_10068856 3300031241 Bacteria 1780
561 Ga0265329_10049328 3300031242 Bacteria 1342
562 Ga0265329_10090407 3300031242 Unclassified 971
563 Ga0265340_10009260 3300031247 Bacteria 5289
564 Ga0265340_10019815 3300031247 Bacteria 3461
565 Ga0265340_10059546 3300031247 Bacteria 1832
566 Ga0265340_10140583 3300031247 Unclassified 1104
567 Ga0265339_10000899 3300031249 Bacteria 22835
568 Ga0265339_10001232 3300031249 Bacteria 19233
569 Ga0265339_10009868 3300031249 Bacteria 5961
570 Ga0265339_10094684 3300031249 Bacteria 1561
571 Ga0265339_10146940 3300031249 Bacteria 1195
572 Ga0265339_10183518 3300031249 Bacteria 1041
573 Ga0265331_10065378 3300031250 Bacteria 1710
574 Ga0265316_10000692 3300031344 Bacteria 37515
575 Ga0265316_10001589 3300031344 Bacteria 24272
576 Ga0265316_10009712 3300031344 Bacteria 8832
577 Ga0265316_10017785 3300031344 Bacteria 6128
578 Ga0265316_10023982 3300031344 Bacteria 5122
579 Ga0265316_10030629 3300031344 Unclassified 4408
580 Ga0265316_10030645 3300031344 Bacteria 4406
581 Ga0265316_10042587 3300031344 Bacteria 3628
582 Ga0265316_10375836 3300031344 Bacteria 1026
583 Ga0265313_10000889 3300031595 Bacteria 30069
584 Ga0265313_10001674 3300031595 Bacteria 20509
585 Ga0265313_10009220 3300031595 Bacteria 6433
586 Ga0265313_10033410 3300031595 Unclassified 2614
587 Ga0265314_10000047 3300031711 Bacteria 194061
588 Ga0265314_10030156 3300031711 Bacteria 4018
589 Ga0265314_10151026 3300031711 Bacteria 1424
590 Ga0265314_10273098 3300031711 Bacteria 960
591 Ga0265314_10552543 3300031711 Unclassified 599
592 Ga0265342_10000395 3300031712 Bacteria 48238
593 Ga0265342_10001287 3300031712 Bacteria 23577
594 Ga0265342_10025826 3300031712 Bacteria 3687
595 Ga0265342_10064052 3300031712 Bacteria 2159
596 Ga0265342_10073805 3300031712 Bacteria 1983
597 Ga0265342_10078741 3300031712 Bacteria 1907
598 Ga0265342_10123968 3300031712 Bacteria 1452
599 Ga0265342_10139574 3300031712 Unclassified 1353
600 Ga0265342_10661937 3300031712 Unclassified 524
601 Ga0307510_10251889 3300033180 Bacteria 1253
602 Ga0307510_10545474 3300033180 Unclassified 605
603 Ga0373946_0268876 3300035171 Bacteria 836
604 Ga0373935_0655080 3300035692 Unclassified 770
605 Ga0373933_0287150 3300035724 Unclassified 1064
606 Ga0373937_1799380 3300036401 Bacteria 559
607 Ga0373925_0487716 3300037068 Bacteria 1011
608 Ga0395900_1478532 3300037418 Unclassified 592
609 Ga0436360_0610332 3300039438 Bacteria 4785
610 Ga0436361_0337765 3300039447 Bacteria 6510
611 Ga0466966_0047123 3300044684 Bacteria 2750
612 Ga0466961_0389735 3300044693 Bacteria 846
613 Ga0466963_0971671 3300044694 Unclassified 598
614 Ga0466970_0570819 3300044765 Unclassified 655
615 Ga0466967_0004403 3300045976 Bacteria 9489
616 Ga0466967_0102326 3300045976 Bacteria 2620
617 Ga0495603_0009966 3300046455 Bacteria 5750
618 Ga0495590_0248597 3300046457 Bacteria 661
619 Ga0495629_0004596 3300046459 Bacteria 10331
620 Ga0495629_0013052 3300046459 Bacteria 6003
621 Ga0495629_0111918 3300046459 Bacteria 1903
622 Ga0495651_0010544 3300046462 Bacteria 7102
623 Ga0495651_0057334 3300046462 Bacteria 2990
624 Ga0495651_0268372 3300046462 Unclassified 1158
625 Ga0495653_0112746 3300046463 Bacteria 1951
626 Ga0495650_0000038 3300046471 Bacteria 377530
627 Ga0495650_0010097 3300046471 Bacteria 5301
628 Ga0495580_0068034 3300046472 Bacteria 2491
629 Ga0495580_0104933 3300046472 Bacteria 1964
630 Ga0495580_0192359 3300046472 Bacteria 1407
631 Ga0495580_0262810 3300046472 Bacteria 1180
632 Ga0495582_0001708 3300046473 Bacteria 12393
633 Ga0495582_0064541 3300046473 Unclassified 2022
634 Ga0495582_0155597 3300046473 Bacteria 1299
635 Ga0495605_0048804 3300046474 Bacteria 2071
636 Ga0495639_0039244 3300046475 Bacteria 2129
637 Ga0495662_0010153 3300046476 Bacteria 4615
638 Ga0495662_0420243 3300046476 Unclassified 656
639 Ga0495664_0179703 3300046477 Bacteria 1283
640 Ga0495664_0196812 3300046477 Bacteria 1221
641 Ga0495664_0336460 3300046477 Unclassified 910
642 Ga0495594_0002105 3300046499 Bacteria 10362
643 Ga0495594_0025826 3300046499 Bacteria 3158
644 Ga0495594_0114808 3300046499 Unclassified 1520
645 Ga0495596_0098481 3300046500 Bacteria 1135
646 Ga0495583_0052919 3300046506 Bacteria 1844
647 Ga0495606_0093447 3300046507 Bacteria 1845
648 Ga0495618_0160179 3300046514 Bacteria 1435
649 Ga0495628_0133383 3300046516 Bacteria 1899
650 Ga0495628_0161033 3300046516 Bacteria 1705
651 Ga0495628_0563609 3300046516 Unclassified 817
652 Ga0495630_0871451 3300046517 Unclassified 686
653 Ga0495630_1055222 3300046517 Bacteria 617
654 Ga0495631_0163961 3300046518 Unclassified 953
655 Ga0495632_0316393 3300046519 Bacteria 690
656 Ga0495643_0058683 3300046522 Bacteria 2047
657 Ga0495644_0000075 3300046523 Bacteria 48572
658 Ga0495648_0164735 3300046524 Bacteria 1142
659 Ga0495648_0386790 3300046524 Bacteria 629
660 Ga0495642_0190129 3300046528 Bacteria 894
661 Ga0495642_0223351 3300046528 Unclassified 822
662 Ga0495652_0022120 3300046529 Bacteria 5647
663 Ga0495652_0030912 3300046529 Bacteria 4693
664 Ga0495652_0118940 3300046529 Bacteria 2111
665 Ga0495652_0233087 3300046529 Bacteria 1375
666 Ga0495665_0000961 3300046531 Bacteria 15243
667 Ga0495665_0101587 3300046531 Bacteria 1509
668 Ga0495665_0102091 3300046531 Bacteria 1505
669 Ga0495665_0148396 3300046531 Unclassified 1224
670 Ga0495665_0214842 3300046531 Unclassified 995
671 Ga0495640_0114801 3300046533 Bacteria 1755
672 Ga0495640_0162704 3300046533 Unclassified 1429
673 Ga0495640_0764773 3300046533 Bacteria 577
674 Ga0495587_0012311 3300046536 Bacteria 5391
675 Ga0495587_0090331 3300046536 Bacteria 1769
676 Ga0495587_0097917 3300046536 Unclassified 1691
677 Ga0495587_0545854 3300046536 Unclassified 640
678 Ga0495609_0010193 3300046538 Bacteria 4517
679 Ga0495609_0053100 3300046538 Bacteria 1802
680 Ga0495645_0001164 3300046543 Bacteria 17908
681 Ga0495645_0013696 3300046543 Bacteria 5746
682 Ga0495645_0019830 3300046543 Bacteria 4845
683 Ga0495645_0046501 3300046543 Bacteria 3163
684 Ga0495645_0377211 3300046543 Unclassified 908
685 Ga0495645_0551181 3300046543 Bacteria 715
686 Ga0495667_0004747 3300046559 Bacteria 9191
687 Ga0495667_0149335 3300046559 Bacteria 1505
688 Ga0495668_0117896 3300046616 Bacteria 1452
689 Ga0495634_0014390 3300046642 Bacteria 5706
690 Ga0495625_0011712 3300046660 Bacteria 7130
691 Ga0495625_0018413 3300046660 Bacteria 5455
692 Ga0495625_0024754 3300046660 Bacteria 4562
693 Ga0495625_0513842 3300046660 Unclassified 731
694 Ga0495635_0062130 3300046663 Bacteria 2565
695 Ga0495635_0103802 3300046663 Bacteria 1942
696 Ga0495635_0126339 3300046663 Bacteria 1744
697 Ga0495635_0377141 3300046663 Bacteria 944
698 Ga0495588_0219771 3300046674 Bacteria 1003
699 Ga0495599_0015216 3300046678 Bacteria 4771
700 Ga0495623_0012464 3300046679 Bacteria 5501
701 Ga0495623_0035344 3300046679 Bacteria 3203
702 Ga0495623_0052952 3300046679 Bacteria 2564
703 Ga0495646_0020802 3300046680 Bacteria 4149
704 Ga0495647_0148756 3300046681 Unclassified 1003
705 Ga0495658_0390538 3300046683 Unclassified 887
706 Ga0495669_0028767 3300046684 Unclassified 2435
707 Ga0495669_0375330 3300046684 Bacteria 688
708 Ga0495613_0020679 3300046689 Bacteria 4906
709 Ga0495613_0149849 3300046689 Bacteria 1664
710 Ga0495613_0212728 3300046689 Bacteria 1359
711 Ga0495613_0368034 3300046689 Unclassified 984
712 Ga0495624_0628313 3300046690 Unclassified 639
713 Ga0495670_0069173 3300046691 Bacteria 1785
714 Ga0495649_0013111 3300046694 Bacteria 4791
715 Ga0495649_0241179 3300046694 Bacteria 931
716 Ga0495600_0002839 3300046809 Bacteria 10076
717 Ga0495600_0056864 3300046809 Bacteria 2556
718 Ga0495600_0099600 3300046809 Bacteria 1894
719 Ga0495600_0121445 3300046809 Bacteria 1699
