F481584
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 805 | 319 | 805 | 115 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_101261010|Ga0068869_1012610102 |
| Length | 128 |
| Sequence | MTTRKKGAMAKKDAAGRPPRMKIKKGDHVVVISGRDAGREGTVILADPERQRVLVQGVNMVHKNKKVDYQGRGAGGSKQGGIINTEALIHVSNVQLIDPDTKKPARAGYRYDENGAKIRVSRPGGKDF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 53 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300019183 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 79 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 80 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 84 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 90 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 91 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300023660 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 97 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 138 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 143 | 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 144 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 148 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 149 | 3300030882 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300030889 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 152 | 3300030942 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 153 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 155 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031591 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 163 | 3300031592 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031614 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 166 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 167 | 3300031678 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 168 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 169 | 3300031690 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 170 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 176 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 177 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 178 | 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Metagenome | Unclassified |
| 179 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 180 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 181 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 182 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 185 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 186 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 187 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 211 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 215 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 216 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 226 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041508 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaT | Metatranscriptome | Unclassified |
| 229 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.96 |
| Metatranscriptomes | 14.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.98 |
| Rhizosphere | 90.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058863_10087617 | 3300004799 | Bacteria | 1342 |
| 2 | Ga0058861_10050561 | 3300004800 | Bacteria | 2533 |
| 3 | Ga0058861_10187278 | 3300004800 | Bacteria | 1075 |
| 4 | Ga0058862_10129161 | 3300004803 | Bacteria | 996 |
| 5 | Ga0058862_12484301 | 3300004803 | Bacteria | 914 |
| 6 | Ga0070658_10088897 | 3300005327 | Bacteria | 2543 |
| 7 | Ga0070683_100186457 | 3300005329 | Bacteria | 1969 |
| 8 | Ga0070683_100245669 | 3300005329 | Bacteria | 1702 |
| 9 | Ga0070683_101336258 | 3300005329 | Bacteria | 689 |
| 10 | Ga0068869_101261010 | 3300005334 | Bacteria | 651 |
| 11 | Ga0070680_100067854 | 3300005336 | Bacteria | 2926 |
| 12 | Ga0070680_100472511 | 3300005336 | Bacteria | 1072 |
| 13 | Ga0070680_100920382 | 3300005336 | Bacteria | 754 |
| 14 | Ga0070682_100048057 | 3300005337 | Bacteria | 2655 |
| 15 | Ga0070682_100075432 | 3300005337 | Bacteria | 2168 |
| 16 | Ga0070660_100362640 | 3300005339 | Bacteria | 1194 |
| 17 | Ga0070691_10743503 | 3300005341 | Bacteria | 592 |
| 18 | Ga0070661_100201326 | 3300005344 | Bacteria | 1522 |
| 19 | Ga0070671_100252590 | 3300005355 | Bacteria | 1498 |
| 20 | Ga0070709_10000382 | 3300005434 | Bacteria | 27333 |
| 21 | Ga0070709_10020576 | 3300005434 | Bacteria | 3830 |
| 22 | Ga0070709_10173185 | 3300005434 | Bacteria | 1510 |
| 23 | Ga0070709_10879235 | 3300005434 | Bacteria | 707 |
| 24 | Ga0070714_100001124 | 3300005435 | Bacteria | 19227 |
| 25 | Ga0070714_100003109 | 3300005435 | Bacteria | 12330 |
| 26 | Ga0070714_100005961 | 3300005435 | Bacteria | 9359 |
| 27 | Ga0070714_100067826 | 3300005435 | Bacteria | 3077 |
| 28 | Ga0070714_100111149 | 3300005435 | Bacteria | 2426 |
| 29 | Ga0070714_100239174 | 3300005435 | Bacteria | 1675 |
| 30 | Ga0070714_100389436 | 3300005435 | Bacteria | 1315 |
| 31 | Ga0070714_101572057 | 3300005435 | Bacteria | 642 |
| 32 | Ga0070713_100001233 | 3300005436 | Bacteria | 16350 |
| 33 | Ga0070713_100030847 | 3300005436 | Bacteria | 4264 |
| 34 | Ga0070713_100092635 | 3300005436 | Bacteria | 2602 |
| 35 | Ga0070713_100223624 | 3300005436 | Bacteria | 1708 |
| 36 | Ga0070713_100227446 | 3300005436 | Bacteria | 1694 |
| 37 | Ga0070713_100377852 | 3300005436 | Bacteria | 1319 |
| 38 | Ga0070713_100400705 | 3300005436 | Bacteria | 1281 |
| 39 | Ga0070713_101079577 | 3300005436 | Bacteria | 775 |
| 40 | Ga0070713_101538726 | 3300005436 | Bacteria | 645 |
| 41 | Ga0070713_101732303 | 3300005436 | Bacteria | 606 |
| 42 | Ga0070710_10000437 | 3300005437 | Bacteria | 19522 |
| 43 | Ga0070710_10009084 | 3300005437 | Bacteria | 4859 |
| 44 | Ga0070710_10019019 | 3300005437 | Bacteria | 3544 |
| 45 | Ga0070710_10038529 | 3300005437 | Bacteria | 2626 |
| 46 | Ga0070710_10249275 | 3300005437 | Bacteria | 1141 |
| 47 | Ga0070710_10512930 | 3300005437 | Bacteria | 822 |
| 48 | Ga0070710_11115486 | 3300005437 | Bacteria | 580 |
| 49 | Ga0070711_100017511 | 3300005439 | Bacteria | 4563 |
| 50 | Ga0070711_100045638 | 3300005439 | Bacteria | 2982 |
| 51 | Ga0070711_100102272 | 3300005439 | Bacteria | 2087 |
| 52 | Ga0070711_100527905 | 3300005439 | Bacteria | 976 |
| 53 | Ga0070705_100112618 | 3300005440 | Bacteria | 1741 |
| 54 | Ga0070708_100073925 | 3300005445 | Bacteria | 3073 |
| 55 | Ga0070708_100101804 | 3300005445 | Bacteria | 2631 |
| 56 | Ga0070708_100111554 | 3300005445 | Bacteria | 2514 |
| 57 | Ga0070708_100467745 | 3300005445 | Bacteria | 1189 |
| 58 | Ga0070708_100481855 | 3300005445 | Bacteria | 1170 |
| 59 | Ga0070708_100702517 | 3300005445 | Bacteria | 952 |
| 60 | Ga0070708_102237466 | 3300005445 | Bacteria | 505 |
| 61 | Ga0070663_100145197 | 3300005455 | Bacteria | 1815 |
| 62 | Ga0070663_100190100 | 3300005455 | Bacteria | 1597 |
| 63 | Ga0070663_100722200 | 3300005455 | Bacteria | 848 |
| 64 | Ga0070678_100338566 | 3300005456 | Bacteria | 1290 |
| 65 | Ga0070681_10567682 | 3300005458 | Bacteria | 1048 |
| 66 | Ga0070706_100001216 | 3300005467 | Bacteria | 27559 |
| 67 | Ga0070706_100003720 | 3300005467 | Bacteria | 14916 |
| 68 | Ga0070706_100041850 | 3300005467 | Bacteria | 4231 |
| 69 | Ga0070706_100094440 | 3300005467 | Bacteria | 2775 |
| 70 | Ga0070706_100105887 | 3300005467 | Bacteria | 2617 |
| 71 | Ga0070706_100178715 | 3300005467 | Bacteria | 1981 |
| 72 | Ga0070706_100257139 | 3300005467 | Bacteria | 1630 |
| 73 | Ga0070706_100268164 | 3300005467 | Bacteria | 1593 |
| 74 | Ga0070706_100953912 | 3300005467 | Bacteria | 791 |
| 75 | Ga0070706_101884222 | 3300005467 | Bacteria | 543 |
| 76 | Ga0070707_100011795 | 3300005468 | Bacteria | 8160 |
| 77 | Ga0070707_100098495 | 3300005468 | Bacteria | 2832 |
| 78 | Ga0070707_100197595 | 3300005468 | Bacteria | 1961 |
| 79 | Ga0070707_100260221 | 3300005468 | Bacteria | 1688 |
| 80 | Ga0070707_100332689 | 3300005468 | Bacteria | 1476 |
| 81 | Ga0070707_101759611 | 3300005468 | Bacteria | 587 |
| 82 | Ga0070698_100001882 | 3300005471 | Bacteria | 23378 |
| 83 | Ga0070698_100007360 | 3300005471 | Bacteria | 11918 |
| 84 | Ga0070698_100009167 | 3300005471 | Bacteria | 10622 |
| 85 | Ga0070698_100018293 | 3300005471 | Bacteria | 7379 |
| 86 | Ga0070698_100034346 | 3300005471 | Bacteria | 5249 |
| 87 | Ga0070698_100065182 | 3300005471 | Bacteria | 3668 |
| 88 | Ga0070698_100084017 | 3300005471 | Bacteria | 3173 |
| 89 | Ga0070698_100099685 | 3300005471 | Bacteria | 2878 |
| 90 | Ga0070698_100163572 | 3300005471 | Bacteria | 2168 |
| 91 | Ga0070698_100177424 | 3300005471 | Bacteria | 2069 |
| 92 | Ga0070698_100521425 | 3300005471 | Bacteria | 1127 |
| 93 | Ga0070699_100169232 | 3300005518 | Bacteria | 1936 |
| 94 | Ga0070679_101090515 | 3300005530 | Bacteria | 743 |
| 95 | Ga0070679_101351359 | 3300005530 | Bacteria | 658 |
| 96 | Ga0070684_100108391 | 3300005535 | Bacteria | 2488 |
| 97 | Ga0070697_100066801 | 3300005536 | Bacteria | 2940 |
| 98 | Ga0070697_100763184 | 3300005536 | Bacteria | 855 |
| 99 | Ga0070697_101165370 | 3300005536 | Bacteria | 686 |
| 100 | Ga0070697_101942639 | 3300005536 | Bacteria | 527 |
| 101 | Ga0070697_102109545 | 3300005536 | Bacteria | 505 |
| 102 | Ga0068853_100493092 | 3300005539 | Bacteria | 1156 |
| 103 | Ga0070695_101599897 | 3300005545 | Bacteria | 544 |
| 104 | Ga0070696_100084890 | 3300005546 | Bacteria | 2247 |
| 105 | Ga0070696_101124184 | 3300005546 | Bacteria | 661 |
| 106 | Ga0070704_100654605 | 3300005549 | Bacteria | 928 |
| 107 | Ga0068855_101155889 | 3300005563 | Bacteria | 807 |
| 108 | Ga0068855_102077002 | 3300005563 | Bacteria | 573 |
| 109 | Ga0070664_102074122 | 3300005564 | Bacteria | 540 |
| 110 | Ga0068857_100611783 | 3300005577 | Bacteria | 1030 |
| 111 | Ga0068854_101621514 | 3300005578 | Bacteria | 590 |
| 112 | Ga0068856_100014944 | 3300005614 | Bacteria | 7496 |
| 113 | Ga0068856_100144813 | 3300005614 | Bacteria | 2383 |
| 114 | Ga0068856_100256540 | 3300005614 | Bacteria | 1763 |
| 115 | Ga0068864_100232132 | 3300005618 | Bacteria | 1707 |
| 116 | Ga0068863_100407865 | 3300005841 | Bacteria | 1330 |
| 117 | Ga0068858_100485400 | 3300005842 | Bacteria | 1193 |
| 118 | Ga0068858_101272031 | 3300005842 | Bacteria | 724 |
| 119 | Ga0068860_102180995 | 3300005843 | Bacteria | 575 |
| 120 | Ga0081455_10251481 | 3300005937 | Bacteria | 1292 |
| 121 | Ga0081540_1002039 | 3300005983 | Bacteria | 16850 |
| 122 | Ga0070717_10010919 | 3300006028 | Bacteria | 6876 |
| 123 | Ga0070717_10030218 | 3300006028 | Bacteria | 4353 |
| 124 | Ga0070717_10035630 | 3300006028 | Bacteria | 4030 |
| 125 | Ga0070717_10178591 | 3300006028 | Bacteria | 1849 |
| 126 | Ga0070717_10205554 | 3300006028 | Bacteria | 1726 |
| 127 | Ga0070717_10213398 | 3300006028 | Bacteria | 1695 |
| 128 | Ga0070717_10310893 | 3300006028 | Bacteria | 1402 |
| 129 | Ga0070717_10323495 | 3300006028 | Bacteria | 1374 |
| 130 | Ga0070717_10567360 | 3300006028 | Bacteria | 1028 |
| 131 | Ga0070717_10961811 | 3300006028 | Bacteria | 778 |
| 132 | Ga0070717_11067551 | 3300006028 | Bacteria | 735 |
| 133 | Ga0070717_11150319 | 3300006028 | Bacteria | 706 |
| 134 | Ga0070717_11335078 | 3300006028 | Bacteria | 652 |
| 135 | Ga0070717_11469512 | 3300006028 | Bacteria | 618 |
| 136 | Ga0070715_10001006 | 3300006163 | Bacteria | 7922 |
| 137 | Ga0070715_10053222 | 3300006163 | Bacteria | 1749 |
| 138 | Ga0070716_100000511 | 3300006173 | Bacteria | 16168 |
| 139 | Ga0070716_100003131 | 3300006173 | Bacteria | 7731 |
| 140 | Ga0070716_100079914 | 3300006173 | Bacteria | 1948 |
| 141 | Ga0070716_100185330 | 3300006173 | Bacteria | 1370 |
| 142 | Ga0070716_100477791 | 3300006173 | Bacteria | 914 |
| 143 | Ga0070716_100679952 | 3300006173 | Bacteria | 784 |
| 144 | Ga0070716_101316365 | 3300006173 | Bacteria | 584 |
| 145 | Ga0070712_100001287 | 3300006175 | Bacteria | 15146 |
| 146 | Ga0070712_100389699 | 3300006175 | Bacteria | 1148 |
| 147 | Ga0070712_100422846 | 3300006175 | Bacteria | 1104 |
| 148 | Ga0070712_100570172 | 3300006175 | Bacteria | 955 |
| 149 | Ga0068871_100107345 | 3300006358 | Bacteria | 2345 |
| 150 | Ga0075428_100107848 | 3300006844 | Bacteria | 3035 |
| 151 | Ga0075431_101399628 | 3300006847 | Bacteria | 659 |
| 152 | Ga0075433_10004127 | 3300006852 | Bacteria | 11262 |
| 153 | Ga0075433_10015253 | 3300006852 | Bacteria | 6298 |
| 154 | Ga0075434_100016693 | 3300006871 | Bacteria | 7062 |
| 155 | Ga0075434_100041293 | 3300006871 | Bacteria | 4570 |
| 156 | Ga0075434_100609782 | 3300006871 | Bacteria | 1110 |
| 157 | Ga0075434_101203518 | 3300006871 | Bacteria | 770 |
| 158 | Ga0075436_100020129 | 3300006914 | Bacteria | 4580 |
| 159 | Ga0075436_100072403 | 3300006914 | Bacteria | 2384 |
| 160 | Ga0075436_100275799 | 3300006914 | Bacteria | 1201 |
| 161 | Ga0075435_100016080 | 3300007076 | Bacteria | 5636 |
| 162 | Ga0075435_100081437 | 3300007076 | Bacteria | 2659 |
| 163 | Ga0075435_100161520 | 3300007076 | Bacteria | 1887 |
| 164 | Ga0075435_100357826 | 3300007076 | Bacteria | 1252 |
| 165 | Ga0075435_100829136 | 3300007076 | Bacteria | 806 |
| 166 | Ga0099794_10015745 | 3300007265 | Bacteria | 3343 |
| 167 | Ga0099794_10751760 | 3300007265 | Bacteria | 521 |
| 168 | Ga0099794_10753436 | 3300007265 | Bacteria | 520 |
| 169 | Ga0105240_10326462 | 3300009093 | Bacteria | 1747 |
| 170 | Ga0111539_10276546 | 3300009094 | Bacteria | 1954 |
| 171 | Ga0105245_10117718 | 3300009098 | Bacteria | 2478 |
| 172 | Ga0105245_13118014 | 3300009098 | Bacteria | 514 |
| 173 | Ga0105247_10360370 | 3300009101 | Bacteria | 1025 |
| 174 | Ga0114129_10025444 | 3300009147 | Bacteria | 8387 |
| 175 | Ga0114129_12113893 | 3300009147 | Bacteria | 679 |
| 176 | Ga0105241_11291982 | 3300009174 | Bacteria | 694 |
| 177 | Ga0105241_11402457 | 3300009174 | Bacteria | 669 |
| 178 | Ga0105237_10207460 | 3300009545 | Bacteria | 1960 |
| 179 | Ga0105239_10213868 | 3300010375 | Bacteria | 2161 |
| 180 | Ga0105239_10907364 | 3300010375 | Bacteria | 1011 |
