F481584

General Info

Members Datasets Scaffolds Average Seq Length
805 319 805 115

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101261010|Ga0068869_1012610102
Length 128
Sequence MTTRKKGAMAKKDAAGRPPRMKIKKGDHVVVISGRDAGREGTVILADPERQRVLVQGVNMVHKNKKVDYQGRGAGGSKQGGIINTEALIHVSNVQLIDPDTKKPARAGYRYDENGAKIRVSRPGGKDF

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
138 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
163 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031614 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
166 3300031666 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
167 3300031678 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
168 3300031686 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
169 3300031690 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
176 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
177 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
178 3300033548 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 Metagenome Unclassified
179 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
182 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
183 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
184 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
202 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
215 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
216 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
227 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
228 3300041508 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT Metatranscriptome Unclassified
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
277 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.96
Metatranscriptomes 14.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.98
Rhizosphere 90.81
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10087617 3300004799 Bacteria 1342
2 Ga0058861_10050561 3300004800 Bacteria 2533
3 Ga0058861_10187278 3300004800 Bacteria 1075
4 Ga0058862_10129161 3300004803 Bacteria 996
5 Ga0058862_12484301 3300004803 Bacteria 914
6 Ga0070658_10088897 3300005327 Bacteria 2543
7 Ga0070683_100186457 3300005329 Bacteria 1969
8 Ga0070683_100245669 3300005329 Bacteria 1702
9 Ga0070683_101336258 3300005329 Bacteria 689
10 Ga0068869_101261010 3300005334 Bacteria 651
11 Ga0070680_100067854 3300005336 Bacteria 2926
12 Ga0070680_100472511 3300005336 Bacteria 1072
13 Ga0070680_100920382 3300005336 Bacteria 754
14 Ga0070682_100048057 3300005337 Bacteria 2655
15 Ga0070682_100075432 3300005337 Bacteria 2168
16 Ga0070660_100362640 3300005339 Bacteria 1194
17 Ga0070691_10743503 3300005341 Bacteria 592
18 Ga0070661_100201326 3300005344 Bacteria 1522
19 Ga0070671_100252590 3300005355 Bacteria 1498
20 Ga0070709_10000382 3300005434 Bacteria 27333
21 Ga0070709_10020576 3300005434 Bacteria 3830
22 Ga0070709_10173185 3300005434 Bacteria 1510
23 Ga0070709_10879235 3300005434 Bacteria 707
24 Ga0070714_100001124 3300005435 Bacteria 19227
25 Ga0070714_100003109 3300005435 Bacteria 12330
26 Ga0070714_100005961 3300005435 Bacteria 9359
27 Ga0070714_100067826 3300005435 Bacteria 3077
28 Ga0070714_100111149 3300005435 Bacteria 2426
29 Ga0070714_100239174 3300005435 Bacteria 1675
30 Ga0070714_100389436 3300005435 Bacteria 1315
31 Ga0070714_101572057 3300005435 Bacteria 642
32 Ga0070713_100001233 3300005436 Bacteria 16350
33 Ga0070713_100030847 3300005436 Bacteria 4264
34 Ga0070713_100092635 3300005436 Bacteria 2602
35 Ga0070713_100223624 3300005436 Bacteria 1708
36 Ga0070713_100227446 3300005436 Bacteria 1694
37 Ga0070713_100377852 3300005436 Bacteria 1319
38 Ga0070713_100400705 3300005436 Bacteria 1281
39 Ga0070713_101079577 3300005436 Bacteria 775
40 Ga0070713_101538726 3300005436 Bacteria 645
41 Ga0070713_101732303 3300005436 Bacteria 606
42 Ga0070710_10000437 3300005437 Bacteria 19522
43 Ga0070710_10009084 3300005437 Bacteria 4859
44 Ga0070710_10019019 3300005437 Bacteria 3544
45 Ga0070710_10038529 3300005437 Bacteria 2626
46 Ga0070710_10249275 3300005437 Bacteria 1141
47 Ga0070710_10512930 3300005437 Bacteria 822
48 Ga0070710_11115486 3300005437 Bacteria 580
49 Ga0070711_100017511 3300005439 Bacteria 4563
50 Ga0070711_100045638 3300005439 Bacteria 2982
51 Ga0070711_100102272 3300005439 Bacteria 2087
52 Ga0070711_100527905 3300005439 Bacteria 976
53 Ga0070705_100112618 3300005440 Bacteria 1741
54 Ga0070708_100073925 3300005445 Bacteria 3073
55 Ga0070708_100101804 3300005445 Bacteria 2631
56 Ga0070708_100111554 3300005445 Bacteria 2514
57 Ga0070708_100467745 3300005445 Bacteria 1189
58 Ga0070708_100481855 3300005445 Bacteria 1170
59 Ga0070708_100702517 3300005445 Bacteria 952
60 Ga0070708_102237466 3300005445 Bacteria 505
61 Ga0070663_100145197 3300005455 Bacteria 1815
62 Ga0070663_100190100 3300005455 Bacteria 1597
63 Ga0070663_100722200 3300005455 Bacteria 848
64 Ga0070678_100338566 3300005456 Bacteria 1290
65 Ga0070681_10567682 3300005458 Bacteria 1048
66 Ga0070706_100001216 3300005467 Bacteria 27559
67 Ga0070706_100003720 3300005467 Bacteria 14916
68 Ga0070706_100041850 3300005467 Bacteria 4231
69 Ga0070706_100094440 3300005467 Bacteria 2775
70 Ga0070706_100105887 3300005467 Bacteria 2617
71 Ga0070706_100178715 3300005467 Bacteria 1981
72 Ga0070706_100257139 3300005467 Bacteria 1630
73 Ga0070706_100268164 3300005467 Bacteria 1593
74 Ga0070706_100953912 3300005467 Bacteria 791
75 Ga0070706_101884222 3300005467 Bacteria 543
76 Ga0070707_100011795 3300005468 Bacteria 8160
77 Ga0070707_100098495 3300005468 Bacteria 2832
78 Ga0070707_100197595 3300005468 Bacteria 1961
79 Ga0070707_100260221 3300005468 Bacteria 1688
80 Ga0070707_100332689 3300005468 Bacteria 1476
81 Ga0070707_101759611 3300005468 Bacteria 587
82 Ga0070698_100001882 3300005471 Bacteria 23378
83 Ga0070698_100007360 3300005471 Bacteria 11918
84 Ga0070698_100009167 3300005471 Bacteria 10622
85 Ga0070698_100018293 3300005471 Bacteria 7379
86 Ga0070698_100034346 3300005471 Bacteria 5249
87 Ga0070698_100065182 3300005471 Bacteria 3668
88 Ga0070698_100084017 3300005471 Bacteria 3173
89 Ga0070698_100099685 3300005471 Bacteria 2878
90 Ga0070698_100163572 3300005471 Bacteria 2168
91 Ga0070698_100177424 3300005471 Bacteria 2069
92 Ga0070698_100521425 3300005471 Bacteria 1127
93 Ga0070699_100169232 3300005518 Bacteria 1936
94 Ga0070679_101090515 3300005530 Bacteria 743
95 Ga0070679_101351359 3300005530 Bacteria 658
96 Ga0070684_100108391 3300005535 Bacteria 2488
97 Ga0070697_100066801 3300005536 Bacteria 2940
98 Ga0070697_100763184 3300005536 Bacteria 855
99 Ga0070697_101165370 3300005536 Bacteria 686
100 Ga0070697_101942639 3300005536 Bacteria 527
101 Ga0070697_102109545 3300005536 Bacteria 505
102 Ga0068853_100493092 3300005539 Bacteria 1156
103 Ga0070695_101599897 3300005545 Bacteria 544
104 Ga0070696_100084890 3300005546 Bacteria 2247
105 Ga0070696_101124184 3300005546 Bacteria 661
106 Ga0070704_100654605 3300005549 Bacteria 928
107 Ga0068855_101155889 3300005563 Bacteria 807
108 Ga0068855_102077002 3300005563 Bacteria 573
109 Ga0070664_102074122 3300005564 Bacteria 540
110 Ga0068857_100611783 3300005577 Bacteria 1030
111 Ga0068854_101621514 3300005578 Bacteria 590
112 Ga0068856_100014944 3300005614 Bacteria 7496
113 Ga0068856_100144813 3300005614 Bacteria 2383
114 Ga0068856_100256540 3300005614 Bacteria 1763
115 Ga0068864_100232132 3300005618 Bacteria 1707
116 Ga0068863_100407865 3300005841 Bacteria 1330
117 Ga0068858_100485400 3300005842 Bacteria 1193
118 Ga0068858_101272031 3300005842 Bacteria 724
119 Ga0068860_102180995 3300005843 Bacteria 575
120 Ga0081455_10251481 3300005937 Bacteria 1292
121 Ga0081540_1002039 3300005983 Bacteria 16850
122 Ga0070717_10010919 3300006028 Bacteria 6876
123 Ga0070717_10030218 3300006028 Bacteria 4353
124 Ga0070717_10035630 3300006028 Bacteria 4030
125 Ga0070717_10178591 3300006028 Bacteria 1849
126 Ga0070717_10205554 3300006028 Bacteria 1726
127 Ga0070717_10213398 3300006028 Bacteria 1695
128 Ga0070717_10310893 3300006028 Bacteria 1402
129 Ga0070717_10323495 3300006028 Bacteria 1374
130 Ga0070717_10567360 3300006028 Bacteria 1028
131 Ga0070717_10961811 3300006028 Bacteria 778
132 Ga0070717_11067551 3300006028 Bacteria 735
133 Ga0070717_11150319 3300006028 Bacteria 706
134 Ga0070717_11335078 3300006028 Bacteria 652
135 Ga0070717_11469512 3300006028 Bacteria 618
136 Ga0070715_10001006 3300006163 Bacteria 7922
137 Ga0070715_10053222 3300006163 Bacteria 1749
138 Ga0070716_100000511 3300006173 Bacteria 16168
139 Ga0070716_100003131 3300006173 Bacteria 7731
140 Ga0070716_100079914 3300006173 Bacteria 1948
141 Ga0070716_100185330 3300006173 Bacteria 1370
142 Ga0070716_100477791 3300006173 Bacteria 914
143 Ga0070716_100679952 3300006173 Bacteria 784
144 Ga0070716_101316365 3300006173 Bacteria 584
145 Ga0070712_100001287 3300006175 Bacteria 15146
146 Ga0070712_100389699 3300006175 Bacteria 1148
147 Ga0070712_100422846 3300006175 Bacteria 1104
148 Ga0070712_100570172 3300006175 Bacteria 955
149 Ga0068871_100107345 3300006358 Bacteria 2345
150 Ga0075428_100107848 3300006844 Bacteria 3035
151 Ga0075431_101399628 3300006847 Bacteria 659
152 Ga0075433_10004127 3300006852 Bacteria 11262
153 Ga0075433_10015253 3300006852 Bacteria 6298
154 Ga0075434_100016693 3300006871 Bacteria 7062
155 Ga0075434_100041293 3300006871 Bacteria 4570
156 Ga0075434_100609782 3300006871 Bacteria 1110
157 Ga0075434_101203518 3300006871 Bacteria 770
158 Ga0075436_100020129 3300006914 Bacteria 4580
159 Ga0075436_100072403 3300006914 Bacteria 2384
160 Ga0075436_100275799 3300006914 Bacteria 1201
161 Ga0075435_100016080 3300007076 Bacteria 5636
162 Ga0075435_100081437 3300007076 Bacteria 2659
163 Ga0075435_100161520 3300007076 Bacteria 1887
164 Ga0075435_100357826 3300007076 Bacteria 1252
165 Ga0075435_100829136 3300007076 Bacteria 806
166 Ga0099794_10015745 3300007265 Bacteria 3343
167 Ga0099794_10751760 3300007265 Bacteria 521
168 Ga0099794_10753436 3300007265 Bacteria 520
169 Ga0105240_10326462 3300009093 Bacteria 1747
170 Ga0111539_10276546 3300009094 Bacteria 1954
171 Ga0105245_10117718 3300009098 Bacteria 2478
172 Ga0105245_13118014 3300009098 Bacteria 514
173 Ga0105247_10360370 3300009101 Bacteria 1025
174 Ga0114129_10025444 3300009147 Bacteria 8387
175 Ga0114129_12113893 3300009147 Bacteria 679
176 Ga0105241_11291982 3300009174 Bacteria 694
177 Ga0105241_11402457 3300009174 Bacteria 669
178 Ga0105237_10207460 3300009545 Bacteria 1960
179 Ga0105239_10213868 3300010375 Bacteria 2161
180 Ga0105239_10907364 3300010375 Bacteria 1011
181 Ga0105239_12860447 3300010375 Bacteria 563
182 Ga0105246_10611449 3300011119 Bacteria 943
183 Ga0157371_10176020 3300013102 Bacteria 1530
184 Ga0157370_10036228 3300013104 Bacteria 4789
185 Ga0157370_10693410 3300013104 Bacteria 930
186 Ga0157370_12017761 3300013104 Bacteria 517
187 Ga0157369_10224100 3300013105 Bacteria 1967
188 Ga0157369_10343337 3300013105 Bacteria 1551
189 Ga0157369_10503476 3300013105 Bacteria 1253
190 Ga0157378_10473139 3300013297 Bacteria 1247
191 Ga0163162_10333055 3300013306 Bacteria 1650
192 Ga0157372_10874280 3300013307 Bacteria 1043
193 Ga0157372_12905783 3300013307 Bacteria 549
194 Ga0157372_12972637 3300013307 Bacteria 542
195 Ga0157379_11510309 3300014968 Bacteria 654
196 Ga0157376_10296265 3300014969 Bacteria 1529
197 Ga0184602_110879 3300019161 Bacteria 502
198 Ga0184598_105504 3300019182 Bacteria 587
199 Ga0184601_132300 3300019183 Bacteria 711