720 Ga0495581_0047580 3300047315 Bacteria 2478
721 Ga0495581_0052854 3300047315 Bacteria 2347
722 Ga0495604_0006208 3300047317 Bacteria 9486
723 Ga0495604_0017720 3300047317 Bacteria 5699
724 Ga0495604_0042851 3300047317 Bacteria 3545
725 Ga0495604_0760150 3300047317 Bacteria 612
726 Ga0495674_0018433 3300047319 Bacteria 6497
727 Ga0495674_0244802 3300047319 Unclassified 1477
728 Ga0495674_0307893 3300047319 Bacteria 1293
729 Ga0495674_0598427 3300047319 Bacteria 874
730 Ga0495676_0001072 3300047321 Bacteria 23161
731 Ga0495687_064633 3300047443 Bacteria 1493
732 Ga0495675_0057328 3300047444 Bacteria 2470
733 Ga0495677_0110072 3300047445 Bacteria 1047
734 Ga0495685_106174 3300047447 Bacteria 926
735 Ga0495684_0052900 3300047471 Bacteria 3099
736 Ga0495684_0055291 3300047471 Bacteria 3027
737 Ga0495684_0084614 3300047471 Bacteria 2406
738 Ga0495684_0680074 3300047471 Bacteria 685
739 Ga0495686_0002264 3300047472 Bacteria 18562
740 Ga0495686_0003622 3300047472 Bacteria 13249
741 Ga0495593_0032650 3300047673 Bacteria 2836
742 Ga0495602_0145971 3300048088 Bacteria 1866
743 Ga0495602_0491431 3300048088 Unclassified 859
744 Ga0495602_0834098 3300048088 Unclassified 617
745 Ga0495614_0025368 3300048089 Bacteria 2556
746 Ga0496100_0523827 3300048903 Bacteria 915
747 Ga0496102_0378084 3300048905 Bacteria 1333
748 Ga0496104_0023290 3300048907 Bacteria 5693
749 Ga0496104_0627734 3300048907 Bacteria 984
750 Ga0496105_0028399 3300048908 Bacteria 4574
751 Ga0496105_0197739 3300048908 Bacteria 1642
752 Ga0496105_0246083 3300048908 Bacteria 1450
753 Ga0496106_0441674 3300048909 Bacteria 1045
754 Ga0496107_0452449 3300048910 Bacteria 954
755 Ga0496112_0294601 3300048915 Bacteria 1568
756 Ga0496112_0437099 3300048915 Bacteria 1247
757 Ga0496113_0611012 3300048916 Bacteria 873
758 Ga0496114_0204386 3300048917 Bacteria 1731
759 Ga0496114_0353777 3300048917 Bacteria 1299
760 Ga0496115_0109286 3300048918 Unclassified 2270
761 Ga0496115_0112272 3300048918 Bacteria 2239
762 Ga0496115_0180452 3300048918 Bacteria 1745
763 Ga0496115_0714590 3300048918 Unclassified 786
764 Ga0496115_0758318 3300048918 Bacteria 758
765 Ga0496115_1349943 3300048918 Bacteria 529
766 Ga0496126_0000029 3300048929 Bacteria 389370
767 Ga0496126_0015123 3300048929 Bacteria 7772
768 Ga0496126_0046844 3300048929 Bacteria 3962
769 Ga0496126_0339958 3300048929 Bacteria 1230
770 Ga0495682_0008913 3300049460 Bacteria 3936
771 Ga0495682_0160113 3300049460 Bacteria 801
772 Ga0501032_0022789 3300049569 Bacteria 4337
773 Ga0501032_0052909 3300049569 Bacteria 2736
774 Ga0501033_0132566 3300049570 Bacteria 1804
775 Ga0501033_0626495 3300049570 Bacteria 736
776 Ga0501034_0077473 3300049571 Bacteria 3330
777 Ga0501036_0003869 3300049572 Bacteria 12010
778 Ga0501037_0050421 3300049573 Bacteria 3046
779 Ga0501037_0082324 3300049573 Bacteria 2332
780 Ga0501037_0172500 3300049573 Bacteria 1537
781 Ga0501038_0032815 3300049574 Bacteria 4577
782 Ga0501038_0163971 3300049574 Bacteria 1804
783 Ga0501038_0202752 3300049574 Bacteria 1591
784 Ga0501043_0006418 3300049579 Bacteria 9445
785 Ga0501047_0005103 3300049581 Bacteria 12320
786 Ga0501047_0261777 3300049581 Bacteria 1577
787 Ga0501070_0106465 3300049586 Bacteria 2318
788 Ga0501070_0228564 3300049586 Unclassified 1525
789 Ga0501073_0182751 3300049589 Bacteria 1451
790 Ga0501073_0191207 3300049589 Unclassified 1416
791 Ga0501073_1104112 3300049589 Bacteria 545
792 Ga0501080_0068317 3300049742 Bacteria 3306
793 Ga0501081_0886332 3300049743 Bacteria 673
794 Ga0501035_0161724 3300049822 Bacteria 1937
795 Ga0501035_0272362 3300049822 Bacteria 1432
796 Ga0501044_0041402 3300049823 Bacteria 4795
797 Ga0501044_0158418 3300049823 Bacteria 2242
798 Ga0495601_0550310 3300053077 Unclassified 742
799 Ga0495601_0789957 3300053077 Bacteria 603
800 Ga0500595_000004 3300053119 Bacteria 410922
801 Ga0500595_105138 3300053119 Bacteria 806
802 Ga0500595_206394 3300053119 Unclassified 541
803 Ga0501084_0199585 3300054114 Bacteria 1688
804 Ga0500661_002075 3300055283 Bacteria 3787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031235 Ga0265330_10000373 Ga0265330_1000037328 115
2 3300031241 Ga0265325_10000560 Ga0265325_100005605 115
3 3300031249 Ga0265339_10000899 Ga0265339_1000089913 115
4 3300031344 Ga0265316_10000692 Ga0265316_100006926 115
5 3300031595 Ga0265313_10001674 Ga0265313_1000167412 115
6 3300031712 Ga0265342_10000395 Ga0265342_100003959 115
7 3300028800 Ga0265338_10006276 Ga0265338_100062767 120
8 3300031235 Ga0265330_10000946 Ga0265330_1000094614 120
9 3300031241 Ga0265325_10004041 Ga0265325_100040415 120
10 3300031247 Ga0265340_10009260 Ga0265340_100092605 120
11 3300031249 Ga0265339_10009868 Ga0265339_100098685 120
12 3300031344 Ga0265316_10017785 Ga0265316_100177858 120
13 3300031712 Ga0265342_10001287 Ga0265342_1000128716 120
14 3300031595 Ga0265313_10009220 Ga0265313_100092205 125
15 3300031241 Ga0265325_10030207 Ga0265325_100302074 134
16 3300014969 Ga0157376_10591281 Ga0157376_105912813 135
17 3300031241 Ga0265325_10010053 Ga0265325_100100535 135
18 3300048929 Ga0496126_0046844 Ga0496126_0046844_2728_3135 135
19 3300005459 Ga0068867_100919244 Ga0068867_1009192441 136
20 3300031235 Ga0265330_10065596 Ga0265330_100655962 137
21 3300031247 Ga0265340_10019815 Ga0265340_100198153 137
22 3300031247 Ga0265340_10140583 Ga0265340_101405831 137
23 3300031344 Ga0265316_10009712 Ga0265316_1000971210 137
24 3300031344 Ga0265316_10042587 Ga0265316_100425872 137
25 3300031712 Ga0265342_10139574 Ga0265342_101395742 137
26 3300031235 Ga0265330_10392499 Ga0265330_103924991 138
27 3300031344 Ga0265316_10030645 Ga0265316_100306454 138
28 3300031711 Ga0265314_10273098 Ga0265314_102730982 138
29 3300031712 Ga0265342_10064052 Ga0265342_100640523 138
30 3300048903 Ga0496100_0523827 Ga0496100_0523827_89_508 139
31 iso_pu_bacteria 2884215851 2884219576 139
32 3300028666 Ga0265336_10007866 Ga0265336_100078662 140
33 3300005455 Ga0070663_100720848 Ga0070663_1007208482 141
34 3300005530 Ga0070679_100003039 Ga0070679_10000303911 141
35 3300005539 Ga0068853_101167926 Ga0068853_1011679261 141
36 3300005616 Ga0068852_100101081 Ga0068852_1001010813 141
37 3300006175 Ga0070712_100767895 Ga0070712_1007678951 141
38 3300013104 Ga0157370_10069134 Ga0157370_100691342 141
39 3300013105 Ga0157369_10373482 Ga0157369_103734822 141
40 3300013307 Ga0157372_10174325 Ga0157372_101743254 141
41 3300025915 Ga0207693_10308120 Ga0207693_103081201 141
42 3300025921 Ga0207652_10004174 Ga0207652_100041748 141
43 3300026041 Ga0207639_10981926 Ga0207639_109819262 141
44 3300026142 Ga0207698_10048069 Ga0207698_100480695 141
45 3300046462 Ga0495651_0010544 Ga0495651_0010544_3000_3428 141
46 3300046477 Ga0495664_0179703 Ga0495664_0179703_362_790 141
47 3300046516 Ga0495628_0133383 Ga0495628_0133383_213_641 141
48 3300046529 Ga0495652_0022120 Ga0495652_0022120_2587_3015 141
49 3300046536 Ga0495587_0090331 Ga0495587_0090331_969_1397 141
50 3300046543 Ga0495645_0001164 Ga0495645_0001164_12356_12784 141
51 3300046559 Ga0495667_0149335 Ga0495667_0149335_126_554 141
52 3300046663 Ga0495635_0062130 Ga0495635_0062130_611_1039 141
53 3300046679 Ga0495623_0012464 Ga0495623_0012464_4672_5100 141
54 3300046689 Ga0495613_0149849 Ga0495613_0149849_513_941 141
55 3300046809 Ga0495600_0056864 Ga0495600_0056864_1208_1636 141
56 3300047317 Ga0495604_0006208 Ga0495604_0006208_4262_4690 141
57 3300047444 Ga0495675_0057328 Ga0495675_0057328_1282_1710 141
58 3300047471 Ga0495684_0052900 Ga0495684_0052900_1599_2027 141
59 3300047472 Ga0495686_0003622 Ga0495686_0003622_6037_6462 141
60 3300048088 Ga0495602_0145971 Ga0495602_0145971_1105_1533 141
61 3300053077 Ga0495601_0789957 Ga0495601_0789957_106_534 141
62 3300005327 Ga0070658_10158097 Ga0070658_101580972 142