| 181 | Ga0105239_12860447 | 3300010375 | Bacteria | 563 |
| 182 | Ga0105246_10611449 | 3300011119 | Bacteria | 943 |
| 183 | Ga0157371_10176020 | 3300013102 | Bacteria | 1530 |
| 184 | Ga0157370_10036228 | 3300013104 | Bacteria | 4789 |
| 185 | Ga0157370_10693410 | 3300013104 | Bacteria | 930 |
| 186 | Ga0157370_12017761 | 3300013104 | Bacteria | 517 |
| 187 | Ga0157369_10224100 | 3300013105 | Bacteria | 1967 |
| 188 | Ga0157369_10343337 | 3300013105 | Bacteria | 1551 |
| 189 | Ga0157369_10503476 | 3300013105 | Bacteria | 1253 |
| 190 | Ga0157378_10473139 | 3300013297 | Bacteria | 1247 |
| 191 | Ga0163162_10333055 | 3300013306 | Bacteria | 1650 |
| 192 | Ga0157372_10874280 | 3300013307 | Bacteria | 1043 |
| 193 | Ga0157372_12905783 | 3300013307 | Bacteria | 549 |
| 194 | Ga0157372_12972637 | 3300013307 | Bacteria | 542 |
| 195 | Ga0157379_11510309 | 3300014968 | Bacteria | 654 |
| 196 | Ga0157376_10296265 | 3300014969 | Bacteria | 1529 |
| 197 | Ga0184602_110879 | 3300019161 | Bacteria | 502 |
| 198 | Ga0184598_105504 | 3300019182 | Bacteria | 587 |
| 199 | Ga0184601_132300 | 3300019183 | Bacteria | 711 |
| 200 | Ga0184599_144470 | 3300019188 | Bacteria | 1148 |
| 201 | Ga0184599_148056 | 3300019188 | Bacteria | 653 |
| 202 | Ga0184600_101748 | 3300019190 | Bacteria | 1242 |
| 203 | Ga0184600_125102 | 3300019190 | Bacteria | 1304 |
| 204 | Ga0184600_131170 | 3300019190 | Bacteria | 1574 |
| 205 | Ga0184603_142199 | 3300019192 | Bacteria | 1801 |
| 206 | Ga0197907_10140557 | 3300020069 | Bacteria | 1000 |
| 207 | Ga0197907_10560617 | 3300020069 | Bacteria | 1171 |
| 208 | Ga0197907_11410793 | 3300020069 | Bacteria | 8364 |
| 209 | Ga0206356_10113528 | 3300020070 | Bacteria | 679 |
| 210 | Ga0206356_10231414 | 3300020070 | Bacteria | 1218 |
| 211 | Ga0206356_10627949 | 3300020070 | Bacteria | 3194 |
| 212 | Ga0206356_11122293 | 3300020070 | Bacteria | 3054 |
| 213 | Ga0206349_1085727 | 3300020075 | Bacteria | 576 |
| 214 | Ga0206349_1093562 | 3300020075 | Bacteria | 676 |
| 215 | Ga0206355_1081850 | 3300020076 | Bacteria | 2382 |
| 216 | Ga0206355_1146852 | 3300020076 | Bacteria | 925 |
| 217 | Ga0206355_1475090 | 3300020076 | Bacteria | 602 |
| 218 | Ga0206351_10172658 | 3300020077 | Bacteria | 1372 |
| 219 | Ga0206351_10189769 | 3300020077 | Bacteria | 1516 |
| 220 | Ga0206351_10935693 | 3300020077 | Bacteria | 718 |
| 221 | Ga0206351_10966915 | 3300020077 | Bacteria | 1786 |
| 222 | Ga0206352_10550210 | 3300020078 | Bacteria | 591 |
| 223 | Ga0206352_10797554 | 3300020078 | Bacteria | 854 |
| 224 | Ga0206352_11071090 | 3300020078 | Bacteria | 3529 |
| 225 | Ga0206352_11237361 | 3300020078 | Bacteria | 1190 |
| 226 | Ga0206350_10457115 | 3300020080 | Bacteria | 2167 |
| 227 | Ga0206350_10589439 | 3300020080 | Bacteria | 1842 |
| 228 | Ga0206350_11271940 | 3300020080 | Bacteria | 892 |
| 229 | Ga0206350_11664796 | 3300020080 | Bacteria | 2420 |
| 230 | Ga0206354_10227392 | 3300020081 | Bacteria | 1915 |
| 231 | Ga0206354_10316033 | 3300020081 | Bacteria | 821 |
| 232 | Ga0206354_10439839 | 3300020081 | Bacteria | 1302 |
| 233 | Ga0206354_11478351 | 3300020081 | Bacteria | 776 |
| 234 | Ga0206353_10178129 | 3300020082 | Bacteria | 2228 |
| 235 | Ga0206353_10181719 | 3300020082 | Bacteria | 1991 |
| 236 | Ga0206353_10565899 | 3300020082 | Bacteria | 724 |
| 237 | Ga0206353_10902912 | 3300020082 | Bacteria | 1664 |
| 238 | Ga0154015_1067250 | 3300020610 | Bacteria | 2032 |
| 239 | Ga0154015_1474683 | 3300020610 | Bacteria | 1347 |
| 240 | Ga0154015_1525166 | 3300020610 | Bacteria | 685 |
| 241 | Ga0213873_10130699 | 3300021358 | Bacteria | 743 |
| 242 | Ga0213874_10042088 | 3300021377 | Bacteria | 1371 |
| 243 | Ga0213874_10079706 | 3300021377 | Bacteria | 1059 |
| 244 | Ga0213875_10022186 | 3300021388 | Bacteria | 3037 |
| 245 | Ga0213875_10027897 | 3300021388 | Bacteria | 2685 |
| 246 | Ga0213875_10036259 | 3300021388 | Bacteria | 2326 |
| 247 | Ga0213875_10078941 | 3300021388 | Bacteria | 1535 |
| 248 | Ga0224712_10042950 | 3300022467 | Bacteria | 1716 |
| 249 | Ga0224712_10193364 | 3300022467 | Bacteria | 922 |
| 250 | Ga0224712_10210464 | 3300022467 | Bacteria | 887 |
| 251 | Ga0247550_102792 | 3300023660 | Bacteria | 609 |
| 252 | Ga0247553_111181 | 3300023672 | Bacteria | 522 |
| 253 | Ga0224572_1110363 | 3300024225 | Bacteria | 509 |
| 254 | Ga0228598_1043014 | 3300024227 | Bacteria | 893 |
| 255 | Ga0207692_10001130 | 3300025898 | Bacteria | 9809 |
| 256 | Ga0207692_10006028 | 3300025898 | Bacteria | 4900 |
| 257 | Ga0207692_10007166 | 3300025898 | Bacteria | 4556 |
| 258 | Ga0207692_10009470 | 3300025898 | Bacteria | 4071 |
| 259 | Ga0207692_10219244 | 3300025898 | Bacteria | 1127 |
| 260 | Ga0207647_10100984 | 3300025904 | Bacteria | 1712 |
| 261 | Ga0207685_10001544 | 3300025905 | Bacteria | 4888 |
| 262 | Ga0207685_10008831 | 3300025905 | Bacteria | 2895 |
| 263 | Ga0207685_10217527 | 3300025905 | Bacteria | 906 |
| 264 | Ga0207699_10000260 | 3300025906 | Bacteria | 29008 |
| 265 | Ga0207699_10001977 | 3300025906 | Bacteria | 9676 |
| 266 | Ga0207699_10007633 | 3300025906 | Bacteria | 5295 |
| 267 | Ga0207699_10008993 | 3300025906 | Bacteria | 4952 |
| 268 | Ga0207699_10184010 | 3300025906 | Bacteria | 1406 |
| 269 | Ga0207705_10158625 | 3300025909 | Bacteria | 1698 |
| 270 | Ga0207684_10002031 | 3300025910 | Bacteria | 20859 |
| 271 | Ga0207684_10002505 | 3300025910 | Bacteria | 18476 |
| 272 | Ga0207684_10016512 | 3300025910 | Bacteria | 6339 |
| 273 | Ga0207684_10027808 | 3300025910 | Bacteria | 4817 |
| 274 | Ga0207684_10034449 | 3300025910 | Bacteria | 4302 |
| 275 | Ga0207684_10034994 | 3300025910 | Bacteria | 4265 |
| 276 | Ga0207684_10392457 | 3300025910 | Bacteria | 1193 |
| 277 | Ga0207684_10490615 | 3300025910 | Bacteria | 1053 |
| 278 | Ga0207684_10928131 | 3300025910 | Bacteria | 731 |
| 279 | Ga0207684_11311350 | 3300025910 | Bacteria | 596 |
| 280 | Ga0207654_10745871 | 3300025911 | Bacteria | 705 |
| 281 | Ga0207707_10008073 | 3300025912 | Bacteria | 9140 |
| 282 | Ga0207671_10451396 | 3300025914 | Bacteria | 1024 |
| 283 | Ga0207693_10002650 | 3300025915 | Bacteria | 15546 |
| 284 | Ga0207693_10004081 | 3300025915 | Bacteria | 12404 |
| 285 | Ga0207693_10031891 | 3300025915 | Bacteria | 4163 |
| 286 | Ga0207693_10130380 | 3300025915 | Bacteria | 1976 |
| 287 | Ga0207693_10178908 | 3300025915 | Bacteria | 1669 |
| 288 | Ga0207693_10218465 | 3300025915 | Bacteria | 1498 |
| 289 | Ga0207693_10540287 | 3300025915 | Bacteria | 909 |
| 290 | Ga0207663_10000595 | 3300025916 | Bacteria | 15977 |
| 291 | Ga0207663_10018057 | 3300025916 | Bacteria | 3942 |
| 292 | Ga0207663_10021515 | 3300025916 | Bacteria | 3673 |
| 293 | Ga0207663_10023223 | 3300025916 | Bacteria | 3555 |
| 294 | Ga0207663_10241148 | 3300025916 | Bacteria | 1326 |
| 295 | Ga0207663_10720010 | 3300025916 | Bacteria | 791 |
| 296 | Ga0207660_10093017 | 3300025917 | Bacteria | 2239 |
| 297 | Ga0207657_10067642 | 3300025919 | Bacteria | 3037 |
| 298 | Ga0207652_10095451 | 3300025921 | Bacteria | 2619 |
| 299 | Ga0207652_10137583 | 3300025921 | Bacteria | 2182 |
| 300 | Ga0207652_10553990 | 3300025921 | Bacteria | 1033 |
| 301 | Ga0207646_10001638 | 3300025922 | Bacteria | 27351 |
| 302 | Ga0207646_10079404 | 3300025922 | Bacteria | 2933 |
| 303 | Ga0207646_10118343 | 3300025922 | Bacteria | 2380 |
| 304 | Ga0207646_10159851 | 3300025922 | Bacteria | 2033 |
| 305 | Ga0207646_10188791 | 3300025922 | Bacteria | 1861 |
| 306 | Ga0207646_10379724 | 3300025922 | Bacteria | 1277 |
| 307 | Ga0207646_10661678 | 3300025922 | Bacteria | 935 |
| 308 | Ga0207687_10067273 | 3300025927 | Bacteria | 2548 |
| 309 | Ga0207700_10000091 | 3300025928 | Bacteria | 55792 |
| 310 | Ga0207700_10006412 | 3300025928 | Bacteria | 7101 |
| 311 | Ga0207700_10009657 | 3300025928 | Bacteria | 6040 |
| 312 | Ga0207700_10076347 | 3300025928 | Bacteria | 2599 |
| 313 | Ga0207700_10209767 | 3300025928 | Bacteria | 1646 |
| 314 | Ga0207700_10284128 | 3300025928 | Bacteria | 1424 |
| 315 | Ga0207700_10309942 | 3300025928 | Bacteria | 1365 |
| 316 | Ga0207700_10629107 | 3300025928 | Bacteria | 956 |
| 317 | Ga0207700_10672073 | 3300025928 | Bacteria | 924 |
| 318 | Ga0207700_10981177 | 3300025928 | Bacteria | 756 |
| 319 | Ga0207664_10001032 | 3300025929 | Bacteria | 18646 |
| 320 | Ga0207664_10001323 | 3300025929 | Bacteria | 16307 |
| 321 | Ga0207664_10006431 | 3300025929 | Bacteria | 8085 |
| 322 | Ga0207664_10006898 | 3300025929 | Bacteria | 7853 |
| 323 | Ga0207664_10009075 | 3300025929 | Bacteria | 6966 |
| 324 | Ga0207664_10012435 | 3300025929 | Bacteria | 6085 |
| 325 | Ga0207664_10027344 | 3300025929 | Bacteria | 4323 |
| 326 | Ga0207664_10087825 | 3300025929 | Bacteria | 2543 |
| 327 | Ga0207664_10639072 | 3300025929 | Bacteria | 956 |
| 328 | Ga0207664_10675916 | 3300025929 | Bacteria | 928 |
| 329 | Ga0207664_10685776 | 3300025929 | Bacteria | 921 |
| 330 | Ga0207664_11027721 | 3300025929 | Bacteria | 738 |
| 331 | Ga0207644_10144493 | 3300025931 | Bacteria | 1835 |
| 332 | Ga0207665_10000821 | 3300025939 | Bacteria | 21034 |
| 333 | Ga0207665_10011973 | 3300025939 | Bacteria | 5697 |
| 334 | Ga0207665_10013605 | 3300025939 | Bacteria | 5353 |
| 335 | Ga0207665_10022319 | 3300025939 | Bacteria | 4163 |
| 336 | Ga0207665_10654819 | 3300025939 | Bacteria | 823 |
| 337 | Ga0207665_10676007 | 3300025939 | Bacteria | 811 |
| 338 | Ga0207689_11229876 | 3300025942 | Bacteria | 630 |
| 339 | Ga0207661_10057724 | 3300025944 | Bacteria | 3122 |
| 340 | Ga0207679_11224452 | 3300025945 | Bacteria | 689 |
| 341 | Ga0207667_11429000 | 3300025949 | Bacteria | 665 |
| 342 | Ga0207651_10547541 | 3300025960 | Bacteria | 1006 |
| 343 | Ga0207677_10167377 | 3300026023 | Bacteria | 1715 |
| 344 | Ga0207703_10752596 | 3300026035 | Bacteria | 928 |
| 345 | Ga0207703_10792409 | 3300026035 | Bacteria | 904 |
| 346 | Ga0207678_10124096 | 3300026067 | Bacteria | 2203 |
| 347 | Ga0207678_10156175 | 3300026067 | Bacteria | 1948 |
| 348 | Ga0207678_10191197 | 3300026067 | Bacteria | 1749 |
| 349 | Ga0207702_10011071 | 3300026078 | Bacteria | 7530 |
| 350 | Ga0207702_10075749 | 3300026078 | Bacteria | 2907 |
| 351 | Ga0207702_10197384 | 3300026078 | Bacteria | 1863 |
| 352 | Ga0207641_10704718 | 3300026088 | Bacteria | 994 |
| 353 | Ga0207674_10341731 | 3300026116 | Bacteria | 1447 |
| 354 | Ga0207674_10491963 | 3300026116 | Bacteria | 1185 |
| 355 | Ga0207428_10175378 | 3300027907 | Bacteria | 1622 |
| 356 | Ga0268266_10023185 | 3300028379 | Bacteria | 5286 |
| 357 | Ga0268264_10650291 | 3300028381 | Bacteria | 1043 |
| 358 | Ga0265337_1000049 | 3300028556 | Bacteria | 53677 |
| 359 | Ga0265326_10000822 | 3300028558 | Bacteria | 11437 |
| 360 | Ga0265319_1000220 | 3300028563 | Bacteria | 42678 |
| 361 | Ga0265334_10000083 | 3300028573 | Bacteria | 67832 |
| 362 | Ga0265318_10020851 | 3300028577 | Bacteria | 2638 |
| 363 | Ga0265323_10040745 | 3300028653 | Bacteria | 1688 |
| 364 | Ga0265322_10004536 | 3300028654 | Bacteria | 4130 |
| 365 | Ga0265336_10001694 | 3300028666 | Bacteria | 9708 |
| 366 | Ga0265336_10004565 | 3300028666 | Bacteria | 5213 |
| 367 | Ga0265338_10000358 | 3300028800 | Bacteria | 82643 |
| 368 | Ga0265338_10000940 | 3300028800 | Bacteria | 49081 |
| 369 | Ga0265338_10014758 | 3300028800 | Bacteria | 8652 |
| 370 | Ga0265338_10061662 | 3300028800 | Bacteria | 3285 |
| 371 | Ga0265324_10001390 | 3300029957 | Bacteria | 13975 |
| 372 | Ga0265762_1005987 | 3300030760 | Bacteria | 2179 |
| 373 | Ga0265775_103046 | 3300030762 | Bacteria | 893 |
| 374 | Ga0265775_115245 | 3300030762 | Bacteria | 514 |
| 375 | Ga0265763_1025851 | 3300030763 | Bacteria | 643 |
| 376 | Ga0265767_100417 | 3300030836 | Bacteria | 1789 |
| 377 | Ga0265766_1000538 | 3300030863 | Bacteria | 1687 |
| 378 | Ga0265766_1016712 | 3300030863 | Bacteria | 577 |
| 379 | Ga0265777_114919 | 3300030877 | Bacteria | 603 |
| 380 | Ga0265777_125996 | 3300030877 | Bacteria | 503 |
| 381 | Ga0265770_1007774 | 3300030878 | Bacteria | 1515 |
| 382 | Ga0265764_100345 | 3300030882 | Bacteria | 1693 |
| 383 | Ga0265764_112277 | 3300030882 | Bacteria | 562 |
| 384 | Ga0265769_101486 | 3300030888 | Bacteria | 1131 |
| 385 | Ga0265769_117187 | 3300030888 | Bacteria | 552 |
| 386 | Ga0265761_101512 | 3300030889 | Bacteria | 1026 |
| 387 | Ga0265761_102520 | 3300030889 | Bacteria | 859 |
| 388 | Ga0265761_107242 | 3300030889 | Bacteria | 604 |
| 389 | Ga0247549_103889 | 3300030942 | Bacteria | 568 |
| 390 | Ga0265768_102649 | 3300030963 | Bacteria | 926 |
| 391 | Ga0265768_104272 | 3300030963 | Bacteria | 799 |
| 392 | Ga0265771_1001777 | 3300031010 | Bacteria | 1073 |
| 393 | Ga0265771_1012352 | 3300031010 | Bacteria | 651 |
| 394 | Ga0265760_10011877 | 3300031090 | Bacteria | 2488 |
| 395 | Ga0265760_10015954 | 3300031090 | Bacteria | 2154 |
| 396 | Ga0265760_10016761 | 3300031090 | Bacteria | 2104 |
| 397 | Ga0265760_10072545 | 3300031090 | Bacteria | 1057 |
| 398 | Ga0265332_10000675 | 3300031238 | Bacteria | 21963 |
| 399 | Ga0265320_10003833 | 3300031240 | Bacteria | 9974 |
| 400 | Ga0265325_10006148 | 3300031241 | Bacteria | 7327 |
| 401 | Ga0265340_10000796 | 3300031247 | Bacteria | 17872 |
| 402 | Ga0265339_10046537 | 3300031249 | Bacteria | 2384 |
| 403 | Ga0265316_10007400 | 3300031344 | Bacteria | 10348 |
| 404 | Ga0310116_103289 | 3300031591 | Bacteria | 1658 |
| 405 | Ga0310117_112719 | 3300031592 | Bacteria | 879 |
| 406 | Ga0310117_117491 | 3300031592 | Bacteria | 730 |
| 407 | Ga0265313_10018894 | 3300031595 | Bacteria | 3856 |
| 408 | Ga0310103_104508 | 3300031614 | Bacteria | 1813 |
| 409 | Ga0310103_108291 | 3300031614 | Bacteria | 1400 |
| 410 | Ga0310103_129084 | 3300031614 | Bacteria | 670 |
| 411 | Ga0310105_114668 | 3300031666 | Bacteria | 694 |
| 412 | Ga0310114_111665 | 3300031678 | Bacteria | 850 |
| 413 | Ga0310119_127835 | 3300031686 | Bacteria | 590 |
| 414 | Ga0310101_105794 | 3300031690 | Bacteria | 1491 |
| 415 | Ga0265314_10008203 | 3300031711 | Bacteria | 8980 |