200 Ga0184599_144470 3300019188 Bacteria 1148
201 Ga0184599_148056 3300019188 Bacteria 653
202 Ga0184600_101748 3300019190 Bacteria 1242
203 Ga0184600_125102 3300019190 Bacteria 1304
204 Ga0184600_131170 3300019190 Bacteria 1574
205 Ga0184603_142199 3300019192 Bacteria 1801
206 Ga0197907_10140557 3300020069 Bacteria 1000
207 Ga0197907_10560617 3300020069 Bacteria 1171
208 Ga0197907_11410793 3300020069 Bacteria 8364
209 Ga0206356_10113528 3300020070 Bacteria 679
210 Ga0206356_10231414 3300020070 Bacteria 1218
211 Ga0206356_10627949 3300020070 Bacteria 3194
212 Ga0206356_11122293 3300020070 Bacteria 3054
213 Ga0206349_1085727 3300020075 Bacteria 576
214 Ga0206349_1093562 3300020075 Bacteria 676
215 Ga0206355_1081850 3300020076 Bacteria 2382
216 Ga0206355_1146852 3300020076 Bacteria 925
217 Ga0206355_1475090 3300020076 Bacteria 602
218 Ga0206351_10172658 3300020077 Bacteria 1372
219 Ga0206351_10189769 3300020077 Bacteria 1516
220 Ga0206351_10935693 3300020077 Bacteria 718
221 Ga0206351_10966915 3300020077 Bacteria 1786
222 Ga0206352_10550210 3300020078 Bacteria 591
223 Ga0206352_10797554 3300020078 Bacteria 854
224 Ga0206352_11071090 3300020078 Bacteria 3529
225 Ga0206352_11237361 3300020078 Bacteria 1190
226 Ga0206350_10457115 3300020080 Bacteria 2167
227 Ga0206350_10589439 3300020080 Bacteria 1842
228 Ga0206350_11271940 3300020080 Bacteria 892
229 Ga0206350_11664796 3300020080 Bacteria 2420
230 Ga0206354_10227392 3300020081 Bacteria 1915
231 Ga0206354_10316033 3300020081 Bacteria 821
232 Ga0206354_10439839 3300020081 Bacteria 1302
233 Ga0206354_11478351 3300020081 Bacteria 776
234 Ga0206353_10178129 3300020082 Bacteria 2228
235 Ga0206353_10181719 3300020082 Bacteria 1991
236 Ga0206353_10565899 3300020082 Bacteria 724
237 Ga0206353_10902912 3300020082 Bacteria 1664
238 Ga0154015_1067250 3300020610 Bacteria 2032
239 Ga0154015_1474683 3300020610 Bacteria 1347
240 Ga0154015_1525166 3300020610 Bacteria 685
241 Ga0213873_10130699 3300021358 Bacteria 743
242 Ga0213874_10042088 3300021377 Bacteria 1371
243 Ga0213874_10079706 3300021377 Bacteria 1059
244 Ga0213875_10022186 3300021388 Bacteria 3037
245 Ga0213875_10027897 3300021388 Bacteria 2685
246 Ga0213875_10036259 3300021388 Bacteria 2326
247 Ga0213875_10078941 3300021388 Bacteria 1535
248 Ga0224712_10042950 3300022467 Bacteria 1716
249 Ga0224712_10193364 3300022467 Bacteria 922
250 Ga0224712_10210464 3300022467 Bacteria 887
251 Ga0247550_102792 3300023660 Bacteria 609
252 Ga0247553_111181 3300023672 Bacteria 522
253 Ga0224572_1110363 3300024225 Bacteria 509
254 Ga0228598_1043014 3300024227 Bacteria 893
255 Ga0207692_10001130 3300025898 Bacteria 9809
256 Ga0207692_10006028 3300025898 Bacteria 4900
257 Ga0207692_10007166 3300025898 Bacteria 4556
258 Ga0207692_10009470 3300025898 Bacteria 4071
259 Ga0207692_10219244 3300025898 Bacteria 1127
260 Ga0207647_10100984 3300025904 Bacteria 1712
261 Ga0207685_10001544 3300025905 Bacteria 4888
262 Ga0207685_10008831 3300025905 Bacteria 2895
263 Ga0207685_10217527 3300025905 Bacteria 906
264 Ga0207699_10000260 3300025906 Bacteria 29008
265 Ga0207699_10001977 3300025906 Bacteria 9676
266 Ga0207699_10007633 3300025906 Bacteria 5295
267 Ga0207699_10008993 3300025906 Bacteria 4952
268 Ga0207699_10184010 3300025906 Bacteria 1406
269 Ga0207705_10158625 3300025909 Bacteria 1698
270 Ga0207684_10002031 3300025910 Bacteria 20859
271 Ga0207684_10002505 3300025910 Bacteria 18476
272 Ga0207684_10016512 3300025910 Bacteria 6339
273 Ga0207684_10027808 3300025910 Bacteria 4817
274 Ga0207684_10034449 3300025910 Bacteria 4302
275 Ga0207684_10034994 3300025910 Bacteria 4265
276 Ga0207684_10392457 3300025910 Bacteria 1193
277 Ga0207684_10490615 3300025910 Bacteria 1053
278 Ga0207684_10928131 3300025910 Bacteria 731
279 Ga0207684_11311350 3300025910 Bacteria 596
280 Ga0207654_10745871 3300025911 Bacteria 705
281 Ga0207707_10008073 3300025912 Bacteria 9140
282 Ga0207671_10451396 3300025914 Bacteria 1024
283 Ga0207693_10002650 3300025915 Bacteria 15546
284 Ga0207693_10004081 3300025915 Bacteria 12404
285 Ga0207693_10031891 3300025915 Bacteria 4163
286 Ga0207693_10130380 3300025915 Bacteria 1976
287 Ga0207693_10178908 3300025915 Bacteria 1669
288 Ga0207693_10218465 3300025915 Bacteria 1498
289 Ga0207693_10540287 3300025915 Bacteria 909
290 Ga0207663_10000595 3300025916 Bacteria 15977
291 Ga0207663_10018057 3300025916 Bacteria 3942
292 Ga0207663_10021515 3300025916 Bacteria 3673
293 Ga0207663_10023223 3300025916 Bacteria 3555
294 Ga0207663_10241148 3300025916 Bacteria 1326
295 Ga0207663_10720010 3300025916 Bacteria 791
296 Ga0207660_10093017 3300025917 Bacteria 2239
297 Ga0207657_10067642 3300025919 Bacteria 3037
298 Ga0207652_10095451 3300025921 Bacteria 2619
299 Ga0207652_10137583 3300025921 Bacteria 2182
300 Ga0207652_10553990 3300025921 Bacteria 1033
301 Ga0207646_10001638 3300025922 Bacteria 27351
302 Ga0207646_10079404 3300025922 Bacteria 2933
303 Ga0207646_10118343 3300025922 Bacteria 2380
304 Ga0207646_10159851 3300025922 Bacteria 2033
305 Ga0207646_10188791 3300025922 Bacteria 1861
306 Ga0207646_10379724 3300025922 Bacteria 1277
307 Ga0207646_10661678 3300025922 Bacteria 935
308 Ga0207687_10067273 3300025927 Bacteria 2548
309 Ga0207700_10000091 3300025928 Bacteria 55792
310 Ga0207700_10006412 3300025928 Bacteria 7101
311 Ga0207700_10009657 3300025928 Bacteria 6040
312 Ga0207700_10076347 3300025928 Bacteria 2599
313 Ga0207700_10209767 3300025928 Bacteria 1646
314 Ga0207700_10284128 3300025928 Bacteria 1424
315 Ga0207700_10309942 3300025928 Bacteria 1365
316 Ga0207700_10629107 3300025928 Bacteria 956
317 Ga0207700_10672073 3300025928 Bacteria 924
318 Ga0207700_10981177 3300025928 Bacteria 756
319 Ga0207664_10001032 3300025929 Bacteria 18646
320 Ga0207664_10001323 3300025929 Bacteria 16307
321 Ga0207664_10006431 3300025929 Bacteria 8085
322 Ga0207664_10006898 3300025929 Bacteria 7853
323 Ga0207664_10009075 3300025929 Bacteria 6966
324 Ga0207664_10012435 3300025929 Bacteria 6085
325 Ga0207664_10027344 3300025929 Bacteria 4323
326 Ga0207664_10087825 3300025929 Bacteria 2543
327 Ga0207664_10639072 3300025929 Bacteria 956
328 Ga0207664_10675916 3300025929 Bacteria 928
329 Ga0207664_10685776 3300025929 Bacteria 921
330 Ga0207664_11027721 3300025929 Bacteria 738
331 Ga0207644_10144493 3300025931 Bacteria 1835
332 Ga0207665_10000821 3300025939 Bacteria 21034
333 Ga0207665_10011973 3300025939 Bacteria 5697
334 Ga0207665_10013605 3300025939 Bacteria 5353
335 Ga0207665_10022319 3300025939 Bacteria 4163
336 Ga0207665_10654819 3300025939 Bacteria 823
337 Ga0207665_10676007 3300025939 Bacteria 811
338 Ga0207689_11229876 3300025942 Bacteria 630
339 Ga0207661_10057724 3300025944 Bacteria 3122
340 Ga0207679_11224452 3300025945 Bacteria 689
341 Ga0207667_11429000 3300025949 Bacteria 665
342 Ga0207651_10547541 3300025960 Bacteria 1006
343 Ga0207677_10167377 3300026023 Bacteria 1715
344 Ga0207703_10752596 3300026035 Bacteria 928
345 Ga0207703_10792409 3300026035 Bacteria 904
346 Ga0207678_10124096 3300026067 Bacteria 2203
347 Ga0207678_10156175 3300026067 Bacteria 1948
348 Ga0207678_10191197 3300026067 Bacteria 1749
349 Ga0207702_10011071 3300026078 Bacteria 7530
350 Ga0207702_10075749 3300026078 Bacteria 2907
351 Ga0207702_10197384 3300026078 Bacteria 1863
352 Ga0207641_10704718 3300026088 Bacteria 994
353 Ga0207674_10341731 3300026116 Bacteria 1447
354 Ga0207674_10491963 3300026116 Bacteria 1185
355 Ga0207428_10175378 3300027907 Bacteria 1622
356 Ga0268266_10023185 3300028379 Bacteria 5286
357 Ga0268264_10650291 3300028381 Bacteria 1043
358 Ga0265337_1000049 3300028556 Bacteria 53677
359 Ga0265326_10000822 3300028558 Bacteria 11437
360 Ga0265319_1000220 3300028563 Bacteria 42678
361 Ga0265334_10000083 3300028573 Bacteria 67832
362 Ga0265318_10020851 3300028577 Bacteria 2638
363 Ga0265323_10040745 3300028653 Bacteria 1688
364 Ga0265322_10004536 3300028654 Bacteria 4130
365 Ga0265336_10001694 3300028666 Bacteria 9708
366 Ga0265336_10004565 3300028666 Bacteria 5213
367 Ga0265338_10000358 3300028800 Bacteria 82643
368 Ga0265338_10000940 3300028800 Bacteria 49081
369 Ga0265338_10014758 3300028800 Bacteria 8652
370 Ga0265338_10061662 3300028800 Bacteria 3285
371 Ga0265324_10001390 3300029957 Bacteria 13975
372 Ga0265762_1005987 3300030760 Bacteria 2179
373 Ga0265775_103046 3300030762 Bacteria 893
374 Ga0265775_115245 3300030762 Bacteria 514
375 Ga0265763_1025851 3300030763 Bacteria 643
376 Ga0265767_100417 3300030836 Bacteria 1789
377 Ga0265766_1000538 3300030863 Bacteria 1687
378 Ga0265766_1016712 3300030863 Bacteria 577
379 Ga0265777_114919 3300030877 Bacteria 603
380 Ga0265777_125996 3300030877 Bacteria 503
381 Ga0265770_1007774 3300030878 Bacteria 1515
382 Ga0265764_100345 3300030882 Bacteria 1693
383 Ga0265764_112277 3300030882 Bacteria 562
384 Ga0265769_101486 3300030888 Bacteria 1131
385 Ga0265769_117187 3300030888 Bacteria 552
386 Ga0265761_101512 3300030889 Bacteria 1026
387 Ga0265761_102520 3300030889 Bacteria 859
388 Ga0265761_107242 3300030889 Bacteria 604
389 Ga0247549_103889 3300030942 Bacteria 568
390 Ga0265768_102649 3300030963 Bacteria 926
391 Ga0265768_104272 3300030963 Bacteria 799
392 Ga0265771_1001777 3300031010 Bacteria 1073
393 Ga0265771_1012352 3300031010 Bacteria 651
394 Ga0265760_10011877 3300031090 Bacteria 2488
395 Ga0265760_10015954 3300031090 Bacteria 2154
396 Ga0265760_10016761 3300031090 Bacteria 2104
397 Ga0265760_10072545 3300031090 Bacteria 1057
398 Ga0265332_10000675 3300031238 Bacteria 21963
399 Ga0265320_10003833 3300031240 Bacteria 9974
400 Ga0265325_10006148 3300031241 Bacteria 7327
401 Ga0265340_10000796 3300031247 Bacteria 17872
402 Ga0265339_10046537 3300031249 Bacteria 2384
403 Ga0265316_10007400 3300031344 Bacteria 10348
404 Ga0310116_103289 3300031591 Bacteria 1658
405 Ga0310117_112719 3300031592 Bacteria 879
406 Ga0310117_117491 3300031592 Bacteria 730
407 Ga0265313_10018894 3300031595 Bacteria 3856
408 Ga0310103_104508 3300031614 Bacteria 1813
409 Ga0310103_108291 3300031614 Bacteria 1400
410 Ga0310103_129084 3300031614 Bacteria 670
411 Ga0310105_114668 3300031666 Bacteria 694
412 Ga0310114_111665 3300031678 Bacteria 850
413 Ga0310119_127835 3300031686 Bacteria 590
414 Ga0310101_105794 3300031690 Bacteria 1491
415 Ga0265314_10008203 3300031711 Bacteria 8980
416 Ga0265342_10029921 3300031712 Bacteria 3378
417 Ga0247548_108915 3300031814 Bacteria 512
418 Ga0307406_11732527 3300031901 Bacteria 554
419 Ga0307510_10660135 3300033180 Bacteria 505
420 Ga0316215_1028139 3300033544 Bacteria 581
421 Ga0316214_1000853 3300033545 Bacteria 3335
422 Ga0316212_1007476 3300033547 Bacteria 1576
423 Ga0316216_1010539 3300033548 Bacteria 715
424 Ga0373930_0007648 3300034816 Bacteria 1866
425 Ga0373948_0074115 3300034817 Bacteria 767
426 Ga0373950_0022310 3300034818 Bacteria 1125
427 Ga0373958_0001426 3300034819 Bacteria 3212
428 Ga0373959_0049988 3300034820 Bacteria 900
429 Ga0373938_0003303 3300034957 Bacteria 2636
430 Ga0373926_0029022 3300035083 Bacteria 1943
431 Ga0373926_0302388 3300035083 Bacteria 624
432 Ga0373929_0002602 3300035085 Bacteria 3308
433 Ga0373934_0000328 3300035086 Bacteria 16740
434 Ga0373934_0032981 3300035086 Bacteria 2032
435 Ga0373934_0060411 3300035086 Bacteria 1509
436 Ga0373934_0114350 3300035086 Bacteria 1096
437 Ga0373940_0048435 3300035088 Bacteria 1187
438 Ga0373951_0009688 3300035091 Bacteria 2165