63 3300005327 Ga0070658_10475198 Ga0070658_104751983 142
64 3300005329 Ga0070683_100044078 Ga0070683_1000440785 142
65 3300005331 Ga0070670_100020567 Ga0070670_1000205676 142
66 3300005335 Ga0070666_10052334 Ga0070666_100523344 142
67 3300005336 Ga0070680_100024639 Ga0070680_1000246395 142
68 3300005339 Ga0070660_100010075 Ga0070660_1000100756 142
69 3300005344 Ga0070661_100148660 Ga0070661_1001486604 142
70 3300005347 Ga0070668_101428514 Ga0070668_1014285141 142
71 3300005355 Ga0070671_100000915 Ga0070671_10000091512 142
72 3300005364 Ga0070673_100206950 Ga0070673_1002069504 142
73 3300005367 Ga0070667_100078885 Ga0070667_1000788853 142
74 3300005434 Ga0070709_10391741 Ga0070709_103917412 142
75 3300005436 Ga0070713_100006331 Ga0070713_1000063317 142
76 3300005436 Ga0070713_100307943 Ga0070713_1003079432 142
77 3300005455 Ga0070663_100039784 Ga0070663_1000397843 142
78 3300005455 Ga0070663_101845086 Ga0070663_1018450861 142
79 3300005456 Ga0070678_100459640 Ga0070678_1004596403 142
80 3300005458 Ga0070681_10032775 Ga0070681_100327756 142
81 3300005530 Ga0070679_100013656 Ga0070679_1000136563 142
82 3300005535 Ga0070684_100104930 Ga0070684_1001049302 142
83 3300005539 Ga0068853_100017080 Ga0068853_1000170806 142
84 3300005548 Ga0070665_100016489 Ga0070665_1000164899 142
85 3300005563 Ga0068855_100171851 Ga0068855_1001718514 142
86 3300005577 Ga0068857_100014218 Ga0068857_1000142185 142
87 3300005578 Ga0068854_100044701 Ga0068854_1000447014 142
88 3300005841 Ga0068863_100068676 Ga0068863_1000686765 142
89 3300009093 Ga0105240_10047123 Ga0105240_100471235 142
90 3300009174 Ga0105241_10308077 Ga0105241_103080772 142
91 3300009545 Ga0105237_10030905 Ga0105237_100309056 142
92 3300009551 Ga0105238_10044082 Ga0105238_100440825 142
93 3300009553 Ga0105249_10829172 Ga0105249_108291721 142
94 3300013100 Ga0157373_10142263 Ga0157373_101422633 142
95 3300013104 Ga0157370_10015491 Ga0157370_100154917 142
96 3300013105 Ga0157369_10079960 Ga0157369_100799606 142
97 3300013296 Ga0157374_10004033 Ga0157374_1000403311 142
98 3300013307 Ga0157372_10069378 Ga0157372_100693786 142
99 3300013308 Ga0157375_11348880 Ga0157375_113488802 142
100 3300014325 Ga0163163_10042935 Ga0163163_100429353 142
101 3300014969 Ga0157376_10032165 Ga0157376_100321654 142
102 3300025903 Ga0207680_10074192 Ga0207680_100741924 142
103 3300025904 Ga0207647_10005646 Ga0207647_100056466 142
104 3300025909 Ga0207705_10010673 Ga0207705_100106735 142
105 3300025909 Ga0207705_10019060 Ga0207705_100190603 142
106 3300025912 Ga0207707_10024675 Ga0207707_100246755 142
107 3300025913 Ga0207695_10059854 Ga0207695_100598542 142
108 3300025914 Ga0207671_10290504 Ga0207671_102905042 142
109 3300025917 Ga0207660_10070179 Ga0207660_100701795 142
110 3300025919 Ga0207657_10016204 Ga0207657_100162045 142
111 3300025920 Ga0207649_10119311 Ga0207649_101193111 142
112 3300025921 Ga0207652_10017306 Ga0207652_100173063 142
113 3300025925 Ga0207650_10189948 Ga0207650_101899483 142
114 3300025928 Ga0207700_10093999 Ga0207700_100939993 142
115 3300025931 Ga0207644_10002739 Ga0207644_100027395 142
116 3300025932 Ga0207690_10092837 Ga0207690_100928375 142
117 3300025939 Ga0207665_10295203 Ga0207665_102952032 142
118 3300025944 Ga0207661_10162825 Ga0207661_101628254 142
119 3300025945 Ga0207679_10093288 Ga0207679_100932885 142
120 3300025949 Ga0207667_10023299 Ga0207667_100232996 142
121 3300025986 Ga0207658_10072072 Ga0207658_100720723 142
122 3300026041 Ga0207639_11442066 Ga0207639_114420661 142
123 3300026067 Ga0207678_10017514 Ga0207678_100175145 142
124 3300026116 Ga0207674_10018649 Ga0207674_100186496 142
125 3300026121 Ga0207683_10764963 Ga0207683_107649632 142
126 3300028379 Ga0268266_10167568 Ga0268266_101675682 142
127 3300031018 Ga0265773_1034552 Ga0265773_10345521 142
128 3300031712 Ga0265342_10025826 Ga0265342_100258262 142
129 3300033180 Ga0307510_10251889 Ga0307510_102518892 142
130 3300046459 Ga0495629_0004596 Ga0495629_0004596_7681_8109 142
131 3300046472 Ga0495580_0192359 Ga0495580_0192359_674_1165 142
132 3300046499 Ga0495594_0002105 Ga0495594_0002105_4588_5016 142
133 3300046499 Ga0495594_0114808 Ga0495594_0114808_762_1190 142
134 3300046516 Ga0495628_0161033 Ga0495628_0161033_1030_1458 142
135 3300046531 Ga0495665_0102091 Ga0495665_0102091_882_1310 142
136 3300046543 Ga0495645_0013696 Ga0495645_0013696_5142_5570 142
137 3300046543 Ga0495645_0046501 Ga0495645_0046501_1006_1434 142
138 3300046616 Ga0495668_0117896 Ga0495668_0117896_48_476 142
139 3300046674 Ga0495588_0219771 Ga0495588_0219771_95_523 142
140 3300046678 Ga0495599_0015216 Ga0495599_0015216_1754_2182 142
141 3300046690 Ga0495624_0628313 Ga0495624_0628313_177_605 142
142 3300046809 Ga0495600_0121445 Ga0495600_0121445_1085_1513 142
143 3300047317 Ga0495604_0760150 Ga0495604_0760150_35_463 142
144 3300047319 Ga0495674_0018433 Ga0495674_0018433_2076_2504 142
145 3300047471 Ga0495684_0055291 Ga0495684_0055291_177_605 142
146 3300047471 Ga0495684_0084614 Ga0495684_0084614_543_971 142
147 3300048915 Ga0496112_0294601 Ga0496112_0294601_226_654 142
148 3300049573 Ga0501037_0050421 Ga0501037_0050421_403_831 142
149 3300049574 Ga0501038_0202752 Ga0501038_0202752_971_1399 142
150 3300049581 Ga0501047_0261777 Ga0501047_0261777_745_1173 142
151 3300049586 Ga0501070_0228564 Ga0501070_0228564_175_603 142
152 3300049589 Ga0501073_0191207 Ga0501073_0191207_863_1291 142
153 3300000546 LJNas_1006184 LJNas_10061842 143
154 3300001991 JGI24743J22301_10055314 JGI24743J22301_100553141 143
155 3300003320 rootH2_10285490 rootH2_102854902 143
156 3300003322 rootL2_10356678 rootL2_103566782 143
157 3300005327 Ga0070658_10000142 Ga0070658_1000014215 143
158 3300005327 Ga0070658_10014001 Ga0070658_100140015 143
159 3300005327 Ga0070658_10051815 Ga0070658_100518153 143
160 3300005327 Ga0070658_10090710 Ga0070658_100907103 143
161 3300005327 Ga0070658_10124843 Ga0070658_101248432 143
162 3300005327 Ga0070658_10192532 Ga0070658_101925322 143
163 3300005327 Ga0070658_11003223 Ga0070658_110032232 143
164 3300005327 Ga0070658_11182145 Ga0070658_111821451 143
165 3300005328 Ga0070676_10019001 Ga0070676_100190011 143
166 3300005329 Ga0070683_100003012 Ga0070683_1000030125 143
167 3300005329 Ga0070683_100021519 Ga0070683_1000215194 143
168 3300005329 Ga0070683_100061847 Ga0070683_1000618473 143
169 3300005329 Ga0070683_100132588 Ga0070683_1001325882 143
170 3300005329 Ga0070683_100177481 Ga0070683_1001774812 143
171 3300005329 Ga0070683_100420913 Ga0070683_1004209131 143
172 3300005329 Ga0070683_100635777 Ga0070683_1006357772 143
173 3300005329 Ga0070683_100710150 Ga0070683_1007101501 143
174 3300005330 Ga0070690_100164351 Ga0070690_1001643512 143
175 3300005331 Ga0070670_100002930 Ga0070670_1000029308 143
176 3300005334 Ga0068869_100000517 Ga0068869_10000051715 143
177 3300005334 Ga0068869_100062344 Ga0068869_1000623443 143
178 3300005335 Ga0070666_10012804 Ga0070666_100128045 143
179 3300005337 Ga0070682_101526941 Ga0070682_1015269411 143
180 3300005337 Ga0070682_101725761 Ga0070682_1017257611 143
181 3300005338 Ga0068868_100027110 Ga0068868_1000271103 143
182 3300005338 Ga0068868_100047080 Ga0068868_1000470802 143
183 3300005338 Ga0068868_100325876 Ga0068868_1003258762 143
184 3300005339 Ga0070660_100003805 Ga0070660_1000038056 143
185 3300005339 Ga0070660_100049896 Ga0070660_1000498964 143
186 3300005339 Ga0070660_100050439 Ga0070660_1000504394 143
187 3300005339 Ga0070660_100559691 Ga0070660_1005596912 143
188 3300005344 Ga0070661_100000910 Ga0070661_1000009107 143
189 3300005344 Ga0070661_100082658 Ga0070661_1000826581 143
190 3300005344 Ga0070661_100505212 Ga0070661_1005052122 143
191 3300005344 Ga0070661_100583560 Ga0070661_1005835602 143