| 416 | Ga0265342_10029921 | 3300031712 | Bacteria | 3378 |
| 417 | Ga0247548_108915 | 3300031814 | Bacteria | 512 |
| 418 | Ga0307406_11732527 | 3300031901 | Bacteria | 554 |
| 419 | Ga0307510_10660135 | 3300033180 | Bacteria | 505 |
| 420 | Ga0316215_1028139 | 3300033544 | Bacteria | 581 |
| 421 | Ga0316214_1000853 | 3300033545 | Bacteria | 3335 |
| 422 | Ga0316212_1007476 | 3300033547 | Bacteria | 1576 |
| 423 | Ga0316216_1010539 | 3300033548 | Bacteria | 715 |
| 424 | Ga0373930_0007648 | 3300034816 | Bacteria | 1866 |
| 425 | Ga0373948_0074115 | 3300034817 | Bacteria | 767 |
| 426 | Ga0373950_0022310 | 3300034818 | Bacteria | 1125 |
| 427 | Ga0373958_0001426 | 3300034819 | Bacteria | 3212 |
| 428 | Ga0373959_0049988 | 3300034820 | Bacteria | 900 |
| 429 | Ga0373938_0003303 | 3300034957 | Bacteria | 2636 |
| 430 | Ga0373926_0029022 | 3300035083 | Bacteria | 1943 |
| 431 | Ga0373926_0302388 | 3300035083 | Bacteria | 624 |
| 432 | Ga0373929_0002602 | 3300035085 | Bacteria | 3308 |
| 433 | Ga0373934_0000328 | 3300035086 | Bacteria | 16740 |
| 434 | Ga0373934_0032981 | 3300035086 | Bacteria | 2032 |
| 435 | Ga0373934_0060411 | 3300035086 | Bacteria | 1509 |
| 436 | Ga0373934_0114350 | 3300035086 | Bacteria | 1096 |
| 437 | Ga0373940_0048435 | 3300035088 | Bacteria | 1187 |
| 438 | Ga0373951_0009688 | 3300035091 | Bacteria | 2165 |
| 439 | Ga0373952_0021896 | 3300035092 | Bacteria | 1353 |
| 440 | Ga0373923_0029692 | 3300035111 | Bacteria | 2194 |
| 441 | Ga0373923_0112223 | 3300035111 | Bacteria | 1211 |
| 442 | Ga0373932_0007413 | 3300035112 | Bacteria | 2611 |
| 443 | Ga0373936_0097200 | 3300035113 | Bacteria | 1239 |
| 444 | Ga0373936_0119229 | 3300035113 | Bacteria | 1126 |
| 445 | Ga0373936_0123726 | 3300035113 | Bacteria | 1107 |
| 446 | Ga0373939_0021110 | 3300035114 | Bacteria | 1778 |
| 447 | Ga0373941_0357657 | 3300035115 | Bacteria | 595 |
| 448 | Ga0373945_0108636 | 3300035116 | Bacteria | 1092 |
| 449 | Ga0373945_0168616 | 3300035116 | Bacteria | 896 |
| 450 | Ga0373945_0353501 | 3300035116 | Bacteria | 637 |
| 451 | Ga0373945_0578697 | 3300035116 | Bacteria | 506 |
| 452 | Ga0373953_0000262 | 3300035117 | Bacteria | 14315 |
| 453 | Ga0373953_0005330 | 3300035117 | Bacteria | 4165 |
| 454 | Ga0373953_0034706 | 3300035117 | Bacteria | 1978 |
| 455 | Ga0373953_0053423 | 3300035117 | Bacteria | 1637 |
| 456 | Ga0373953_0055776 | 3300035117 | Bacteria | 1605 |
| 457 | Ga0373953_0372084 | 3300035117 | Bacteria | 627 |
| 458 | Ga0373954_0119148 | 3300035118 | Bacteria | 1280 |
| 459 | Ga0373954_0154806 | 3300035118 | Bacteria | 1120 |
| 460 | Ga0373954_0215984 | 3300035118 | Bacteria | 943 |
| 461 | Ga0373954_0339640 | 3300035118 | Bacteria | 742 |
| 462 | Ga0373954_0394658 | 3300035118 | Bacteria | 684 |
| 463 | Ga0373956_0004145 | 3300035119 | Bacteria | 5818 |
| 464 | Ga0373956_0007049 | 3300035119 | Bacteria | 4521 |
| 465 | Ga0373956_0063596 | 3300035119 | Bacteria | 1674 |
| 466 | Ga0373956_0084786 | 3300035119 | Bacteria | 1456 |
| 467 | Ga0373956_0518982 | 3300035119 | Bacteria | 569 |
| 468 | Ga0373957_0000312 | 3300035120 | Bacteria | 12205 |
| 469 | Ga0373957_0001248 | 3300035120 | Bacteria | 6802 |
| 470 | Ga0373957_0039494 | 3300035120 | Bacteria | 1770 |
| 471 | Ga0373957_0072893 | 3300035120 | Bacteria | 1345 |
| 472 | Ga0373957_0136378 | 3300035120 | Bacteria | 1001 |
| 473 | Ga0373957_0250847 | 3300035120 | Bacteria | 745 |
| 474 | Ga0373957_0383216 | 3300035120 | Bacteria | 603 |
| 475 | Ga0373960_0011629 | 3300035121 | Bacteria | 2171 |
| 476 | Ga0373943_0048034 | 3300035170 | Bacteria | 2089 |
| 477 | Ga0373943_0156022 | 3300035170 | Bacteria | 1239 |
| 478 | Ga0373943_0376761 | 3300035170 | Bacteria | 816 |
| 479 | Ga0373955_0000233 | 3300035172 | Bacteria | 23155 |
| 480 | Ga0373955_0015005 | 3300035172 | Bacteria | 3783 |
| 481 | Ga0373955_0032433 | 3300035172 | Bacteria | 2741 |
| 482 | Ga0373955_0130168 | 3300035172 | Bacteria | 1468 |
| 483 | Ga0373955_0507075 | 3300035172 | Bacteria | 737 |
| 484 | Ga0373942_0019668 | 3300035207 | Bacteria | 1687 |
| 485 | Ga0373961_0007849 | 3300035241 | Bacteria | 2587 |
| 486 | Ga0373924_0016779 | 3300035410 | Bacteria | 2800 |
| 487 | Ga0373924_0027702 | 3300035410 | Bacteria | 2254 |
| 488 | Ga0373924_0159988 | 3300035410 | Bacteria | 987 |
| 489 | Ga0373924_0221717 | 3300035410 | Bacteria | 835 |
| 490 | Ga0373931_0018524 | 3300035691 | Bacteria | 3464 |
| 491 | Ga0373931_0023038 | 3300035691 | Bacteria | 3140 |
| 492 | Ga0373935_0025535 | 3300035692 | Bacteria | 3640 |
| 493 | Ga0373935_0089335 | 3300035692 | Bacteria | 2014 |
| 494 | Ga0373935_0243431 | 3300035692 | Bacteria | 1256 |
| 495 | Ga0373927_0068698 | 3300035695 | Bacteria | 2293 |
| 496 | Ga0373927_0309110 | 3300035695 | Bacteria | 1041 |
| 497 | Ga0373927_0416553 | 3300035695 | Bacteria | 886 |
| 498 | Ga0373927_0792825 | 3300035695 | Bacteria | 626 |
| 499 | Ga0373933_0000843 | 3300035724 | Bacteria | 18752 |
| 500 | Ga0373933_0009135 | 3300035724 | Bacteria | 5411 |
| 501 | Ga0373933_0012378 | 3300035724 | Bacteria | 4711 |
| 502 | Ga0373933_0039537 | 3300035724 | Bacteria | 2775 |
| 503 | Ga0373933_0087053 | 3300035724 | Bacteria | 1923 |
| 504 | Ga0373933_0109284 | 3300035724 | Bacteria | 1723 |
| 505 | Ga0373947_0035271 | 3300035725 | Bacteria | 2962 |
| 506 | Ga0373947_0085364 | 3300035725 | Bacteria | 1960 |
| 507 | Ga0373947_0201473 | 3300035725 | Bacteria | 1302 |
| 508 | Ga0373947_0613715 | 3300035725 | Bacteria | 741 |
| 509 | Ga0373937_0000112 | 3300036401 | Bacteria | 77473 |
| 510 | Ga0373937_0007454 | 3300036401 | Bacteria | 9467 |
| 511 | Ga0373937_0025538 | 3300036401 | Bacteria | 5333 |
| 512 | Ga0373937_0039458 | 3300036401 | Bacteria | 4303 |
| 513 | Ga0373937_0089360 | 3300036401 | Bacteria | 2852 |
| 514 | Ga0373937_0507803 | 3300036401 | Bacteria | 1145 |
| 515 | Ga0373937_0896568 | 3300036401 | Bacteria | 835 |
| 516 | Ga0265778_021945 | 3300036457 | Bacteria | 793 |
| 517 | Ga0265778_048135 | 3300036457 | Bacteria | 579 |
| 518 | Ga0265778_049055 | 3300036457 | Bacteria | 575 |
| 519 | Ga0310112_013351 | 3300036458 | Bacteria | 1170 |
| 520 | Ga0372808_000924 | 3300036459 | Bacteria | 2755 |
| 521 | Ga0372808_003049 | 3300036459 | Bacteria | 2011 |
| 522 | Ga0310109_031615 | 3300036534 | Bacteria | 700 |
| 523 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 524 | Ga0373925_0001140 | 3300037068 | Bacteria | 23618 |
| 525 | Ga0373925_0017994 | 3300037068 | Bacteria | 5131 |
| 526 | Ga0373925_0068419 | 3300037068 | Bacteria | 2680 |
| 527 | Ga0373925_0551908 | 3300037068 | Bacteria | 947 |
| 528 | Ga0373925_1251057 | 3300037068 | Bacteria | 609 |
| 529 | Ga0373925_1798945 | 3300037068 | Bacteria | 500 |
| 530 | Ga0395898_0078143 | 3300037466 | Bacteria | 3193 |
| 531 | Ga0436364_0385416 | 3300037853 | Bacteria | 26442 |
| 532 | Ga0436364_0697983 | 3300037853 | Bacteria | 1996 |
| 533 | Ga0436364_0741352 | 3300037853 | Bacteria | 4163 |
| 534 | Ga0436364_1198874 | 3300037853 | Bacteria | 2439 |
| 535 | Ga0436364_1316048 | 3300037853 | Bacteria | 1190 |
| 536 | Ga0395901_0220498 | 3300038443 | Bacteria | 1983 |
| 537 | Ga0436365_0791880 | 3300039437 | Bacteria | 897 |
| 538 | Ga0436365_1385863 | 3300039437 | Bacteria | 1284 |
| 539 | Ga0436365_1830100 | 3300039437 | Bacteria | 884 |
| 540 | Ga0436360_0112883 | 3300039438 | Bacteria | 1581 |
| 541 | Ga0436360_0712781 | 3300039438 | Bacteria | 744 |
| 542 | Ga0436361_1006107 | 3300039447 | Bacteria | 894 |
| 543 | Ga0436363_0292346 | 3300039450 | Bacteria | 1004 |
| 544 | Ga0436363_0299477 | 3300039450 | Bacteria | 805 |
| 545 | Ga0436363_1625798 | 3300039450 | Bacteria | 2373 |
| 546 | Ga0436362_0581664 | 3300039453 | Bacteria | 587 |
| 547 | Ga0436362_1089947 | 3300039453 | Bacteria | 1280 |
| 548 | Ga0451787_806040 | 3300041441 | Bacteria | 1005 |
| 549 | Ga0451795_1667535 | 3300041456 | Bacteria | 710 |
| 550 | Ga0451852_07722 | 3300041508 | Bacteria | 590 |
| 551 | Ga0451852_31681 | 3300041508 | Bacteria | 996 |
| 552 | Ga0451852_42244 | 3300041508 | Bacteria | 858 |
| 553 | Ga0466965_0402567 | 3300044683 | Bacteria | 756 |
| 554 | Ga0466966_0881340 | 3300044684 | Bacteria | 540 |
| 555 | Ga0466963_0266010 | 3300044694 | Bacteria | 1204 |
| 556 | Ga0466968_0130492 | 3300044735 | Bacteria | 1143 |
| 557 | Ga0466968_0216604 | 3300044735 | Bacteria | 901 |
| 558 | Ga0466968_0487973 | 3300044735 | Bacteria | 613 |
| 559 | Ga0466957_0200035 | 3300044842 | Bacteria | 1312 |
| 560 | Ga0466959_0293548 | 3300045049 | Bacteria | 1114 |
| 561 | Ga0466958_0103955 | 3300045836 | Bacteria | 1769 |
| 562 | Ga0466967_0440340 | 3300045976 | Bacteria | 1272 |
| 563 | Ga0466967_1371476 | 3300045976 | Bacteria | 704 |
| 564 | Ga0495592_0001722 | 3300046454 | Bacteria | 15384 |
| 565 | Ga0495592_0019017 | 3300046454 | Bacteria | 5227 |
| 566 | Ga0495592_0027974 | 3300046454 | Bacteria | 4270 |
| 567 | Ga0495592_0036908 | 3300046454 | Bacteria | 3679 |
| 568 | Ga0495592_0136109 | 3300046454 | Bacteria | 1713 |
| 569 | Ga0495603_0041898 | 3300046455 | Bacteria | 2738 |
| 570 | Ga0495629_0016271 | 3300046459 | Bacteria | 5337 |
| 571 | Ga0495629_0068955 | 3300046459 | Bacteria | 2467 |
| 572 | Ga0495629_0136056 | 3300046459 | Bacteria | 1710 |
| 573 | Ga0495641_0018421 | 3300046461 | Bacteria | 3602 |
| 574 | Ga0495641_0280173 | 3300046461 | Bacteria | 750 |
| 575 | Ga0495651_0000041 | 3300046462 | Bacteria | 94160 |
| 576 | Ga0495651_0026619 | 3300046462 | Bacteria | 4504 |
| 577 | Ga0495651_0029113 | 3300046462 | Bacteria | 4307 |
| 578 | Ga0495651_0048866 | 3300046462 | Bacteria | 3266 |
| 579 | Ga0495651_0080871 | 3300046462 | Bacteria | 2453 |
| 580 | Ga0495651_0314721 | 3300046462 | Bacteria | 1045 |
| 581 | Ga0495651_0359138 | 3300046462 | Bacteria | 960 |
| 582 | Ga0495653_0008925 | 3300046463 | Bacteria | 8198 |
| 583 | Ga0495653_0068546 | 3300046463 | Bacteria | 2660 |
| 584 | Ga0495653_0179294 | 3300046463 | Bacteria | 1455 |
| 585 | Ga0495653_0471668 | 3300046463 | Bacteria | 786 |
| 586 | Ga0495653_0664450 | 3300046463 | Bacteria | 635 |
| 587 | Ga0495580_0069109 | 3300046472 | Bacteria | 2468 |
| 588 | Ga0495580_0394658 | 3300046472 | Bacteria | 933 |
| 589 | Ga0495582_0005320 | 3300046473 | Bacteria | 7186 |
| 590 | Ga0495582_0039452 | 3300046473 | Bacteria | 2599 |
| 591 | Ga0495582_0093463 | 3300046473 | Bacteria | 1678 |
| 592 | Ga0495639_0034767 | 3300046475 | Bacteria | 2254 |
| 593 | Ga0495662_0004602 | 3300046476 | Bacteria | 6915 |
| 594 | Ga0495662_0089659 | 3300046476 | Bacteria | 1498 |
| 595 | Ga0495662_0210839 | 3300046476 | Bacteria | 957 |
| 596 | Ga0495662_0500968 | 3300046476 | Bacteria | 595 |
| 597 | Ga0495664_0006941 | 3300046477 | Bacteria | 6269 |
| 598 | Ga0495664_0012241 | 3300046477 | Bacteria | 4858 |
| 599 | Ga0495664_0047317 | 3300046477 | Bacteria | 2552 |
| 600 | Ga0495664_0054637 | 3300046477 | Bacteria | 2374 |
| 601 | Ga0495664_0687100 | 3300046477 | Bacteria | 605 |
| 602 | Ga0495594_0222542 | 3300046499 | Bacteria | 1076 |
| 603 | Ga0495608_0001767 | 3300046511 | Bacteria | 15433 |
| 604 | Ga0495608_0004661 | 3300046511 | Bacteria | 9803 |
| 605 | Ga0495608_0031563 | 3300046511 | Bacteria | 3581 |
| 606 | Ga0495608_0207881 | 3300046511 | Bacteria | 1231 |
| 607 | Ga0495618_0041548 | 3300046514 | Bacteria | 2896 |
| 608 | Ga0495618_0044087 | 3300046514 | Bacteria | 2813 |
| 609 | Ga0495618_0098707 | 3300046514 | Bacteria | 1868 |
| 610 | Ga0495618_0132139 | 3300046514 | Bacteria | 1597 |
| 611 | Ga0495618_0255868 | 3300046514 | Bacteria | 1097 |
| 612 | Ga0495628_0003221 | 3300046516 | Bacteria | 14640 |
| 613 | Ga0495628_0025761 | 3300046516 | Bacteria | 4802 |
| 614 | Ga0495628_0039808 | 3300046516 | Bacteria | 3758 |
| 615 | Ga0495628_0081317 | 3300046516 | Bacteria | 2516 |
| 616 | Ga0495628_0234239 | 3300046516 | Bacteria | 1375 |
| 617 | Ga0495628_0555864 | 3300046516 | Bacteria | 823 |
| 618 | Ga0495630_0028653 | 3300046517 | Bacteria | 4137 |
| 619 | Ga0495630_0033618 | 3300046517 | Bacteria | 3824 |
| 620 | Ga0495630_0061782 | 3300046517 | Bacteria | 2813 |
| 621 | Ga0495630_0570355 | 3300046517 | Bacteria | 868 |
| 622 | Ga0495630_0904416 | 3300046517 | Bacteria | 672 |
| 623 | Ga0495630_0982556 | 3300046517 | Bacteria | 642 |
| 624 | Ga0495666_0047504 | 3300046526 | Bacteria | 2067 |
| 625 | Ga0495666_0277385 | 3300046526 | Bacteria | 760 |
| 626 | Ga0495652_0010557 | 3300046529 | Bacteria | 8368 |
| 627 | Ga0495652_0013883 | 3300046529 | Bacteria | 7245 |
| 628 | Ga0495652_0016567 | 3300046529 | Bacteria | 6591 |
| 629 | Ga0495652_0023593 | 3300046529 | Bacteria | 5453 |
| 630 | Ga0495652_0267071 | 3300046529 | Bacteria | 1259 |
| 631 | Ga0495665_0002880 | 3300046531 | Bacteria | 9299 |
| 632 | Ga0495665_0019986 | 3300046531 | Bacteria | 3601 |
| 633 | Ga0495665_0118219 | 3300046531 | Bacteria | 1388 |
| 634 | Ga0495640_0030637 | 3300046533 | Bacteria | 3849 |
| 635 | Ga0495640_0032652 | 3300046533 | Bacteria | 3706 |
| 636 | Ga0495640_0049080 | 3300046533 | Bacteria | 2912 |
| 637 | Ga0495640_0081516 | 3300046533 | Bacteria | 2150 |
| 638 | Ga0495640_0911177 | 3300046533 | Bacteria | 520 |
| 639 | Ga0495586_0046132 | 3300046535 | Bacteria | 2349 |
| 640 | Ga0495586_0121485 | 3300046535 | Bacteria | 1459 |
| 641 | Ga0495587_0000038 | 3300046536 | Bacteria | 116118 |
| 642 | Ga0495587_0019029 | 3300046536 | Bacteria | 4255 |
| 643 | Ga0495587_0040683 | 3300046536 | Bacteria | 2776 |
| 644 | Ga0495587_0047578 | 3300046536 | Bacteria | 2542 |
| 645 | Ga0495645_0025092 | 3300046543 | Bacteria | 4326 |
| 646 | Ga0495645_0054078 | 3300046543 | Bacteria | 2917 |
| 647 | Ga0495645_0147073 | 3300046543 | Bacteria | 1640 |
| 648 | Ga0495645_0188261 | 3300046543 | Bacteria | 1409 |
| 649 | Ga0495645_0210647 | 3300046543 | Bacteria | 1312 |
| 650 | Ga0495667_0000445 | 3300046559 | Bacteria | 26398 |
| 651 | Ga0495667_0000985 | 3300046559 | Bacteria | 18417 |
| 652 | Ga0495667_0002803 | 3300046559 | Bacteria | 11641 |