439 Ga0373952_0021896 3300035092 Bacteria 1353
440 Ga0373923_0029692 3300035111 Bacteria 2194
441 Ga0373923_0112223 3300035111 Bacteria 1211
442 Ga0373932_0007413 3300035112 Bacteria 2611
443 Ga0373936_0097200 3300035113 Bacteria 1239
444 Ga0373936_0119229 3300035113 Bacteria 1126
445 Ga0373936_0123726 3300035113 Bacteria 1107
446 Ga0373939_0021110 3300035114 Bacteria 1778
447 Ga0373941_0357657 3300035115 Bacteria 595
448 Ga0373945_0108636 3300035116 Bacteria 1092
449 Ga0373945_0168616 3300035116 Bacteria 896
450 Ga0373945_0353501 3300035116 Bacteria 637
451 Ga0373945_0578697 3300035116 Bacteria 506
452 Ga0373953_0000262 3300035117 Bacteria 14315
453 Ga0373953_0005330 3300035117 Bacteria 4165
454 Ga0373953_0034706 3300035117 Bacteria 1978
455 Ga0373953_0053423 3300035117 Bacteria 1637
456 Ga0373953_0055776 3300035117 Bacteria 1605
457 Ga0373953_0372084 3300035117 Bacteria 627
458 Ga0373954_0119148 3300035118 Bacteria 1280
459 Ga0373954_0154806 3300035118 Bacteria 1120
460 Ga0373954_0215984 3300035118 Bacteria 943
461 Ga0373954_0339640 3300035118 Bacteria 742
462 Ga0373954_0394658 3300035118 Bacteria 684
463 Ga0373956_0004145 3300035119 Bacteria 5818
464 Ga0373956_0007049 3300035119 Bacteria 4521
465 Ga0373956_0063596 3300035119 Bacteria 1674
466 Ga0373956_0084786 3300035119 Bacteria 1456
467 Ga0373956_0518982 3300035119 Bacteria 569
468 Ga0373957_0000312 3300035120 Bacteria 12205
469 Ga0373957_0001248 3300035120 Bacteria 6802
470 Ga0373957_0039494 3300035120 Bacteria 1770
471 Ga0373957_0072893 3300035120 Bacteria 1345
472 Ga0373957_0136378 3300035120 Bacteria 1001
473 Ga0373957_0250847 3300035120 Bacteria 745
474 Ga0373957_0383216 3300035120 Bacteria 603
475 Ga0373960_0011629 3300035121 Bacteria 2171
476 Ga0373943_0048034 3300035170 Bacteria 2089
477 Ga0373943_0156022 3300035170 Bacteria 1239
478 Ga0373943_0376761 3300035170 Bacteria 816
479 Ga0373955_0000233 3300035172 Bacteria 23155
480 Ga0373955_0015005 3300035172 Bacteria 3783
481 Ga0373955_0032433 3300035172 Bacteria 2741
482 Ga0373955_0130168 3300035172 Bacteria 1468
483 Ga0373955_0507075 3300035172 Bacteria 737
484 Ga0373942_0019668 3300035207 Bacteria 1687
485 Ga0373961_0007849 3300035241 Bacteria 2587
486 Ga0373924_0016779 3300035410 Bacteria 2800
487 Ga0373924_0027702 3300035410 Bacteria 2254
488 Ga0373924_0159988 3300035410 Bacteria 987
489 Ga0373924_0221717 3300035410 Bacteria 835
490 Ga0373931_0018524 3300035691 Bacteria 3464
491 Ga0373931_0023038 3300035691 Bacteria 3140
492 Ga0373935_0025535 3300035692 Bacteria 3640
493 Ga0373935_0089335 3300035692 Bacteria 2014
494 Ga0373935_0243431 3300035692 Bacteria 1256
495 Ga0373927_0068698 3300035695 Bacteria 2293
496 Ga0373927_0309110 3300035695 Bacteria 1041
497 Ga0373927_0416553 3300035695 Bacteria 886
498 Ga0373927_0792825 3300035695 Bacteria 626
499 Ga0373933_0000843 3300035724 Bacteria 18752
500 Ga0373933_0009135 3300035724 Bacteria 5411
501 Ga0373933_0012378 3300035724 Bacteria 4711
502 Ga0373933_0039537 3300035724 Bacteria 2775
503 Ga0373933_0087053 3300035724 Bacteria 1923
504 Ga0373933_0109284 3300035724 Bacteria 1723
505 Ga0373947_0035271 3300035725 Bacteria 2962
506 Ga0373947_0085364 3300035725 Bacteria 1960
507 Ga0373947_0201473 3300035725 Bacteria 1302
508 Ga0373947_0613715 3300035725 Bacteria 741
509 Ga0373937_0000112 3300036401 Bacteria 77473
510 Ga0373937_0007454 3300036401 Bacteria 9467
511 Ga0373937_0025538 3300036401 Bacteria 5333
512 Ga0373937_0039458 3300036401 Bacteria 4303
513 Ga0373937_0089360 3300036401 Bacteria 2852
514 Ga0373937_0507803 3300036401 Bacteria 1145
515 Ga0373937_0896568 3300036401 Bacteria 835
516 Ga0265778_021945 3300036457 Bacteria 793
517 Ga0265778_048135 3300036457 Bacteria 579
518 Ga0265778_049055 3300036457 Bacteria 575
519 Ga0310112_013351 3300036458 Bacteria 1170
520 Ga0372808_000924 3300036459 Bacteria 2755
521 Ga0372808_003049 3300036459 Bacteria 2011
522 Ga0310109_031615 3300036534 Bacteria 700
523 Ga0373925_0000004 3300037068 Bacteria 361597
524 Ga0373925_0001140 3300037068 Bacteria 23618
525 Ga0373925_0017994 3300037068 Bacteria 5131
526 Ga0373925_0068419 3300037068 Bacteria 2680
527 Ga0373925_0551908 3300037068 Bacteria 947
528 Ga0373925_1251057 3300037068 Bacteria 609
529 Ga0373925_1798945 3300037068 Bacteria 500
530 Ga0395898_0078143 3300037466 Bacteria 3193
531 Ga0436364_0385416 3300037853 Bacteria 26442
532 Ga0436364_0697983 3300037853 Bacteria 1996
533 Ga0436364_0741352 3300037853 Bacteria 4163
534 Ga0436364_1198874 3300037853 Bacteria 2439
535 Ga0436364_1316048 3300037853 Bacteria 1190
536 Ga0395901_0220498 3300038443 Bacteria 1983
537 Ga0436365_0791880 3300039437 Bacteria 897
538 Ga0436365_1385863 3300039437 Bacteria 1284
539 Ga0436365_1830100 3300039437 Bacteria 884
540 Ga0436360_0112883 3300039438 Bacteria 1581
541 Ga0436360_0712781 3300039438 Bacteria 744
542 Ga0436361_1006107 3300039447 Bacteria 894
543 Ga0436363_0292346 3300039450 Bacteria 1004
544 Ga0436363_0299477 3300039450 Bacteria 805
545 Ga0436363_1625798 3300039450 Bacteria 2373
546 Ga0436362_0581664 3300039453 Bacteria 587
547 Ga0436362_1089947 3300039453 Bacteria 1280
548 Ga0451787_806040 3300041441 Bacteria 1005
549 Ga0451795_1667535 3300041456 Bacteria 710
550 Ga0451852_07722 3300041508 Bacteria 590
551 Ga0451852_31681 3300041508 Bacteria 996
552 Ga0451852_42244 3300041508 Bacteria 858
553 Ga0466965_0402567 3300044683 Bacteria 756
554 Ga0466966_0881340 3300044684 Bacteria 540
555 Ga0466963_0266010 3300044694 Bacteria 1204
556 Ga0466968_0130492 3300044735 Bacteria 1143
557 Ga0466968_0216604 3300044735 Bacteria 901
558 Ga0466968_0487973 3300044735 Bacteria 613
559 Ga0466957_0200035 3300044842 Bacteria 1312
560 Ga0466959_0293548 3300045049 Bacteria 1114
561 Ga0466958_0103955 3300045836 Bacteria 1769
562 Ga0466967_0440340 3300045976 Bacteria 1272
563 Ga0466967_1371476 3300045976 Bacteria 704
564 Ga0495592_0001722 3300046454 Bacteria 15384
565 Ga0495592_0019017 3300046454 Bacteria 5227
566 Ga0495592_0027974 3300046454 Bacteria 4270
567 Ga0495592_0036908 3300046454 Bacteria 3679
568 Ga0495592_0136109 3300046454 Bacteria 1713
569 Ga0495603_0041898 3300046455 Bacteria 2738
570 Ga0495629_0016271 3300046459 Bacteria 5337
571 Ga0495629_0068955 3300046459 Bacteria 2467
572 Ga0495629_0136056 3300046459 Bacteria 1710
573 Ga0495641_0018421 3300046461 Bacteria 3602
574 Ga0495641_0280173 3300046461 Bacteria 750
575 Ga0495651_0000041 3300046462 Bacteria 94160
576 Ga0495651_0026619 3300046462 Bacteria 4504
577 Ga0495651_0029113 3300046462 Bacteria 4307
578 Ga0495651_0048866 3300046462 Bacteria 3266
579 Ga0495651_0080871 3300046462 Bacteria 2453
580 Ga0495651_0314721 3300046462 Bacteria 1045
581 Ga0495651_0359138 3300046462 Bacteria 960
582 Ga0495653_0008925 3300046463 Bacteria 8198
583 Ga0495653_0068546 3300046463 Bacteria 2660
584 Ga0495653_0179294 3300046463 Bacteria 1455
585 Ga0495653_0471668 3300046463 Bacteria 786
586 Ga0495653_0664450 3300046463 Bacteria 635
587 Ga0495580_0069109 3300046472 Bacteria 2468
588 Ga0495580_0394658 3300046472 Bacteria 933
589 Ga0495582_0005320 3300046473 Bacteria 7186
590 Ga0495582_0039452 3300046473 Bacteria 2599
591 Ga0495582_0093463 3300046473 Bacteria 1678
592 Ga0495639_0034767 3300046475 Bacteria 2254
593 Ga0495662_0004602 3300046476 Bacteria 6915
594 Ga0495662_0089659 3300046476 Bacteria 1498
595 Ga0495662_0210839 3300046476 Bacteria 957
596 Ga0495662_0500968 3300046476 Bacteria 595
597 Ga0495664_0006941 3300046477 Bacteria 6269
598 Ga0495664_0012241 3300046477 Bacteria 4858
599 Ga0495664_0047317 3300046477 Bacteria 2552
600 Ga0495664_0054637 3300046477 Bacteria 2374
601 Ga0495664_0687100 3300046477 Bacteria 605
602 Ga0495594_0222542 3300046499 Bacteria 1076
603 Ga0495608_0001767 3300046511 Bacteria 15433
604 Ga0495608_0004661 3300046511 Bacteria 9803
605 Ga0495608_0031563 3300046511 Bacteria 3581
606 Ga0495608_0207881 3300046511 Bacteria 1231
607 Ga0495618_0041548 3300046514 Bacteria 2896
608 Ga0495618_0044087 3300046514 Bacteria 2813
609 Ga0495618_0098707 3300046514 Bacteria 1868
610 Ga0495618_0132139 3300046514 Bacteria 1597
611 Ga0495618_0255868 3300046514 Bacteria 1097
612 Ga0495628_0003221 3300046516 Bacteria 14640
613 Ga0495628_0025761 3300046516 Bacteria 4802
614 Ga0495628_0039808 3300046516 Bacteria 3758
615 Ga0495628_0081317 3300046516 Bacteria 2516
616 Ga0495628_0234239 3300046516 Bacteria 1375
617 Ga0495628_0555864 3300046516 Bacteria 823
618 Ga0495630_0028653 3300046517 Bacteria 4137
619 Ga0495630_0033618 3300046517 Bacteria 3824
620 Ga0495630_0061782 3300046517 Bacteria 2813
621 Ga0495630_0570355 3300046517 Bacteria 868
622 Ga0495630_0904416 3300046517 Bacteria 672
623 Ga0495630_0982556 3300046517 Bacteria 642
624 Ga0495666_0047504 3300046526 Bacteria 2067
625 Ga0495666_0277385 3300046526 Bacteria 760
626 Ga0495652_0010557 3300046529 Bacteria 8368
627 Ga0495652_0013883 3300046529 Bacteria 7245
628 Ga0495652_0016567 3300046529 Bacteria 6591
629 Ga0495652_0023593 3300046529 Bacteria 5453
630 Ga0495652_0267071 3300046529 Bacteria 1259
631 Ga0495665_0002880 3300046531 Bacteria 9299
632 Ga0495665_0019986 3300046531 Bacteria 3601
633 Ga0495665_0118219 3300046531 Bacteria 1388
634 Ga0495640_0030637 3300046533 Bacteria 3849
635 Ga0495640_0032652 3300046533 Bacteria 3706
636 Ga0495640_0049080 3300046533 Bacteria 2912
637 Ga0495640_0081516 3300046533 Bacteria 2150
638 Ga0495640_0911177 3300046533 Bacteria 520
639 Ga0495586_0046132 3300046535 Bacteria 2349
640 Ga0495586_0121485 3300046535 Bacteria 1459
641 Ga0495587_0000038 3300046536 Bacteria 116118
642 Ga0495587_0019029 3300046536 Bacteria 4255
643 Ga0495587_0040683 3300046536 Bacteria 2776
644 Ga0495587_0047578 3300046536 Bacteria 2542
645 Ga0495645_0025092 3300046543 Bacteria 4326
646 Ga0495645_0054078 3300046543 Bacteria 2917
647 Ga0495645_0147073 3300046543 Bacteria 1640
648 Ga0495645_0188261 3300046543 Bacteria 1409
649 Ga0495645_0210647 3300046543 Bacteria 1312
650 Ga0495667_0000445 3300046559 Bacteria 26398
651 Ga0495667_0000985 3300046559 Bacteria 18417
652 Ga0495667_0002803 3300046559 Bacteria 11641
653 Ga0495667_0021959 3300046559 Bacteria 4302
654 Ga0495634_0014303 3300046642 Bacteria 5725
655 Ga0495634_0016396 3300046642 Bacteria 5300
656 Ga0495634_0071383 3300046642 Bacteria 2286
657 Ga0495634_0114595 3300046642 Bacteria 1731
658 Ga0495635_0007096 3300046663 Bacteria 7833
659 Ga0495635_0023342 3300046663 Bacteria 4311
660 Ga0495635_0071799 3300046663 Bacteria 2372
661 Ga0495635_0122343 3300046663 Bacteria 1774
662 Ga0495588_0125340 3300046674 Bacteria 1354
663 Ga0495657_0002519 3300046675 Bacteria 15384
664 Ga0495657_0005213 3300046675 Bacteria 10290
665 Ga0495657_0014816 3300046675 Bacteria 5721
666 Ga0495657_0018704 3300046675 Bacteria 5006
667 Ga0495657_0044000 3300046675 Bacteria 3040
668 Ga0495599_0000100 3300046678 Bacteria 60814
669 Ga0495599_0005877 3300046678 Bacteria 7371
670 Ga0495599_0020499 3300046678 Bacteria 4117
671 Ga0495599_0058622 3300046678 Bacteria 2408
672 Ga0495599_0071792 3300046678 Bacteria 2160
673 Ga0495599_0489233 3300046678 Bacteria 725
674 Ga0495623_0030013 3300046679 Bacteria 3499
675 Ga0495623_0036882 3300046679 Bacteria 3131
676 Ga0495623_0328836 3300046679 Bacteria 837
677 Ga0495646_0023289 3300046680 Bacteria 3899
678 Ga0495646_0094885 3300046680 Bacteria 1717
679 Ga0495646_0126398 3300046680 Bacteria 1442
680 Ga0495647_0073081 3300046681 Bacteria 1376
681 Ga0495658_0037949 3300046683 Bacteria 2665