192 3300005345 Ga0070692_10204663 Ga0070692_102046632 143
193 3300005345 Ga0070692_10502226 Ga0070692_105022261 143
194 3300005347 Ga0070668_100113140 Ga0070668_1001131403 143
195 3300005354 Ga0070675_100034701 Ga0070675_1000347013 143
196 3300005355 Ga0070671_100000458 Ga0070671_10000045815 143
197 3300005355 Ga0070671_100132125 Ga0070671_1001321253 143
198 3300005364 Ga0070673_100358621 Ga0070673_1003586212 143
199 3300005364 Ga0070673_100705982 Ga0070673_1007059821 143
200 3300005366 Ga0070659_100002926 Ga0070659_1000029267 143
201 3300005366 Ga0070659_100048475 Ga0070659_1000484754 143
202 3300005367 Ga0070667_100067812 Ga0070667_1000678122 143
203 3300005367 Ga0070667_100074985 Ga0070667_1000749852 143
204 3300005434 Ga0070709_10222379 Ga0070709_102223791 143
205 3300005434 Ga0070709_10509921 Ga0070709_105099212 143
206 3300005435 Ga0070714_100103847 Ga0070714_1001038472 143
207 3300005435 Ga0070714_100270563 Ga0070714_1002705632 143
208 3300005436 Ga0070713_100002026 Ga0070713_10000202612 143
209 3300005436 Ga0070713_100083713 Ga0070713_1000837133 143
210 3300005455 Ga0070663_100087286 Ga0070663_1000872862 143
211 3300005455 Ga0070663_100091871 Ga0070663_1000918713 143
212 3300005455 Ga0070663_100101520 Ga0070663_1001015202 143
213 3300005456 Ga0070678_100007527 Ga0070678_1000075272 143
214 3300005458 Ga0070681_10555344 Ga0070681_105553442 143
215 3300005458 Ga0070681_10940690 Ga0070681_109406902 143
216 3300005459 Ga0068867_101054227 Ga0068867_1010542271 143
217 3300005530 Ga0070679_100066464 Ga0070679_1000664642 143
218 3300005530 Ga0070679_100511862 Ga0070679_1005118622 143
219 3300005535 Ga0070684_100011640 Ga0070684_1000116405 143
220 3300005535 Ga0070684_100034362 Ga0070684_1000343624 143
221 3300005535 Ga0070684_100116051 Ga0070684_1001160513 143
222 3300005535 Ga0070684_100124895 Ga0070684_1001248952 143
223 3300005535 Ga0070684_100809282 Ga0070684_1008092822 143
224 3300005539 Ga0068853_100000018 Ga0068853_10000001841 143
225 3300005539 Ga0068853_100007063 Ga0068853_1000070636 143
226 3300005539 Ga0068853_100054488 Ga0068853_1000544884 143
227 3300005539 Ga0068853_100200276 Ga0068853_1002002762 143
228 3300005539 Ga0068853_100219206 Ga0068853_1002192062 143
229 3300005539 Ga0068853_100345218 Ga0068853_1003452182 143
230 3300005539 Ga0068853_102306996 Ga0068853_1023069961 143
231 3300005543 Ga0070672_100002005 Ga0070672_1000020054 143
232 3300005548 Ga0070665_100017091 Ga0070665_1000170912 143
233 3300005548 Ga0070665_100073342 Ga0070665_1000733423 143
234 3300005548 Ga0070665_100231116 Ga0070665_1002311163 143
235 3300005548 Ga0070665_100577924 Ga0070665_1005779242 143
236 3300005548 Ga0070665_100707005 Ga0070665_1007070052 143
237 3300005563 Ga0068855_100003707 Ga0068855_1000037073 143
238 3300005563 Ga0068855_100020184 Ga0068855_1000201842 143
239 3300005563 Ga0068855_100026998 Ga0068855_1000269986 143
240 3300005563 Ga0068855_100044675 Ga0068855_1000446752 143
241 3300005563 Ga0068855_100047496 Ga0068855_1000474965 143
242 3300005563 Ga0068855_100048851 Ga0068855_1000488514 143
243 3300005563 Ga0068855_100080886 Ga0068855_1000808865 143
244 3300005563 Ga0068855_100084463 Ga0068855_1000844633 143
245 3300005563 Ga0068855_100192999 Ga0068855_1001929992 143
246 3300005563 Ga0068855_100321459 Ga0068855_1003214592 143
247 3300005563 Ga0068855_100327545 Ga0068855_1003275451 143
248 3300005563 Ga0068855_100697128 Ga0068855_1006971282 143
249 3300005577 Ga0068857_100000749 Ga0068857_1000007494 143
250 3300005577 Ga0068857_100001413 Ga0068857_10000141314 143
251 3300005577 Ga0068857_100516036 Ga0068857_1005160362 143
252 3300005578 Ga0068854_100000042 Ga0068854_10000004268 143
253 3300005578 Ga0068854_100161709 Ga0068854_1001617092 143
254 3300005578 Ga0068854_100766669 Ga0068854_1007666692 143
255 3300005578 Ga0068854_100884056 Ga0068854_1008840562 143
256 3300005614 Ga0068856_100006392 Ga0068856_1000063924 143
257 3300005614 Ga0068856_100008572 Ga0068856_1000085726 143
258 3300005614 Ga0068856_100036870 Ga0068856_1000368702 143
259 3300005614 Ga0068856_100058871 Ga0068856_1000588711 143
260 3300005614 Ga0068856_100367671 Ga0068856_1003676712 143
261 3300005614 Ga0068856_100511148 Ga0068856_1005111482 143
262 3300005614 Ga0068856_100648613 Ga0068856_1006486132 143
263 3300005614 Ga0068856_100792783 Ga0068856_1007927832 143
264 3300005614 Ga0068856_101143353 Ga0068856_1011433532 143
265 3300005616 Ga0068852_100000714 Ga0068852_1000007144 143
266 3300005616 Ga0068852_100009322 Ga0068852_1000093223 143
267 3300005616 Ga0068852_100017448 Ga0068852_1000174483 143
268 3300005616 Ga0068852_100103064 Ga0068852_1001030642 143
269 3300005616 Ga0068852_100154020 Ga0068852_1001540202 143
270 3300005616 Ga0068852_100187369 Ga0068852_1001873691 143
271 3300005616 Ga0068852_100482028 Ga0068852_1004820283 143
272 3300005616 Ga0068852_100786678 Ga0068852_1007866781 143
273 3300005617 Ga0068859_100038997 Ga0068859_1000389975 143
274 3300005617 Ga0068859_100110389 Ga0068859_1001103893 143
275 3300005618 Ga0068864_100000992 Ga0068864_1000009927 143
276 3300005618 Ga0068864_101889048 Ga0068864_1018890481 143
277 3300005718 Ga0068866_10080976 Ga0068866_100809762 143
278 3300005834 Ga0068851_10136152 Ga0068851_101361521 143
279 3300005834 Ga0068851_10139335 Ga0068851_101393352 143
280 3300005834 Ga0068851_10375748 Ga0068851_103757482 143
281 3300005834 Ga0068851_10467268 Ga0068851_104672681 143
282 3300005834 Ga0068851_10513008 Ga0068851_105130081 143
283 3300005841 Ga0068863_100008605 Ga0068863_1000086056 143
284 3300005841 Ga0068863_100666525 Ga0068863_1006665252 143
285 3300005841 Ga0068863_101968815 Ga0068863_1019688152 143
286 3300005842 Ga0068858_100063440 Ga0068858_1000634404 143
287 3300005842 Ga0068858_100125789 Ga0068858_1001257893 143
288 3300005842 Ga0068858_100420384 Ga0068858_1004203842 143
289 3300005843 Ga0068860_100003788 Ga0068860_1000037887 143
290 3300005843 Ga0068860_100255708 Ga0068860_1002557082 143
291 3300005844 Ga0068862_100054466 Ga0068862_1000544666 143
292 3300006028 Ga0070717_11493671 Ga0070717_114936712 143
293 3300006237 Ga0097621_100004302 Ga0097621_1000043023 143
294 3300006237 Ga0097621_100029015 Ga0097621_1000290154 143
295 3300006358 Ga0068871_100002034 Ga0068871_1000020349 143
296 3300006358 Ga0068871_100017601 Ga0068871_1000176015 143
297 3300006358 Ga0068871_100065138 Ga0068871_1000651382 143
298 3300006881 Ga0068865_100043149 Ga0068865_1000431493 143
299 3300006931 Ga0097620_100038995 Ga0097620_1000389952 143
300 3300006931 Ga0097620_100110393 Ga0097620_1001103932 143
301 3300009093 Ga0105240_10000284 Ga0105240_1000028412 143
302 3300009093 Ga0105240_10001593 Ga0105240_1000159329 143
303 3300009093 Ga0105240_10001640 Ga0105240_1000164015 143
304 3300009093 Ga0105240_10008641 Ga0105240_100086413 143
305 3300009093 Ga0105240_10009569 Ga0105240_100095695 143
306 3300009093 Ga0105240_10122136 Ga0105240_101221364 143
307 3300009093 Ga0105240_10167381 Ga0105240_101673813 143
308 3300009093 Ga0105240_10440799 Ga0105240_104407991 143
309 3300009093 Ga0105240_11138913 Ga0105240_111389131 143
310 3300009093 Ga0105240_11171971 Ga0105240_111719712 143
311 3300009093 Ga0105240_11701418 Ga0105240_117014182 143
312 3300009093 Ga0105240_12502135 Ga0105240_125021351 143
313 3300009098 Ga0105245_10001856 Ga0105245_100018569 143
314 3300009098 Ga0105245_10026871 Ga0105245_100268713 143
315 3300009098 Ga0105245_10354412 Ga0105245_103544121 143
316 3300009098 Ga0105245_10365177 Ga0105245_103651772 143
317 3300009101 Ga0105247_10015372 Ga0105247_100153724 143
318 3300009101 Ga0105247_10100415 Ga0105247_101004151 143
319 3300009174 Ga0105241_10000265 Ga0105241_1000026532 143
320 3300009174 Ga0105241_10002773 Ga0105241_100027739 143