| 653 | Ga0495667_0021959 | 3300046559 | Bacteria | 4302 |
| 654 | Ga0495634_0014303 | 3300046642 | Bacteria | 5725 |
| 655 | Ga0495634_0016396 | 3300046642 | Bacteria | 5300 |
| 656 | Ga0495634_0071383 | 3300046642 | Bacteria | 2286 |
| 657 | Ga0495634_0114595 | 3300046642 | Bacteria | 1731 |
| 658 | Ga0495635_0007096 | 3300046663 | Bacteria | 7833 |
| 659 | Ga0495635_0023342 | 3300046663 | Bacteria | 4311 |
| 660 | Ga0495635_0071799 | 3300046663 | Bacteria | 2372 |
| 661 | Ga0495635_0122343 | 3300046663 | Bacteria | 1774 |
| 662 | Ga0495588_0125340 | 3300046674 | Bacteria | 1354 |
| 663 | Ga0495657_0002519 | 3300046675 | Bacteria | 15384 |
| 664 | Ga0495657_0005213 | 3300046675 | Bacteria | 10290 |
| 665 | Ga0495657_0014816 | 3300046675 | Bacteria | 5721 |
| 666 | Ga0495657_0018704 | 3300046675 | Bacteria | 5006 |
| 667 | Ga0495657_0044000 | 3300046675 | Bacteria | 3040 |
| 668 | Ga0495599_0000100 | 3300046678 | Bacteria | 60814 |
| 669 | Ga0495599_0005877 | 3300046678 | Bacteria | 7371 |
| 670 | Ga0495599_0020499 | 3300046678 | Bacteria | 4117 |
| 671 | Ga0495599_0058622 | 3300046678 | Bacteria | 2408 |
| 672 | Ga0495599_0071792 | 3300046678 | Bacteria | 2160 |
| 673 | Ga0495599_0489233 | 3300046678 | Bacteria | 725 |
| 674 | Ga0495623_0030013 | 3300046679 | Bacteria | 3499 |
| 675 | Ga0495623_0036882 | 3300046679 | Bacteria | 3131 |
| 676 | Ga0495623_0328836 | 3300046679 | Bacteria | 837 |
| 677 | Ga0495646_0023289 | 3300046680 | Bacteria | 3899 |
| 678 | Ga0495646_0094885 | 3300046680 | Bacteria | 1717 |
| 679 | Ga0495646_0126398 | 3300046680 | Bacteria | 1442 |
| 680 | Ga0495647_0073081 | 3300046681 | Bacteria | 1376 |
| 681 | Ga0495658_0037949 | 3300046683 | Bacteria | 2665 |
| 682 | Ga0495658_0156765 | 3300046683 | Bacteria | 1401 |
| 683 | Ga0495613_0004973 | 3300046689 | Bacteria | 9984 |
| 684 | Ga0495613_0054488 | 3300046689 | Bacteria | 2939 |
| 685 | Ga0495624_0006742 | 3300046690 | Bacteria | 8114 |
| 686 | Ga0495624_0101714 | 3300046690 | Bacteria | 1769 |
| 687 | Ga0495624_0273946 | 3300046690 | Bacteria | 1019 |
| 688 | Ga0495624_0374248 | 3300046690 | Bacteria | 856 |
| 689 | Ga0495600_0021742 | 3300046809 | Bacteria | 4113 |
| 690 | Ga0495600_0033758 | 3300046809 | Bacteria | 3321 |
| 691 | Ga0495600_0034389 | 3300046809 | Bacteria | 3289 |
| 692 | Ga0495600_0241977 | 3300046809 | Bacteria | 1149 |
| 693 | Ga0495600_0287517 | 3300046809 | Bacteria | 1039 |
| 694 | Ga0495581_0007649 | 3300047315 | Bacteria | 6251 |
| 695 | Ga0495581_0031164 | 3300047315 | Bacteria | 3089 |
| 696 | Ga0495581_0083298 | 3300047315 | Bacteria | 1852 |
| 697 | Ga0495604_0000061 | 3300047317 | Bacteria | 94158 |
| 698 | Ga0495604_0020965 | 3300047317 | Bacteria | 5215 |
| 699 | Ga0495604_0023815 | 3300047317 | Bacteria | 4885 |
| 700 | Ga0495604_0090980 | 3300047317 | Bacteria | 2264 |
| 701 | Ga0495604_0288404 | 3300047317 | Bacteria | 1106 |
| 702 | Ga0495604_0323474 | 3300047317 | Bacteria | 1030 |
| 703 | Ga0495674_0045071 | 3300047319 | Bacteria | 3917 |
| 704 | Ga0495674_0063469 | 3300047319 | Bacteria | 3213 |
| 705 | Ga0495674_0063741 | 3300047319 | Bacteria | 3205 |
| 706 | Ga0495674_0096092 | 3300047319 | Bacteria | 2525 |
| 707 | Ga0495674_0173934 | 3300047319 | Bacteria | 1795 |
| 708 | Ga0495674_0262545 | 3300047319 | Bacteria | 1418 |
| 709 | Ga0495676_0141456 | 3300047321 | Bacteria | 1724 |
| 710 | Ga0495676_0533015 | 3300047321 | Bacteria | 768 |
| 711 | Ga0495680_0003514 | 3300047322 | Bacteria | 15376 |
| 712 | Ga0495680_0031237 | 3300047322 | Bacteria | 4337 |
| 713 | Ga0495680_0065787 | 3300047322 | Bacteria | 2775 |
| 714 | Ga0495680_0086063 | 3300047322 | Bacteria | 2365 |
| 715 | Ga0495680_0138006 | 3300047322 | Bacteria | 1786 |
| 716 | Ga0495680_0328199 | 3300047322 | Bacteria | 1069 |
| 717 | Ga0495675_0002156 | 3300047444 | Bacteria | 11734 |
| 718 | Ga0495675_0003593 | 3300047444 | Bacteria | 9349 |
| 719 | Ga0495675_0019155 | 3300047444 | Bacteria | 4348 |
| 720 | Ga0495675_0123411 | 3300047444 | Bacteria | 1612 |
| 721 | Ga0495684_0044908 | 3300047471 | Bacteria | 3382 |
| 722 | Ga0495684_0058007 | 3300047471 | Bacteria | 2949 |
| 723 | Ga0495684_0061787 | 3300047471 | Bacteria | 2849 |
| 724 | Ga0495684_0453541 | 3300047471 | Bacteria | 890 |
| 725 | Ga0495593_0009590 | 3300047673 | Bacteria | 5621 |
| 726 | Ga0495593_0081220 | 3300047673 | Bacteria | 1676 |
| 727 | Ga0495593_0091946 | 3300047673 | Bacteria | 1562 |
| 728 | Ga0495602_0004271 | 3300048088 | Bacteria | 14873 |
| 729 | Ga0495602_0023507 | 3300048088 | Bacteria | 6002 |
| 730 | Ga0495602_0036394 | 3300048088 | Bacteria | 4581 |
| 731 | Ga0495602_0040512 | 3300048088 | Bacteria | 4269 |
| 732 | Ga0495614_0006961 | 3300048089 | Bacteria | 5052 |
| 733 | Ga0495614_0231767 | 3300048089 | Bacteria | 841 |
| 734 | Ga0496100_0034483 | 3300048903 | Bacteria | 3176 |
| 735 | Ga0496100_0151745 | 3300048903 | Bacteria | 1653 |
| 736 | Ga0496102_0031789 | 3300048905 | Bacteria | 4738 |
| 737 | Ga0496102_0096410 | 3300048905 | Bacteria | 2742 |
| 738 | Ga0496102_1618265 | 3300048905 | Bacteria | 566 |
| 739 | Ga0496103_0131820 | 3300048906 | Bacteria | 1596 |
| 740 | Ga0496104_0001325 | 3300048907 | Bacteria | 21370 |
| 741 | Ga0496104_0085657 | 3300048907 | Bacteria | 3007 |
| 742 | Ga0496105_0000744 | 3300048908 | Bacteria | 22107 |
| 743 | Ga0496105_0025654 | 3300048908 | Bacteria | 4799 |
| 744 | Ga0496106_0198905 | 3300048909 | Bacteria | 1594 |
| 745 | Ga0496106_0293908 | 3300048909 | Bacteria | 1303 |
| 746 | Ga0496107_0003098 | 3300048910 | Bacteria | 11049 |
| 747 | Ga0496108_0002190 | 3300048911 | Bacteria | 15672 |
| 748 | Ga0496108_0047492 | 3300048911 | Bacteria | 3588 |
| 749 | Ga0496108_0796840 | 3300048911 | Bacteria | 815 |
| 750 | Ga0496109_0013057 | 3300048912 | Bacteria | 7185 |
| 751 | Ga0496109_0083528 | 3300048912 | Bacteria | 2945 |
| 752 | Ga0496111_0195292 | 3300048914 | Bacteria | 1504 |
| 753 | Ga0496112_0001139 | 3300048915 | Bacteria | 19803 |
| 754 | Ga0496112_0028330 | 3300048915 | Bacteria | 5405 |
| 755 | Ga0496112_0584377 | 3300048915 | Bacteria | 1049 |
| 756 | Ga0496113_0008126 | 3300048916 | Bacteria | 6813 |
| 757 | Ga0496113_0031782 | 3300048916 | Bacteria | 3833 |
| 758 | Ga0496113_0759848 | 3300048916 | Bacteria | 771 |
| 759 | Ga0496114_0010283 | 3300048917 | Bacteria | 7446 |
| 760 | Ga0496114_0027524 | 3300048917 | Bacteria | 4658 |
| 761 | Ga0496115_0004035 | 3300048918 | Bacteria | 10597 |
| 762 | Ga0496115_0015962 | 3300048918 | Bacteria | 5709 |
| 763 | Ga0496115_0101468 | 3300048918 | Bacteria | 2359 |
| 764 | Ga0496126_0043842 | 3300048929 | Bacteria | 4123 |
| 765 | Ga0496126_0111838 | 3300048929 | Bacteria | 2378 |
| 766 | Ga0496126_0421231 | 3300048929 | Bacteria | 1079 |
| 767 | nmdc:mga05p37_31729_c1 | 3300050507 | Bacteria | 6457 |
| 768 | nmdc:mga08y16_238967_c1 | 3300050511 | Bacteria | 1878 |
| 769 | nmdc:mga0n895_1944188_c1 | 3300050512 | Bacteria | 547 |
| 770 | nmdc:mga0n895_207347_c1 | 3300050512 | Bacteria | 1991 |
| 771 | nmdc:mga0n895_463554_c1 | 3300050512 | Bacteria | 1279 |
| 772 | nmdc:mga0n895_93657_c1 | 3300050512 | Bacteria | 3008 |
| 773 | nmdc:mga0rr50_32817_c1 | 3300050513 | Bacteria | 3704 |
| 774 | nmdc:mga0rr50_6896_c1 | 3300050513 | Bacteria | 6966 |
| 775 | nmdc:mga0rr50_9558_c1 | 3300050513 | Bacteria | 6104 |
| 776 | nmdc:mga08x19_115058_c1 | 3300050514 | Bacteria | 1798 |
| 777 | nmdc:mga08x19_16321_c1 | 3300050514 | Bacteria | 4527 |
| 778 | nmdc:mga08x19_32682_c1 | 3300050514 | Bacteria | 3281 |
| 779 | nmdc:mga0a205_3984_c1 | 3300050515 | Bacteria | 13204 |
| 780 | Ga0495601_0037098 | 3300053077 | Bacteria | 3046 |
| 781 | Ga0495601_0038877 | 3300053077 | Bacteria | 2976 |
| 782 | Ga0495601_0104587 | 3300053077 | Bacteria | 1830 |
| 783 | Ga0495601_0136955 | 3300053077 | Bacteria | 1596 |
| 784 | Ga0495601_0212874 | 3300053077 | Bacteria | 1262 |
| 785 | Ga0495601_0650365 | 3300053077 | Bacteria | 674 |
| 786 | Ga0495612_0029952 | 3300053078 | Bacteria | 2192 |
| 787 | Ga0495612_0033074 | 3300053078 | Bacteria | 2091 |
| 788 | Ga0495595_0008946 | 3300053084 | Bacteria | 4128 |
| 789 | Ga0495595_0012574 | 3300053084 | Bacteria | 3561 |
| 790 | Ga0495619_0007700 | 3300053085 | Bacteria | 6819 |
| 791 | Ga0495619_0024282 | 3300053085 | Bacteria | 3887 |
| 792 | Ga0495619_0074722 | 3300053085 | Bacteria | 2273 |
| 793 | Ga0495619_1103220 | 3300053085 | Bacteria | 528 |
| 794 | Ga0587084_083896 | 3300059477 | Bacteria | 621 |
| 795 | Ga0587066_106195 | 3300059490 | Bacteria | 645 |
| 796 | Ga0587070_028468 | 3300059491 | Bacteria | 997 |
| 797 | Ga0587073_0157346 | 3300059492 | Bacteria | 648 |
| 798 | Ga0587086_089771 | 3300059507 | Bacteria | 553 |
| 799 | Ga0587091_049644 | 3300059511 | Bacteria | 857 |
| 800 | Ga0587092_072959 | 3300059512 | Bacteria | 664 |
| 801 | Ga0587101_118345 | 3300059623 | Bacteria | 545 |
| 802 | Ga0587109_119655 | 3300059624 | Bacteria | 624 |
| 803 | Ga0587067_016763 | 3300059640 | Bacteria | 1207 |
| 804 | Ga0587068_100235 | 3300059641 | Bacteria | 607 |
| 805 | Ga0587111_0081692 | 3300060346 | Bacteria | 773 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041441 | Ga0451787_806040 | Ga0451787_806040_253_558 | 101 |
| 2 | 3300041456 | Ga0451795_1667535 | Ga0451795_1667535_200_505 | 101 |
| 3 | 3300041508 | Ga0451852_07722 | Ga0451852_07722_254_571 | 101 |
| 4 | 3300041508 | Ga0451852_31681 | Ga0451852_31681_591_911 | 101 |
| 5 | 3300041508 | Ga0451852_42244 | Ga0451852_42244_543_848 | 101 |
| 6 | 3300006847 | Ga0075431_101399628 | Ga0075431_1013996282 | 103 |
| 7 | 3300005434 | Ga0070709_10173185 | Ga0070709_101731852 | 105 |
| 8 | 3300005435 | Ga0070714_100005961 | Ga0070714_10000596114 | 105 |
| 9 | 3300005436 | Ga0070713_100030847 | Ga0070713_1000308475 | 105 |
| 10 | 3300005436 | Ga0070713_100400705 | Ga0070713_1004007052 | 105 |
| 11 | 3300005437 | Ga0070710_10009084 | Ga0070710_100090842 | 105 |
| 12 | 3300005437 | Ga0070710_10249275 | Ga0070710_102492752 | 105 |
| 13 | 3300005439 | Ga0070711_100102272 | Ga0070711_1001022725 | 105 |
| 14 | 3300005468 | Ga0070707_100260221 | Ga0070707_1002602214 | 105 |
| 15 | 3300005471 | Ga0070698_100521425 | Ga0070698_1005214253 | 105 |
| 16 | 3300006028 | Ga0070717_10035630 | Ga0070717_100356305 | 105 |
| 17 | 3300006028 | Ga0070717_10567360 | Ga0070717_105673602 | 105 |
| 18 | 3300006173 | Ga0070716_100079914 | Ga0070716_1000799143 | 105 |
| 19 | 3300006173 | Ga0070716_100679952 | Ga0070716_1006799521 | 105 |
| 20 | 3300006914 | Ga0075436_100072403 | Ga0075436_1000724034 | 105 |
| 21 | 3300007076 | Ga0075435_100357826 | Ga0075435_1003578263 | 105 |
| 22 | 3300007265 | Ga0099794_10015745 | Ga0099794_100157457 | 105 |
| 23 | 3300025898 | Ga0207692_10007166 | Ga0207692_100071662 | 105 |
| 24 | 3300025898 | Ga0207692_10219244 | Ga0207692_102192442 | 105 |
| 25 | 3300025906 | Ga0207699_10001977 | Ga0207699_100019777 | 105 |
| 26 | 3300025906 | Ga0207699_10184010 | Ga0207699_101840102 | 105 |
| 27 | 3300025915 | Ga0207693_10218465 | Ga0207693_102184652 | 105 |
| 28 | 3300025916 | Ga0207663_10018057 | Ga0207663_100180573 | 105 |
| 29 | 3300025916 | Ga0207663_10241148 | Ga0207663_102411482 | 105 |
| 30 | 3300025922 | Ga0207646_10118343 | Ga0207646_101183432 | 105 |
| 31 | 3300025928 | Ga0207700_10006412 | Ga0207700_100064129 | 105 |
| 32 | 3300025929 | Ga0207664_10006898 | Ga0207664_100068988 | 105 |
| 33 | 3300025929 | Ga0207664_10009075 | Ga0207664_100090754 | 105 |
| 34 | 3300025929 | Ga0207664_10087825 | Ga0207664_100878252 | 105 |
| 35 | 3300025939 | Ga0207665_10011973 | Ga0207665_1001197310 | 105 |
| 36 | 3300025939 | Ga0207665_10654819 | Ga0207665_106548192 | 105 |
| 37 | 3300030882 | Ga0265764_112277 | Ga0265764_1122771 | 105 |
| 38 | 3300053085 | Ga0495619_1103220 | Ga0495619_1103220_51_410 | 105 |
| 39 | 3300004799 | Ga0058863_10087617 | Ga0058863_100876172 | 106 |
| 40 | 3300004800 | Ga0058861_10050561 | Ga0058861_100505615 | 106 |
| 41 | 3300004800 | Ga0058861_10187278 | Ga0058861_101872783 | 106 |
| 42 | 3300004803 | Ga0058862_10129161 | Ga0058862_101291612 | 106 |
| 43 | 3300004803 | Ga0058862_12484301 | Ga0058862_124843012 | 106 |
| 44 | 3300005327 | Ga0070658_10088897 | Ga0070658_100888975 | 106 |
| 45 | 3300005329 | Ga0070683_100186457 | Ga0070683_1001864574 | 106 |
| 46 | 3300005329 | Ga0070683_100245669 | Ga0070683_1002456694 | 106 |
| 47 | 3300005329 | Ga0070683_101336258 | Ga0070683_1013362582 | 106 |
| 48 | 3300005334 | Ga0068869_101261010 | Ga0068869_1012610102 | 106 |
| 49 | 3300005336 | Ga0070680_100067854 | Ga0070680_1000678546 | 106 |
| 50 | 3300005336 | Ga0070680_100472511 | Ga0070680_1004725111 | 106 |
| 51 | 3300005336 | Ga0070680_100920382 | Ga0070680_1009203822 | 106 |
| 52 | 3300005337 | Ga0070682_100048057 | Ga0070682_1000480572 | 106 |
| 53 | 3300005337 | Ga0070682_100075432 | Ga0070682_1000754324 | 106 |
| 54 | 3300005339 | Ga0070660_100362640 | Ga0070660_1003626402 | 106 |
| 55 | 3300005341 | Ga0070691_10743503 | Ga0070691_107435031 | 106 |
| 56 | 3300005344 | Ga0070661_100201326 | Ga0070661_1002013262 | 106 |
| 57 | 3300005355 | Ga0070671_100252590 | Ga0070671_1002525903 | 106 |
| 58 | 3300005434 | Ga0070709_10000382 | Ga0070709_1000038221 | 106 |
| 59 | 3300005434 | Ga0070709_10020576 | Ga0070709_100205763 | 106 |
| 60 | 3300005434 | Ga0070709_10879235 | Ga0070709_108792351 | 106 |
| 61 | 3300005435 | Ga0070714_100001124 | Ga0070714_10000112421 | 106 |
| 62 | 3300005435 | Ga0070714_100003109 | Ga0070714_10000310919 | 106 |
| 63 | 3300005435 | Ga0070714_100067826 | Ga0070714_1000678265 | 106 |
| 64 | 3300005435 | Ga0070714_100111149 | Ga0070714_1001111492 | 106 |
| 65 | 3300005435 | Ga0070714_100239174 | Ga0070714_1002391742 | 106 |
| 66 | 3300005435 | Ga0070714_100389436 | Ga0070714_1003894362 | 106 |
| 67 | 3300005435 | Ga0070714_101572057 | Ga0070714_1015720572 | 106 |
| 68 | 3300005436 | Ga0070713_100001233 | Ga0070713_1000012336 | 106 |