682 Ga0495658_0156765 3300046683 Bacteria 1401
683 Ga0495613_0004973 3300046689 Bacteria 9984
684 Ga0495613_0054488 3300046689 Bacteria 2939
685 Ga0495624_0006742 3300046690 Bacteria 8114
686 Ga0495624_0101714 3300046690 Bacteria 1769
687 Ga0495624_0273946 3300046690 Bacteria 1019
688 Ga0495624_0374248 3300046690 Bacteria 856
689 Ga0495600_0021742 3300046809 Bacteria 4113
690 Ga0495600_0033758 3300046809 Bacteria 3321
691 Ga0495600_0034389 3300046809 Bacteria 3289
692 Ga0495600_0241977 3300046809 Bacteria 1149
693 Ga0495600_0287517 3300046809 Bacteria 1039
694 Ga0495581_0007649 3300047315 Bacteria 6251
695 Ga0495581_0031164 3300047315 Bacteria 3089
696 Ga0495581_0083298 3300047315 Bacteria 1852
697 Ga0495604_0000061 3300047317 Bacteria 94158
698 Ga0495604_0020965 3300047317 Bacteria 5215
699 Ga0495604_0023815 3300047317 Bacteria 4885
700 Ga0495604_0090980 3300047317 Bacteria 2264
701 Ga0495604_0288404 3300047317 Bacteria 1106
702 Ga0495604_0323474 3300047317 Bacteria 1030
703 Ga0495674_0045071 3300047319 Bacteria 3917
704 Ga0495674_0063469 3300047319 Bacteria 3213
705 Ga0495674_0063741 3300047319 Bacteria 3205
706 Ga0495674_0096092 3300047319 Bacteria 2525
707 Ga0495674_0173934 3300047319 Bacteria 1795
708 Ga0495674_0262545 3300047319 Bacteria 1418
709 Ga0495676_0141456 3300047321 Bacteria 1724
710 Ga0495676_0533015 3300047321 Bacteria 768
711 Ga0495680_0003514 3300047322 Bacteria 15376
712 Ga0495680_0031237 3300047322 Bacteria 4337
713 Ga0495680_0065787 3300047322 Bacteria 2775
714 Ga0495680_0086063 3300047322 Bacteria 2365
715 Ga0495680_0138006 3300047322 Bacteria 1786
716 Ga0495680_0328199 3300047322 Bacteria 1069
717 Ga0495675_0002156 3300047444 Bacteria 11734
718 Ga0495675_0003593 3300047444 Bacteria 9349
719 Ga0495675_0019155 3300047444 Bacteria 4348
720 Ga0495675_0123411 3300047444 Bacteria 1612
721 Ga0495684_0044908 3300047471 Bacteria 3382
722 Ga0495684_0058007 3300047471 Bacteria 2949
723 Ga0495684_0061787 3300047471 Bacteria 2849
724 Ga0495684_0453541 3300047471 Bacteria 890
725 Ga0495593_0009590 3300047673 Bacteria 5621
726 Ga0495593_0081220 3300047673 Bacteria 1676
727 Ga0495593_0091946 3300047673 Bacteria 1562
728 Ga0495602_0004271 3300048088 Bacteria 14873
729 Ga0495602_0023507 3300048088 Bacteria 6002
730 Ga0495602_0036394 3300048088 Bacteria 4581
731 Ga0495602_0040512 3300048088 Bacteria 4269
732 Ga0495614_0006961 3300048089 Bacteria 5052
733 Ga0495614_0231767 3300048089 Bacteria 841
734 Ga0496100_0034483 3300048903 Bacteria 3176
735 Ga0496100_0151745 3300048903 Bacteria 1653
736 Ga0496102_0031789 3300048905 Bacteria 4738
737 Ga0496102_0096410 3300048905 Bacteria 2742
738 Ga0496102_1618265 3300048905 Bacteria 566
739 Ga0496103_0131820 3300048906 Bacteria 1596
740 Ga0496104_0001325 3300048907 Bacteria 21370
741 Ga0496104_0085657 3300048907 Bacteria 3007
742 Ga0496105_0000744 3300048908 Bacteria 22107
743 Ga0496105_0025654 3300048908 Bacteria 4799
744 Ga0496106_0198905 3300048909 Bacteria 1594
745 Ga0496106_0293908 3300048909 Bacteria 1303
746 Ga0496107_0003098 3300048910 Bacteria 11049
747 Ga0496108_0002190 3300048911 Bacteria 15672
748 Ga0496108_0047492 3300048911 Bacteria 3588
749 Ga0496108_0796840 3300048911 Bacteria 815
750 Ga0496109_0013057 3300048912 Bacteria 7185
751 Ga0496109_0083528 3300048912 Bacteria 2945
752 Ga0496111_0195292 3300048914 Bacteria 1504
753 Ga0496112_0001139 3300048915 Bacteria 19803
754 Ga0496112_0028330 3300048915 Bacteria 5405
755 Ga0496112_0584377 3300048915 Bacteria 1049
756 Ga0496113_0008126 3300048916 Bacteria 6813
757 Ga0496113_0031782 3300048916 Bacteria 3833
758 Ga0496113_0759848 3300048916 Bacteria 771
759 Ga0496114_0010283 3300048917 Bacteria 7446
760 Ga0496114_0027524 3300048917 Bacteria 4658
761 Ga0496115_0004035 3300048918 Bacteria 10597
762 Ga0496115_0015962 3300048918 Bacteria 5709
763 Ga0496115_0101468 3300048918 Bacteria 2359
764 Ga0496126_0043842 3300048929 Bacteria 4123
765 Ga0496126_0111838 3300048929 Bacteria 2378
766 Ga0496126_0421231 3300048929 Bacteria 1079
767 nmdc:mga05p37_31729_c1 3300050507 Bacteria 6457
768 nmdc:mga08y16_238967_c1 3300050511 Bacteria 1878
769 nmdc:mga0n895_1944188_c1 3300050512 Bacteria 547
770 nmdc:mga0n895_207347_c1 3300050512 Bacteria 1991
771 nmdc:mga0n895_463554_c1 3300050512 Bacteria 1279
772 nmdc:mga0n895_93657_c1 3300050512 Bacteria 3008
773 nmdc:mga0rr50_32817_c1 3300050513 Bacteria 3704
774 nmdc:mga0rr50_6896_c1 3300050513 Bacteria 6966
775 nmdc:mga0rr50_9558_c1 3300050513 Bacteria 6104
776 nmdc:mga08x19_115058_c1 3300050514 Bacteria 1798
777 nmdc:mga08x19_16321_c1 3300050514 Bacteria 4527
778 nmdc:mga08x19_32682_c1 3300050514 Bacteria 3281
779 nmdc:mga0a205_3984_c1 3300050515 Bacteria 13204
780 Ga0495601_0037098 3300053077 Bacteria 3046
781 Ga0495601_0038877 3300053077 Bacteria 2976
782 Ga0495601_0104587 3300053077 Bacteria 1830
783 Ga0495601_0136955 3300053077 Bacteria 1596
784 Ga0495601_0212874 3300053077 Bacteria 1262
785 Ga0495601_0650365 3300053077 Bacteria 674
786 Ga0495612_0029952 3300053078 Bacteria 2192
787 Ga0495612_0033074 3300053078 Bacteria 2091
788 Ga0495595_0008946 3300053084 Bacteria 4128
789 Ga0495595_0012574 3300053084 Bacteria 3561
790 Ga0495619_0007700 3300053085 Bacteria 6819
791 Ga0495619_0024282 3300053085 Bacteria 3887
792 Ga0495619_0074722 3300053085 Bacteria 2273
793 Ga0495619_1103220 3300053085 Bacteria 528
794 Ga0587084_083896 3300059477 Bacteria 621
795 Ga0587066_106195 3300059490 Bacteria 645
796 Ga0587070_028468 3300059491 Bacteria 997
797 Ga0587073_0157346 3300059492 Bacteria 648
798 Ga0587086_089771 3300059507 Bacteria 553
799 Ga0587091_049644 3300059511 Bacteria 857
800 Ga0587092_072959 3300059512 Bacteria 664
801 Ga0587101_118345 3300059623 Bacteria 545
802 Ga0587109_119655 3300059624 Bacteria 624
803 Ga0587067_016763 3300059640 Bacteria 1207
804 Ga0587068_100235 3300059641 Bacteria 607
805 Ga0587111_0081692 3300060346 Bacteria 773

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041441 Ga0451787_806040 Ga0451787_806040_253_558 101
2 3300041456 Ga0451795_1667535 Ga0451795_1667535_200_505 101
3 3300041508 Ga0451852_07722 Ga0451852_07722_254_571 101
4 3300041508 Ga0451852_31681 Ga0451852_31681_591_911 101
5 3300041508 Ga0451852_42244 Ga0451852_42244_543_848 101
6 3300006847 Ga0075431_101399628 Ga0075431_1013996282 103
7 3300005434 Ga0070709_10173185 Ga0070709_101731852 105
8 3300005435 Ga0070714_100005961 Ga0070714_10000596114 105
9 3300005436 Ga0070713_100030847 Ga0070713_1000308475 105
10 3300005436 Ga0070713_100400705 Ga0070713_1004007052 105
11 3300005437 Ga0070710_10009084 Ga0070710_100090842 105
12 3300005437 Ga0070710_10249275 Ga0070710_102492752 105
13 3300005439 Ga0070711_100102272 Ga0070711_1001022725 105
14 3300005468 Ga0070707_100260221 Ga0070707_1002602214 105
15 3300005471 Ga0070698_100521425 Ga0070698_1005214253 105
16 3300006028 Ga0070717_10035630 Ga0070717_100356305 105
17 3300006028 Ga0070717_10567360 Ga0070717_105673602 105
18 3300006173 Ga0070716_100079914 Ga0070716_1000799143 105
19 3300006173 Ga0070716_100679952 Ga0070716_1006799521 105
20 3300006914 Ga0075436_100072403 Ga0075436_1000724034 105
21 3300007076 Ga0075435_100357826 Ga0075435_1003578263 105
22 3300007265 Ga0099794_10015745 Ga0099794_100157457 105
23 3300025898 Ga0207692_10007166 Ga0207692_100071662 105
24 3300025898 Ga0207692_10219244 Ga0207692_102192442 105
25 3300025906 Ga0207699_10001977 Ga0207699_100019777 105
26 3300025906 Ga0207699_10184010 Ga0207699_101840102 105
27 3300025915 Ga0207693_10218465 Ga0207693_102184652 105
28 3300025916 Ga0207663_10018057 Ga0207663_100180573 105
29 3300025916 Ga0207663_10241148 Ga0207663_102411482 105
30 3300025922 Ga0207646_10118343 Ga0207646_101183432 105
31 3300025928 Ga0207700_10006412 Ga0207700_100064129 105
32 3300025929 Ga0207664_10006898 Ga0207664_100068988 105
33 3300025929 Ga0207664_10009075 Ga0207664_100090754 105
34 3300025929 Ga0207664_10087825 Ga0207664_100878252 105
35 3300025939 Ga0207665_10011973 Ga0207665_1001197310 105
36 3300025939 Ga0207665_10654819 Ga0207665_106548192 105
37 3300030882 Ga0265764_112277 Ga0265764_1122771 105
38 3300053085 Ga0495619_1103220 Ga0495619_1103220_51_410 105
39 3300004799 Ga0058863_10087617 Ga0058863_100876172 106
40 3300004800 Ga0058861_10050561 Ga0058861_100505615 106
41 3300004800 Ga0058861_10187278 Ga0058861_101872783 106
42 3300004803 Ga0058862_10129161 Ga0058862_101291612 106
43 3300004803 Ga0058862_12484301 Ga0058862_124843012 106
44 3300005327 Ga0070658_10088897 Ga0070658_100888975 106
45 3300005329 Ga0070683_100186457 Ga0070683_1001864574 106
46 3300005329 Ga0070683_100245669 Ga0070683_1002456694 106
47 3300005329 Ga0070683_101336258 Ga0070683_1013362582 106
48 3300005334 Ga0068869_101261010 Ga0068869_1012610102 106
49 3300005336 Ga0070680_100067854 Ga0070680_1000678546 106
50 3300005336 Ga0070680_100472511 Ga0070680_1004725111 106
51 3300005336 Ga0070680_100920382 Ga0070680_1009203822 106
52 3300005337 Ga0070682_100048057 Ga0070682_1000480572 106
53 3300005337 Ga0070682_100075432 Ga0070682_1000754324 106
54 3300005339 Ga0070660_100362640 Ga0070660_1003626402 106
55 3300005341 Ga0070691_10743503 Ga0070691_107435031 106
56 3300005344 Ga0070661_100201326 Ga0070661_1002013262 106
57 3300005355 Ga0070671_100252590 Ga0070671_1002525903 106
58 3300005434 Ga0070709_10000382 Ga0070709_1000038221 106
59 3300005434 Ga0070709_10020576 Ga0070709_100205763 106
60 3300005434 Ga0070709_10879235 Ga0070709_108792351 106
61 3300005435 Ga0070714_100001124 Ga0070714_10000112421 106
62 3300005435 Ga0070714_100003109 Ga0070714_10000310919 106
63 3300005435 Ga0070714_100067826 Ga0070714_1000678265 106
64 3300005435 Ga0070714_100111149 Ga0070714_1001111492 106
65 3300005435 Ga0070714_100239174 Ga0070714_1002391742 106
66 3300005435 Ga0070714_100389436 Ga0070714_1003894362 106
67 3300005435 Ga0070714_101572057 Ga0070714_1015720572 106
68 3300005436 Ga0070713_100001233 Ga0070713_1000012336 106
69 3300005436 Ga0070713_100092635 Ga0070713_1000926354 106
70 3300005436 Ga0070713_100223624 Ga0070713_1002236243 106
71 3300005436 Ga0070713_100227446 Ga0070713_1002274461 106
72 3300005436 Ga0070713_100377852 Ga0070713_1003778521 106
73 3300005436 Ga0070713_101079577 Ga0070713_1010795771 106
74 3300005436 Ga0070713_101538726 Ga0070713_1015387261 106
75 3300005436 Ga0070713_101732303 Ga0070713_1017323032 106
76 3300005437 Ga0070710_10000437 Ga0070710_1000043712 106
77 3300005437 Ga0070710_10019019 Ga0070710_100190196 106
78 3300005437 Ga0070710_10038529 Ga0070710_100385295 106
79 3300005437 Ga0070710_10512930 Ga0070710_105129302 106
80 3300005437 Ga0070710_11115486 Ga0070710_111154861 106
81 3300005439 Ga0070711_100017511 Ga0070711_1000175115 106
82 3300005439 Ga0070711_100045638 Ga0070711_1000456386 106
83 3300005439 Ga0070711_100527905 Ga0070711_1005279052 106
84 3300005440 Ga0070705_100112618 Ga0070705_1001126184 106
85 3300005445 Ga0070708_100073925 Ga0070708_1000739254 106
86 3300005445 Ga0070708_100101804 Ga0070708_1001018046 106
87 3300005445 Ga0070708_100111554 Ga0070708_1001115542 106
88 3300005445 Ga0070708_100467745 Ga0070708_1004677452 106
89 3300005445 Ga0070708_100481855 Ga0070708_1004818552 106
90 3300005445 Ga0070708_100702517 Ga0070708_1007025172 106
91 3300005445 Ga0070708_102237466 Ga0070708_1022374661 106
92 3300005455 Ga0070663_100145197 Ga0070663_1001451972 106
93 3300005455 Ga0070663_100190100 Ga0070663_1001901001 106