321 3300009174 Ga0105241_10003506 Ga0105241_100035066 143
322 3300009174 Ga0105241_10027355 Ga0105241_100273552 143
323 3300009174 Ga0105241_10050443 Ga0105241_100504434 143
324 3300009174 Ga0105241_10416495 Ga0105241_104164952 143
325 3300009174 Ga0105241_10994579 Ga0105241_109945792 143
326 3300009174 Ga0105241_11241257 Ga0105241_112412572 143
327 3300009177 Ga0105248_10003308 Ga0105248_100033088 143
328 3300009177 Ga0105248_10010912 Ga0105248_100109129 143
329 3300009177 Ga0105248_10115613 Ga0105248_101156133 143
330 3300009177 Ga0105248_10398651 Ga0105248_103986513 143
331 3300009177 Ga0105248_10730943 Ga0105248_107309432 143
332 3300009545 Ga0105237_10009543 Ga0105237_100095433 143
333 3300009545 Ga0105237_10086789 Ga0105237_100867893 143
334 3300009545 Ga0105237_10098112 Ga0105237_100981124 143
335 3300009545 Ga0105237_10239765 Ga0105237_102397651 143
336 3300009545 Ga0105237_10264097 Ga0105237_102640972 143
337 3300009545 Ga0105237_10283365 Ga0105237_102833652 143
338 3300009545 Ga0105237_10490760 Ga0105237_104907601 143
339 3300009545 Ga0105237_10634632 Ga0105237_106346322 143
340 3300009551 Ga0105238_10000338 Ga0105238_1000033827 143
341 3300009551 Ga0105238_10004902 Ga0105238_100049028 143
342 3300009551 Ga0105238_10010228 Ga0105238_100102286 143
343 3300009551 Ga0105238_10010638 Ga0105238_100106386 143
344 3300009551 Ga0105238_10030278 Ga0105238_100302783 143
345 3300009551 Ga0105238_10030933 Ga0105238_100309336 143
346 3300009551 Ga0105238_10044390 Ga0105238_100443903 143
347 3300009551 Ga0105238_10050443 Ga0105238_100504432 143
348 3300009551 Ga0105238_10063776 Ga0105238_100637764 143
349 3300009551 Ga0105238_10087015 Ga0105238_100870153 143
350 3300009551 Ga0105238_10288267 Ga0105238_102882672 143
351 3300009551 Ga0105238_10349520 Ga0105238_103495203 143
352 3300009551 Ga0105238_10634566 Ga0105238_106345662 143
353 3300009551 Ga0105238_11044752 Ga0105238_110447521 143
354 3300009551 Ga0105238_11145933 Ga0105238_111459331 143
355 3300009553 Ga0105249_10056784 Ga0105249_100567844 143
356 3300009553 Ga0105249_10063775 Ga0105249_100637751 143
357 3300009553 Ga0105249_10371438 Ga0105249_103714382 143
358 3300010375 Ga0105239_10002626 Ga0105239_1000262616 143
359 3300010375 Ga0105239_10028844 Ga0105239_100288447 143
360 3300010375 Ga0105239_10058648 Ga0105239_100586483 143
361 3300010375 Ga0105239_10099800 Ga0105239_100998003 143
362 3300010375 Ga0105239_10119210 Ga0105239_101192103 143
363 3300010375 Ga0105239_10149163 Ga0105239_101491633 143
364 3300010375 Ga0105239_10243778 Ga0105239_102437782 143
365 3300010375 Ga0105239_10928312 Ga0105239_109283122 143
366 3300011119 Ga0105246_10002388 Ga0105246_100023885 143
367 3300011119 Ga0105246_10011686 Ga0105246_100116862 143
368 3300013100 Ga0157373_10055052 Ga0157373_100550524 143
369 3300013100 Ga0157373_10189746 Ga0157373_101897462 143
370 3300013100 Ga0157373_10239460 Ga0157373_102394602 143
371 3300013102 Ga0157371_10122087 Ga0157371_101220872 143
372 3300013102 Ga0157371_10649794 Ga0157371_106497942 143
373 3300013104 Ga0157370_10000685 Ga0157370_100006853 143
374 3300013104 Ga0157370_10014019 Ga0157370_100140196 143
375 3300013104 Ga0157370_10019566 Ga0157370_100195665 143
376 3300013104 Ga0157370_10031093 Ga0157370_100310932 143
377 3300013104 Ga0157370_10040413 Ga0157370_100404134 143
378 3300013104 Ga0157370_10103184 Ga0157370_101031844 143
379 3300013104 Ga0157370_10480464 Ga0157370_104804642 143
380 3300013104 Ga0157370_10808379 Ga0157370_108083792 143
381 3300013105 Ga0157369_10000699 Ga0157369_100006993 143
382 3300013105 Ga0157369_10003649 Ga0157369_1000364913 143
383 3300013105 Ga0157369_10004476 Ga0157369_100044769 143
384 3300013105 Ga0157369_10018778 Ga0157369_100187781 143
385 3300013105 Ga0157369_10037519 Ga0157369_100375195 143
386 3300013105 Ga0157369_10041216 Ga0157369_100412164 143
387 3300013105 Ga0157369_10046148 Ga0157369_100461484 143
388 3300013105 Ga0157369_10057696 Ga0157369_100576964 143
389 3300013105 Ga0157369_10122762 Ga0157369_101227624 143
390 3300013105 Ga0157369_10175135 Ga0157369_101751353 143
391 3300013105 Ga0157369_10217831 Ga0157369_102178314 143
392 3300013105 Ga0157369_10218622 Ga0157369_102186222 143
393 3300013105 Ga0157369_10248502 Ga0157369_102485023 143
394 3300013105 Ga0157369_10417235 Ga0157369_104172353 143
395 3300013105 Ga0157369_10549034 Ga0157369_105490342 143
396 3300013105 Ga0157369_11481404 Ga0157369_114814041 143
397 3300013296 Ga0157374_10003668 Ga0157374_100036689 143
398 3300013296 Ga0157374_10005152 Ga0157374_100051528 143
399 3300013296 Ga0157374_10012662 Ga0157374_100126623 143
400 3300013296 Ga0157374_10053216 Ga0157374_100532165 143
401 3300013296 Ga0157374_10064013 Ga0157374_100640133 143
402 3300013296 Ga0157374_10152869 Ga0157374_101528692 143
403 3300013296 Ga0157374_10551649 Ga0157374_105516493 143
404 3300013296 Ga0157374_10789951 Ga0157374_107899512 143
405 3300013296 Ga0157374_11671468 Ga0157374_116714681 143
406 3300013296 Ga0157374_11993245 Ga0157374_119932452 143
407 3300013297 Ga0157378_10003077 Ga0157378_100030773 143
408 3300013297 Ga0157378_10021015 Ga0157378_100210156 143
409 3300013297 Ga0157378_10022074 Ga0157378_100220745 143
410 3300013297 Ga0157378_10022330 Ga0157378_100223306 143
411 3300013297 Ga0157378_10238993 Ga0157378_102389932 143
412 3300013306 Ga0163162_10007199 Ga0163162_100071995 143
413 3300013306 Ga0163162_10025177 Ga0163162_100251774 143
414 3300013306 Ga0163162_10487348 Ga0163162_104873482 143
415 3300013306 Ga0163162_10909387 Ga0163162_109093872 143
416 3300013307 Ga0157372_10003883 Ga0157372_100038833 143
417 3300013307 Ga0157372_10026862 Ga0157372_100268627 143
418 3300013307 Ga0157372_10032337 Ga0157372_100323375 143
419 3300013307 Ga0157372_10112785 Ga0157372_101127853 143
420 3300013307 Ga0157372_10141879 Ga0157372_101418792 143
421 3300013307 Ga0157372_10230156 Ga0157372_102301562 143
422 3300013307 Ga0157372_10249654 Ga0157372_102496542 143
423 3300013307 Ga0157372_10268079 Ga0157372_102680792 143
424 3300013307 Ga0157372_10393626 Ga0157372_103936262 143
425 3300013307 Ga0157372_10477083 Ga0157372_104770832 143
426 3300013307 Ga0157372_10504207 Ga0157372_105042071 143
427 3300013307 Ga0157372_11201835 Ga0157372_112018352 143
428 3300013308 Ga0157375_10013492 Ga0157375_100134922 143
429 3300013308 Ga0157375_10016797 Ga0157375_100167974 143
430 3300013308 Ga0157375_10297394 Ga0157375_102973942 143
431 3300013308 Ga0157375_10961360 Ga0157375_109613602 143
432 3300014325 Ga0163163_10004242 Ga0163163_100042428 143
433 3300014325 Ga0163163_10318921 Ga0163163_103189212 143
434 3300014745 Ga0157377_10037796 Ga0157377_100377963 143
435 3300014968 Ga0157379_10049522 Ga0157379_100495224 143
436 3300014968 Ga0157379_10076244 Ga0157379_100762442 143
437 3300014968 Ga0157379_10110996 Ga0157379_101109963 143
438 3300014968 Ga0157379_10222997 Ga0157379_102229972 143
439 3300014969 Ga0157376_10000803 Ga0157376_1000080310 143
440 3300014969 Ga0157376_10031107 Ga0157376_100311073 143
441 3300014969 Ga0157376_10036467 Ga0157376_100364672 143
442 3300014969 Ga0157376_10052320 Ga0157376_100523203 143
443 3300014969 Ga0157376_10059462 Ga0157376_100594625 143
444 3300014969 Ga0157376_10510007 Ga0157376_105100072 143
445 3300014969 Ga0157376_11391671 Ga0157376_113916711 143
446 3300014969 Ga0157376_11702895 Ga0157376_117028951 143
447 3300014969 Ga0157376_11866536 Ga0157376_118665361 143
448 3300017792 Ga0163161_10015051 Ga0163161_100150515 143
449 3300021361 Ga0213872_10042844 Ga0213872_100428442 143
450 3300025321 Ga0207656_10044622 Ga0207656_100446221 143
451 3300025321 Ga0207656_10053720 Ga0207656_100537203 143
452 3300025321 Ga0207656_10057988 Ga0207656_100579882 143
453 3300025321 Ga0207656_10100013 Ga0207656_101000132 143