| 69 | 3300005436 | Ga0070713_100092635 | Ga0070713_1000926354 | 106 |
| 70 | 3300005436 | Ga0070713_100223624 | Ga0070713_1002236243 | 106 |
| 71 | 3300005436 | Ga0070713_100227446 | Ga0070713_1002274461 | 106 |
| 72 | 3300005436 | Ga0070713_100377852 | Ga0070713_1003778521 | 106 |
| 73 | 3300005436 | Ga0070713_101079577 | Ga0070713_1010795771 | 106 |
| 74 | 3300005436 | Ga0070713_101538726 | Ga0070713_1015387261 | 106 |
| 75 | 3300005436 | Ga0070713_101732303 | Ga0070713_1017323032 | 106 |
| 76 | 3300005437 | Ga0070710_10000437 | Ga0070710_1000043712 | 106 |
| 77 | 3300005437 | Ga0070710_10019019 | Ga0070710_100190196 | 106 |
| 78 | 3300005437 | Ga0070710_10038529 | Ga0070710_100385295 | 106 |
| 79 | 3300005437 | Ga0070710_10512930 | Ga0070710_105129302 | 106 |
| 80 | 3300005437 | Ga0070710_11115486 | Ga0070710_111154861 | 106 |
| 81 | 3300005439 | Ga0070711_100017511 | Ga0070711_1000175115 | 106 |
| 82 | 3300005439 | Ga0070711_100045638 | Ga0070711_1000456386 | 106 |
| 83 | 3300005439 | Ga0070711_100527905 | Ga0070711_1005279052 | 106 |
| 84 | 3300005440 | Ga0070705_100112618 | Ga0070705_1001126184 | 106 |
| 85 | 3300005445 | Ga0070708_100073925 | Ga0070708_1000739254 | 106 |
| 86 | 3300005445 | Ga0070708_100101804 | Ga0070708_1001018046 | 106 |
| 87 | 3300005445 | Ga0070708_100111554 | Ga0070708_1001115542 | 106 |
| 88 | 3300005445 | Ga0070708_100467745 | Ga0070708_1004677452 | 106 |
| 89 | 3300005445 | Ga0070708_100481855 | Ga0070708_1004818552 | 106 |
| 90 | 3300005445 | Ga0070708_100702517 | Ga0070708_1007025172 | 106 |
| 91 | 3300005445 | Ga0070708_102237466 | Ga0070708_1022374661 | 106 |
| 92 | 3300005455 | Ga0070663_100145197 | Ga0070663_1001451972 | 106 |
| 93 | 3300005455 | Ga0070663_100190100 | Ga0070663_1001901001 | 106 |
| 94 | 3300005455 | Ga0070663_100722200 | Ga0070663_1007222002 | 106 |
| 95 | 3300005456 | Ga0070678_100338566 | Ga0070678_1003385663 | 106 |
| 96 | 3300005458 | Ga0070681_10567682 | Ga0070681_105676822 | 106 |
| 97 | 3300005467 | Ga0070706_100001216 | Ga0070706_10000121632 | 106 |
| 98 | 3300005467 | Ga0070706_100003720 | Ga0070706_10000372011 | 106 |
| 99 | 3300005467 | Ga0070706_100041850 | Ga0070706_1000418509 | 106 |
| 100 | 3300005467 | Ga0070706_100094440 | Ga0070706_1000944406 | 106 |
| 101 | 3300005467 | Ga0070706_100105887 | Ga0070706_1001058872 | 106 |
| 102 | 3300005467 | Ga0070706_100178715 | Ga0070706_1001787155 | 106 |
| 103 | 3300005467 | Ga0070706_100257139 | Ga0070706_1002571392 | 106 |
| 104 | 3300005467 | Ga0070706_100268164 | Ga0070706_1002681641 | 106 |
| 105 | 3300005467 | Ga0070706_100953912 | Ga0070706_1009539121 | 106 |
| 106 | 3300005467 | Ga0070706_101884222 | Ga0070706_1018842222 | 106 |
| 107 | 3300005468 | Ga0070707_100011795 | Ga0070707_10001179510 | 106 |
| 108 | 3300005468 | Ga0070707_100098495 | Ga0070707_1000984956 | 106 |
| 109 | 3300005468 | Ga0070707_100197595 | Ga0070707_1001975952 | 106 |
| 110 | 3300005468 | Ga0070707_100332689 | Ga0070707_1003326893 | 106 |
| 111 | 3300005468 | Ga0070707_101759611 | Ga0070707_1017596111 | 106 |
| 112 | 3300005471 | Ga0070698_100001882 | Ga0070698_10000188216 | 106 |
| 113 | 3300005471 | Ga0070698_100007360 | Ga0070698_10000736011 | 106 |
| 114 | 3300005471 | Ga0070698_100009167 | Ga0070698_1000091677 | 106 |
| 115 | 3300005471 | Ga0070698_100018293 | Ga0070698_1000182936 | 106 |
| 116 | 3300005471 | Ga0070698_100034346 | Ga0070698_10003434610 | 106 |
| 117 | 3300005471 | Ga0070698_100065182 | Ga0070698_1000651822 | 106 |
| 118 | 3300005471 | Ga0070698_100084017 | Ga0070698_1000840176 | 106 |
| 119 | 3300005471 | Ga0070698_100099685 | Ga0070698_1000996852 | 106 |
| 120 | 3300005471 | Ga0070698_100163572 | Ga0070698_1001635724 | 106 |
| 121 | 3300005471 | Ga0070698_100177424 | Ga0070698_1001774245 | 106 |
| 122 | 3300005518 | Ga0070699_100169232 | Ga0070699_1001692324 | 106 |
| 123 | 3300005530 | Ga0070679_101090515 | Ga0070679_1010905152 | 106 |
| 124 | 3300005530 | Ga0070679_101351359 | Ga0070679_1013513592 | 106 |
| 125 | 3300005535 | Ga0070684_100108391 | Ga0070684_1001083912 | 106 |
| 126 | 3300005536 | Ga0070697_100066801 | Ga0070697_1000668012 | 106 |
| 127 | 3300005536 | Ga0070697_100763184 | Ga0070697_1007631842 | 106 |
| 128 | 3300005536 | Ga0070697_101165370 | Ga0070697_1011653702 | 106 |
| 129 | 3300005536 | Ga0070697_101942639 | Ga0070697_1019426391 | 106 |
| 130 | 3300005536 | Ga0070697_102109545 | Ga0070697_1021095451 | 106 |
| 131 | 3300005539 | Ga0068853_100493092 | Ga0068853_1004930921 | 106 |
| 132 | 3300005545 | Ga0070695_101599897 | Ga0070695_1015998971 | 106 |
| 133 | 3300005546 | Ga0070696_100084890 | Ga0070696_1000848902 | 106 |
| 134 | 3300005546 | Ga0070696_101124184 | Ga0070696_1011241841 | 106 |
| 135 | 3300005549 | Ga0070704_100654605 | Ga0070704_1006546051 | 106 |
| 136 | 3300005563 | Ga0068855_101155889 | Ga0068855_1011558892 | 106 |
| 137 | 3300005563 | Ga0068855_102077002 | Ga0068855_1020770022 | 106 |
| 138 | 3300005564 | Ga0070664_102074122 | Ga0070664_1020741221 | 106 |
| 139 | 3300005577 | Ga0068857_100611783 | Ga0068857_1006117832 | 106 |
| 140 | 3300005578 | Ga0068854_101621514 | Ga0068854_1016215141 | 106 |
| 141 | 3300005614 | Ga0068856_100014944 | Ga0068856_10001494413 | 106 |
| 142 | 3300005614 | Ga0068856_100144813 | Ga0068856_1001448132 | 106 |
| 143 | 3300005614 | Ga0068856_100256540 | Ga0068856_1002565405 | 106 |
| 144 | 3300005618 | Ga0068864_100232132 | Ga0068864_1002321325 | 106 |
| 145 | 3300005841 | Ga0068863_100407865 | Ga0068863_1004078653 | 106 |
| 146 | 3300005842 | Ga0068858_100485400 | Ga0068858_1004854002 | 106 |
| 147 | 3300005842 | Ga0068858_101272031 | Ga0068858_1012720312 | 106 |
| 148 | 3300005843 | Ga0068860_102180995 | Ga0068860_1021809952 | 106 |
| 149 | 3300005937 | Ga0081455_10251481 | Ga0081455_102514812 | 106 |
| 150 | 3300005983 | Ga0081540_1002039 | Ga0081540_100203923 | 106 |
| 151 | 3300006028 | Ga0070717_10010919 | Ga0070717_100109195 | 106 |
| 152 | 3300006028 | Ga0070717_10030218 | Ga0070717_100302182 | 106 |
| 153 | 3300006028 | Ga0070717_10178591 | Ga0070717_101785913 | 106 |
| 154 | 3300006028 | Ga0070717_10205554 | Ga0070717_102055543 | 106 |
| 155 | 3300006028 | Ga0070717_10213398 | Ga0070717_102133982 | 106 |
| 156 | 3300006028 | Ga0070717_10310893 | Ga0070717_103108932 | 106 |
| 157 | 3300006028 | Ga0070717_10323495 | Ga0070717_103234953 | 106 |
| 158 | 3300006028 | Ga0070717_10961811 | Ga0070717_109618112 | 106 |
| 159 | 3300006028 | Ga0070717_11067551 | Ga0070717_110675512 | 106 |
| 160 | 3300006028 | Ga0070717_11150319 | Ga0070717_111503192 | 106 |
| 161 | 3300006028 | Ga0070717_11335078 | Ga0070717_113350782 | 106 |
| 162 | 3300006028 | Ga0070717_11469512 | Ga0070717_114695122 | 106 |
| 163 | 3300006163 | Ga0070715_10001006 | Ga0070715_1000100610 | 106 |
| 164 | 3300006163 | Ga0070715_10053222 | Ga0070715_100532222 | 106 |
| 165 | 3300006173 | Ga0070716_100000511 | Ga0070716_10000051122 | 106 |
| 166 | 3300006173 | Ga0070716_100003131 | Ga0070716_1000031319 | 106 |
| 167 | 3300006173 | Ga0070716_100185330 | Ga0070716_1001853302 | 106 |
| 168 | 3300006173 | Ga0070716_100477791 | Ga0070716_1004777912 | 106 |
| 169 | 3300006173 | Ga0070716_101316365 | Ga0070716_1013163651 | 106 |
| 170 | 3300006175 | Ga0070712_100001287 | Ga0070712_1000012875 | 106 |
| 171 | 3300006175 | Ga0070712_100389699 | Ga0070712_1003896992 | 106 |
| 172 | 3300006175 | Ga0070712_100422846 | Ga0070712_1004228461 | 106 |
| 173 | 3300006175 | Ga0070712_100570172 | Ga0070712_1005701722 | 106 |
| 174 | 3300006358 | Ga0068871_100107345 | Ga0068871_1001073452 | 106 |
| 175 | 3300006844 | Ga0075428_100107848 | Ga0075428_1001078482 | 106 |
| 176 | 3300006852 | Ga0075433_10004127 | Ga0075433_100041273 | 106 |
| 177 | 3300006852 | Ga0075433_10015253 | Ga0075433_100152536 | 106 |
| 178 | 3300006871 | Ga0075434_100016693 | Ga0075434_1000166933 | 106 |
| 179 | 3300006871 | Ga0075434_100041293 | Ga0075434_1000412932 | 106 |
| 180 | 3300006871 | Ga0075434_100609782 | Ga0075434_1006097822 | 106 |
| 181 | 3300006871 | Ga0075434_101203518 | Ga0075434_1012035182 | 106 |
| 182 | 3300006914 | Ga0075436_100020129 | Ga0075436_1000201298 | 106 |
| 183 | 3300006914 | Ga0075436_100275799 | Ga0075436_1002757992 | 106 |
| 184 | 3300007076 | Ga0075435_100016080 | Ga0075435_10001608011 | 106 |
| 185 | 3300007076 | Ga0075435_100081437 | Ga0075435_1000814374 | 106 |
| 186 | 3300007076 | Ga0075435_100161520 | Ga0075435_1001615204 | 106 |
| 187 | 3300007076 | Ga0075435_100829136 | Ga0075435_1008291361 | 106 |
| 188 | 3300007265 | Ga0099794_10751760 | Ga0099794_107517601 | 106 |
| 189 | 3300007265 | Ga0099794_10753436 | Ga0099794_107534362 | 106 |
| 190 | 3300009093 | Ga0105240_10326462 | Ga0105240_103264625 | 106 |
| 191 | 3300009094 | Ga0111539_10276546 | Ga0111539_102765464 | 106 |
| 192 | 3300009098 | Ga0105245_10117718 | Ga0105245_101177184 | 106 |
| 193 | 3300009098 | Ga0105245_13118014 | Ga0105245_131180142 | 106 |
| 194 | 3300009101 | Ga0105247_10360370 | Ga0105247_103603702 | 106 |
| 195 | 3300009147 | Ga0114129_10025444 | Ga0114129_1002544410 | 106 |
| 196 | 3300009147 | Ga0114129_12113893 | Ga0114129_121138932 | 106 |
| 197 | 3300009174 | Ga0105241_11291982 | Ga0105241_112919821 | 106 |
| 198 | 3300009174 | Ga0105241_11402457 | Ga0105241_114024572 | 106 |
| 199 | 3300009545 | Ga0105237_10207460 | Ga0105237_102074602 | 106 |
| 200 | 3300010375 | Ga0105239_10213868 | Ga0105239_102138685 | 106 |
| 201 | 3300010375 | Ga0105239_10907364 | Ga0105239_109073642 | 106 |
| 202 | 3300010375 | Ga0105239_12860447 | Ga0105239_128604472 | 106 |
| 203 | 3300011119 | Ga0105246_10611449 | Ga0105246_106114492 | 106 |
| 204 | 3300013102 | Ga0157371_10176020 | Ga0157371_101760204 | 106 |
| 205 | 3300013104 | Ga0157370_10036228 | Ga0157370_100362288 | 106 |
| 206 | 3300013104 | Ga0157370_10693410 | Ga0157370_106934102 | 106 |
| 207 | 3300013104 | Ga0157370_12017761 | Ga0157370_120177612 | 106 |
| 208 | 3300013105 | Ga0157369_10224100 | Ga0157369_102241002 | 106 |
| 209 | 3300013105 | Ga0157369_10343337 | Ga0157369_103433374 | 106 |
| 210 | 3300013105 | Ga0157369_10503476 | Ga0157369_105034762 | 106 |
| 211 | 3300013297 | Ga0157378_10473139 | Ga0157378_104731392 | 106 |
| 212 | 3300013306 | Ga0163162_10333055 | Ga0163162_103330552 | 106 |
| 213 | 3300013307 | Ga0157372_10874280 | Ga0157372_108742802 | 106 |
| 214 | 3300013307 | Ga0157372_12905783 | Ga0157372_129057832 | 106 |
| 215 | 3300013307 | Ga0157372_12972637 | Ga0157372_129726371 | 106 |
| 216 | 3300014968 | Ga0157379_11510309 | Ga0157379_115103092 | 106 |
| 217 | 3300014969 | Ga0157376_10296265 | Ga0157376_102962652 | 106 |
| 218 | 3300019161 | Ga0184602_110879 | Ga0184602_1108792 | 106 |
| 219 | 3300019182 | Ga0184598_105504 | Ga0184598_1055042 | 106 |
| 220 | 3300019183 | Ga0184601_132300 | Ga0184601_1323002 | 106 |
| 221 | 3300019188 | Ga0184599_144470 | Ga0184599_1444702 | 106 |
| 222 | 3300019188 | Ga0184599_148056 | Ga0184599_1480562 | 106 |
| 223 | 3300019190 | Ga0184600_101748 | Ga0184600_1017483 | 106 |
| 224 | 3300019190 | Ga0184600_125102 | Ga0184600_1251024 | 106 |
| 225 | 3300019190 | Ga0184600_131170 | Ga0184600_1311705 | 106 |
| 226 | 3300019192 | Ga0184603_142199 | Ga0184603_1421992 | 106 |
| 227 | 3300020069 | Ga0197907_10140557 | Ga0197907_101405572 | 106 |
| 228 | 3300020069 | Ga0197907_10560617 | Ga0197907_105606172 | 106 |
| 229 | 3300020069 | Ga0197907_11410793 | Ga0197907_1141079312 | 106 |
| 230 | 3300020070 | Ga0206356_10113528 | Ga0206356_101135282 | 106 |
| 231 | 3300020070 | Ga0206356_10231414 | Ga0206356_102314142 | 106 |
| 232 | 3300020070 | Ga0206356_10627949 | Ga0206356_106279494 | 106 |
| 233 | 3300020070 | Ga0206356_11122293 | Ga0206356_111222936 | 106 |
| 234 | 3300020075 | Ga0206349_1085727 | Ga0206349_10857271 | 106 |
| 235 | 3300020075 | Ga0206349_1093562 | Ga0206349_10935622 | 106 |
| 236 | 3300020076 | Ga0206355_1081850 | Ga0206355_10818506 | 106 |
| 237 | 3300020076 | Ga0206355_1146852 | Ga0206355_11468522 | 106 |
| 238 | 3300020076 | Ga0206355_1475090 | Ga0206355_14750902 | 106 |
| 239 | 3300020077 | Ga0206351_10172658 | Ga0206351_101726581 | 106 |
| 240 | 3300020077 | Ga0206351_10189769 | Ga0206351_101897693 | 106 |
| 241 | 3300020077 | Ga0206351_10935693 | Ga0206351_109356932 | 106 |
| 242 | 3300020077 | Ga0206351_10966915 | Ga0206351_109669155 | 106 |
| 243 | 3300020078 | Ga0206352_10550210 | Ga0206352_105502102 | 106 |
| 244 | 3300020078 | Ga0206352_10797554 | Ga0206352_107975542 | 106 |
| 245 | 3300020078 | Ga0206352_11071090 | Ga0206352_110710905 | 106 |
| 246 | 3300020078 | Ga0206352_11237361 | Ga0206352_112373613 | 106 |
| 247 | 3300020080 | Ga0206350_10457115 | Ga0206350_104571152 | 106 |
| 248 | 3300020080 | Ga0206350_10589439 | Ga0206350_105894392 | 106 |
| 249 | 3300020080 | Ga0206350_11271940 | Ga0206350_112719402 | 106 |
| 250 | 3300020080 | Ga0206350_11664796 | Ga0206350_116647965 | 106 |
| 251 | 3300020081 | Ga0206354_10227392 | Ga0206354_102273922 | 106 |
| 252 | 3300020081 | Ga0206354_10316033 | Ga0206354_103160332 | 106 |
| 253 | 3300020081 | Ga0206354_10439839 | Ga0206354_104398392 | 106 |
| 254 | 3300020081 | Ga0206354_11478351 | Ga0206354_114783512 | 106 |
| 255 | 3300020082 | Ga0206353_10178129 | Ga0206353_101781292 | 106 |
| 256 | 3300020082 | Ga0206353_10181719 | Ga0206353_101817192 | 106 |
| 257 | 3300020082 | Ga0206353_10565899 | Ga0206353_105658992 | 106 |
| 258 | 3300020082 | Ga0206353_10902912 | Ga0206353_109029125 | 106 |
| 259 | 3300020610 | Ga0154015_1067250 | Ga0154015_10672504 | 106 |
| 260 | 3300020610 | Ga0154015_1474683 | Ga0154015_14746832 | 106 |
| 261 | 3300020610 | Ga0154015_1525166 | Ga0154015_15251662 | 106 |
| 262 | 3300021358 | Ga0213873_10130699 | Ga0213873_101306992 | 106 |
| 263 | 3300021377 | Ga0213874_10042088 | Ga0213874_100420884 | 106 |
| 264 | 3300021377 | Ga0213874_10079706 | Ga0213874_100797062 | 106 |
| 265 | 3300021388 | Ga0213875_10022186 | Ga0213875_100221864 | 106 |
| 266 | 3300021388 | Ga0213875_10027897 | Ga0213875_100278974 | 106 |