94 3300005455 Ga0070663_100722200 Ga0070663_1007222002 106
95 3300005456 Ga0070678_100338566 Ga0070678_1003385663 106
96 3300005458 Ga0070681_10567682 Ga0070681_105676822 106
97 3300005467 Ga0070706_100001216 Ga0070706_10000121632 106
98 3300005467 Ga0070706_100003720 Ga0070706_10000372011 106
99 3300005467 Ga0070706_100041850 Ga0070706_1000418509 106
100 3300005467 Ga0070706_100094440 Ga0070706_1000944406 106
101 3300005467 Ga0070706_100105887 Ga0070706_1001058872 106
102 3300005467 Ga0070706_100178715 Ga0070706_1001787155 106
103 3300005467 Ga0070706_100257139 Ga0070706_1002571392 106
104 3300005467 Ga0070706_100268164 Ga0070706_1002681641 106
105 3300005467 Ga0070706_100953912 Ga0070706_1009539121 106
106 3300005467 Ga0070706_101884222 Ga0070706_1018842222 106
107 3300005468 Ga0070707_100011795 Ga0070707_10001179510 106
108 3300005468 Ga0070707_100098495 Ga0070707_1000984956 106
109 3300005468 Ga0070707_100197595 Ga0070707_1001975952 106
110 3300005468 Ga0070707_100332689 Ga0070707_1003326893 106
111 3300005468 Ga0070707_101759611 Ga0070707_1017596111 106
112 3300005471 Ga0070698_100001882 Ga0070698_10000188216 106
113 3300005471 Ga0070698_100007360 Ga0070698_10000736011 106
114 3300005471 Ga0070698_100009167 Ga0070698_1000091677 106
115 3300005471 Ga0070698_100018293 Ga0070698_1000182936 106
116 3300005471 Ga0070698_100034346 Ga0070698_10003434610 106
117 3300005471 Ga0070698_100065182 Ga0070698_1000651822 106
118 3300005471 Ga0070698_100084017 Ga0070698_1000840176 106
119 3300005471 Ga0070698_100099685 Ga0070698_1000996852 106
120 3300005471 Ga0070698_100163572 Ga0070698_1001635724 106
121 3300005471 Ga0070698_100177424 Ga0070698_1001774245 106
122 3300005518 Ga0070699_100169232 Ga0070699_1001692324 106
123 3300005530 Ga0070679_101090515 Ga0070679_1010905152 106
124 3300005530 Ga0070679_101351359 Ga0070679_1013513592 106
125 3300005535 Ga0070684_100108391 Ga0070684_1001083912 106
126 3300005536 Ga0070697_100066801 Ga0070697_1000668012 106
127 3300005536 Ga0070697_100763184 Ga0070697_1007631842 106
128 3300005536 Ga0070697_101165370 Ga0070697_1011653702 106
129 3300005536 Ga0070697_101942639 Ga0070697_1019426391 106
130 3300005536 Ga0070697_102109545 Ga0070697_1021095451 106
131 3300005539 Ga0068853_100493092 Ga0068853_1004930921 106
132 3300005545 Ga0070695_101599897 Ga0070695_1015998971 106
133 3300005546 Ga0070696_100084890 Ga0070696_1000848902 106
134 3300005546 Ga0070696_101124184 Ga0070696_1011241841 106
135 3300005549 Ga0070704_100654605 Ga0070704_1006546051 106
136 3300005563 Ga0068855_101155889 Ga0068855_1011558892 106
137 3300005563 Ga0068855_102077002 Ga0068855_1020770022 106
138 3300005564 Ga0070664_102074122 Ga0070664_1020741221 106
139 3300005577 Ga0068857_100611783 Ga0068857_1006117832 106
140 3300005578 Ga0068854_101621514 Ga0068854_1016215141 106
141 3300005614 Ga0068856_100014944 Ga0068856_10001494413 106
142 3300005614 Ga0068856_100144813 Ga0068856_1001448132 106
143 3300005614 Ga0068856_100256540 Ga0068856_1002565405 106
144 3300005618 Ga0068864_100232132 Ga0068864_1002321325 106
145 3300005841 Ga0068863_100407865 Ga0068863_1004078653 106
146 3300005842 Ga0068858_100485400 Ga0068858_1004854002 106
147 3300005842 Ga0068858_101272031 Ga0068858_1012720312 106
148 3300005843 Ga0068860_102180995 Ga0068860_1021809952 106
149 3300005937 Ga0081455_10251481 Ga0081455_102514812 106
150 3300005983 Ga0081540_1002039 Ga0081540_100203923 106
151 3300006028 Ga0070717_10010919 Ga0070717_100109195 106
152 3300006028 Ga0070717_10030218 Ga0070717_100302182 106
153 3300006028 Ga0070717_10178591 Ga0070717_101785913 106
154 3300006028 Ga0070717_10205554 Ga0070717_102055543 106
155 3300006028 Ga0070717_10213398 Ga0070717_102133982 106
156 3300006028 Ga0070717_10310893 Ga0070717_103108932 106
157 3300006028 Ga0070717_10323495 Ga0070717_103234953 106
158 3300006028 Ga0070717_10961811 Ga0070717_109618112 106
159 3300006028 Ga0070717_11067551 Ga0070717_110675512 106
160 3300006028 Ga0070717_11150319 Ga0070717_111503192 106
161 3300006028 Ga0070717_11335078 Ga0070717_113350782 106
162 3300006028 Ga0070717_11469512 Ga0070717_114695122 106
163 3300006163 Ga0070715_10001006 Ga0070715_1000100610 106
164 3300006163 Ga0070715_10053222 Ga0070715_100532222 106
165 3300006173 Ga0070716_100000511 Ga0070716_10000051122 106
166 3300006173 Ga0070716_100003131 Ga0070716_1000031319 106
167 3300006173 Ga0070716_100185330 Ga0070716_1001853302 106
168 3300006173 Ga0070716_100477791 Ga0070716_1004777912 106
169 3300006173 Ga0070716_101316365 Ga0070716_1013163651 106
170 3300006175 Ga0070712_100001287 Ga0070712_1000012875 106
171 3300006175 Ga0070712_100389699 Ga0070712_1003896992 106
172 3300006175 Ga0070712_100422846 Ga0070712_1004228461 106
173 3300006175 Ga0070712_100570172 Ga0070712_1005701722 106
174 3300006358 Ga0068871_100107345 Ga0068871_1001073452 106
175 3300006844 Ga0075428_100107848 Ga0075428_1001078482 106
176 3300006852 Ga0075433_10004127 Ga0075433_100041273 106
177 3300006852 Ga0075433_10015253 Ga0075433_100152536 106
178 3300006871 Ga0075434_100016693 Ga0075434_1000166933 106
179 3300006871 Ga0075434_100041293 Ga0075434_1000412932 106
180 3300006871 Ga0075434_100609782 Ga0075434_1006097822 106
181 3300006871 Ga0075434_101203518 Ga0075434_1012035182 106
182 3300006914 Ga0075436_100020129 Ga0075436_1000201298 106
183 3300006914 Ga0075436_100275799 Ga0075436_1002757992 106
184 3300007076 Ga0075435_100016080 Ga0075435_10001608011 106
185 3300007076 Ga0075435_100081437 Ga0075435_1000814374 106
186 3300007076 Ga0075435_100161520 Ga0075435_1001615204 106
187 3300007076 Ga0075435_100829136 Ga0075435_1008291361 106
188 3300007265 Ga0099794_10751760 Ga0099794_107517601 106
189 3300007265 Ga0099794_10753436 Ga0099794_107534362 106
190 3300009093 Ga0105240_10326462 Ga0105240_103264625 106
191 3300009094 Ga0111539_10276546 Ga0111539_102765464 106
192 3300009098 Ga0105245_10117718 Ga0105245_101177184 106
193 3300009098 Ga0105245_13118014 Ga0105245_131180142 106
194 3300009101 Ga0105247_10360370 Ga0105247_103603702 106
195 3300009147 Ga0114129_10025444 Ga0114129_1002544410 106
196 3300009147 Ga0114129_12113893 Ga0114129_121138932 106
197 3300009174 Ga0105241_11291982 Ga0105241_112919821 106
198 3300009174 Ga0105241_11402457 Ga0105241_114024572 106
199 3300009545 Ga0105237_10207460 Ga0105237_102074602 106
200 3300010375 Ga0105239_10213868 Ga0105239_102138685 106
201 3300010375 Ga0105239_10907364 Ga0105239_109073642 106
202 3300010375 Ga0105239_12860447 Ga0105239_128604472 106
203 3300011119 Ga0105246_10611449 Ga0105246_106114492 106
204 3300013102 Ga0157371_10176020 Ga0157371_101760204 106
205 3300013104 Ga0157370_10036228 Ga0157370_100362288 106
206 3300013104 Ga0157370_10693410 Ga0157370_106934102 106
207 3300013104 Ga0157370_12017761 Ga0157370_120177612 106
208 3300013105 Ga0157369_10224100 Ga0157369_102241002 106
209 3300013105 Ga0157369_10343337 Ga0157369_103433374 106
210 3300013105 Ga0157369_10503476 Ga0157369_105034762 106
211 3300013297 Ga0157378_10473139 Ga0157378_104731392 106
212 3300013306 Ga0163162_10333055 Ga0163162_103330552 106
213 3300013307 Ga0157372_10874280 Ga0157372_108742802 106
214 3300013307 Ga0157372_12905783 Ga0157372_129057832 106
215 3300013307 Ga0157372_12972637 Ga0157372_129726371 106
216 3300014968 Ga0157379_11510309 Ga0157379_115103092 106
217 3300014969 Ga0157376_10296265 Ga0157376_102962652 106
218 3300019161 Ga0184602_110879 Ga0184602_1108792 106
219 3300019182 Ga0184598_105504 Ga0184598_1055042 106
220 3300019183 Ga0184601_132300 Ga0184601_1323002 106
221 3300019188 Ga0184599_144470 Ga0184599_1444702 106
222 3300019188 Ga0184599_148056 Ga0184599_1480562 106
223 3300019190 Ga0184600_101748 Ga0184600_1017483 106
224 3300019190 Ga0184600_125102 Ga0184600_1251024 106
225 3300019190 Ga0184600_131170 Ga0184600_1311705 106
226 3300019192 Ga0184603_142199 Ga0184603_1421992 106
227 3300020069 Ga0197907_10140557 Ga0197907_101405572 106
228 3300020069 Ga0197907_10560617 Ga0197907_105606172 106
229 3300020069 Ga0197907_11410793 Ga0197907_1141079312 106
230 3300020070 Ga0206356_10113528 Ga0206356_101135282 106
231 3300020070 Ga0206356_10231414 Ga0206356_102314142 106
232 3300020070 Ga0206356_10627949 Ga0206356_106279494 106
233 3300020070 Ga0206356_11122293 Ga0206356_111222936 106
234 3300020075 Ga0206349_1085727 Ga0206349_10857271 106
235 3300020075 Ga0206349_1093562 Ga0206349_10935622 106
236 3300020076 Ga0206355_1081850 Ga0206355_10818506 106
237 3300020076 Ga0206355_1146852 Ga0206355_11468522 106
238 3300020076 Ga0206355_1475090 Ga0206355_14750902 106
239 3300020077 Ga0206351_10172658 Ga0206351_101726581 106
240 3300020077 Ga0206351_10189769 Ga0206351_101897693 106
241 3300020077 Ga0206351_10935693 Ga0206351_109356932 106
242 3300020077 Ga0206351_10966915 Ga0206351_109669155 106
243 3300020078 Ga0206352_10550210 Ga0206352_105502102 106
244 3300020078 Ga0206352_10797554 Ga0206352_107975542 106
245 3300020078 Ga0206352_11071090 Ga0206352_110710905 106
246 3300020078 Ga0206352_11237361 Ga0206352_112373613 106
247 3300020080 Ga0206350_10457115 Ga0206350_104571152 106
248 3300020080 Ga0206350_10589439 Ga0206350_105894392 106
249 3300020080 Ga0206350_11271940 Ga0206350_112719402 106
250 3300020080 Ga0206350_11664796 Ga0206350_116647965 106
251 3300020081 Ga0206354_10227392 Ga0206354_102273922 106
252 3300020081 Ga0206354_10316033 Ga0206354_103160332 106
253 3300020081 Ga0206354_10439839 Ga0206354_104398392 106
254 3300020081 Ga0206354_11478351 Ga0206354_114783512 106
255 3300020082 Ga0206353_10178129 Ga0206353_101781292 106
256 3300020082 Ga0206353_10181719 Ga0206353_101817192 106
257 3300020082 Ga0206353_10565899 Ga0206353_105658992 106
258 3300020082 Ga0206353_10902912 Ga0206353_109029125 106
259 3300020610 Ga0154015_1067250 Ga0154015_10672504 106
260 3300020610 Ga0154015_1474683 Ga0154015_14746832 106
261 3300020610 Ga0154015_1525166 Ga0154015_15251662 106
262 3300021358 Ga0213873_10130699 Ga0213873_101306992 106
263 3300021377 Ga0213874_10042088 Ga0213874_100420884 106
264 3300021377 Ga0213874_10079706 Ga0213874_100797062 106
265 3300021388 Ga0213875_10022186 Ga0213875_100221864 106
266 3300021388 Ga0213875_10027897 Ga0213875_100278974 106
267 3300021388 Ga0213875_10036259 Ga0213875_100362596 106
268 3300021388 Ga0213875_10078941 Ga0213875_100789412 106
269 3300022467 Ga0224712_10042950 Ga0224712_100429504 106
270 3300022467 Ga0224712_10193364 Ga0224712_101933642 106
271 3300022467 Ga0224712_10210464 Ga0224712_102104642 106
272 3300023660 Ga0247550_102792 Ga0247550_1027922 106
273 3300023672 Ga0247553_111181 Ga0247553_1111812 106
274 3300024225 Ga0224572_1110363 Ga0224572_11103632 106
275 3300024227 Ga0228598_1043014 Ga0228598_10430142 106
276 3300025898 Ga0207692_10001130 Ga0207692_1000113010 106
277 3300025898 Ga0207692_10006028 Ga0207692_100060285 106
278 3300025898 Ga0207692_10009470 Ga0207692_100094704 106
279 3300025904 Ga0207647_10100984 Ga0207647_101009844 106
280 3300025905 Ga0207685_10001544 Ga0207685_100015448 106
281 3300025905 Ga0207685_10008831 Ga0207685_100088313 106
282 3300025905 Ga0207685_10217527 Ga0207685_102175272 106
283 3300025906 Ga0207699_10000260 Ga0207699_1000026018 106
284 3300025906 Ga0207699_10007633 Ga0207699_100076335 106
285 3300025906 Ga0207699_10008993 Ga0207699_100089935 106
286 3300025909 Ga0207705_10158625 Ga0207705_101586253 106
287 3300025910 Ga0207684_10002031 Ga0207684_1000203127 106