454 3300025321 Ga0207656_10114377 Ga0207656_101143771 143
455 3300025321 Ga0207656_10182385 Ga0207656_101823851 143
456 3300025899 Ga0207642_10220476 Ga0207642_102204762 143
457 3300025900 Ga0207710_10005472 Ga0207710_100054723 143
458 3300025900 Ga0207710_10310662 Ga0207710_103106622 143
459 3300025901 Ga0207688_10067264 Ga0207688_100672643 143
460 3300025903 Ga0207680_10050119 Ga0207680_100501193 143
461 3300025904 Ga0207647_10030028 Ga0207647_100300283 143
462 3300025904 Ga0207647_10190870 Ga0207647_101908701 143
463 3300025907 Ga0207645_10059026 Ga0207645_100590263 143
464 3300025909 Ga0207705_10000329 Ga0207705_1000032915 143
465 3300025909 Ga0207705_10013575 Ga0207705_100135753 143
466 3300025909 Ga0207705_10016110 Ga0207705_100161102 143
467 3300025909 Ga0207705_10032962 Ga0207705_100329624 143
468 3300025909 Ga0207705_10087426 Ga0207705_100874262 143
469 3300025909 Ga0207705_10235828 Ga0207705_102358282 143
470 3300025909 Ga0207705_11027771 Ga0207705_110277711 143
471 3300025911 Ga0207654_10002016 Ga0207654_100020168 143
472 3300025911 Ga0207654_10005807 Ga0207654_100058077 143
473 3300025911 Ga0207654_10113015 Ga0207654_101130152 143
474 3300025911 Ga0207654_10139477 Ga0207654_101394773 143
475 3300025911 Ga0207654_10401248 Ga0207654_104012482 143
476 3300025913 Ga0207695_10000001 Ga0207695_100000011058 143
477 3300025913 Ga0207695_10000098 Ga0207695_10000098117 143
478 3300025913 Ga0207695_10000331 Ga0207695_1000033191 143
479 3300025913 Ga0207695_10000823 Ga0207695_1000082335 143
480 3300025913 Ga0207695_10001323 Ga0207695_100013233 143
481 3300025913 Ga0207695_10002473 Ga0207695_1000247310 143
482 3300025913 Ga0207695_10003432 Ga0207695_100034326 143
483 3300025913 Ga0207695_10031120 Ga0207695_100311205 143
484 3300025913 Ga0207695_10037287 Ga0207695_100372875 143
485 3300025913 Ga0207695_10051687 Ga0207695_100516874 143
486 3300025913 Ga0207695_10723352 Ga0207695_107233522 143
487 3300025913 Ga0207695_11246380 Ga0207695_112463801 143
488 3300025914 Ga0207671_10000655 Ga0207671_1000065515 143
489 3300025914 Ga0207671_10001346 Ga0207671_100013466 143
490 3300025914 Ga0207671_10071130 Ga0207671_100711303 143
491 3300025914 Ga0207671_10277182 Ga0207671_102771822 143
492 3300025914 Ga0207671_10664821 Ga0207671_106648212 143
493 3300025914 Ga0207671_11183042 Ga0207671_111830421 143
494 3300025919 Ga0207657_10021566 Ga0207657_100215666 143
495 3300025919 Ga0207657_10079770 Ga0207657_100797704 143
496 3300025919 Ga0207657_10419998 Ga0207657_104199981 143
497 3300025919 Ga0207657_10434674 Ga0207657_104346742 143
498 3300025920 Ga0207649_10002070 Ga0207649_100020707 143
499 3300025920 Ga0207649_10038694 Ga0207649_100386942 143
500 3300025920 Ga0207649_10056860 Ga0207649_100568604 143
501 3300025920 Ga0207649_10548066 Ga0207649_105480662 143
502 3300025921 Ga0207652_10190665 Ga0207652_101906653 143
503 3300025924 Ga0207694_10000105 Ga0207694_1000010573 143
504 3300025924 Ga0207694_10000727 Ga0207694_1000072720 143
505 3300025924 Ga0207694_10004769 Ga0207694_100047695 143
506 3300025924 Ga0207694_10038031 Ga0207694_100380314 143
507 3300025924 Ga0207694_10052016 Ga0207694_100520162 143
508 3300025924 Ga0207694_10114873 Ga0207694_101148732 143
509 3300025924 Ga0207694_10190913 Ga0207694_101909133 143
510 3300025924 Ga0207694_10210018 Ga0207694_102100181 143
511 3300025924 Ga0207694_10247007 Ga0207694_102470071 143
512 3300025924 Ga0207694_10616202 Ga0207694_106162022 143
513 3300025924 Ga0207694_10703596 Ga0207694_107035961 143
514 3300025925 Ga0207650_10006265 Ga0207650_100062657 143
515 3300025927 Ga0207687_10011961 Ga0207687_100119613 143
516 3300025927 Ga0207687_10016887 Ga0207687_100168872 143
517 3300025927 Ga0207687_10037312 Ga0207687_100373122 143
518 3300025928 Ga0207700_10002588 Ga0207700_100025885 143
519 3300025928 Ga0207700_11335452 Ga0207700_113354521 143
520 3300025931 Ga0207644_10010986 Ga0207644_100109862 143
521 3300025931 Ga0207644_10818648 Ga0207644_108186481 143
522 3300025932 Ga0207690_10000778 Ga0207690_1000077815 143
523 3300025932 Ga0207690_10022060 Ga0207690_100220602 143
524 3300025932 Ga0207690_11473966 Ga0207690_114739661 143
525 3300025933 Ga0207706_10015144 Ga0207706_100151444 143
526 3300025940 Ga0207691_10006334 Ga0207691_100063345 143
527 3300025941 Ga0207711_10001943 Ga0207711_100019436 143
528 3300025941 Ga0207711_10151664 Ga0207711_101516642 143
529 3300025941 Ga0207711_10231355 Ga0207711_102313552 143
530 3300025941 Ga0207711_10429853 Ga0207711_104298532 143
531 3300025942 Ga0207689_10000311 Ga0207689_1000031119 143
532 3300025942 Ga0207689_10045853 Ga0207689_100458533 143
533 3300025944 Ga0207661_10016768 Ga0207661_100167684 143
534 3300025944 Ga0207661_10029655 Ga0207661_100296552 143
535 3300025944 Ga0207661_10146793 Ga0207661_101467932 143
536 3300025944 Ga0207661_10322875 Ga0207661_103228752 143
537 3300025944 Ga0207661_11451253 Ga0207661_114512531 143
538 3300025949 Ga0207667_10002382 Ga0207667_100023824 143
539 3300025949 Ga0207667_10004198 Ga0207667_1000419814 143
540 3300025949 Ga0207667_10016687 Ga0207667_100166872 143
541 3300025949 Ga0207667_10022906 Ga0207667_100229066 143
542 3300025949 Ga0207667_10035823 Ga0207667_100358235 143
543 3300025949 Ga0207667_10076964 Ga0207667_100769642 143
544 3300025949 Ga0207667_10105514 Ga0207667_101055144 143
545 3300025949 Ga0207667_10165227 Ga0207667_101652273 143
546 3300025949 Ga0207667_10166247 Ga0207667_101662472 143
547 3300025949 Ga0207667_10212111 Ga0207667_102121112 143
548 3300025949 Ga0207667_10524929 Ga0207667_105249292 143
549 3300025960 Ga0207651_10675647 Ga0207651_106756472 143
550 3300025961 Ga0207712_10030704 Ga0207712_100307043 143
551 3300025961 Ga0207712_10238350 Ga0207712_102383502 143
552 3300025961 Ga0207712_10958470 Ga0207712_109584701 143
553 3300025972 Ga0207668_10463019 Ga0207668_104630192 143
554 3300025981 Ga0207640_10000002 Ga0207640_10000002156 143
555 3300025981 Ga0207640_10125090 Ga0207640_101250902 143
556 3300025981 Ga0207640_10177477 Ga0207640_101774771 143
557 3300025986 Ga0207658_10034137 Ga0207658_100341373 143
558 3300025986 Ga0207658_11046378 Ga0207658_110463781 143
559 3300026023 Ga0207677_10004327 Ga0207677_100043273 143
560 3300026023 Ga0207677_10010143 Ga0207677_100101433 143
561 3300026023 Ga0207677_10193841 Ga0207677_101938411 143
562 3300026035 Ga0207703_10020790 Ga0207703_100207904 143
563 3300026035 Ga0207703_10346469 Ga0207703_103464693 143
564 3300026035 Ga0207703_10368582 Ga0207703_103685821 143
565 3300026041 Ga0207639_10000011 Ga0207639_1000001173 143
566 3300026041 Ga0207639_10008592 Ga0207639_100085923 143
567 3300026041 Ga0207639_10041090 Ga0207639_100410904 143
568 3300026041 Ga0207639_10089034 Ga0207639_100890342 143
569 3300026041 Ga0207639_10106486 Ga0207639_101064861 143
570 3300026041 Ga0207639_10339644 Ga0207639_103396442 143
571 3300026041 Ga0207639_10348409 Ga0207639_103484091 143
572 3300026067 Ga0207678_10015022 Ga0207678_100150225 143
573 3300026067 Ga0207678_10020198 Ga0207678_100201982 143
574 3300026067 Ga0207678_10073882 Ga0207678_100738824 143
575 3300026067 Ga0207678_10137316 Ga0207678_101373163 143
576 3300026067 Ga0207678_10379015 Ga0207678_103790153 143
577 3300026067 Ga0207678_10433328 Ga0207678_104333282 143
578 3300026067 Ga0207678_10445444 Ga0207678_104454441 143
579 3300026067 Ga0207678_10665378 Ga0207678_106653782 143
580 3300026078 Ga0207702_10000984 Ga0207702_100009849 143
581 3300026078 Ga0207702_10023069 Ga0207702_100230692 143
582 3300026078 Ga0207702_10024626 Ga0207702_100246264 143
583 3300026078 Ga0207702_10046034 Ga0207702_100460344 143
584 3300026078 Ga0207702_10310019 Ga0207702_103100192 143
585 3300026078 Ga0207702_10715477 Ga0207702_107154771 143