| 267 | 3300021388 | Ga0213875_10036259 | Ga0213875_100362596 | 106 |
| 268 | 3300021388 | Ga0213875_10078941 | Ga0213875_100789412 | 106 |
| 269 | 3300022467 | Ga0224712_10042950 | Ga0224712_100429504 | 106 |
| 270 | 3300022467 | Ga0224712_10193364 | Ga0224712_101933642 | 106 |
| 271 | 3300022467 | Ga0224712_10210464 | Ga0224712_102104642 | 106 |
| 272 | 3300023660 | Ga0247550_102792 | Ga0247550_1027922 | 106 |
| 273 | 3300023672 | Ga0247553_111181 | Ga0247553_1111812 | 106 |
| 274 | 3300024225 | Ga0224572_1110363 | Ga0224572_11103632 | 106 |
| 275 | 3300024227 | Ga0228598_1043014 | Ga0228598_10430142 | 106 |
| 276 | 3300025898 | Ga0207692_10001130 | Ga0207692_1000113010 | 106 |
| 277 | 3300025898 | Ga0207692_10006028 | Ga0207692_100060285 | 106 |
| 278 | 3300025898 | Ga0207692_10009470 | Ga0207692_100094704 | 106 |
| 279 | 3300025904 | Ga0207647_10100984 | Ga0207647_101009844 | 106 |
| 280 | 3300025905 | Ga0207685_10001544 | Ga0207685_100015448 | 106 |
| 281 | 3300025905 | Ga0207685_10008831 | Ga0207685_100088313 | 106 |
| 282 | 3300025905 | Ga0207685_10217527 | Ga0207685_102175272 | 106 |
| 283 | 3300025906 | Ga0207699_10000260 | Ga0207699_1000026018 | 106 |
| 284 | 3300025906 | Ga0207699_10007633 | Ga0207699_100076335 | 106 |
| 285 | 3300025906 | Ga0207699_10008993 | Ga0207699_100089935 | 106 |
| 286 | 3300025909 | Ga0207705_10158625 | Ga0207705_101586253 | 106 |
| 287 | 3300025910 | Ga0207684_10002031 | Ga0207684_1000203127 | 106 |
| 288 | 3300025910 | Ga0207684_10002505 | Ga0207684_100025059 | 106 |
| 289 | 3300025910 | Ga0207684_10016512 | Ga0207684_1001651213 | 106 |
| 290 | 3300025910 | Ga0207684_10027808 | Ga0207684_100278085 | 106 |
| 291 | 3300025910 | Ga0207684_10034449 | Ga0207684_100344493 | 106 |
| 292 | 3300025910 | Ga0207684_10034994 | Ga0207684_100349949 | 106 |
| 293 | 3300025910 | Ga0207684_10392457 | Ga0207684_103924572 | 106 |
| 294 | 3300025910 | Ga0207684_10490615 | Ga0207684_104906152 | 106 |
| 295 | 3300025910 | Ga0207684_10928131 | Ga0207684_109281312 | 106 |
| 296 | 3300025910 | Ga0207684_11311350 | Ga0207684_113113502 | 106 |
| 297 | 3300025911 | Ga0207654_10745871 | Ga0207654_107458712 | 106 |
| 298 | 3300025912 | Ga0207707_10008073 | Ga0207707_100080733 | 106 |
| 299 | 3300025914 | Ga0207671_10451396 | Ga0207671_104513963 | 106 |
| 300 | 3300025915 | Ga0207693_10002650 | Ga0207693_1000265022 | 106 |
| 301 | 3300025915 | Ga0207693_10004081 | Ga0207693_1000408118 | 106 |
| 302 | 3300025915 | Ga0207693_10031891 | Ga0207693_100318914 | 106 |
| 303 | 3300025915 | Ga0207693_10130380 | Ga0207693_101303803 | 106 |
| 304 | 3300025915 | Ga0207693_10178908 | Ga0207693_101789082 | 106 |
| 305 | 3300025915 | Ga0207693_10540287 | Ga0207693_105402872 | 106 |
| 306 | 3300025916 | Ga0207663_10000595 | Ga0207663_1000059522 | 106 |
| 307 | 3300025916 | Ga0207663_10021515 | Ga0207663_100215157 | 106 |
| 308 | 3300025916 | Ga0207663_10023223 | Ga0207663_100232238 | 106 |
| 309 | 3300025916 | Ga0207663_10720010 | Ga0207663_107200102 | 106 |
| 310 | 3300025917 | Ga0207660_10093017 | Ga0207660_100930174 | 106 |
| 311 | 3300025919 | Ga0207657_10067642 | Ga0207657_100676425 | 106 |
| 312 | 3300025921 | Ga0207652_10095451 | Ga0207652_100954512 | 106 |
| 313 | 3300025921 | Ga0207652_10137583 | Ga0207652_101375837 | 106 |
| 314 | 3300025921 | Ga0207652_10553990 | Ga0207652_105539902 | 106 |
| 315 | 3300025922 | Ga0207646_10001638 | Ga0207646_1000163829 | 106 |
| 316 | 3300025922 | Ga0207646_10079404 | Ga0207646_100794044 | 106 |
| 317 | 3300025922 | Ga0207646_10159851 | Ga0207646_101598512 | 106 |
| 318 | 3300025922 | Ga0207646_10188791 | Ga0207646_101887915 | 106 |
| 319 | 3300025922 | Ga0207646_10379724 | Ga0207646_103797243 | 106 |
| 320 | 3300025922 | Ga0207646_10661678 | Ga0207646_106616781 | 106 |
| 321 | 3300025927 | Ga0207687_10067273 | Ga0207687_100672733 | 106 |
| 322 | 3300025928 | Ga0207700_10000091 | Ga0207700_1000009147 | 106 |
| 323 | 3300025928 | Ga0207700_10009657 | Ga0207700_100096576 | 106 |
| 324 | 3300025928 | Ga0207700_10076347 | Ga0207700_100763474 | 106 |
| 325 | 3300025928 | Ga0207700_10209767 | Ga0207700_102097673 | 106 |
| 326 | 3300025928 | Ga0207700_10284128 | Ga0207700_102841283 | 106 |
| 327 | 3300025928 | Ga0207700_10309942 | Ga0207700_103099421 | 106 |
| 328 | 3300025928 | Ga0207700_10629107 | Ga0207700_106291072 | 106 |
| 329 | 3300025928 | Ga0207700_10672073 | Ga0207700_106720732 | 106 |
| 330 | 3300025928 | Ga0207700_10981177 | Ga0207700_109811771 | 106 |
| 331 | 3300025929 | Ga0207664_10001032 | Ga0207664_1000103213 | 106 |
| 332 | 3300025929 | Ga0207664_10001323 | Ga0207664_1000132322 | 106 |
| 333 | 3300025929 | Ga0207664_10006431 | Ga0207664_100064319 | 106 |
| 334 | 3300025929 | Ga0207664_10012435 | Ga0207664_100124355 | 106 |
| 335 | 3300025929 | Ga0207664_10027344 | Ga0207664_100273446 | 106 |
| 336 | 3300025929 | Ga0207664_10639072 | Ga0207664_106390722 | 106 |
| 337 | 3300025929 | Ga0207664_10675916 | Ga0207664_106759161 | 106 |
| 338 | 3300025929 | Ga0207664_10685776 | Ga0207664_106857762 | 106 |
| 339 | 3300025929 | Ga0207664_11027721 | Ga0207664_110277212 | 106 |
| 340 | 3300025931 | Ga0207644_10144493 | Ga0207644_101444933 | 106 |
| 341 | 3300025939 | Ga0207665_10000821 | Ga0207665_1000082122 | 106 |
| 342 | 3300025939 | Ga0207665_10013605 | Ga0207665_1001360510 | 106 |
| 343 | 3300025939 | Ga0207665_10022319 | Ga0207665_100223197 | 106 |
| 344 | 3300025939 | Ga0207665_10676007 | Ga0207665_106760072 | 106 |
| 345 | 3300025942 | Ga0207689_11229876 | Ga0207689_112298761 | 106 |
| 346 | 3300025944 | Ga0207661_10057724 | Ga0207661_100577244 | 106 |
| 347 | 3300025945 | Ga0207679_11224452 | Ga0207679_112244522 | 106 |
| 348 | 3300025949 | Ga0207667_11429000 | Ga0207667_114290002 | 106 |
| 349 | 3300025960 | Ga0207651_10547541 | Ga0207651_105475412 | 106 |
| 350 | 3300026023 | Ga0207677_10167377 | Ga0207677_101673773 | 106 |
| 351 | 3300026035 | Ga0207703_10752596 | Ga0207703_107525962 | 106 |
| 352 | 3300026035 | Ga0207703_10792409 | Ga0207703_107924091 | 106 |
| 353 | 3300026067 | Ga0207678_10124096 | Ga0207678_101240962 | 106 |
| 354 | 3300026067 | Ga0207678_10156175 | Ga0207678_101561754 | 106 |
| 355 | 3300026067 | Ga0207678_10191197 | Ga0207678_101911972 | 106 |
| 356 | 3300026078 | Ga0207702_10011071 | Ga0207702_1001107113 | 106 |
| 357 | 3300026078 | Ga0207702_10075749 | Ga0207702_100757495 | 106 |
| 358 | 3300026078 | Ga0207702_10197384 | Ga0207702_101973843 | 106 |
| 359 | 3300026088 | Ga0207641_10704718 | Ga0207641_107047182 | 106 |
| 360 | 3300026116 | Ga0207674_10341731 | Ga0207674_103417312 | 106 |
| 361 | 3300026116 | Ga0207674_10491963 | Ga0207674_104919632 | 106 |
| 362 | 3300027907 | Ga0207428_10175378 | Ga0207428_101753784 | 106 |
| 363 | 3300028379 | Ga0268266_10023185 | Ga0268266_100231852 | 106 |
| 364 | 3300028381 | Ga0268264_10650291 | Ga0268264_106502913 | 106 |
| 365 | 3300028556 | Ga0265337_1000049 | Ga0265337_100004932 | 106 |
| 366 | 3300028558 | Ga0265326_10000822 | Ga0265326_1000082213 | 106 |
| 367 | 3300028563 | Ga0265319_1000220 | Ga0265319_100022022 | 106 |
| 368 | 3300028573 | Ga0265334_10000083 | Ga0265334_1000008342 | 106 |
| 369 | 3300028577 | Ga0265318_10020851 | Ga0265318_100208513 | 106 |
| 370 | 3300028653 | Ga0265323_10040745 | Ga0265323_100407454 | 106 |
| 371 | 3300028654 | Ga0265322_10004536 | Ga0265322_100045361 | 106 |
| 372 | 3300028666 | Ga0265336_10001694 | Ga0265336_1000169414 | 106 |
| 373 | 3300028666 | Ga0265336_10004565 | Ga0265336_100045655 | 106 |
| 374 | 3300028800 | Ga0265338_10000358 | Ga0265338_1000035855 | 106 |
| 375 | 3300028800 | Ga0265338_10000940 | Ga0265338_1000094012 | 106 |
| 376 | 3300028800 | Ga0265338_10014758 | Ga0265338_100147582 | 106 |
| 377 | 3300028800 | Ga0265338_10061662 | Ga0265338_100616622 | 106 |
| 378 | 3300029957 | Ga0265324_10001390 | Ga0265324_1000139012 | 106 |
| 379 | 3300030760 | Ga0265762_1005987 | Ga0265762_10059874 | 106 |
| 380 | 3300030762 | Ga0265775_103046 | Ga0265775_1030462 | 106 |
| 381 | 3300030762 | Ga0265775_115245 | Ga0265775_1152452 | 106 |
| 382 | 3300030763 | Ga0265763_1025851 | Ga0265763_10258512 | 106 |
| 383 | 3300030836 | Ga0265767_100417 | Ga0265767_1004174 | 106 |
| 384 | 3300030863 | Ga0265766_1000538 | Ga0265766_10005382 | 106 |
| 385 | 3300030863 | Ga0265766_1016712 | Ga0265766_10167122 | 106 |
| 386 | 3300030877 | Ga0265777_114919 | Ga0265777_1149192 | 106 |
| 387 | 3300030877 | Ga0265777_125996 | Ga0265777_1259961 | 106 |
| 388 | 3300030878 | Ga0265770_1007774 | Ga0265770_10077743 | 106 |
| 389 | 3300030882 | Ga0265764_100345 | Ga0265764_1003454 | 106 |
| 390 | 3300030888 | Ga0265769_101486 | Ga0265769_1014863 | 106 |
| 391 | 3300030888 | Ga0265769_117187 | Ga0265769_1171872 | 106 |
| 392 | 3300030889 | Ga0265761_101512 | Ga0265761_1015122 | 106 |
| 393 | 3300030889 | Ga0265761_102520 | Ga0265761_1025202 | 106 |
| 394 | 3300030889 | Ga0265761_107242 | Ga0265761_1072422 | 106 |
| 395 | 3300030942 | Ga0247549_103889 | Ga0247549_1038891 | 106 |
| 396 | 3300030963 | Ga0265768_102649 | Ga0265768_1026492 | 106 |
| 397 | 3300030963 | Ga0265768_104272 | Ga0265768_1042722 | 106 |
| 398 | 3300031010 | Ga0265771_1001777 | Ga0265771_10017772 | 106 |
| 399 | 3300031010 | Ga0265771_1012352 | Ga0265771_10123522 | 106 |
| 400 | 3300031090 | Ga0265760_10011877 | Ga0265760_100118776 | 106 |
| 401 | 3300031090 | Ga0265760_10015954 | Ga0265760_100159545 | 106 |
| 402 | 3300031090 | Ga0265760_10016761 | Ga0265760_100167614 | 106 |
| 403 | 3300031090 | Ga0265760_10072545 | Ga0265760_100725452 | 106 |
| 404 | 3300031238 | Ga0265332_10000675 | Ga0265332_1000067510 | 106 |
| 405 | 3300031240 | Ga0265320_10003833 | Ga0265320_1000383310 | 106 |
| 406 | 3300031241 | Ga0265325_10006148 | Ga0265325_100061482 | 106 |
| 407 | 3300031247 | Ga0265340_10000796 | Ga0265340_1000079618 | 106 |
| 408 | 3300031249 | Ga0265339_10046537 | Ga0265339_100465372 | 106 |
| 409 | 3300031344 | Ga0265316_10007400 | Ga0265316_1000740012 | 106 |
| 410 | 3300031591 | Ga0310116_103289 | Ga0310116_1032894 | 106 |
| 411 | 3300031592 | Ga0310117_112719 | Ga0310117_1127192 | 106 |
| 412 | 3300031592 | Ga0310117_117491 | Ga0310117_1174912 | 106 |
| 413 | 3300031595 | Ga0265313_10018894 | Ga0265313_100188942 | 106 |
| 414 | 3300031614 | Ga0310103_104508 | Ga0310103_1045082 | 106 |
| 415 | 3300031614 | Ga0310103_108291 | Ga0310103_1082912 | 106 |
| 416 | 3300031614 | Ga0310103_129084 | Ga0310103_1290842 | 106 |
| 417 | 3300031666 | Ga0310105_114668 | Ga0310105_1146682 | 106 |
| 418 | 3300031678 | Ga0310114_111665 | Ga0310114_1116652 | 106 |
| 419 | 3300031686 | Ga0310119_127835 | Ga0310119_1278352 | 106 |
| 420 | 3300031690 | Ga0310101_105794 | Ga0310101_1057944 | 106 |
| 421 | 3300031711 | Ga0265314_10008203 | Ga0265314_1000820310 | 106 |
| 422 | 3300031712 | Ga0265342_10029921 | Ga0265342_100299215 | 106 |
| 423 | 3300031814 | Ga0247548_108915 | Ga0247548_1089152 | 106 |
| 424 | 3300031901 | Ga0307406_11732527 | Ga0307406_117325271 | 106 |
| 425 | 3300033180 | Ga0307510_10660135 | Ga0307510_106601352 | 106 |
| 426 | 3300033544 | Ga0316215_1028139 | Ga0316215_10281391 | 106 |
| 427 | 3300033545 | Ga0316214_1000853 | Ga0316214_10008536 | 106 |
| 428 | 3300033547 | Ga0316212_1007476 | Ga0316212_10074762 | 106 |
| 429 | 3300033548 | Ga0316216_1010539 | Ga0316216_10105392 | 106 |
| 430 | 3300034816 | Ga0373930_0007648 | Ga0373930_0007648_1492_1821 | 106 |
| 431 | 3300034817 | Ga0373948_0074115 | Ga0373948_0074115_28_396 | 106 |
| 432 | 3300034818 | Ga0373950_0022310 | Ga0373950_0022310_758_1087 | 106 |
| 433 | 3300034819 | Ga0373958_0001426 | Ga0373958_0001426_935_1303 | 106 |
| 434 | 3300034820 | Ga0373959_0049988 | Ga0373959_0049988_71_439 | 106 |
| 435 | 3300034957 | Ga0373938_0003303 | Ga0373938_0003303_607_975 | 106 |
| 436 | 3300035083 | Ga0373926_0029022 | Ga0373926_0029022_949_1278 | 106 |
| 437 | 3300035083 | Ga0373926_0302388 | Ga0373926_0302388_214_543 | 106 |
| 438 | 3300035085 | Ga0373929_0002602 | Ga0373929_0002602_1734_2102 | 106 |
| 439 | 3300035086 | Ga0373934_0000328 | Ga0373934_0000328_10147_10515 | 106 |
| 440 | 3300035086 | Ga0373934_0032981 | Ga0373934_0032981_261_626 | 106 |
| 441 | 3300035086 | Ga0373934_0060411 | Ga0373934_0060411_747_1076 | 106 |
| 442 | 3300035086 | Ga0373934_0114350 | Ga0373934_0114350_753_1073 | 106 |
| 443 | 3300035088 | Ga0373940_0048435 | Ga0373940_0048435_581_910 | 106 |
| 444 | 3300035091 | Ga0373951_0009688 | Ga0373951_0009688_591_959 | 106 |
| 445 | 3300035092 | Ga0373952_0021896 | Ga0373952_0021896_582_950 | 106 |
| 446 | 3300035111 | Ga0373923_0029692 | Ga0373923_0029692_1213_1581 | 106 |
| 447 | 3300035111 | Ga0373923_0112223 | Ga0373923_0112223_395_724 | 106 |
| 448 | 3300035112 | Ga0373932_0007413 | Ga0373932_0007413_353_682 | 106 |
| 449 | 3300035113 | Ga0373936_0097200 | Ga0373936_0097200_406_735 | 106 |
| 450 | 3300035113 | Ga0373936_0119229 | Ga0373936_0119229_288_674 | 106 |
| 451 | 3300035113 | Ga0373936_0123726 | Ga0373936_0123726_402_767 | 106 |
| 452 | 3300035114 | Ga0373939_0021110 | Ga0373939_0021110_993_1322 | 106 |
| 453 | 3300035115 | Ga0373941_0357657 | Ga0373941_0357657_251_580 | 106 |
| 454 | 3300035116 | Ga0373945_0108636 | Ga0373945_0108636_379_708 | 106 |
| 455 | 3300035116 | Ga0373945_0168616 | Ga0373945_0168616_91_456 | 106 |
| 456 | 3300035116 | Ga0373945_0353501 | Ga0373945_0353501_145_474 | 106 |
| 457 | 3300035116 | Ga0373945_0578697 | Ga0373945_0578697_51_371 | 106 |
| 458 | 3300035117 | Ga0373953_0000262 | Ga0373953_0000262_2298_2666 | 106 |
| 459 | 3300035117 | Ga0373953_0005330 | Ga0373953_0005330_1610_1939 | 106 |
| 460 | 3300035117 | Ga0373953_0034706 | Ga0373953_0034706_107_472 | 106 |
| 461 | 3300035117 | Ga0373953_0053423 | Ga0373953_0053423_261_626 | 106 |
| 462 | 3300035117 | Ga0373953_0055776 | Ga0373953_0055776_165_530 | 106 |
| 463 | 3300035117 | Ga0373953_0372084 | Ga0373953_0372084_174_554 | 106 |