288 3300025910 Ga0207684_10002505 Ga0207684_100025059 106
289 3300025910 Ga0207684_10016512 Ga0207684_1001651213 106
290 3300025910 Ga0207684_10027808 Ga0207684_100278085 106
291 3300025910 Ga0207684_10034449 Ga0207684_100344493 106
292 3300025910 Ga0207684_10034994 Ga0207684_100349949 106
293 3300025910 Ga0207684_10392457 Ga0207684_103924572 106
294 3300025910 Ga0207684_10490615 Ga0207684_104906152 106
295 3300025910 Ga0207684_10928131 Ga0207684_109281312 106
296 3300025910 Ga0207684_11311350 Ga0207684_113113502 106
297 3300025911 Ga0207654_10745871 Ga0207654_107458712 106
298 3300025912 Ga0207707_10008073 Ga0207707_100080733 106
299 3300025914 Ga0207671_10451396 Ga0207671_104513963 106
300 3300025915 Ga0207693_10002650 Ga0207693_1000265022 106
301 3300025915 Ga0207693_10004081 Ga0207693_1000408118 106
302 3300025915 Ga0207693_10031891 Ga0207693_100318914 106
303 3300025915 Ga0207693_10130380 Ga0207693_101303803 106
304 3300025915 Ga0207693_10178908 Ga0207693_101789082 106
305 3300025915 Ga0207693_10540287 Ga0207693_105402872 106
306 3300025916 Ga0207663_10000595 Ga0207663_1000059522 106
307 3300025916 Ga0207663_10021515 Ga0207663_100215157 106
308 3300025916 Ga0207663_10023223 Ga0207663_100232238 106
309 3300025916 Ga0207663_10720010 Ga0207663_107200102 106
310 3300025917 Ga0207660_10093017 Ga0207660_100930174 106
311 3300025919 Ga0207657_10067642 Ga0207657_100676425 106
312 3300025921 Ga0207652_10095451 Ga0207652_100954512 106
313 3300025921 Ga0207652_10137583 Ga0207652_101375837 106
314 3300025921 Ga0207652_10553990 Ga0207652_105539902 106
315 3300025922 Ga0207646_10001638 Ga0207646_1000163829 106
316 3300025922 Ga0207646_10079404 Ga0207646_100794044 106
317 3300025922 Ga0207646_10159851 Ga0207646_101598512 106
318 3300025922 Ga0207646_10188791 Ga0207646_101887915 106
319 3300025922 Ga0207646_10379724 Ga0207646_103797243 106
320 3300025922 Ga0207646_10661678 Ga0207646_106616781 106
321 3300025927 Ga0207687_10067273 Ga0207687_100672733 106
322 3300025928 Ga0207700_10000091 Ga0207700_1000009147 106
323 3300025928 Ga0207700_10009657 Ga0207700_100096576 106
324 3300025928 Ga0207700_10076347 Ga0207700_100763474 106
325 3300025928 Ga0207700_10209767 Ga0207700_102097673 106
326 3300025928 Ga0207700_10284128 Ga0207700_102841283 106
327 3300025928 Ga0207700_10309942 Ga0207700_103099421 106
328 3300025928 Ga0207700_10629107 Ga0207700_106291072 106
329 3300025928 Ga0207700_10672073 Ga0207700_106720732 106
330 3300025928 Ga0207700_10981177 Ga0207700_109811771 106
331 3300025929 Ga0207664_10001032 Ga0207664_1000103213 106
332 3300025929 Ga0207664_10001323 Ga0207664_1000132322 106
333 3300025929 Ga0207664_10006431 Ga0207664_100064319 106
334 3300025929 Ga0207664_10012435 Ga0207664_100124355 106
335 3300025929 Ga0207664_10027344 Ga0207664_100273446 106
336 3300025929 Ga0207664_10639072 Ga0207664_106390722 106
337 3300025929 Ga0207664_10675916 Ga0207664_106759161 106
338 3300025929 Ga0207664_10685776 Ga0207664_106857762 106
339 3300025929 Ga0207664_11027721 Ga0207664_110277212 106
340 3300025931 Ga0207644_10144493 Ga0207644_101444933 106
341 3300025939 Ga0207665_10000821 Ga0207665_1000082122 106
342 3300025939 Ga0207665_10013605 Ga0207665_1001360510 106
343 3300025939 Ga0207665_10022319 Ga0207665_100223197 106
344 3300025939 Ga0207665_10676007 Ga0207665_106760072 106
345 3300025942 Ga0207689_11229876 Ga0207689_112298761 106
346 3300025944 Ga0207661_10057724 Ga0207661_100577244 106
347 3300025945 Ga0207679_11224452 Ga0207679_112244522 106
348 3300025949 Ga0207667_11429000 Ga0207667_114290002 106
349 3300025960 Ga0207651_10547541 Ga0207651_105475412 106
350 3300026023 Ga0207677_10167377 Ga0207677_101673773 106
351 3300026035 Ga0207703_10752596 Ga0207703_107525962 106
352 3300026035 Ga0207703_10792409 Ga0207703_107924091 106
353 3300026067 Ga0207678_10124096 Ga0207678_101240962 106
354 3300026067 Ga0207678_10156175 Ga0207678_101561754 106
355 3300026067 Ga0207678_10191197 Ga0207678_101911972 106
356 3300026078 Ga0207702_10011071 Ga0207702_1001107113 106
357 3300026078 Ga0207702_10075749 Ga0207702_100757495 106
358 3300026078 Ga0207702_10197384 Ga0207702_101973843 106
359 3300026088 Ga0207641_10704718 Ga0207641_107047182 106
360 3300026116 Ga0207674_10341731 Ga0207674_103417312 106
361 3300026116 Ga0207674_10491963 Ga0207674_104919632 106
362 3300027907 Ga0207428_10175378 Ga0207428_101753784 106
363 3300028379 Ga0268266_10023185 Ga0268266_100231852 106
364 3300028381 Ga0268264_10650291 Ga0268264_106502913 106
365 3300028556 Ga0265337_1000049 Ga0265337_100004932 106
366 3300028558 Ga0265326_10000822 Ga0265326_1000082213 106
367 3300028563 Ga0265319_1000220 Ga0265319_100022022 106
368 3300028573 Ga0265334_10000083 Ga0265334_1000008342 106
369 3300028577 Ga0265318_10020851 Ga0265318_100208513 106
370 3300028653 Ga0265323_10040745 Ga0265323_100407454 106
371 3300028654 Ga0265322_10004536 Ga0265322_100045361 106
372 3300028666 Ga0265336_10001694 Ga0265336_1000169414 106
373 3300028666 Ga0265336_10004565 Ga0265336_100045655 106
374 3300028800 Ga0265338_10000358 Ga0265338_1000035855 106
375 3300028800 Ga0265338_10000940 Ga0265338_1000094012 106
376 3300028800 Ga0265338_10014758 Ga0265338_100147582 106
377 3300028800 Ga0265338_10061662 Ga0265338_100616622 106
378 3300029957 Ga0265324_10001390 Ga0265324_1000139012 106
379 3300030760 Ga0265762_1005987 Ga0265762_10059874 106
380 3300030762 Ga0265775_103046 Ga0265775_1030462 106
381 3300030762 Ga0265775_115245 Ga0265775_1152452 106
382 3300030763 Ga0265763_1025851 Ga0265763_10258512 106
383 3300030836 Ga0265767_100417 Ga0265767_1004174 106
384 3300030863 Ga0265766_1000538 Ga0265766_10005382 106
385 3300030863 Ga0265766_1016712 Ga0265766_10167122 106
386 3300030877 Ga0265777_114919 Ga0265777_1149192 106
387 3300030877 Ga0265777_125996 Ga0265777_1259961 106
388 3300030878 Ga0265770_1007774 Ga0265770_10077743 106
389 3300030882 Ga0265764_100345 Ga0265764_1003454 106
390 3300030888 Ga0265769_101486 Ga0265769_1014863 106
391 3300030888 Ga0265769_117187 Ga0265769_1171872 106
392 3300030889 Ga0265761_101512 Ga0265761_1015122 106
393 3300030889 Ga0265761_102520 Ga0265761_1025202 106
394 3300030889 Ga0265761_107242 Ga0265761_1072422 106
395 3300030942 Ga0247549_103889 Ga0247549_1038891 106
396 3300030963 Ga0265768_102649 Ga0265768_1026492 106
397 3300030963 Ga0265768_104272 Ga0265768_1042722 106
398 3300031010 Ga0265771_1001777 Ga0265771_10017772 106
399 3300031010 Ga0265771_1012352 Ga0265771_10123522 106
400 3300031090 Ga0265760_10011877 Ga0265760_100118776 106
401 3300031090 Ga0265760_10015954 Ga0265760_100159545 106
402 3300031090 Ga0265760_10016761 Ga0265760_100167614 106
403 3300031090 Ga0265760_10072545 Ga0265760_100725452 106
404 3300031238 Ga0265332_10000675 Ga0265332_1000067510 106
405 3300031240 Ga0265320_10003833 Ga0265320_1000383310 106
406 3300031241 Ga0265325_10006148 Ga0265325_100061482 106
407 3300031247 Ga0265340_10000796 Ga0265340_1000079618 106
408 3300031249 Ga0265339_10046537 Ga0265339_100465372 106
409 3300031344 Ga0265316_10007400 Ga0265316_1000740012 106
410 3300031591 Ga0310116_103289 Ga0310116_1032894 106
411 3300031592 Ga0310117_112719 Ga0310117_1127192 106
412 3300031592 Ga0310117_117491 Ga0310117_1174912 106
413 3300031595 Ga0265313_10018894 Ga0265313_100188942 106
414 3300031614 Ga0310103_104508 Ga0310103_1045082 106
415 3300031614 Ga0310103_108291 Ga0310103_1082912 106
416 3300031614 Ga0310103_129084 Ga0310103_1290842 106
417 3300031666 Ga0310105_114668 Ga0310105_1146682 106
418 3300031678 Ga0310114_111665 Ga0310114_1116652 106
419 3300031686 Ga0310119_127835 Ga0310119_1278352 106
420 3300031690 Ga0310101_105794 Ga0310101_1057944 106
421 3300031711 Ga0265314_10008203 Ga0265314_1000820310 106
422 3300031712 Ga0265342_10029921 Ga0265342_100299215 106
423 3300031814 Ga0247548_108915 Ga0247548_1089152 106
424 3300031901 Ga0307406_11732527 Ga0307406_117325271 106
425 3300033180 Ga0307510_10660135 Ga0307510_106601352 106
426 3300033544 Ga0316215_1028139 Ga0316215_10281391 106
427 3300033545 Ga0316214_1000853 Ga0316214_10008536 106
428 3300033547 Ga0316212_1007476 Ga0316212_10074762 106
429 3300033548 Ga0316216_1010539 Ga0316216_10105392 106
430 3300034816 Ga0373930_0007648 Ga0373930_0007648_1492_1821 106
431 3300034817 Ga0373948_0074115 Ga0373948_0074115_28_396 106
432 3300034818 Ga0373950_0022310 Ga0373950_0022310_758_1087 106
433 3300034819 Ga0373958_0001426 Ga0373958_0001426_935_1303 106
434 3300034820 Ga0373959_0049988 Ga0373959_0049988_71_439 106
435 3300034957 Ga0373938_0003303 Ga0373938_0003303_607_975 106
436 3300035083 Ga0373926_0029022 Ga0373926_0029022_949_1278 106
437 3300035083 Ga0373926_0302388 Ga0373926_0302388_214_543 106
438 3300035085 Ga0373929_0002602 Ga0373929_0002602_1734_2102 106
439 3300035086 Ga0373934_0000328 Ga0373934_0000328_10147_10515 106
440 3300035086 Ga0373934_0032981 Ga0373934_0032981_261_626 106
441 3300035086 Ga0373934_0060411 Ga0373934_0060411_747_1076 106
442 3300035086 Ga0373934_0114350 Ga0373934_0114350_753_1073 106
443 3300035088 Ga0373940_0048435 Ga0373940_0048435_581_910 106
444 3300035091 Ga0373951_0009688 Ga0373951_0009688_591_959 106
445 3300035092 Ga0373952_0021896 Ga0373952_0021896_582_950 106
446 3300035111 Ga0373923_0029692 Ga0373923_0029692_1213_1581 106
447 3300035111 Ga0373923_0112223 Ga0373923_0112223_395_724 106
448 3300035112 Ga0373932_0007413 Ga0373932_0007413_353_682 106
449 3300035113 Ga0373936_0097200 Ga0373936_0097200_406_735 106
450 3300035113 Ga0373936_0119229 Ga0373936_0119229_288_674 106
451 3300035113 Ga0373936_0123726 Ga0373936_0123726_402_767 106
452 3300035114 Ga0373939_0021110 Ga0373939_0021110_993_1322 106
453 3300035115 Ga0373941_0357657 Ga0373941_0357657_251_580 106
454 3300035116 Ga0373945_0108636 Ga0373945_0108636_379_708 106
455 3300035116 Ga0373945_0168616 Ga0373945_0168616_91_456 106
456 3300035116 Ga0373945_0353501 Ga0373945_0353501_145_474 106
457 3300035116 Ga0373945_0578697 Ga0373945_0578697_51_371 106
458 3300035117 Ga0373953_0000262 Ga0373953_0000262_2298_2666 106
459 3300035117 Ga0373953_0005330 Ga0373953_0005330_1610_1939 106
460 3300035117 Ga0373953_0034706 Ga0373953_0034706_107_472 106
461 3300035117 Ga0373953_0053423 Ga0373953_0053423_261_626 106
462 3300035117 Ga0373953_0055776 Ga0373953_0055776_165_530 106
463 3300035117 Ga0373953_0372084 Ga0373953_0372084_174_554 106
464 3300035118 Ga0373954_0119148 Ga0373954_0119148_85_450 106
465 3300035118 Ga0373954_0154806 Ga0373954_0154806_300_668 106
466 3300035118 Ga0373954_0215984 Ga0373954_0215984_383_748 106
467 3300035118 Ga0373954_0339640 Ga0373954_0339640_102_488 106
468 3300035118 Ga0373954_0394658 Ga0373954_0394658_193_573 106
469 3300035119 Ga0373956_0004145 Ga0373956_0004145_300_668 106
470 3300035119 Ga0373956_0007049 Ga0373956_0007049_2256_2621 106
471 3300035119 Ga0373956_0063596 Ga0373956_0063596_749_1129 106
472 3300035119 Ga0373956_0084786 Ga0373956_0084786_831_1196 106
473 3300035119 Ga0373956_0518982 Ga0373956_0518982_224_544 106
474 3300035120 Ga0373957_0000312 Ga0373957_0000312_5477_5845 106
475 3300035120 Ga0373957_0001248 Ga0373957_0001248_4421_4750 106
476 3300035120 Ga0373957_0039494 Ga0373957_0039494_692_1012 106
477 3300035120 Ga0373957_0072893 Ga0373957_0072893_261_626 106
478 3300035120 Ga0373957_0136378 Ga0373957_0136378_440_805 106
479 3300035120 Ga0373957_0250847 Ga0373957_0250847_166_552 106