586 3300026078 Ga0207702_10793783 Ga0207702_107937832 143
587 3300026078 Ga0207702_11703172 Ga0207702_117031722 143
588 3300026088 Ga0207641_10007496 Ga0207641_100074967 143
589 3300026088 Ga0207641_10087653 Ga0207641_100876534 143
590 3300026088 Ga0207641_11877094 Ga0207641_118770942 143
591 3300026095 Ga0207676_10001007 Ga0207676_100010076 143
592 3300026116 Ga0207674_10000855 Ga0207674_1000085515 143
593 3300026116 Ga0207674_10000980 Ga0207674_100009804 143
594 3300026116 Ga0207674_10820184 Ga0207674_108201842 143
595 3300026121 Ga0207683_10000538 Ga0207683_1000053828 143
596 3300026142 Ga0207698_10000274 Ga0207698_1000027427 143
597 3300026142 Ga0207698_10006887 Ga0207698_100068877 143
598 3300026142 Ga0207698_10174806 Ga0207698_101748063 143
599 3300026142 Ga0207698_10205720 Ga0207698_102057203 143
600 3300026142 Ga0207698_10386870 Ga0207698_103868702 143
601 3300026142 Ga0207698_12136499 Ga0207698_121364991 143
602 3300028379 Ga0268266_10002567 Ga0268266_100025679 143
603 3300028379 Ga0268266_10013530 Ga0268266_100135302 143
604 3300028379 Ga0268266_10028613 Ga0268266_100286133 143
605 3300028379 Ga0268266_10038595 Ga0268266_100385952 143
606 3300028379 Ga0268266_10149580 Ga0268266_101495803 143
607 3300028380 Ga0268265_10090122 Ga0268265_100901221 143
608 3300028381 Ga0268264_10002880 Ga0268264_100028809 143
609 3300028653 Ga0265323_10033302 Ga0265323_100333023 143
610 3300028800 Ga0265338_10053262 Ga0265338_100532622 143
611 3300028800 Ga0265338_10128248 Ga0265338_101282482 143
612 3300029957 Ga0265324_10066237 Ga0265324_100662372 143
613 3300029957 Ga0265324_10345234 Ga0265324_103452341 143
614 3300031235 Ga0265330_10013349 Ga0265330_100133495 143
615 3300031235 Ga0265330_10050775 Ga0265330_100507751 143
616 3300031238 Ga0265332_10020744 Ga0265332_100207441 143
617 3300031238 Ga0265332_10437035 Ga0265332_104370351 143
618 3300031239 Ga0265328_10013516 Ga0265328_100135163 143
619 3300031239 Ga0265328_10016020 Ga0265328_100160203 143
620 3300031240 Ga0265320_10029314 Ga0265320_100293141 143
621 3300031241 Ga0265325_10049112 Ga0265325_100491122 143
622 3300031241 Ga0265325_10068856 Ga0265325_100688563 143
623 3300031242 Ga0265329_10049328 Ga0265329_100493283 143
624 3300031242 Ga0265329_10090407 Ga0265329_100904071 143
625 3300031247 Ga0265340_10059546 Ga0265340_100595463 143
626 3300031249 Ga0265339_10001232 Ga0265339_100012327 143
627 3300031249 Ga0265339_10094684 Ga0265339_100946842 143
628 3300031249 Ga0265339_10146940 Ga0265339_101469402 143
629 3300031249 Ga0265339_10183518 Ga0265339_101835181 143
630 3300031250 Ga0265331_10065378 Ga0265331_100653782 143
631 3300031344 Ga0265316_10001589 Ga0265316_1000158910 143
632 3300031344 Ga0265316_10023982 Ga0265316_100239822 143
633 3300031344 Ga0265316_10030629 Ga0265316_100306293 143
634 3300031344 Ga0265316_10375836 Ga0265316_103758362 143
635 3300031595 Ga0265313_10000889 Ga0265313_1000088924 143
636 3300031595 Ga0265313_10033410 Ga0265313_100334103 143
637 3300031711 Ga0265314_10000047 Ga0265314_100000472 143
638 3300031711 Ga0265314_10030156 Ga0265314_100301563 143
639 3300031711 Ga0265314_10151026 Ga0265314_101510261 143
640 3300031711 Ga0265314_10552543 Ga0265314_105525431 143
641 3300031712 Ga0265342_10073805 Ga0265342_100738053 143
642 3300031712 Ga0265342_10078741 Ga0265342_100787411 143
643 3300031712 Ga0265342_10123968 Ga0265342_101239682 143
644 3300031712 Ga0265342_10661937 Ga0265342_106619371 143
645 3300033180 Ga0307510_10545474 Ga0307510_105454742 143
646 3300035171 Ga0373946_0268876 Ga0373946_0268876_20_475 143
647 3300035692 Ga0373935_0655080 Ga0373935_0655080_295_750 143
648 3300035724 Ga0373933_0287150 Ga0373933_0287150_165_620 143
649 3300036401 Ga0373937_1799380 Ga0373937_1799380_25_480 143
650 3300037068 Ga0373925_0487716 Ga0373925_0487716_397_828 143
651 3300037418 Ga0395900_1478532 Ga0395900_1478532_59_499 143
652 3300039438 Ga0436360_0610332 Ga0436360_0610332_4265_4699 143
653 3300039447 Ga0436361_0337765 Ga0436361_0337765_846_1280 143
654 3300044684 Ga0466966_0047123 Ga0466966_0047123_120_560 143
655 3300044693 Ga0466961_0389735 Ga0466961_0389735_75_530 143
656 3300044694 Ga0466963_0971671 Ga0466963_0971671_38_493 143
657 3300044765 Ga0466970_0570819 Ga0466970_0570819_43_498 143
658 3300045976 Ga0466967_0004403 Ga0466967_0004403_8802_9257 143
659 3300045976 Ga0466967_0102326 Ga0466967_0102326_535_975 143
660 3300046455 Ga0495603_0009966 Ga0495603_0009966_495_935 143
661 3300046457 Ga0495590_0248597 Ga0495590_0248597_35_469 143
662 3300046459 Ga0495629_0013052 Ga0495629_0013052_4868_5323 143
663 3300046459 Ga0495629_0111918 Ga0495629_0111918_941_1396 143
664 3300046462 Ga0495651_0057334 Ga0495651_0057334_577_1026 143
665 3300046462 Ga0495651_0268372 Ga0495651_0268372_30_485 143
666 3300046463 Ga0495653_0112746 Ga0495653_0112746_1076_1525 143
667 3300046471 Ga0495650_0000038 Ga0495650_0000038_330863_331309 143
668 3300046471 Ga0495650_0010097 Ga0495650_0010097_4331_4762 143
669 3300046472 Ga0495580_0068034 Ga0495580_0068034_1383_1838 143
670 3300046472 Ga0495580_0104933 Ga0495580_0104933_718_1173 143
671 3300046472 Ga0495580_0262810 Ga0495580_0262810_585_1025 143
672 3300046473 Ga0495582_0001708 Ga0495582_0001708_8058_8507 143
673 3300046473 Ga0495582_0064541 Ga0495582_0064541_268_723 143
674 3300046473 Ga0495582_0155597 Ga0495582_0155597_20_475 143
675 3300046474 Ga0495605_0048804 Ga0495605_0048804_1452_1892 143
676 3300046475 Ga0495639_0039244 Ga0495639_0039244_660_1109 143
677 3300046476 Ga0495662_0010153 Ga0495662_0010153_3590_4039 143
678 3300046476 Ga0495662_0420243 Ga0495662_0420243_20_475 143
679 3300046477 Ga0495664_0196812 Ga0495664_0196812_414_863 143
680 3300046477 Ga0495664_0336460 Ga0495664_0336460_137_592 143
681 3300046499 Ga0495594_0025826 Ga0495594_0025826_1987_2427 143
682 3300046500 Ga0495596_0098481 Ga0495596_0098481_640_1080 143
683 3300046506 Ga0495583_0052919 Ga0495583_0052919_292_723 143
684 3300046507 Ga0495606_0093447 Ga0495606_0093447_650_1099 143
685 3300046514 Ga0495618_0160179 Ga0495618_0160179_47_502 143
686 3300046516 Ga0495628_0563609 Ga0495628_0563609_216_671 143
687 3300046517 Ga0495630_0871451 Ga0495630_0871451_177_632 143
688 3300046517 Ga0495630_1055222 Ga0495630_1055222_42_473 143
689 3300046518 Ga0495631_0163961 Ga0495631_0163961_459_899 143
690 3300046519 Ga0495632_0316393 Ga0495632_0316393_236_667 143
691 3300046522 Ga0495643_0058683 Ga0495643_0058683_694_1128 143
692 3300046523 Ga0495644_0000075 Ga0495644_0000075_25180_25620 143
693 3300046524 Ga0495648_0164735 Ga0495648_0164735_349_789 143
694 3300046524 Ga0495648_0386790 Ga0495648_0386790_43_474 143
695 3300046528 Ga0495642_0190129 Ga0495642_0190129_50_505 143
696 3300046528 Ga0495642_0223351 Ga0495642_0223351_176_625 143
697 3300046529 Ga0495652_0030912 Ga0495652_0030912_102_551 143
698 3300046529 Ga0495652_0118940 Ga0495652_0118940_312_767 143
699 3300046529 Ga0495652_0233087 Ga0495652_0233087_823_1254 143
700 3300046531 Ga0495665_0000961 Ga0495665_0000961_4049_4498 143
701 3300046531 Ga0495665_0101587 Ga0495665_0101587_395_829 143
702 3300046531 Ga0495665_0148396 Ga0495665_0148396_550_1005 143
703 3300046531 Ga0495665_0214842 Ga0495665_0214842_330_785 143
704 3300046533 Ga0495640_0114801 Ga0495640_0114801_1150_1599 143
705 3300046533 Ga0495640_0162704 Ga0495640_0162704_808_1263 143
706 3300046533 Ga0495640_0764773 Ga0495640_0764773_17_448 143
707 3300046536 Ga0495587_0012311 Ga0495587_0012311_3833_4282 143
708 3300046536 Ga0495587_0097917 Ga0495587_0097917_68_523 143
709 3300046536 Ga0495587_0545854 Ga0495587_0545854_97_552 143
710 3300046538 Ga0495609_0010193 Ga0495609_0010193_2644_3093 143
711 3300046538 Ga0495609_0053100 Ga0495609_0053100_1064_1504 143