| 464 | 3300035118 | Ga0373954_0119148 | Ga0373954_0119148_85_450 | 106 |
| 465 | 3300035118 | Ga0373954_0154806 | Ga0373954_0154806_300_668 | 106 |
| 466 | 3300035118 | Ga0373954_0215984 | Ga0373954_0215984_383_748 | 106 |
| 467 | 3300035118 | Ga0373954_0339640 | Ga0373954_0339640_102_488 | 106 |
| 468 | 3300035118 | Ga0373954_0394658 | Ga0373954_0394658_193_573 | 106 |
| 469 | 3300035119 | Ga0373956_0004145 | Ga0373956_0004145_300_668 | 106 |
| 470 | 3300035119 | Ga0373956_0007049 | Ga0373956_0007049_2256_2621 | 106 |
| 471 | 3300035119 | Ga0373956_0063596 | Ga0373956_0063596_749_1129 | 106 |
| 472 | 3300035119 | Ga0373956_0084786 | Ga0373956_0084786_831_1196 | 106 |
| 473 | 3300035119 | Ga0373956_0518982 | Ga0373956_0518982_224_544 | 106 |
| 474 | 3300035120 | Ga0373957_0000312 | Ga0373957_0000312_5477_5845 | 106 |
| 475 | 3300035120 | Ga0373957_0001248 | Ga0373957_0001248_4421_4750 | 106 |
| 476 | 3300035120 | Ga0373957_0039494 | Ga0373957_0039494_692_1012 | 106 |
| 477 | 3300035120 | Ga0373957_0072893 | Ga0373957_0072893_261_626 | 106 |
| 478 | 3300035120 | Ga0373957_0136378 | Ga0373957_0136378_440_805 | 106 |
| 479 | 3300035120 | Ga0373957_0250847 | Ga0373957_0250847_166_552 | 106 |
| 480 | 3300035120 | Ga0373957_0383216 | Ga0373957_0383216_157_522 | 106 |
| 481 | 3300035121 | Ga0373960_0011629 | Ga0373960_0011629_1186_1554 | 106 |
| 482 | 3300035170 | Ga0373943_0048034 | Ga0373943_0048034_1562_1891 | 106 |
| 483 | 3300035170 | Ga0373943_0156022 | Ga0373943_0156022_422_808 | 106 |
| 484 | 3300035170 | Ga0373943_0376761 | Ga0373943_0376761_43_408 | 106 |
| 485 | 3300035172 | Ga0373955_0000233 | Ga0373955_0000233_7977_8345 | 106 |
| 486 | 3300035172 | Ga0373955_0015005 | Ga0373955_0015005_3175_3504 | 106 |
| 487 | 3300035172 | Ga0373955_0032433 | Ga0373955_0032433_1756_2121 | 106 |
| 488 | 3300035172 | Ga0373955_0130168 | Ga0373955_0130168_852_1232 | 106 |
| 489 | 3300035172 | Ga0373955_0507075 | Ga0373955_0507075_201_587 | 106 |
| 490 | 3300035207 | Ga0373942_0019668 | Ga0373942_0019668_966_1295 | 106 |
| 491 | 3300035241 | Ga0373961_0007849 | Ga0373961_0007849_828_1157 | 106 |
| 492 | 3300035410 | Ga0373924_0016779 | Ga0373924_0016779_409_777 | 106 |
| 493 | 3300035410 | Ga0373924_0027702 | Ga0373924_0027702_1805_2170 | 106 |
| 494 | 3300035410 | Ga0373924_0159988 | Ga0373924_0159988_174_554 | 106 |
| 495 | 3300035410 | Ga0373924_0221717 | Ga0373924_0221717_31_360 | 106 |
| 496 | 3300035691 | Ga0373931_0018524 | Ga0373931_0018524_923_1288 | 106 |
| 497 | 3300035691 | Ga0373931_0023038 | Ga0373931_0023038_1034_1402 | 106 |
| 498 | 3300035692 | Ga0373935_0025535 | Ga0373935_0025535_1107_1472 | 106 |
| 499 | 3300035692 | Ga0373935_0089335 | Ga0373935_0089335_1412_1732 | 106 |
| 500 | 3300035692 | Ga0373935_0243431 | Ga0373935_0243431_408_737 | 106 |
| 501 | 3300035695 | Ga0373927_0068698 | Ga0373927_0068698_41_406 | 106 |
| 502 | 3300035695 | Ga0373927_0309110 | Ga0373927_0309110_550_936 | 106 |
| 503 | 3300035695 | Ga0373927_0416553 | Ga0373927_0416553_31_360 | 106 |
| 504 | 3300035695 | Ga0373927_0792825 | Ga0373927_0792825_84_404 | 106 |
| 505 | 3300035724 | Ga0373933_0000843 | Ga0373933_0000843_11962_12330 | 106 |
| 506 | 3300035724 | Ga0373933_0009135 | Ga0373933_0009135_2229_2609 | 106 |
| 507 | 3300035724 | Ga0373933_0012378 | Ga0373933_0012378_1880_2209 | 106 |
| 508 | 3300035724 | Ga0373933_0039537 | Ga0373933_0039537_959_1324 | 106 |
| 509 | 3300035724 | Ga0373933_0087053 | Ga0373933_0087053_995_1360 | 106 |
| 510 | 3300035724 | Ga0373933_0109284 | Ga0373933_0109284_298_663 | 106 |
| 511 | 3300035725 | Ga0373947_0035271 | Ga0373947_0035271_2329_2715 | 106 |
| 512 | 3300035725 | Ga0373947_0085364 | Ga0373947_0085364_1568_1897 | 106 |
| 513 | 3300035725 | Ga0373947_0201473 | Ga0373947_0201473_797_1162 | 106 |
| 514 | 3300035725 | Ga0373947_0613715 | Ga0373947_0613715_14_379 | 106 |
| 515 | 3300036401 | Ga0373937_0000112 | Ga0373937_0000112_34049_34417 | 106 |
| 516 | 3300036401 | Ga0373937_0007454 | Ga0373937_0007454_9055_9384 | 106 |
| 517 | 3300036401 | Ga0373937_0025538 | Ga0373937_0025538_2336_2701 | 106 |
| 518 | 3300036401 | Ga0373937_0039458 | Ga0373937_0039458_3521_3886 | 106 |
| 519 | 3300036401 | Ga0373937_0089360 | Ga0373937_0089360_1709_2089 | 106 |
| 520 | 3300036401 | Ga0373937_0507803 | Ga0373937_0507803_528_848 | 106 |
| 521 | 3300036401 | Ga0373937_0896568 | Ga0373937_0896568_38_358 | 106 |
| 522 | 3300036457 | Ga0265778_021945 | Ga0265778_021945_97_417 | 106 |
| 523 | 3300036457 | Ga0265778_048135 | Ga0265778_048135_80_400 | 106 |
| 524 | 3300036457 | Ga0265778_049055 | Ga0265778_049055_82_402 | 106 |
| 525 | 3300036458 | Ga0310112_013351 | Ga0310112_013351_589_909 | 106 |
| 526 | 3300036459 | Ga0372808_000924 | Ga0372808_000924_1295_1615 | 106 |
| 527 | 3300036459 | Ga0372808_003049 | Ga0372808_003049_487_807 | 106 |
| 528 | 3300036534 | Ga0310109_031615 | Ga0310109_031615_288_608 | 106 |
| 529 | 3300037068 | Ga0373925_0000004 | Ga0373925_0000004_303179_303499 | 106 |
| 530 | 3300037068 | Ga0373925_0001140 | Ga0373925_0001140_12002_12382 | 106 |
| 531 | 3300037068 | Ga0373925_0017994 | Ga0373925_0017994_3532_3903 | 106 |
| 532 | 3300037068 | Ga0373925_0068419 | Ga0373925_0068419_740_1105 | 106 |
| 533 | 3300037068 | Ga0373925_0551908 | Ga0373925_0551908_218_586 | 106 |
| 534 | 3300037068 | Ga0373925_1251057 | Ga0373925_1251057_91_456 | 106 |
| 535 | 3300037068 | Ga0373925_1798945 | Ga0373925_1798945_18_383 | 106 |
| 536 | 3300037466 | Ga0395898_0078143 | Ga0395898_0078143_342_662 | 106 |
| 537 | 3300037853 | Ga0436364_0385416 | Ga0436364_0385416_1798_2118 | 106 |
| 538 | 3300037853 | Ga0436364_0697983 | Ga0436364_0697983_1027_1347 | 106 |
| 539 | 3300037853 | Ga0436364_0741352 | Ga0436364_0741352_1410_1733 | 106 |
| 540 | 3300037853 | Ga0436364_1198874 | Ga0436364_1198874_473_844 | 106 |
| 541 | 3300037853 | Ga0436364_1316048 | Ga0436364_1316048_302_625 | 106 |
| 542 | 3300038443 | Ga0395901_0220498 | Ga0395901_0220498_1454_1774 | 106 |
| 543 | 3300039437 | Ga0436365_0791880 | Ga0436365_0791880_552_872 | 106 |
| 544 | 3300039437 | Ga0436365_1385863 | Ga0436365_1385863_507_830 | 106 |
| 545 | 3300039437 | Ga0436365_1830100 | Ga0436365_1830100_482_847 | 106 |
| 546 | 3300039438 | Ga0436360_0112883 | Ga0436360_0112883_507_827 | 106 |
| 547 | 3300039438 | Ga0436360_0712781 | Ga0436360_0712781_209_529 | 106 |
| 548 | 3300039447 | Ga0436361_1006107 | Ga0436361_1006107_128_448 | 106 |
| 549 | 3300039450 | Ga0436363_0292346 | Ga0436363_0292346_312_638 | 106 |
| 550 | 3300039450 | Ga0436363_0299477 | Ga0436363_0299477_63_383 | 106 |
| 551 | 3300039450 | Ga0436363_1625798 | Ga0436363_1625798_1353_1718 | 106 |
| 552 | 3300039453 | Ga0436362_0581664 | Ga0436362_0581664_174_494 | 106 |
| 553 | 3300039453 | Ga0436362_1089947 | Ga0436362_1089947_166_489 | 106 |
| 554 | 3300044683 | Ga0466965_0402567 | Ga0466965_0402567_256_576 | 106 |
| 555 | 3300044684 | Ga0466966_0881340 | Ga0466966_0881340_165_485 | 106 |
| 556 | 3300044694 | Ga0466963_0266010 | Ga0466963_0266010_672_992 | 106 |
| 557 | 3300044735 | Ga0466968_0130492 | Ga0466968_0130492_528_887 | 106 |
| 558 | 3300044735 | Ga0466968_0216604 | Ga0466968_0216604_200_565 | 106 |
| 559 | 3300044735 | Ga0466968_0487973 | Ga0466968_0487973_16_336 | 106 |
| 560 | 3300044842 | Ga0466957_0200035 | Ga0466957_0200035_496_816 | 106 |
| 561 | 3300045049 | Ga0466959_0293548 | Ga0466959_0293548_662_1027 | 106 |
| 562 | 3300045836 | Ga0466958_0103955 | Ga0466958_0103955_453_773 | 106 |
| 563 | 3300045976 | Ga0466967_0440340 | Ga0466967_0440340_632_952 | 106 |
| 564 | 3300045976 | Ga0466967_1371476 | Ga0466967_1371476_59_430 | 106 |
| 565 | 3300046454 | Ga0495592_0001722 | Ga0495592_0001722_6451_6819 | 106 |
| 566 | 3300046454 | Ga0495592_0019017 | Ga0495592_0019017_2308_2637 | 106 |
| 567 | 3300046454 | Ga0495592_0027974 | Ga0495592_0027974_2633_2998 | 106 |
| 568 | 3300046454 | Ga0495592_0036908 | Ga0495592_0036908_2170_2550 | 106 |
| 569 | 3300046454 | Ga0495592_0136109 | Ga0495592_0136109_1103_1468 | 106 |
| 570 | 3300046455 | Ga0495603_0041898 | Ga0495603_0041898_968_1297 | 106 |
| 571 | 3300046459 | Ga0495629_0016271 | Ga0495629_0016271_4120_4485 | 106 |
| 572 | 3300046459 | Ga0495629_0068955 | Ga0495629_0068955_1033_1362 | 106 |
| 573 | 3300046459 | Ga0495629_0136056 | Ga0495629_0136056_1030_1359 | 106 |
| 574 | 3300046461 | Ga0495641_0018421 | Ga0495641_0018421_2715_3044 | 106 |
| 575 | 3300046461 | Ga0495641_0280173 | Ga0495641_0280173_17_337 | 106 |
| 576 | 3300046462 | Ga0495651_0000041 | Ga0495651_0000041_6502_6870 | 106 |
| 577 | 3300046462 | Ga0495651_0026619 | Ga0495651_0026619_1580_1945 | 106 |
| 578 | 3300046462 | Ga0495651_0029113 | Ga0495651_0029113_2333_2662 | 106 |
| 579 | 3300046462 | Ga0495651_0048866 | Ga0495651_0048866_2492_2857 | 106 |
| 580 | 3300046462 | Ga0495651_0080871 | Ga0495651_0080871_1899_2279 | 106 |
| 581 | 3300046462 | Ga0495651_0314721 | Ga0495651_0314721_473_838 | 106 |
| 582 | 3300046462 | Ga0495651_0359138 | Ga0495651_0359138_198_527 | 106 |
| 583 | 3300046463 | Ga0495653_0008925 | Ga0495653_0008925_674_1054 | 106 |
| 584 | 3300046463 | Ga0495653_0068546 | Ga0495653_0068546_1278_1607 | 106 |
| 585 | 3300046463 | Ga0495653_0179294 | Ga0495653_0179294_877_1242 | 106 |
| 586 | 3300046463 | Ga0495653_0471668 | Ga0495653_0471668_325_690 | 106 |
| 587 | 3300046463 | Ga0495653_0664450 | Ga0495653_0664450_32_352 | 106 |
| 588 | 3300046472 | Ga0495580_0069109 | Ga0495580_0069109_1615_1944 | 106 |
| 589 | 3300046472 | Ga0495580_0394658 | Ga0495580_0394658_171_491 | 106 |
| 590 | 3300046473 | Ga0495582_0005320 | Ga0495582_0005320_2398_2763 | 106 |
| 591 | 3300046473 | Ga0495582_0039452 | Ga0495582_0039452_1934_2263 | 106 |
| 592 | 3300046473 | Ga0495582_0093463 | Ga0495582_0093463_334_663 | 106 |
| 593 | 3300046475 | Ga0495639_0034767 | Ga0495639_0034767_701_1066 | 106 |
| 594 | 3300046476 | Ga0495662_0004602 | Ga0495662_0004602_2435_2800 | 106 |
| 595 | 3300046476 | Ga0495662_0089659 | Ga0495662_0089659_738_1067 | 106 |
| 596 | 3300046476 | Ga0495662_0210839 | Ga0495662_0210839_468_797 | 106 |
| 597 | 3300046476 | Ga0495662_0500968 | Ga0495662_0500968_161_547 | 106 |
| 598 | 3300046477 | Ga0495664_0006941 | Ga0495664_0006941_18_338 | 106 |
| 599 | 3300046477 | Ga0495664_0012241 | Ga0495664_0012241_4224_4553 | 106 |
| 600 | 3300046477 | Ga0495664_0047317 | Ga0495664_0047317_889_1275 | 106 |
| 601 | 3300046477 | Ga0495664_0054637 | Ga0495664_0054637_858_1178 | 106 |
| 602 | 3300046477 | Ga0495664_0687100 | Ga0495664_0687100_66_386 | 106 |
| 603 | 3300046499 | Ga0495594_0222542 | Ga0495594_0222542_734_1063 | 106 |
| 604 | 3300046511 | Ga0495608_0001767 | Ga0495608_0001767_6449_6817 | 106 |
| 605 | 3300046511 | Ga0495608_0004661 | Ga0495608_0004661_4408_4788 | 106 |
| 606 | 3300046511 | Ga0495608_0031563 | Ga0495608_0031563_399_764 | 106 |
| 607 | 3300046511 | Ga0495608_0207881 | Ga0495608_0207881_799_1164 | 106 |
| 608 | 3300046514 | Ga0495618_0041548 | Ga0495618_0041548_17_337 | 106 |
| 609 | 3300046514 | Ga0495618_0044087 | Ga0495618_0044087_434_763 | 106 |
| 610 | 3300046514 | Ga0495618_0098707 | Ga0495618_0098707_680_1009 | 106 |
| 611 | 3300046514 | Ga0495618_0132139 | Ga0495618_0132139_267_653 | 106 |
| 612 | 3300046514 | Ga0495618_0255868 | Ga0495618_0255868_26_391 | 106 |
| 613 | 3300046516 | Ga0495628_0003221 | Ga0495628_0003221_7877_8245 | 106 |
| 614 | 3300046516 | Ga0495628_0025761 | Ga0495628_0025761_1805_2170 | 106 |
| 615 | 3300046516 | Ga0495628_0039808 | Ga0495628_0039808_166_546 | 106 |
| 616 | 3300046516 | Ga0495628_0081317 | Ga0495628_0081317_306_635 | 106 |
| 617 | 3300046516 | Ga0495628_0234239 | Ga0495628_0234239_811_1176 | 106 |
| 618 | 3300046516 | Ga0495628_0555864 | Ga0495628_0555864_403_789 | 106 |
| 619 | 3300046517 | Ga0495630_0028653 | Ga0495630_0028653_434_763 | 106 |
| 620 | 3300046517 | Ga0495630_0033618 | Ga0495630_0033618_659_988 | 106 |
| 621 | 3300046517 | Ga0495630_0061782 | Ga0495630_0061782_2316_2681 | 106 |
| 622 | 3300046517 | Ga0495630_0570355 | Ga0495630_0570355_83_469 | 106 |
| 623 | 3300046517 | Ga0495630_0904416 | Ga0495630_0904416_120_500 | 106 |
| 624 | 3300046517 | Ga0495630_0982556 | Ga0495630_0982556_16_381 | 106 |
| 625 | 3300046526 | Ga0495666_0047504 | Ga0495666_0047504_1073_1402 | 106 |
| 626 | 3300046526 | Ga0495666_0277385 | Ga0495666_0277385_22_387 | 106 |
| 627 | 3300046529 | Ga0495652_0010557 | Ga0495652_0010557_5900_6280 | 106 |
| 628 | 3300046529 | Ga0495652_0013883 | Ga0495652_0013883_6448_6816 | 106 |
| 629 | 3300046529 | Ga0495652_0016567 | Ga0495652_0016567_3365_3730 | 106 |
| 630 | 3300046529 | Ga0495652_0023593 | Ga0495652_0023593_2591_2920 | 106 |
| 631 | 3300046529 | Ga0495652_0267071 | Ga0495652_0267071_462_782 | 106 |
| 632 | 3300046531 | Ga0495665_0002880 | Ga0495665_0002880_5741_6106 | 106 |
| 633 | 3300046531 | Ga0495665_0019986 | Ga0495665_0019986_1257_1586 | 106 |
| 634 | 3300046531 | Ga0495665_0118219 | Ga0495665_0118219_985_1314 | 106 |
| 635 | 3300046533 | Ga0495640_0030637 | Ga0495640_0030637_1767_2096 | 106 |
| 636 | 3300046533 | Ga0495640_0032652 | Ga0495640_0032652_2353_2733 | 106 |
| 637 | 3300046533 | Ga0495640_0049080 | Ga0495640_0049080_2403_2768 | 106 |
| 638 | 3300046533 | Ga0495640_0081516 | Ga0495640_0081516_741_1070 | 106 |
| 639 | 3300046533 | Ga0495640_0911177 | Ga0495640_0911177_43_363 | 106 |
| 640 | 3300046535 | Ga0495586_0046132 | Ga0495586_0046132_1804_2169 | 106 |
| 641 | 3300046535 | Ga0495586_0121485 | Ga0495586_0121485_99_428 | 106 |
| 642 | 3300046536 | Ga0495587_0000038 | Ga0495587_0000038_81702_82070 | 106 |
| 643 | 3300046536 | Ga0495587_0019029 | Ga0495587_0019029_1849_2229 | 106 |
| 644 | 3300046536 | Ga0495587_0040683 | Ga0495587_0040683_1549_1878 | 106 |
| 645 | 3300046536 | Ga0495587_0047578 | Ga0495587_0047578_1347_1712 | 106 |
| 646 | 3300046543 | Ga0495645_0025092 | Ga0495645_0025092_2555_2920 | 106 |
| 647 | 3300046543 | Ga0495645_0054078 | Ga0495645_0054078_835_1164 | 106 |