480 3300035120 Ga0373957_0383216 Ga0373957_0383216_157_522 106
481 3300035121 Ga0373960_0011629 Ga0373960_0011629_1186_1554 106
482 3300035170 Ga0373943_0048034 Ga0373943_0048034_1562_1891 106
483 3300035170 Ga0373943_0156022 Ga0373943_0156022_422_808 106
484 3300035170 Ga0373943_0376761 Ga0373943_0376761_43_408 106
485 3300035172 Ga0373955_0000233 Ga0373955_0000233_7977_8345 106
486 3300035172 Ga0373955_0015005 Ga0373955_0015005_3175_3504 106
487 3300035172 Ga0373955_0032433 Ga0373955_0032433_1756_2121 106
488 3300035172 Ga0373955_0130168 Ga0373955_0130168_852_1232 106
489 3300035172 Ga0373955_0507075 Ga0373955_0507075_201_587 106
490 3300035207 Ga0373942_0019668 Ga0373942_0019668_966_1295 106
491 3300035241 Ga0373961_0007849 Ga0373961_0007849_828_1157 106
492 3300035410 Ga0373924_0016779 Ga0373924_0016779_409_777 106
493 3300035410 Ga0373924_0027702 Ga0373924_0027702_1805_2170 106
494 3300035410 Ga0373924_0159988 Ga0373924_0159988_174_554 106
495 3300035410 Ga0373924_0221717 Ga0373924_0221717_31_360 106
496 3300035691 Ga0373931_0018524 Ga0373931_0018524_923_1288 106
497 3300035691 Ga0373931_0023038 Ga0373931_0023038_1034_1402 106
498 3300035692 Ga0373935_0025535 Ga0373935_0025535_1107_1472 106
499 3300035692 Ga0373935_0089335 Ga0373935_0089335_1412_1732 106
500 3300035692 Ga0373935_0243431 Ga0373935_0243431_408_737 106
501 3300035695 Ga0373927_0068698 Ga0373927_0068698_41_406 106
502 3300035695 Ga0373927_0309110 Ga0373927_0309110_550_936 106
503 3300035695 Ga0373927_0416553 Ga0373927_0416553_31_360 106
504 3300035695 Ga0373927_0792825 Ga0373927_0792825_84_404 106
505 3300035724 Ga0373933_0000843 Ga0373933_0000843_11962_12330 106
506 3300035724 Ga0373933_0009135 Ga0373933_0009135_2229_2609 106
507 3300035724 Ga0373933_0012378 Ga0373933_0012378_1880_2209 106
508 3300035724 Ga0373933_0039537 Ga0373933_0039537_959_1324 106
509 3300035724 Ga0373933_0087053 Ga0373933_0087053_995_1360 106
510 3300035724 Ga0373933_0109284 Ga0373933_0109284_298_663 106
511 3300035725 Ga0373947_0035271 Ga0373947_0035271_2329_2715 106
512 3300035725 Ga0373947_0085364 Ga0373947_0085364_1568_1897 106
513 3300035725 Ga0373947_0201473 Ga0373947_0201473_797_1162 106
514 3300035725 Ga0373947_0613715 Ga0373947_0613715_14_379 106
515 3300036401 Ga0373937_0000112 Ga0373937_0000112_34049_34417 106
516 3300036401 Ga0373937_0007454 Ga0373937_0007454_9055_9384 106
517 3300036401 Ga0373937_0025538 Ga0373937_0025538_2336_2701 106
518 3300036401 Ga0373937_0039458 Ga0373937_0039458_3521_3886 106
519 3300036401 Ga0373937_0089360 Ga0373937_0089360_1709_2089 106
520 3300036401 Ga0373937_0507803 Ga0373937_0507803_528_848 106
521 3300036401 Ga0373937_0896568 Ga0373937_0896568_38_358 106
522 3300036457 Ga0265778_021945 Ga0265778_021945_97_417 106
523 3300036457 Ga0265778_048135 Ga0265778_048135_80_400 106
524 3300036457 Ga0265778_049055 Ga0265778_049055_82_402 106
525 3300036458 Ga0310112_013351 Ga0310112_013351_589_909 106
526 3300036459 Ga0372808_000924 Ga0372808_000924_1295_1615 106
527 3300036459 Ga0372808_003049 Ga0372808_003049_487_807 106
528 3300036534 Ga0310109_031615 Ga0310109_031615_288_608 106
529 3300037068 Ga0373925_0000004 Ga0373925_0000004_303179_303499 106
530 3300037068 Ga0373925_0001140 Ga0373925_0001140_12002_12382 106
531 3300037068 Ga0373925_0017994 Ga0373925_0017994_3532_3903 106
532 3300037068 Ga0373925_0068419 Ga0373925_0068419_740_1105 106
533 3300037068 Ga0373925_0551908 Ga0373925_0551908_218_586 106
534 3300037068 Ga0373925_1251057 Ga0373925_1251057_91_456 106
535 3300037068 Ga0373925_1798945 Ga0373925_1798945_18_383 106
536 3300037466 Ga0395898_0078143 Ga0395898_0078143_342_662 106
537 3300037853 Ga0436364_0385416 Ga0436364_0385416_1798_2118 106
538 3300037853 Ga0436364_0697983 Ga0436364_0697983_1027_1347 106
539 3300037853 Ga0436364_0741352 Ga0436364_0741352_1410_1733 106
540 3300037853 Ga0436364_1198874 Ga0436364_1198874_473_844 106
541 3300037853 Ga0436364_1316048 Ga0436364_1316048_302_625 106
542 3300038443 Ga0395901_0220498 Ga0395901_0220498_1454_1774 106
543 3300039437 Ga0436365_0791880 Ga0436365_0791880_552_872 106
544 3300039437 Ga0436365_1385863 Ga0436365_1385863_507_830 106
545 3300039437 Ga0436365_1830100 Ga0436365_1830100_482_847 106
546 3300039438 Ga0436360_0112883 Ga0436360_0112883_507_827 106
547 3300039438 Ga0436360_0712781 Ga0436360_0712781_209_529 106
548 3300039447 Ga0436361_1006107 Ga0436361_1006107_128_448 106
549 3300039450 Ga0436363_0292346 Ga0436363_0292346_312_638 106
550 3300039450 Ga0436363_0299477 Ga0436363_0299477_63_383 106
551 3300039450 Ga0436363_1625798 Ga0436363_1625798_1353_1718 106
552 3300039453 Ga0436362_0581664 Ga0436362_0581664_174_494 106
553 3300039453 Ga0436362_1089947 Ga0436362_1089947_166_489 106
554 3300044683 Ga0466965_0402567 Ga0466965_0402567_256_576 106
555 3300044684 Ga0466966_0881340 Ga0466966_0881340_165_485 106
556 3300044694 Ga0466963_0266010 Ga0466963_0266010_672_992 106
557 3300044735 Ga0466968_0130492 Ga0466968_0130492_528_887 106
558 3300044735 Ga0466968_0216604 Ga0466968_0216604_200_565 106
559 3300044735 Ga0466968_0487973 Ga0466968_0487973_16_336 106
560 3300044842 Ga0466957_0200035 Ga0466957_0200035_496_816 106
561 3300045049 Ga0466959_0293548 Ga0466959_0293548_662_1027 106
562 3300045836 Ga0466958_0103955 Ga0466958_0103955_453_773 106
563 3300045976 Ga0466967_0440340 Ga0466967_0440340_632_952 106
564 3300045976 Ga0466967_1371476 Ga0466967_1371476_59_430 106
565 3300046454 Ga0495592_0001722 Ga0495592_0001722_6451_6819 106
566 3300046454 Ga0495592_0019017 Ga0495592_0019017_2308_2637 106
567 3300046454 Ga0495592_0027974 Ga0495592_0027974_2633_2998 106
568 3300046454 Ga0495592_0036908 Ga0495592_0036908_2170_2550 106
569 3300046454 Ga0495592_0136109 Ga0495592_0136109_1103_1468 106
570 3300046455 Ga0495603_0041898 Ga0495603_0041898_968_1297 106
571 3300046459 Ga0495629_0016271 Ga0495629_0016271_4120_4485 106
572 3300046459 Ga0495629_0068955 Ga0495629_0068955_1033_1362 106
573 3300046459 Ga0495629_0136056 Ga0495629_0136056_1030_1359 106
574 3300046461 Ga0495641_0018421 Ga0495641_0018421_2715_3044 106
575 3300046461 Ga0495641_0280173 Ga0495641_0280173_17_337 106
576 3300046462 Ga0495651_0000041 Ga0495651_0000041_6502_6870 106
577 3300046462 Ga0495651_0026619 Ga0495651_0026619_1580_1945 106
578 3300046462 Ga0495651_0029113 Ga0495651_0029113_2333_2662 106
579 3300046462 Ga0495651_0048866 Ga0495651_0048866_2492_2857 106
580 3300046462 Ga0495651_0080871 Ga0495651_0080871_1899_2279 106
581 3300046462 Ga0495651_0314721 Ga0495651_0314721_473_838 106
582 3300046462 Ga0495651_0359138 Ga0495651_0359138_198_527 106
583 3300046463 Ga0495653_0008925 Ga0495653_0008925_674_1054 106
584 3300046463 Ga0495653_0068546 Ga0495653_0068546_1278_1607 106
585 3300046463 Ga0495653_0179294 Ga0495653_0179294_877_1242 106
586 3300046463 Ga0495653_0471668 Ga0495653_0471668_325_690 106
587 3300046463 Ga0495653_0664450 Ga0495653_0664450_32_352 106
588 3300046472 Ga0495580_0069109 Ga0495580_0069109_1615_1944 106
589 3300046472 Ga0495580_0394658 Ga0495580_0394658_171_491 106
590 3300046473 Ga0495582_0005320 Ga0495582_0005320_2398_2763 106
591 3300046473 Ga0495582_0039452 Ga0495582_0039452_1934_2263 106
592 3300046473 Ga0495582_0093463 Ga0495582_0093463_334_663 106
593 3300046475 Ga0495639_0034767 Ga0495639_0034767_701_1066 106
594 3300046476 Ga0495662_0004602 Ga0495662_0004602_2435_2800 106
595 3300046476 Ga0495662_0089659 Ga0495662_0089659_738_1067 106
596 3300046476 Ga0495662_0210839 Ga0495662_0210839_468_797 106
597 3300046476 Ga0495662_0500968 Ga0495662_0500968_161_547 106
598 3300046477 Ga0495664_0006941 Ga0495664_0006941_18_338 106
599 3300046477 Ga0495664_0012241 Ga0495664_0012241_4224_4553 106
600 3300046477 Ga0495664_0047317 Ga0495664_0047317_889_1275 106
601 3300046477 Ga0495664_0054637 Ga0495664_0054637_858_1178 106
602 3300046477 Ga0495664_0687100 Ga0495664_0687100_66_386 106
603 3300046499 Ga0495594_0222542 Ga0495594_0222542_734_1063 106
604 3300046511 Ga0495608_0001767 Ga0495608_0001767_6449_6817 106
605 3300046511 Ga0495608_0004661 Ga0495608_0004661_4408_4788 106
606 3300046511 Ga0495608_0031563 Ga0495608_0031563_399_764 106
607 3300046511 Ga0495608_0207881 Ga0495608_0207881_799_1164 106
608 3300046514 Ga0495618_0041548 Ga0495618_0041548_17_337 106
609 3300046514 Ga0495618_0044087 Ga0495618_0044087_434_763 106
610 3300046514 Ga0495618_0098707 Ga0495618_0098707_680_1009 106
611 3300046514 Ga0495618_0132139 Ga0495618_0132139_267_653 106
612 3300046514 Ga0495618_0255868 Ga0495618_0255868_26_391 106
613 3300046516 Ga0495628_0003221 Ga0495628_0003221_7877_8245 106
614 3300046516 Ga0495628_0025761 Ga0495628_0025761_1805_2170 106
615 3300046516 Ga0495628_0039808 Ga0495628_0039808_166_546 106
616 3300046516 Ga0495628_0081317 Ga0495628_0081317_306_635 106
617 3300046516 Ga0495628_0234239 Ga0495628_0234239_811_1176 106
618 3300046516 Ga0495628_0555864 Ga0495628_0555864_403_789 106
619 3300046517 Ga0495630_0028653 Ga0495630_0028653_434_763 106
620 3300046517 Ga0495630_0033618 Ga0495630_0033618_659_988 106
621 3300046517 Ga0495630_0061782 Ga0495630_0061782_2316_2681 106
622 3300046517 Ga0495630_0570355 Ga0495630_0570355_83_469 106
623 3300046517 Ga0495630_0904416 Ga0495630_0904416_120_500 106
624 3300046517 Ga0495630_0982556 Ga0495630_0982556_16_381 106
625 3300046526 Ga0495666_0047504 Ga0495666_0047504_1073_1402 106
626 3300046526 Ga0495666_0277385 Ga0495666_0277385_22_387 106
627 3300046529 Ga0495652_0010557 Ga0495652_0010557_5900_6280 106
628 3300046529 Ga0495652_0013883 Ga0495652_0013883_6448_6816 106
629 3300046529 Ga0495652_0016567 Ga0495652_0016567_3365_3730 106
630 3300046529 Ga0495652_0023593 Ga0495652_0023593_2591_2920 106
631 3300046529 Ga0495652_0267071 Ga0495652_0267071_462_782 106
632 3300046531 Ga0495665_0002880 Ga0495665_0002880_5741_6106 106
633 3300046531 Ga0495665_0019986 Ga0495665_0019986_1257_1586 106
634 3300046531 Ga0495665_0118219 Ga0495665_0118219_985_1314 106
635 3300046533 Ga0495640_0030637 Ga0495640_0030637_1767_2096 106
636 3300046533 Ga0495640_0032652 Ga0495640_0032652_2353_2733 106
637 3300046533 Ga0495640_0049080 Ga0495640_0049080_2403_2768 106
638 3300046533 Ga0495640_0081516 Ga0495640_0081516_741_1070 106
639 3300046533 Ga0495640_0911177 Ga0495640_0911177_43_363 106
640 3300046535 Ga0495586_0046132 Ga0495586_0046132_1804_2169 106
641 3300046535 Ga0495586_0121485 Ga0495586_0121485_99_428 106
642 3300046536 Ga0495587_0000038 Ga0495587_0000038_81702_82070 106
643 3300046536 Ga0495587_0019029 Ga0495587_0019029_1849_2229 106
644 3300046536 Ga0495587_0040683 Ga0495587_0040683_1549_1878 106
645 3300046536 Ga0495587_0047578 Ga0495587_0047578_1347_1712 106
646 3300046543 Ga0495645_0025092 Ga0495645_0025092_2555_2920 106
647 3300046543 Ga0495645_0054078 Ga0495645_0054078_835_1164 106
648 3300046543 Ga0495645_0147073 Ga0495645_0147073_835_1221 106
649 3300046543 Ga0495645_0188261 Ga0495645_0188261_1003_1368 106
650 3300046543 Ga0495645_0210647 Ga0495645_0210647_759_1139 106
651 3300046559 Ga0495667_0000445 Ga0495667_0000445_22064_22444 106
652 3300046559 Ga0495667_0000985 Ga0495667_0000985_9467_9835 106
653 3300046559 Ga0495667_0002803 Ga0495667_0002803_7398_7763 106
654 3300046559 Ga0495667_0021959 Ga0495667_0021959_2426_2755 106
655 3300046642 Ga0495634_0014303 Ga0495634_0014303_2633_2998 106
656 3300046642 Ga0495634_0016396 Ga0495634_0016396_3699_4028 106
657 3300046642 Ga0495634_0071383 Ga0495634_0071383_1397_1726 106
658 3300046642 Ga0495634_0114595 Ga0495634_0114595_681_1067 106
659 3300046663 Ga0495635_0007096 Ga0495635_0007096_5564_5944 106
660 3300046663 Ga0495635_0023342 Ga0495635_0023342_2728_3093 106
661 3300046663 Ga0495635_0071799 Ga0495635_0071799_1032_1361 106
662 3300046663 Ga0495635_0122343 Ga0495635_0122343_413_742 106
663 3300046674 Ga0495588_0125340 Ga0495588_0125340_513_842 106
664 3300046675 Ga0495657_0002519 Ga0495657_0002519_6434_6802 106
665 3300046675 Ga0495657_0005213 Ga0495657_0005213_7108_7488 106
666 3300046675 Ga0495657_0014816 Ga0495657_0014816_879_1244 106
667 3300046675 Ga0495657_0018704 Ga0495657_0018704_831_1196 106
668 3300046675 Ga0495657_0044000 Ga0495657_0044000_434_763 106
669 3300046678 Ga0495599_0000100 Ga0495599_0000100_6449_6817 106
670 3300046678 Ga0495599_0005877 Ga0495599_0005877_6176_6541 106
671 3300046678 Ga0495599_0020499 Ga0495599_0020499_510_875 106
672 3300046678 Ga0495599_0058622 Ga0495599_0058622_1646_1975 106
673 3300046678 Ga0495599_0071792 Ga0495599_0071792_362_742 106
674 3300046678 Ga0495599_0489233 Ga0495599_0489233_133_498 106
675 3300046679 Ga0495623_0030013 Ga0495623_0030013_1130_1510 106
676 3300046679 Ga0495623_0036882 Ga0495623_0036882_1068_1433 106
677 3300046679 Ga0495623_0328836 Ga0495623_0328836_292_678 106
678 3300046680 Ga0495646_0023289 Ga0495646_0023289_1881_2210 106
679 3300046680 Ga0495646_0094885 Ga0495646_0094885_1315_1701 106
680 3300046680 Ga0495646_0126398 Ga0495646_0126398_157_525 106
681 3300046681 Ga0495647_0073081 Ga0495647_0073081_385_714 106
682 3300046683 Ga0495658_0037949 Ga0495658_0037949_579_908 106
683 3300046683 Ga0495658_0156765 Ga0495658_0156765_485_850 106
684 3300046689 Ga0495613_0004973 Ga0495613_0004973_2315_2680 106
685 3300046689 Ga0495613_0054488 Ga0495613_0054488_1168_1497 106
686 3300046690 Ga0495624_0006742 Ga0495624_0006742_7408_7773 106
687 3300046690 Ga0495624_0101714 Ga0495624_0101714_775_1104 106
688 3300046690 Ga0495624_0273946 Ga0495624_0273946_154_540 106
689 3300046690 Ga0495624_0374248 Ga0495624_0374248_273_638 106
690 3300046809 Ga0495600_0021742 Ga0495600_0021742_3351_3680 106
691 3300046809 Ga0495600_0033758 Ga0495600_0033758_2332_2712 106
692 3300046809 Ga0495600_0034389 Ga0495600_0034389_1966_2331 106
693 3300046809 Ga0495600_0241977 Ga0495600_0241977_243_572 106
694 3300046809 Ga0495600_0287517 Ga0495600_0287517_454_819 106
695 3300047315 Ga0495581_0007649 Ga0495581_0007649_4237_4602 106
696 3300047315 Ga0495581_0031164 Ga0495581_0031164_2702_3022 106
697 3300047315 Ga0495581_0083298 Ga0495581_0083298_1391_1720 106
698 3300047317 Ga0495604_0000061 Ga0495604_0000061_87291_87659 106
699 3300047317 Ga0495604_0020965 Ga0495604_0020965_4282_4662 106
700 3300047317 Ga0495604_0023815 Ga0495604_0023815_2260_2589 106
701 3300047317 Ga0495604_0090980 Ga0495604_0090980_493_858 106
702 3300047317 Ga0495604_0288404 Ga0495604_0288404_328_693 106
703 3300047317 Ga0495604_0323474 Ga0495604_0323474_612_998 106
704 3300047319 Ga0495674_0045071 Ga0495674_0045071_402_782 106
705 3300047319 Ga0495674_0063469 Ga0495674_0063469_118_483 106
706 3300047319 Ga0495674_0063741 Ga0495674_0063741_2537_2923 106
707 3300047319 Ga0495674_0096092 Ga0495674_0096092_2188_2508 106
708 3300047319 Ga0495674_0173934 Ga0495674_0173934_413_742 106
709 3300047319 Ga0495674_0262545 Ga0495674_0262545_677_1006 106
710 3300047321 Ga0495676_0141456 Ga0495676_0141456_535_921 106
711 3300047321 Ga0495676_0533015 Ga0495676_0533015_32_361 106
712 3300047322 Ga0495680_0003514 Ga0495680_0003514_8558_8926 106
713 3300047322 Ga0495680_0031237 Ga0495680_0031237_1653_2033 106
714 3300047322 Ga0495680_0065787 Ga0495680_0065787_959_1324 106
715 3300047322 Ga0495680_0086063 Ga0495680_0086063_391_720 106
716 3300047322 Ga0495680_0138006 Ga0495680_0138006_246_611 106
717 3300047322 Ga0495680_0328199 Ga0495680_0328199_516_845 106
718 3300047444 Ga0495675_0002156 Ga0495675_0002156_8609_8974 106
719 3300047444 Ga0495675_0003593 Ga0495675_0003593_2536_2904 106
720 3300047444 Ga0495675_0019155 Ga0495675_0019155_1811_2191 106
721 3300047444 Ga0495675_0123411 Ga0495675_0123411_328_693 106
722 3300047471 Ga0495684_0044908 Ga0495684_0044908_1278_1658 106
723 3300047471 Ga0495684_0058007 Ga0495684_0058007_521_850 106
724 3300047471 Ga0495684_0061787 Ga0495684_0061787_1078_1443 106
725 3300047471 Ga0495684_0453541 Ga0495684_0453541_374_703 106
726 3300047673 Ga0495593_0009590 Ga0495593_0009590_860_1225 106
727 3300047673 Ga0495593_0081220 Ga0495593_0081220_316_645 106
728 3300047673 Ga0495593_0091946 Ga0495593_0091946_800_1129 106
729 3300048088 Ga0495602_0004271 Ga0495602_0004271_8617_8985 106
730 3300048088 Ga0495602_0023507 Ga0495602_0023507_5565_5945 106
731 3300048088 Ga0495602_0036394 Ga0495602_0036394_2251_2616 106
732 3300048088 Ga0495602_0040512 Ga0495602_0040512_794_1159 106
733 3300048089 Ga0495614_0006961 Ga0495614_0006961_1113_1478 106
734 3300048089 Ga0495614_0231767 Ga0495614_0231767_267_596 106
735 3300048903 Ga0496100_0034483 Ga0496100_0034483_1178_1546 106
736 3300048903 Ga0496100_0151745 Ga0496100_0151745_785_1171 106
737 3300048905 Ga0496102_0031789 Ga0496102_0031789_2947_3276 106
738 3300048905 Ga0496102_0096410 Ga0496102_0096410_1488_1874 106
739 3300048905 Ga0496102_1618265 Ga0496102_1618265_51_371 106
740 3300048906 Ga0496103_0131820 Ga0496103_0131820_661_1029 106
741 3300048907 Ga0496104_0001325 Ga0496104_0001325_7159_7545 106
742 3300048907 Ga0496104_0085657 Ga0496104_0085657_1880_2209 106
743 3300048908 Ga0496105_0000744 Ga0496105_0000744_13414_13800 106
744 3300048908 Ga0496105_0025654 Ga0496105_0025654_2667_2996 106
745 3300048909 Ga0496106_0198905 Ga0496106_0198905_518_847 106
746 3300048909 Ga0496106_0293908 Ga0496106_0293908_66_452 106
747 3300048910 Ga0496107_0003098 Ga0496107_0003098_3451_3780 106
748 3300048911 Ga0496108_0002190 Ga0496108_0002190_13553_13939 106
749 3300048911 Ga0496108_0047492 Ga0496108_0047492_2311_2679 106
750 3300048911 Ga0496108_0796840 Ga0496108_0796840_290_610 106
751 3300048912 Ga0496109_0013057 Ga0496109_0013057_6133_6519 106
752 3300048912 Ga0496109_0083528 Ga0496109_0083528_1662_1991 106
753 3300048914 Ga0496111_0195292 Ga0496111_0195292_564_893 106
754 3300048915 Ga0496112_0001139 Ga0496112_0001139_7370_7756 106
755 3300048915 Ga0496112_0028330 Ga0496112_0028330_1880_2209 106
756 3300048915 Ga0496112_0584377 Ga0496112_0584377_431_751 106
757 3300048916 Ga0496113_0008126 Ga0496113_0008126_4822_5208 106
758 3300048916 Ga0496113_0031782 Ga0496113_0031782_2843_3172 106
759 3300048916 Ga0496113_0759848 Ga0496113_0759848_13_333 106
760 3300048917 Ga0496114_0010283 Ga0496114_0010283_4223_4552 106
761 3300048917 Ga0496114_0027524 Ga0496114_0027524_4096_4482 106
762 3300048918 Ga0496115_0004035 Ga0496115_0004035_7909_8238 106
763 3300048918 Ga0496115_0015962 Ga0496115_0015962_1396_1782 106
764 3300048918 Ga0496115_0101468 Ga0496115_0101468_1959_2279 106
765 3300048929 Ga0496126_0043842 Ga0496126_0043842_315_635 106
766 3300048929 Ga0496126_0111838 Ga0496126_0111838_1744_2064 106
767 3300048929 Ga0496126_0421231 Ga0496126_0421231_363_683 106
768 3300050507 nmdc:mga05p37_31729_c1 nmdc:mga05p37_31729_c1_4650_5018 106
769 3300050511 nmdc:mga08y16_238967_c1 nmdc:mga08y16_238967_c1_906_1274 106
770 3300050512 nmdc:mga0n895_1944188_c1 nmdc:mga0n895_1944188_c1_196_516 106
771 3300050512 nmdc:mga0n895_207347_c1 nmdc:mga0n895_207347_c1_131_496 106
772 3300050512 nmdc:mga0n895_463554_c1 nmdc:mga0n895_463554_c1_352_681 106
773 3300050512 nmdc:mga0n895_93657_c1 nmdc:mga0n895_93657_c1_1577_1945 106
774 3300050513 nmdc:mga0rr50_32817_c1 nmdc:mga0rr50_32817_c1_2078_2443 106
775 3300050513 nmdc:mga0rr50_6896_c1 nmdc:mga0rr50_6896_c1_4624_4953 106
776 3300050513 nmdc:mga0rr50_9558_c1 nmdc:mga0rr50_9558_c1_4814_5182 106
777 3300050514 nmdc:mga08x19_115058_c1 nmdc:mga08x19_115058_c1_301_669 106
778 3300050514 nmdc:mga08x19_16321_c1 nmdc:mga08x19_16321_c1_3787_4116 106
779 3300050514 nmdc:mga08x19_32682_c1 nmdc:mga08x19_32682_c1_2773_3138 106
780 3300050515 nmdc:mga0a205_3984_c1 nmdc:mga0a205_3984_c1_421_786 106
781 3300053077 Ga0495601_0037098 Ga0495601_0037098_2082_2411 106
782 3300053077 Ga0495601_0038877 Ga0495601_0038877_1407_1772 106
783 3300053077 Ga0495601_0104587 Ga0495601_0104587_117_497 106
784 3300053077 Ga0495601_0136955 Ga0495601_0136955_1008_1394 106
785 3300053077 Ga0495601_0212874 Ga0495601_0212874_269_598 106
786 3300053077 Ga0495601_0650365 Ga0495601_0650365_227_592 106
787 3300053078 Ga0495612_0029952 Ga0495612_0029952_833_1162 106
788 3300053078 Ga0495612_0033074 Ga0495612_0033074_17_337 106
789 3300053084 Ga0495595_0008946 Ga0495595_0008946_2286_2615 106
790 3300053084 Ga0495595_0012574 Ga0495595_0012574_2475_2840 106
791 3300053085 Ga0495619_0007700 Ga0495619_0007700_2315_2680 106
792 3300053085 Ga0495619_0024282 Ga0495619_0024282_3069_3449 106
793 3300053085 Ga0495619_0074722 Ga0495619_0074722_1646_1975 106
794 3300059477 Ga0587084_083896 Ga0587084_083896_277_600 106
795 3300059490 Ga0587066_106195 Ga0587066_106195_189_509 106
796 3300059491 Ga0587070_028468 Ga0587070_028468_283_603 106
797 3300059492 Ga0587073_0157346 Ga0587073_0157346_175_495 106
798 3300059507 Ga0587086_089771 Ga0587086_089771_103_423 106
799 3300059511 Ga0587091_049644 Ga0587091_049644_209_529 106
800 3300059512 Ga0587092_072959 Ga0587092_072959_109_429 106
801 3300059623 Ga0587101_118345 Ga0587101_118345_133_453 106
802 3300059624 Ga0587109_119655 Ga0587109_119655_291_611 106
803 3300059640 Ga0587067_016763 Ga0587067_016763_245_565 106
804 3300059641 Ga0587068_100235 Ga0587068_100235_107_427 106
805 3300060346 Ga0587111_0081692 Ga0587111_0081692_218_538 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00467

KOW

KOW motif

25

56

0.97

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

58

128

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gsk-assembly2.cif.gz_C5 structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site 0.9444 1 75
5xym-assembly1.cif.gz_U large subunit of mycobacterium smegmatis 0.9384 1 106
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9314 1 106
5xym-assembly1.cif.gz_U large subunit of mycobacterium smegmatis 0.9279 1 106
5o61-assembly1.cif.gz_V the complete structure of the mycobacterium smegmatis 70s ribosome 0.9231 1 106
ID Description Score Start End Superfamily
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9357 1 104 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9014 1 104 2.30.30.30
af_Q96A35_47_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8925 3 104 2.30.30.30
1nppD03 Mainly Beta;Roll;SH3 type barrels.; 0.8917 4 35 2.30.30.30
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8895 3 36 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2H0RJH9-F1-model_v4 Large ribosomal subunit protein uL24 0.939 1 76 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0G0KQN0-F1-model_v4 Large ribosomal subunit protein uL24 0.9377 1 76 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F7BQA3-F1-model_v4 Large ribosomal subunit protein uL24 0.9368 1 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1A9QE29-F1-model_v4 Large ribosomal subunit protein uL24 0.9268 1 106 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2H0RJH9-F1-model_v4 Large ribosomal subunit protein uL24 0.9266 1 76 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
82.74 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map