712 3300046543 Ga0495645_0019830 Ga0495645_0019830_2283_2738 143
713 3300046543 Ga0495645_0377211 Ga0495645_0377211_432_887 143
714 3300046543 Ga0495645_0551181 Ga0495645_0551181_193_624 143
715 3300046559 Ga0495667_0004747 Ga0495667_0004747_6397_6846 143
716 3300046642 Ga0495634_0014390 Ga0495634_0014390_2574_3023 143
717 3300046660 Ga0495625_0011712 Ga0495625_0011712_3949_4392 143
718 3300046660 Ga0495625_0018413 Ga0495625_0018413_251_691 143
719 3300046660 Ga0495625_0024754 Ga0495625_0024754_881_1312 143
720 3300046660 Ga0495625_0513842 Ga0495625_0513842_189_620 143
721 3300046663 Ga0495635_0103802 Ga0495635_0103802_838_1287 143
722 3300046663 Ga0495635_0126339 Ga0495635_0126339_295_750 143
723 3300046663 Ga0495635_0377141 Ga0495635_0377141_422_853 143
724 3300046679 Ga0495623_0035344 Ga0495623_0035344_2691_3140 143
725 3300046679 Ga0495623_0052952 Ga0495623_0052952_1228_1683 143
726 3300046680 Ga0495646_0020802 Ga0495646_0020802_1757_2206 143
727 3300046681 Ga0495647_0148756 Ga0495647_0148756_128_583 143
728 3300046683 Ga0495658_0390538 Ga0495658_0390538_241_696 143
729 3300046684 Ga0495669_0028767 Ga0495669_0028767_1663_2118 143
730 3300046684 Ga0495669_0375330 Ga0495669_0375330_19_450 143
731 3300046689 Ga0495613_0020679 Ga0495613_0020679_3469_3918 143
732 3300046689 Ga0495613_0212728 Ga0495613_0212728_782_1237 143
733 3300046689 Ga0495613_0368034 Ga0495613_0368034_487_942 143
734 3300046691 Ga0495670_0069173 Ga0495670_0069173_1268_1708 143
735 3300046694 Ga0495649_0013111 Ga0495649_0013111_340_774 143
736 3300046694 Ga0495649_0241179 Ga0495649_0241179_282_716 143
737 3300046809 Ga0495600_0002839 Ga0495600_0002839_6234_6683 143
738 3300046809 Ga0495600_0099600 Ga0495600_0099600_582_1037 143
739 3300047315 Ga0495581_0047580 Ga0495581_0047580_1615_2064 143
740 3300047315 Ga0495581_0052854 Ga0495581_0052854_1123_1578 143
741 3300047317 Ga0495604_0017720 Ga0495604_0017720_3763_4212 143
742 3300047317 Ga0495604_0042851 Ga0495604_0042851_180_611 143
743 3300047319 Ga0495674_0244802 Ga0495674_0244802_957_1412 143
744 3300047319 Ga0495674_0307893 Ga0495674_0307893_163_594 143
745 3300047319 Ga0495674_0598427 Ga0495674_0598427_384_818 143
746 3300047321 Ga0495676_0001072 Ga0495676_0001072_9564_10013 143
747 3300047443 Ga0495687_064633 Ga0495687_064633_150_584 143
748 3300047445 Ga0495677_0110072 Ga0495677_0110072_151_600 143
749 3300047447 Ga0495685_106174 Ga0495685_106174_414_854 143
750 3300047471 Ga0495684_0680074 Ga0495684_0680074_67_522 143
751 3300047472 Ga0495686_0002264 Ga0495686_0002264_13593_14039 143
752 3300047673 Ga0495593_0032650 Ga0495593_0032650_897_1346 143
753 3300048088 Ga0495602_0491431 Ga0495602_0491431_72_527 143
754 3300048088 Ga0495602_0834098 Ga0495602_0834098_129_584 143
755 3300048089 Ga0495614_0025368 Ga0495614_0025368_2006_2455 143
756 3300048905 Ga0496102_0378084 Ga0496102_0378084_764_1219 143
757 3300048907 Ga0496104_0023290 Ga0496104_0023290_97_552 143
758 3300048907 Ga0496104_0627734 Ga0496104_0627734_41_496 143
759 3300048908 Ga0496105_0028399 Ga0496105_0028399_3041_3496 143
760 3300048908 Ga0496105_0197739 Ga0496105_0197739_965_1420 143
761 3300048908 Ga0496105_0246083 Ga0496105_0246083_1007_1438 143
762 3300048909 Ga0496106_0441674 Ga0496106_0441674_216_671 143
763 3300048910 Ga0496107_0452449 Ga0496107_0452449_256_711 143
764 3300048915 Ga0496112_0437099 Ga0496112_0437099_762_1217 143
765 3300048916 Ga0496113_0611012 Ga0496113_0611012_376_831 143
766 3300048917 Ga0496114_0204386 Ga0496114_0204386_387_842 143
767 3300048917 Ga0496114_0353777 Ga0496114_0353777_170_601 143
768 3300048918 Ga0496115_0109286 Ga0496115_0109286_1636_2091 143
769 3300048918 Ga0496115_0112272 Ga0496115_0112272_619_1074 143
770 3300048918 Ga0496115_0180452 Ga0496115_0180452_447_902 143
771 3300048918 Ga0496115_0714590 Ga0496115_0714590_179_634 143
772 3300048918 Ga0496115_0758318 Ga0496115_0758318_244_675 143
773 3300048918 Ga0496115_1349943 Ga0496115_1349943_84_515 143
774 3300048929 Ga0496126_0000029 Ga0496126_0000029_24989_25426 143
775 3300048929 Ga0496126_0015123 Ga0496126_0015123_4014_4445 143
776 3300048929 Ga0496126_0339958 Ga0496126_0339958_629_1060 143
777 3300049460 Ga0495682_0008913 Ga0495682_0008913_994_1425 143
778 3300049460 Ga0495682_0160113 Ga0495682_0160113_258_701 143
779 3300049569 Ga0501032_0022789 Ga0501032_0022789_1922_2353 143
780 3300049569 Ga0501032_0052909 Ga0501032_0052909_1817_2248 143
781 3300049570 Ga0501033_0132566 Ga0501033_0132566_649_1080 143
782 3300049570 Ga0501033_0626495 Ga0501033_0626495_28_459 143
783 3300049571 Ga0501034_0077473 Ga0501034_0077473_1859_2290 143
784 3300049572 Ga0501036_0003869 Ga0501036_0003869_11490_11921 143
785 3300049573 Ga0501037_0082324 Ga0501037_0082324_1204_1635 143
786 3300049573 Ga0501037_0172500 Ga0501037_0172500_42_473 143
787 3300049574 Ga0501038_0032815 Ga0501038_0032815_2440_2871 143
788 3300049574 Ga0501038_0163971 Ga0501038_0163971_1348_1779 143
789 3300049579 Ga0501043_0006418 Ga0501043_0006418_1774_2205 143
790 3300049581 Ga0501047_0005103 Ga0501047_0005103_10308_10739 143
791 3300049586 Ga0501070_0106465 Ga0501070_0106465_878_1309 143
792 3300049589 Ga0501073_0182751 Ga0501073_0182751_62_493 143
793 3300049589 Ga0501073_1104112 Ga0501073_1104112_67_498 143
794 3300049742 Ga0501080_0068317 Ga0501080_0068317_881_1312 143
795 3300049743 Ga0501081_0886332 Ga0501081_0886332_42_473 143
796 3300049822 Ga0501035_0161724 Ga0501035_0161724_1403_1834 143
797 3300049822 Ga0501035_0272362 Ga0501035_0272362_405_836 143
798 3300049823 Ga0501044_0041402 Ga0501044_0041402_3504_3935 143
799 3300049823 Ga0501044_0158418 Ga0501044_0158418_106_537 143
800 3300053077 Ga0495601_0550310 Ga0495601_0550310_220_675 143
801 3300053119 Ga0500595_000004 Ga0500595_000004_84425_84862 143
802 3300053119 Ga0500595_105138 Ga0500595_105138_212_643 143
803 3300053119 Ga0500595_206394 Ga0500595_206394_34_465 143
804 3300054114 Ga0501084_0199585 Ga0501084_0199585_70_501 143
805 3300055283 Ga0500661_002075 Ga0500661_002075_140_583 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

36

126

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v6x-assembly2.cif.gz_B crystal structure of the trna binding domain of pyrrolysyl-trna synthetase mutant (32a ntd) bound to trna(pyl) 0.856 31 57
5ud5-assembly2.cif.gz_B crystal structure of the trna binding domain of pyrrolysyl-trna synthetase bound to trna(pyl) 0.8467 31 57
5tum-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(56) 0.8454 30 56
5tum-assembly2.cif.gz_B crystal structure of tetracycline destructase tet(56) 0.8433 30 57
5tul-assembly1.cif.gz_A crystal structure of tetracycline destructase tet(55) 0.8264 30 57
ID Description Score Start End Superfamily
af_C7J3I8_1_244_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8257 30 57 2.130.10.10
3luuA00 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8084 25 133 3.30.2020.30
af_Q9HBG6_233_372_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8001 33 57 2.130.10.10
af_Q07468_253_583_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.7902 31 57 1.25.40.10
3luuA00 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.7749 25 133 3.30.2020.30
ID Description Score Start End GO Terms
AF-A0A2P6WEE0-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.9279 27 140 GO:0046872
AF-A0A4Q1S9B9-F1-model_v4 DUF971 domain-containing protein 0.9084 1 143 GO:0046872
AF-A0A2V9QN49-F1-model_v4 DUF971 domain-containing protein 0.9041 28 142 GO:0046872
AF-A0A2V9N5C0-F1-model_v4 DUF971 domain-containing protein 0.9032 24 142 GO:0046872
AF-A0A2V9QZL6-F1-model_v4 DUF971 domain-containing protein 0.9018 26 142 GO:0046872

Feature Viewer

pLDDT pTM Quality
82.56 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map