| 648 | 3300046543 | Ga0495645_0147073 | Ga0495645_0147073_835_1221 | 106 |
| 649 | 3300046543 | Ga0495645_0188261 | Ga0495645_0188261_1003_1368 | 106 |
| 650 | 3300046543 | Ga0495645_0210647 | Ga0495645_0210647_759_1139 | 106 |
| 651 | 3300046559 | Ga0495667_0000445 | Ga0495667_0000445_22064_22444 | 106 |
| 652 | 3300046559 | Ga0495667_0000985 | Ga0495667_0000985_9467_9835 | 106 |
| 653 | 3300046559 | Ga0495667_0002803 | Ga0495667_0002803_7398_7763 | 106 |
| 654 | 3300046559 | Ga0495667_0021959 | Ga0495667_0021959_2426_2755 | 106 |
| 655 | 3300046642 | Ga0495634_0014303 | Ga0495634_0014303_2633_2998 | 106 |
| 656 | 3300046642 | Ga0495634_0016396 | Ga0495634_0016396_3699_4028 | 106 |
| 657 | 3300046642 | Ga0495634_0071383 | Ga0495634_0071383_1397_1726 | 106 |
| 658 | 3300046642 | Ga0495634_0114595 | Ga0495634_0114595_681_1067 | 106 |
| 659 | 3300046663 | Ga0495635_0007096 | Ga0495635_0007096_5564_5944 | 106 |
| 660 | 3300046663 | Ga0495635_0023342 | Ga0495635_0023342_2728_3093 | 106 |
| 661 | 3300046663 | Ga0495635_0071799 | Ga0495635_0071799_1032_1361 | 106 |
| 662 | 3300046663 | Ga0495635_0122343 | Ga0495635_0122343_413_742 | 106 |
| 663 | 3300046674 | Ga0495588_0125340 | Ga0495588_0125340_513_842 | 106 |
| 664 | 3300046675 | Ga0495657_0002519 | Ga0495657_0002519_6434_6802 | 106 |
| 665 | 3300046675 | Ga0495657_0005213 | Ga0495657_0005213_7108_7488 | 106 |
| 666 | 3300046675 | Ga0495657_0014816 | Ga0495657_0014816_879_1244 | 106 |
| 667 | 3300046675 | Ga0495657_0018704 | Ga0495657_0018704_831_1196 | 106 |
| 668 | 3300046675 | Ga0495657_0044000 | Ga0495657_0044000_434_763 | 106 |
| 669 | 3300046678 | Ga0495599_0000100 | Ga0495599_0000100_6449_6817 | 106 |
| 670 | 3300046678 | Ga0495599_0005877 | Ga0495599_0005877_6176_6541 | 106 |
| 671 | 3300046678 | Ga0495599_0020499 | Ga0495599_0020499_510_875 | 106 |
| 672 | 3300046678 | Ga0495599_0058622 | Ga0495599_0058622_1646_1975 | 106 |
| 673 | 3300046678 | Ga0495599_0071792 | Ga0495599_0071792_362_742 | 106 |
| 674 | 3300046678 | Ga0495599_0489233 | Ga0495599_0489233_133_498 | 106 |
| 675 | 3300046679 | Ga0495623_0030013 | Ga0495623_0030013_1130_1510 | 106 |
| 676 | 3300046679 | Ga0495623_0036882 | Ga0495623_0036882_1068_1433 | 106 |
| 677 | 3300046679 | Ga0495623_0328836 | Ga0495623_0328836_292_678 | 106 |
| 678 | 3300046680 | Ga0495646_0023289 | Ga0495646_0023289_1881_2210 | 106 |
| 679 | 3300046680 | Ga0495646_0094885 | Ga0495646_0094885_1315_1701 | 106 |
| 680 | 3300046680 | Ga0495646_0126398 | Ga0495646_0126398_157_525 | 106 |
| 681 | 3300046681 | Ga0495647_0073081 | Ga0495647_0073081_385_714 | 106 |
| 682 | 3300046683 | Ga0495658_0037949 | Ga0495658_0037949_579_908 | 106 |
| 683 | 3300046683 | Ga0495658_0156765 | Ga0495658_0156765_485_850 | 106 |
| 684 | 3300046689 | Ga0495613_0004973 | Ga0495613_0004973_2315_2680 | 106 |
| 685 | 3300046689 | Ga0495613_0054488 | Ga0495613_0054488_1168_1497 | 106 |
| 686 | 3300046690 | Ga0495624_0006742 | Ga0495624_0006742_7408_7773 | 106 |
| 687 | 3300046690 | Ga0495624_0101714 | Ga0495624_0101714_775_1104 | 106 |
| 688 | 3300046690 | Ga0495624_0273946 | Ga0495624_0273946_154_540 | 106 |
| 689 | 3300046690 | Ga0495624_0374248 | Ga0495624_0374248_273_638 | 106 |
| 690 | 3300046809 | Ga0495600_0021742 | Ga0495600_0021742_3351_3680 | 106 |
| 691 | 3300046809 | Ga0495600_0033758 | Ga0495600_0033758_2332_2712 | 106 |
| 692 | 3300046809 | Ga0495600_0034389 | Ga0495600_0034389_1966_2331 | 106 |
| 693 | 3300046809 | Ga0495600_0241977 | Ga0495600_0241977_243_572 | 106 |
| 694 | 3300046809 | Ga0495600_0287517 | Ga0495600_0287517_454_819 | 106 |
| 695 | 3300047315 | Ga0495581_0007649 | Ga0495581_0007649_4237_4602 | 106 |
| 696 | 3300047315 | Ga0495581_0031164 | Ga0495581_0031164_2702_3022 | 106 |
| 697 | 3300047315 | Ga0495581_0083298 | Ga0495581_0083298_1391_1720 | 106 |
| 698 | 3300047317 | Ga0495604_0000061 | Ga0495604_0000061_87291_87659 | 106 |
| 699 | 3300047317 | Ga0495604_0020965 | Ga0495604_0020965_4282_4662 | 106 |
| 700 | 3300047317 | Ga0495604_0023815 | Ga0495604_0023815_2260_2589 | 106 |
| 701 | 3300047317 | Ga0495604_0090980 | Ga0495604_0090980_493_858 | 106 |
| 702 | 3300047317 | Ga0495604_0288404 | Ga0495604_0288404_328_693 | 106 |
| 703 | 3300047317 | Ga0495604_0323474 | Ga0495604_0323474_612_998 | 106 |
| 704 | 3300047319 | Ga0495674_0045071 | Ga0495674_0045071_402_782 | 106 |
| 705 | 3300047319 | Ga0495674_0063469 | Ga0495674_0063469_118_483 | 106 |
| 706 | 3300047319 | Ga0495674_0063741 | Ga0495674_0063741_2537_2923 | 106 |
| 707 | 3300047319 | Ga0495674_0096092 | Ga0495674_0096092_2188_2508 | 106 |
| 708 | 3300047319 | Ga0495674_0173934 | Ga0495674_0173934_413_742 | 106 |
| 709 | 3300047319 | Ga0495674_0262545 | Ga0495674_0262545_677_1006 | 106 |
| 710 | 3300047321 | Ga0495676_0141456 | Ga0495676_0141456_535_921 | 106 |
| 711 | 3300047321 | Ga0495676_0533015 | Ga0495676_0533015_32_361 | 106 |
| 712 | 3300047322 | Ga0495680_0003514 | Ga0495680_0003514_8558_8926 | 106 |
| 713 | 3300047322 | Ga0495680_0031237 | Ga0495680_0031237_1653_2033 | 106 |
| 714 | 3300047322 | Ga0495680_0065787 | Ga0495680_0065787_959_1324 | 106 |
| 715 | 3300047322 | Ga0495680_0086063 | Ga0495680_0086063_391_720 | 106 |
| 716 | 3300047322 | Ga0495680_0138006 | Ga0495680_0138006_246_611 | 106 |
| 717 | 3300047322 | Ga0495680_0328199 | Ga0495680_0328199_516_845 | 106 |
| 718 | 3300047444 | Ga0495675_0002156 | Ga0495675_0002156_8609_8974 | 106 |
| 719 | 3300047444 | Ga0495675_0003593 | Ga0495675_0003593_2536_2904 | 106 |
| 720 | 3300047444 | Ga0495675_0019155 | Ga0495675_0019155_1811_2191 | 106 |
| 721 | 3300047444 | Ga0495675_0123411 | Ga0495675_0123411_328_693 | 106 |
| 722 | 3300047471 | Ga0495684_0044908 | Ga0495684_0044908_1278_1658 | 106 |
| 723 | 3300047471 | Ga0495684_0058007 | Ga0495684_0058007_521_850 | 106 |
| 724 | 3300047471 | Ga0495684_0061787 | Ga0495684_0061787_1078_1443 | 106 |
| 725 | 3300047471 | Ga0495684_0453541 | Ga0495684_0453541_374_703 | 106 |
| 726 | 3300047673 | Ga0495593_0009590 | Ga0495593_0009590_860_1225 | 106 |
| 727 | 3300047673 | Ga0495593_0081220 | Ga0495593_0081220_316_645 | 106 |
| 728 | 3300047673 | Ga0495593_0091946 | Ga0495593_0091946_800_1129 | 106 |
| 729 | 3300048088 | Ga0495602_0004271 | Ga0495602_0004271_8617_8985 | 106 |
| 730 | 3300048088 | Ga0495602_0023507 | Ga0495602_0023507_5565_5945 | 106 |
| 731 | 3300048088 | Ga0495602_0036394 | Ga0495602_0036394_2251_2616 | 106 |
| 732 | 3300048088 | Ga0495602_0040512 | Ga0495602_0040512_794_1159 | 106 |
| 733 | 3300048089 | Ga0495614_0006961 | Ga0495614_0006961_1113_1478 | 106 |
| 734 | 3300048089 | Ga0495614_0231767 | Ga0495614_0231767_267_596 | 106 |
| 735 | 3300048903 | Ga0496100_0034483 | Ga0496100_0034483_1178_1546 | 106 |
| 736 | 3300048903 | Ga0496100_0151745 | Ga0496100_0151745_785_1171 | 106 |
| 737 | 3300048905 | Ga0496102_0031789 | Ga0496102_0031789_2947_3276 | 106 |
| 738 | 3300048905 | Ga0496102_0096410 | Ga0496102_0096410_1488_1874 | 106 |
| 739 | 3300048905 | Ga0496102_1618265 | Ga0496102_1618265_51_371 | 106 |
| 740 | 3300048906 | Ga0496103_0131820 | Ga0496103_0131820_661_1029 | 106 |
| 741 | 3300048907 | Ga0496104_0001325 | Ga0496104_0001325_7159_7545 | 106 |
| 742 | 3300048907 | Ga0496104_0085657 | Ga0496104_0085657_1880_2209 | 106 |
| 743 | 3300048908 | Ga0496105_0000744 | Ga0496105_0000744_13414_13800 | 106 |
| 744 | 3300048908 | Ga0496105_0025654 | Ga0496105_0025654_2667_2996 | 106 |
| 745 | 3300048909 | Ga0496106_0198905 | Ga0496106_0198905_518_847 | 106 |
| 746 | 3300048909 | Ga0496106_0293908 | Ga0496106_0293908_66_452 | 106 |
| 747 | 3300048910 | Ga0496107_0003098 | Ga0496107_0003098_3451_3780 | 106 |
| 748 | 3300048911 | Ga0496108_0002190 | Ga0496108_0002190_13553_13939 | 106 |
| 749 | 3300048911 | Ga0496108_0047492 | Ga0496108_0047492_2311_2679 | 106 |
| 750 | 3300048911 | Ga0496108_0796840 | Ga0496108_0796840_290_610 | 106 |
| 751 | 3300048912 | Ga0496109_0013057 | Ga0496109_0013057_6133_6519 | 106 |
| 752 | 3300048912 | Ga0496109_0083528 | Ga0496109_0083528_1662_1991 | 106 |
| 753 | 3300048914 | Ga0496111_0195292 | Ga0496111_0195292_564_893 | 106 |
| 754 | 3300048915 | Ga0496112_0001139 | Ga0496112_0001139_7370_7756 | 106 |
| 755 | 3300048915 | Ga0496112_0028330 | Ga0496112_0028330_1880_2209 | 106 |
| 756 | 3300048915 | Ga0496112_0584377 | Ga0496112_0584377_431_751 | 106 |
| 757 | 3300048916 | Ga0496113_0008126 | Ga0496113_0008126_4822_5208 | 106 |
| 758 | 3300048916 | Ga0496113_0031782 | Ga0496113_0031782_2843_3172 | 106 |
| 759 | 3300048916 | Ga0496113_0759848 | Ga0496113_0759848_13_333 | 106 |
| 760 | 3300048917 | Ga0496114_0010283 | Ga0496114_0010283_4223_4552 | 106 |
| 761 | 3300048917 | Ga0496114_0027524 | Ga0496114_0027524_4096_4482 | 106 |
| 762 | 3300048918 | Ga0496115_0004035 | Ga0496115_0004035_7909_8238 | 106 |
| 763 | 3300048918 | Ga0496115_0015962 | Ga0496115_0015962_1396_1782 | 106 |
| 764 | 3300048918 | Ga0496115_0101468 | Ga0496115_0101468_1959_2279 | 106 |
| 765 | 3300048929 | Ga0496126_0043842 | Ga0496126_0043842_315_635 | 106 |
| 766 | 3300048929 | Ga0496126_0111838 | Ga0496126_0111838_1744_2064 | 106 |
| 767 | 3300048929 | Ga0496126_0421231 | Ga0496126_0421231_363_683 | 106 |
| 768 | 3300050507 | nmdc:mga05p37_31729_c1 | nmdc:mga05p37_31729_c1_4650_5018 | 106 |
| 769 | 3300050511 | nmdc:mga08y16_238967_c1 | nmdc:mga08y16_238967_c1_906_1274 | 106 |
| 770 | 3300050512 | nmdc:mga0n895_1944188_c1 | nmdc:mga0n895_1944188_c1_196_516 | 106 |
| 771 | 3300050512 | nmdc:mga0n895_207347_c1 | nmdc:mga0n895_207347_c1_131_496 | 106 |
| 772 | 3300050512 | nmdc:mga0n895_463554_c1 | nmdc:mga0n895_463554_c1_352_681 | 106 |
| 773 | 3300050512 | nmdc:mga0n895_93657_c1 | nmdc:mga0n895_93657_c1_1577_1945 | 106 |
| 774 | 3300050513 | nmdc:mga0rr50_32817_c1 | nmdc:mga0rr50_32817_c1_2078_2443 | 106 |
| 775 | 3300050513 | nmdc:mga0rr50_6896_c1 | nmdc:mga0rr50_6896_c1_4624_4953 | 106 |
| 776 | 3300050513 | nmdc:mga0rr50_9558_c1 | nmdc:mga0rr50_9558_c1_4814_5182 | 106 |
| 777 | 3300050514 | nmdc:mga08x19_115058_c1 | nmdc:mga08x19_115058_c1_301_669 | 106 |
| 778 | 3300050514 | nmdc:mga08x19_16321_c1 | nmdc:mga08x19_16321_c1_3787_4116 | 106 |
| 779 | 3300050514 | nmdc:mga08x19_32682_c1 | nmdc:mga08x19_32682_c1_2773_3138 | 106 |
| 780 | 3300050515 | nmdc:mga0a205_3984_c1 | nmdc:mga0a205_3984_c1_421_786 | 106 |
| 781 | 3300053077 | Ga0495601_0037098 | Ga0495601_0037098_2082_2411 | 106 |
| 782 | 3300053077 | Ga0495601_0038877 | Ga0495601_0038877_1407_1772 | 106 |
| 783 | 3300053077 | Ga0495601_0104587 | Ga0495601_0104587_117_497 | 106 |
| 784 | 3300053077 | Ga0495601_0136955 | Ga0495601_0136955_1008_1394 | 106 |
| 785 | 3300053077 | Ga0495601_0212874 | Ga0495601_0212874_269_598 | 106 |
| 786 | 3300053077 | Ga0495601_0650365 | Ga0495601_0650365_227_592 | 106 |
| 787 | 3300053078 | Ga0495612_0029952 | Ga0495612_0029952_833_1162 | 106 |
| 788 | 3300053078 | Ga0495612_0033074 | Ga0495612_0033074_17_337 | 106 |
| 789 | 3300053084 | Ga0495595_0008946 | Ga0495595_0008946_2286_2615 | 106 |
| 790 | 3300053084 | Ga0495595_0012574 | Ga0495595_0012574_2475_2840 | 106 |
| 791 | 3300053085 | Ga0495619_0007700 | Ga0495619_0007700_2315_2680 | 106 |
| 792 | 3300053085 | Ga0495619_0024282 | Ga0495619_0024282_3069_3449 | 106 |
| 793 | 3300053085 | Ga0495619_0074722 | Ga0495619_0074722_1646_1975 | 106 |
| 794 | 3300059477 | Ga0587084_083896 | Ga0587084_083896_277_600 | 106 |
| 795 | 3300059490 | Ga0587066_106195 | Ga0587066_106195_189_509 | 106 |
| 796 | 3300059491 | Ga0587070_028468 | Ga0587070_028468_283_603 | 106 |
| 797 | 3300059492 | Ga0587073_0157346 | Ga0587073_0157346_175_495 | 106 |
| 798 | 3300059507 | Ga0587086_089771 | Ga0587086_089771_103_423 | 106 |
| 799 | 3300059511 | Ga0587091_049644 | Ga0587091_049644_209_529 | 106 |
| 800 | 3300059512 | Ga0587092_072959 | Ga0587092_072959_109_429 | 106 |
| 801 | 3300059623 | Ga0587101_118345 | Ga0587101_118345_133_453 | 106 |
| 802 | 3300059624 | Ga0587109_119655 | Ga0587109_119655_291_611 | 106 |
| 803 | 3300059640 | Ga0587067_016763 | Ga0587067_016763_245_565 | 106 |
| 804 | 3300059641 | Ga0587068_100235 | Ga0587068_100235_107_427 | 106 |
| 805 | 3300060346 | Ga0587111_0081692 | Ga0587111_0081692_218_538 | 106 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gsk-assembly2.cif.gz_C5 | structure of t. thermophilus 70s ribosome complex with mrna, trnafmet and near-cognate trnathr in the a-site | 0.9444 | 1 | 75 |
| 5xym-assembly1.cif.gz_U | large subunit of mycobacterium smegmatis | 0.9384 | 1 | 106 |
| 8cam-assembly1.cif.gz_t | evernimicin bound to the 50s subunit | 0.9314 | 1 | 106 |
| 5xym-assembly1.cif.gz_U | large subunit of mycobacterium smegmatis | 0.9279 | 1 | 106 |
| 5o61-assembly1.cif.gz_V | the complete structure of the mycobacterium smegmatis 70s ribosome | 0.9231 | 1 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSP8_36_136_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9357 | 1 | 104 | 2.30.30.30 |
| af_Q55DJ4_14_116_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9014 | 1 | 104 | 2.30.30.30 |
| af_Q96A35_47_153_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8925 | 3 | 104 | 2.30.30.30 |
| 1nppD03 | Mainly Beta;Roll;SH3 type barrels.; | 0.8917 | 4 | 35 | 2.30.30.30 |
| af_Q69T55_240_282_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8895 | 3 | 36 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H0RJH9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.939 | 1 | 76 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0G0KQN0-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9377 | 1 | 76 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F7BQA3-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9368 | 1 | 106 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1A9QE29-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9268 | 1 | 106 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2H0RJH9-F1-model_v4 | Large ribosomal subunit protein uL24 | 0.9266 | 1 | 76 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar