F481580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 804 | 328 | 1608 | 74 |
Family's Representative Sequence
| Representative Sequence | 3300061734|Ga0530510_1389286|Ga0530510_1389286_266_511 |
| Length | 68 |
| Sequence | VLLVNPPGDDARARIQRLLVTGDNRLKQGVAPEKARESYEAVRPLVELRLADLERLAGGSPPPSPPDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 186 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 196 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 199 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 202 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 203 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 204 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 205 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 206 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 207 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 213 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 214 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 215 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 326 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 327 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.13 |
| Metatranscriptomes | 0.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.5 |
| Nodule | 0 |
| Rhizoplane | 9.58 |
| Rhizosphere | 89.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0530510_1389286 | 3300061734 | Unclassified | 539 |
| 2 | JGI25406J46586_10038609 | 3300003203 | Bacteria | 1710 |
| 3 | Ga0070658_10070898 | 3300005327 | Bacteria | 2854 |
| 4 | Ga0070658_10085138 | 3300005327 | Bacteria | 2599 |
| 5 | Ga0070683_100022300 | 3300005329 | Bacteria | 5657 |
| 6 | Ga0070683_100033626 | 3300005329 | Bacteria | 4676 |
| 7 | Ga0070683_100196247 | 3300005329 | Bacteria | 1917 |
| 8 | Ga0070683_100214552 | 3300005329 | Unclassified | 1829 |
| 9 | Ga0070683_100473622 | 3300005329 | Bacteria | 1196 |
| 10 | Ga0070683_100860116 | 3300005329 | Bacteria | 870 |
| 11 | Ga0070690_100973518 | 3300005330 | Unclassified | 667 |
| 12 | Ga0070670_100073978 | 3300005331 | Bacteria | 2926 |
| 13 | Ga0070670_100595417 | 3300005331 | Unclassified | 989 |
| 14 | Ga0070670_102111310 | 3300005331 | Bacteria | 519 |
| 15 | Ga0068869_100465105 | 3300005334 | Bacteria | 1051 |
| 16 | Ga0068869_100739178 | 3300005334 | Unclassified | 842 |
| 17 | Ga0070680_100074635 | 3300005336 | Bacteria | 2791 |
| 18 | Ga0070680_100075036 | 3300005336 | Bacteria | 2783 |
| 19 | Ga0070680_100869142 | 3300005336 | Bacteria | 778 |
| 20 | Ga0070682_100104543 | 3300005337 | Bacteria | 1875 |
| 21 | Ga0070682_100132681 | 3300005337 | Bacteria | 1688 |
| 22 | Ga0070682_100652933 | 3300005337 | Bacteria | 838 |
| 23 | Ga0070682_100707224 | 3300005337 | Bacteria | 809 |
| 24 | Ga0070682_101590426 | 3300005337 | Bacteria | 565 |
| 25 | Ga0070682_101639741 | 3300005337 | Bacteria | 557 |
| 26 | Ga0068868_100136303 | 3300005338 | Bacteria | 2012 |
| 27 | Ga0068868_100635729 | 3300005338 | Unclassified | 949 |
| 28 | Ga0068868_101083055 | 3300005338 | Bacteria | 737 |
| 29 | Ga0068868_101086107 | 3300005338 | Bacteria | 736 |
| 30 | Ga0068868_102220285 | 3300005338 | Bacteria | 523 |
| 31 | Ga0070660_100005964 | 3300005339 | Bacteria | 8421 |
| 32 | Ga0070660_100037919 | 3300005339 | Bacteria | 3655 |
| 33 | Ga0070660_100236663 | 3300005339 | Bacteria | 1486 |
| 34 | Ga0070660_100269032 | 3300005339 | Bacteria | 1393 |
| 35 | Ga0070660_100391618 | 3300005339 | Bacteria | 1148 |
| 36 | Ga0070660_100616736 | 3300005339 | Bacteria | 908 |
| 37 | Ga0070660_100816839 | 3300005339 | Bacteria | 784 |
| 38 | Ga0070660_101437292 | 3300005339 | Bacteria | 586 |
| 39 | Ga0070660_101653094 | 3300005339 | Unclassified | 545 |
| 40 | Ga0070689_100077889 | 3300005340 | Bacteria | 2599 |
| 41 | Ga0070691_10623401 | 3300005341 | Bacteria | 639 |
| 42 | Ga0070661_100028321 | 3300005344 | Bacteria | 4040 |
| 43 | Ga0070661_100062241 | 3300005344 | Bacteria | 2740 |
| 44 | Ga0070661_100075714 | 3300005344 | Bacteria | 2480 |
| 45 | Ga0070661_100384826 | 3300005344 | Bacteria | 1106 |
| 46 | Ga0070661_100594566 | 3300005344 | Bacteria | 894 |
| 47 | Ga0070661_100647582 | 3300005344 | Bacteria | 857 |
| 48 | Ga0070661_100968852 | 3300005344 | Unclassified | 704 |
| 49 | Ga0070692_10406338 | 3300005345 | Bacteria | 861 |
| 50 | Ga0070692_10576630 | 3300005345 | Bacteria | 741 |
| 51 | Ga0070692_10869358 | 3300005345 | Bacteria | 621 |
| 52 | Ga0070692_10928147 | 3300005345 | Unclassified | 604 |
| 53 | Ga0070669_100042810 | 3300005353 | Bacteria | 3296 |
| 54 | Ga0070669_101585602 | 3300005353 | Bacteria | 570 |
| 55 | Ga0070675_100060434 | 3300005354 | Bacteria | 3129 |
| 56 | Ga0070675_101176820 | 3300005354 | Bacteria | 706 |
| 57 | Ga0070671_100179784 | 3300005355 | Bacteria | 1790 |
| 58 | Ga0070671_101925713 | 3300005355 | Unclassified | 526 |
| 59 | Ga0070674_100019958 | 3300005356 | Bacteria | 4270 |
| 60 | Ga0070674_100088469 | 3300005356 | Bacteria | 2229 |
| 61 | Ga0070674_100123355 | 3300005356 | Bacteria | 1921 |
| 62 | Ga0070674_100384518 | 3300005356 | Unclassified | 1142 |
| 63 | Ga0070674_100964793 | 3300005356 | Bacteria | 746 |
| 64 | Ga0070674_101030379 | 3300005356 | Bacteria | 724 |
| 65 | Ga0070673_100066342 | 3300005364 | Bacteria | 2882 |
| 66 | Ga0070673_100619959 | 3300005364 | Unclassified | 988 |
| 67 | Ga0070688_100010786 | 3300005365 | Bacteria | 5050 |
| 68 | Ga0070688_100128286 | 3300005365 | Bacteria | 1707 |
| 69 | Ga0070659_100004790 | 3300005366 | Bacteria | 9673 |
| 70 | Ga0070659_100107485 | 3300005366 | Bacteria | 2250 |
| 71 | Ga0070659_100190058 | 3300005366 | Bacteria | 1687 |
| 72 | Ga0070659_100243159 | 3300005366 | Bacteria | 1490 |
| 73 | Ga0070659_100294174 | 3300005366 | Bacteria | 1353 |
| 74 | Ga0070709_11084390 | 3300005434 | Bacteria | 640 |
| 75 | Ga0070714_100063831 | 3300005435 | Bacteria | 3168 |
| 76 | Ga0070714_100104492 | 3300005435 | Unclassified | 2499 |
| 77 | Ga0070714_100395699 | 3300005435 | Bacteria | 1305 |
| 78 | Ga0070713_100358939 | 3300005436 | Bacteria | 1353 |
| 79 | Ga0070713_100908579 | 3300005436 | Unclassified | 847 |
| 80 | Ga0070710_10093813 | 3300005437 | Bacteria | 1775 |
| 81 | Ga0070701_10675589 | 3300005438 | Bacteria | 692 |
| 82 | Ga0070711_100007272 | 3300005439 | Bacteria | 6729 |
| 83 | Ga0070711_100129140 | 3300005439 | Bacteria | 1880 |
| 84 | Ga0070705_100942792 | 3300005440 | Unclassified | 697 |
| 85 | Ga0070700_100008195 | 3300005441 | Bacteria | 5686 |
| 86 | Ga0070700_100115443 | 3300005441 | Bacteria | 1791 |
| 87 | Ga0070700_100173889 | 3300005441 | Bacteria | 1493 |
| 88 | Ga0070700_100205343 | 3300005441 | Bacteria | 1387 |
| 89 | Ga0070700_100584489 | 3300005441 | Bacteria | 872 |
| 90 | Ga0070700_100781373 | 3300005441 | Unclassified | 767 |
| 91 | Ga0070694_100065825 | 3300005444 | Bacteria | 2484 |
| 92 | Ga0070694_101859176 | 3300005444 | Bacteria | 514 |
| 93 | Ga0070663_100718251 | 3300005455 | Bacteria | 851 |
| 94 | Ga0070663_101442372 | 3300005455 | Bacteria | 611 |
| 95 | Ga0070678_100273024 | 3300005456 | Bacteria | 1427 |
| 96 | Ga0070678_100347060 | 3300005456 | Bacteria | 1275 |
| 97 | Ga0070678_101026281 | 3300005456 | Bacteria | 759 |
| 98 | Ga0070662_100042467 | 3300005457 | Bacteria | 3247 |
| 99 | Ga0070662_100724822 | 3300005457 | Unclassified | 842 |
| 100 | Ga0070681_10050932 | 3300005458 | Bacteria | 4130 |
| 101 | Ga0070681_10081936 | 3300005458 | Bacteria | 3182 |
| 102 | Ga0070681_10085320 | 3300005458 | Bacteria | 3110 |
| 103 | Ga0070681_10159971 | 3300005458 | Bacteria | 2176 |
| 104 | Ga0070681_10261518 | 3300005458 | Bacteria | 1642 |
| 105 | Ga0070681_10573238 | 3300005458 | Bacteria | 1042 |
| 106 | Ga0070681_10742950 | 3300005458 | Bacteria | 898 |
| 107 | Ga0070681_11604551 | 3300005458 | Unclassified | 576 |
| 108 | Ga0068867_100168662 | 3300005459 | Unclassified | 1732 |
| 109 | Ga0068867_100373002 | 3300005459 | Bacteria | 1197 |
| 110 | Ga0068867_100692197 | 3300005459 | Bacteria | 899 |
| 111 | Ga0068867_101317145 | 3300005459 | Unclassified | 667 |
| 112 | Ga0070685_10001824 | 3300005466 | Bacteria | 11086 |
| 113 | Ga0070706_101083380 | 3300005467 | Bacteria | 738 |
| 114 | Ga0070698_100203948 | 3300005471 | Bacteria | 1913 |
| 115 | Ga0070679_100053213 | 3300005530 | Bacteria | 4030 |
| 116 | Ga0070679_100113753 | 3300005530 | Bacteria | 2691 |
| 117 | Ga0070679_100167250 | 3300005530 | Bacteria | 2172 |
| 118 | Ga0070679_100212918 | 3300005530 | Bacteria | 1896 |
| 119 | Ga0070679_100216205 | 3300005530 | Bacteria | 1879 |
| 120 | Ga0070679_100616269 | 3300005530 | Bacteria | 1028 |
| 121 | Ga0070679_100957288 | 3300005530 | Bacteria | 800 |
| 122 | Ga0070684_100052752 | 3300005535 | Bacteria | 3537 |
| 123 | Ga0070684_100077408 | 3300005535 | Bacteria | 2937 |
| 124 | Ga0070684_100086146 | 3300005535 | Bacteria | 2787 |
| 125 | Ga0070684_100094207 | 3300005535 | Bacteria | 2667 |
| 126 | Ga0070684_100121060 | 3300005535 | Bacteria | 2354 |
| 127 | Ga0070684_100140602 | 3300005535 | Bacteria | 2183 |
| 128 | Ga0070684_100151055 | 3300005535 | Bacteria | 2104 |
| 129 | Ga0070684_100413993 | 3300005535 | Bacteria | 1244 |
| 130 | Ga0070684_100653543 | 3300005535 | Bacteria | 979 |
| 131 | Ga0070684_101200090 | 3300005535 | Bacteria | 714 |
| 132 | Ga0068853_100093313 | 3300005539 | Bacteria | 2650 |
| 133 | Ga0068853_100333777 | 3300005539 | Bacteria | 1407 |
| 134 | Ga0068853_100417520 | 3300005539 | Bacteria | 1258 |
| 135 | Ga0068853_100716782 | 3300005539 | Bacteria | 955 |
| 136 | Ga0070672_100051256 | 3300005543 | Bacteria | 3217 |
| 137 | Ga0070672_101275188 | 3300005543 | Bacteria | 656 |
| 138 | Ga0070686_100096511 | 3300005544 | Bacteria | 1988 |
| 139 | Ga0070686_100286447 | 3300005544 | Bacteria | 1217 |
| 140 | Ga0070686_100454365 | 3300005544 | Bacteria | 985 |
| 141 | Ga0070686_100781546 | 3300005544 | Bacteria | 768 |
| 142 | Ga0070695_100406724 | 3300005545 | Bacteria | 1033 |
| 143 | Ga0070695_100867520 | 3300005545 | Bacteria | 727 |
| 144 | Ga0070696_100890161 | 3300005546 | Unclassified | 738 |
| 145 | Ga0070693_100392196 | 3300005547 | Unclassified | 960 |
| 146 | Ga0070693_100815329 | 3300005547 | Bacteria | 693 |
| 147 | Ga0070665_100584496 | 3300005548 | Unclassified | 1130 |
| 148 | Ga0070704_100539681 | 3300005549 | Bacteria | 1018 |
| 149 | Ga0070704_100710533 | 3300005549 | Bacteria | 892 |
| 150 | Ga0070704_101463507 | 3300005549 | Bacteria | 628 |
| 151 | Ga0068855_100047783 | 3300005563 | Bacteria | 5054 |
| 152 | Ga0068855_100134067 | 3300005563 | Bacteria | 2826 |
| 153 | Ga0068855_100273503 | 3300005563 | Bacteria | 1878 |
| 154 | Ga0068855_100298523 | 3300005563 | Bacteria | 1784 |
| 155 | Ga0068855_100305430 | 3300005563 | Bacteria | 1761 |
| 156 | Ga0068855_101484718 | 3300005563 | Bacteria | 696 |
| 157 | Ga0070664_100264773 | 3300005564 | Unclassified | 1547 |
| 158 | Ga0070664_101753244 | 3300005564 | Bacteria | 589 |
| 159 | Ga0068857_100041175 | 3300005577 | Bacteria | 4096 |
| 160 | Ga0068857_100168748 | 3300005577 | Bacteria | 1988 |
| 161 | Ga0068857_100268831 | 3300005577 | Bacteria | 1566 |
| 162 | Ga0068857_101240442 | 3300005577 | Bacteria | 722 |
| 163 | Ga0068854_100719165 | 3300005578 | Bacteria | 863 |
| 164 | Ga0068854_101589583 | 3300005578 | Bacteria | 595 |
| 165 | Ga0068856_100076108 | 3300005614 | Bacteria | 3325 |
| 166 | Ga0068856_100581263 | 3300005614 | Bacteria | 1141 |
| 167 | Ga0070702_100061131 | 3300005615 | Bacteria | 2192 |
| 168 | Ga0070702_100570202 | 3300005615 | Bacteria | 843 |
| 169 | Ga0068852_100511013 | 3300005616 | Bacteria | 1198 |
| 170 | Ga0068864_100031233 | 3300005618 | Bacteria | 4518 |
| 171 | Ga0068861_100674626 | 3300005719 | Bacteria | 957 |
| 172 | Ga0068851_10296375 | 3300005834 | Bacteria | 929 |
| 173 | Ga0068870_10507897 | 3300005840 | Bacteria | 804 |
| 174 | Ga0068863_100166037 | 3300005841 | Bacteria | 2117 |
| 175 | Ga0068860_101426292 | 3300005843 | Bacteria | 714 |
| 176 | Ga0068862_100355635 | 3300005844 | Bacteria | 1360 |
| 177 | Ga0081455_10032806 | 3300005937 | Bacteria | 4675 |
| 178 | Ga0081455_10084700 | 3300005937 | Bacteria | 2586 |
| 179 | Ga0081455_10210192 | 3300005937 | Bacteria | 1450 |
| 180 | Ga0081455_10686943 | 3300005937 | Unclassified | 654 |
| 181 | Ga0070717_10536906 | 3300006028 | Bacteria | 1059 |
| 182 | Ga0070717_12029165 | 3300006028 | Bacteria | 518 |
| 183 | Ga0075365_10055162 | 3300006038 | Bacteria | 2637 |
| 184 | Ga0075365_10100188 | 3300006038 | Bacteria | 1983 |
| 185 | Ga0075365_10268127 | 3300006038 | Unclassified | 1201 |
| 186 | Ga0075432_10133618 | 3300006058 | Bacteria | 941 |
| 187 | Ga0070716_100652723 | 3300006173 | Bacteria | 798 |
| 188 | Ga0070712_100109253 | 3300006175 | Bacteria | 2061 |
| 189 | Ga0070712_100123760 | 3300006175 | Bacteria | 1950 |
| 190 | Ga0070712_101053823 | 3300006175 | Bacteria | 705 |
| 191 | Ga0070712_101521894 | 3300006175 | Bacteria | 585 |
| 192 | Ga0097621_100215680 | 3300006237 | Bacteria | 1670 |
| 193 | Ga0075428_100136065 | 3300006844 | Bacteria | 2671 |
| 194 | Ga0075428_101293291 | 3300006844 | Bacteria | 767 |
| 195 | Ga0075428_102591377 | 3300006844 | Bacteria | 518 |
| 196 | Ga0075430_101382370 | 3300006846 | Unclassified | 579 |
| 197 | Ga0075431_101202254 | 3300006847 | Bacteria | 721 |
| 198 | Ga0075433_10005010 | 3300006852 | Bacteria | 10376 |
| 199 | Ga0075433_10043675 | 3300006852 | Bacteria | 3892 |
| 200 | Ga0075433_10397229 | 3300006852 | Bacteria | 1216 |
| 201 | Ga0075433_10490523 | 3300006852 | Unclassified | 1082 |
| 202 | Ga0075434_100001065 | 3300006871 | Bacteria | 22406 |
| 203 | Ga0075434_100738100 | 3300006871 | Bacteria | 1002 |
| 204 | Ga0075429_100435993 | 3300006880 | Bacteria | 1148 |
| 205 | Ga0075429_100512852 | 3300006880 | Bacteria | 1051 |
| 206 | Ga0075429_101363831 | 3300006880 | Bacteria | 618 |
| 207 | Ga0068865_100065984 | 3300006881 | Bacteria | 2552 |
| 208 | Ga0068865_100103918 | 3300006881 | Bacteria | 2084 |
| 209 | Ga0068865_100291046 | 3300006881 | Bacteria | 1304 |
| 210 | Ga0068865_100329773 | 3300006881 | Bacteria | 1230 |
| 211 | Ga0068865_100448374 | 3300006881 | Bacteria | 1066 |
| 212 | Ga0075436_100127934 | 3300006914 | Bacteria | 1780 |
| 213 | Ga0075435_100023195 | 3300007076 | Bacteria | 4795 |
| 214 | Ga0075435_100155328 | 3300007076 | Bacteria | 1925 |
| 215 | Ga0105240_10316438 | 3300009093 | Bacteria | 1780 |
| 216 | Ga0111539_10057188 | 3300009094 | Bacteria | 4632 |
| 217 | Ga0111539_10215201 | 3300009094 | Bacteria | 2238 |
| 218 | Ga0111539_10802849 | 3300009094 | Bacteria | 1095 |
| 219 | Ga0111539_10991640 | 3300009094 | Bacteria | 977 |
| 220 | Ga0111539_12334375 | 3300009094 | Bacteria | 621 |
| 221 | Ga0105245_10035841 | 3300009098 | Bacteria | 4405 |
| 222 | Ga0105245_10126164 | 3300009098 | Bacteria | 2396 |
| 223 | Ga0105245_10358041 | 3300009098 | Bacteria | 1448 |
| 224 | Ga0105245_10672384 | 3300009098 | Bacteria | 1067 |
| 225 | Ga0105245_10688752 | 3300009098 | Bacteria | 1054 |
| 226 | Ga0105245_11262744 | 3300009098 | Bacteria | 787 |
| 227 | Ga0114129_10125205 | 3300009147 | Bacteria | 3534 |
| 228 | Ga0114129_10624707 | 3300009147 | Bacteria | 1393 |
| 229 | Ga0114129_11488675 | 3300009147 | Bacteria | 832 |
| 230 | Ga0114129_11941027 | 3300009147 | Unclassified | 713 |
| 231 | Ga0114129_12357330 | 3300009147 | Bacteria | 638 |
| 232 | Ga0105243_10051308 | 3300009148 | Bacteria | 3262 |
| 233 | Ga0105243_10652290 | 3300009148 | Bacteria | 1020 |
| 234 | Ga0105243_10992156 | 3300009148 | Bacteria | 842 |
| 235 | Ga0105243_11016294 | 3300009148 | Bacteria | 833 |
| 236 | Ga0105243_11709145 | 3300009148 | Bacteria | 658 |
| 237 | Ga0105241_11153615 | 3300009174 | Bacteria | 732 |
| 238 | Ga0105241_11363332 | 3300009174 | Bacteria | 678 |
| 239 | Ga0105241_11390379 | 3300009174 | Bacteria | 672 |
| 240 | Ga0105241_11690072 | 3300009174 | Unclassified | 615 |
| 241 | Ga0105242_10228249 | 3300009176 | Bacteria | 1667 |
| 242 | Ga0105242_10308915 | 3300009176 | Bacteria | 1446 |
| 243 | Ga0105242_10610071 | 3300009176 | Bacteria | 1055 |
| 244 | Ga0105242_10723630 | 3300009176 | Bacteria | 976 |
| 245 | Ga0105242_10872172 | 3300009176 | Bacteria | 897 |
| 246 | Ga0105242_11053390 | 3300009176 | Bacteria | 824 |
| 247 | Ga0105242_11331890 | 3300009176 | Bacteria | 743 |
| 248 | Ga0105242_11549417 | 3300009176 | Bacteria | 695 |
| 249 | Ga0105248_10298867 | 3300009177 | Bacteria | 1813 |
| 250 | Ga0105248_10508092 | 3300009177 | Bacteria | 1359 |
| 251 | Ga0105248_11405324 | 3300009177 | Bacteria | 790 |
| 252 | Ga0105248_12681710 | 3300009177 | Bacteria | 568 |
| 253 | Ga0105248_13280456 | 3300009177 | Bacteria | 515 |
| 254 | Ga0105237_12513026 | 3300009545 | Bacteria | 525 |
| 255 | Ga0105238_10013829 | 3300009551 | Bacteria | 8158 |
| 256 | Ga0105249_10339996 | 3300009553 | Bacteria | 1517 |
| 257 | Ga0105249_10855296 | 3300009553 | Bacteria | 975 |
| 258 | Ga0105249_13194119 | 3300009553 | Bacteria | 527 |
| 259 | Ga0105239_10072533 | 3300010375 | Bacteria | 3785 |
| 260 | Ga0105239_10563482 | 3300010375 | Bacteria | 1298 |
| 261 | Ga0105239_10953381 | 3300010375 | Bacteria | 986 |
| 262 | Ga0105239_13030178 | 3300010375 | Bacteria | 547 |
| 263 | Ga0105239_13294269 | 3300010375 | Bacteria | 526 |
| 264 | Ga0105246_10494201 | 3300011119 | Bacteria | 1038 |
| 265 | Ga0105246_11030419 | 3300011119 | Unclassified | 747 |
| 266 | Ga0105246_11114198 | 3300011119 | Bacteria | 722 |
| 267 | Ga0105246_12407322 | 3300011119 | Bacteria | 516 |
| 268 | Ga0157317_1029794 | 3300012475 | Bacteria | 527 |
| 269 | Ga0157373_10127963 | 3300013100 | Unclassified | 1786 |
| 270 | Ga0157371_10726034 | 3300013102 | Bacteria | 745 |
| 271 | Ga0157370_10233973 | 3300013104 | Bacteria | 1700 |
| 272 | Ga0157370_11714525 | 3300013104 | Bacteria | 564 |
| 273 | Ga0157369_10107096 | 3300013105 | Bacteria | 2974 |
| 274 | Ga0157369_10472349 | 3300013105 | Bacteria | 1298 |
| 275 | Ga0157369_10547687 | 3300013105 | Bacteria | 1196 |
| 276 | Ga0157374_10020787 | 3300013296 | Bacteria | 5828 |
| 277 | Ga0157374_10237229 | 3300013296 | Bacteria | 1793 |
| 278 | Ga0157374_10747000 | 3300013296 | Bacteria | 993 |
| 279 | Ga0157378_10532829 | 3300013297 | Bacteria | 1177 |
| 280 | Ga0157378_10641998 | 3300013297 | Bacteria | 1076 |
| 281 | Ga0157378_13310620 | 3300013297 | Bacteria | 500 |
| 282 | Ga0163162_10595720 | 3300013306 | Bacteria | 1232 |
| 283 | Ga0163162_11987259 | 3300013306 | Bacteria | 666 |
| 284 | Ga0163162_12889255 | 3300013306 | Bacteria | 553 |
| 285 | Ga0157372_10208878 | 3300013307 | Bacteria | 2262 |
| 286 | Ga0157372_10369616 | 3300013307 | Bacteria | 1671 |
| 287 | Ga0157372_10520295 | 3300013307 | Bacteria | 1387 |
| 288 | Ga0157372_11615214 | 3300013307 | Bacteria | 746 |
| 289 | Ga0157372_11963494 | 3300013307 | Bacteria | 673 |
| 290 | Ga0157372_12557212 | 3300013307 | Bacteria | 586 |
| 291 | Ga0157375_11036870 | 3300013308 | Bacteria | 958 |
| 292 | Ga0157375_11714812 | 3300013308 | Bacteria | 744 |
| 293 | Ga0163163_10295744 | 3300014325 | Bacteria | 1671 |
| 294 | Ga0163163_10592253 | 3300014325 | Unclassified | 1172 |
| 295 | Ga0163163_11673729 | 3300014325 | Bacteria | 697 |
| 296 | Ga0157380_10012612 | 3300014326 | Bacteria | 6132 |
| 297 | Ga0157380_10062172 | 3300014326 | Bacteria | 2990 |
| 298 | Ga0157380_10339412 | 3300014326 | Bacteria | 1401 |
| 299 | Ga0157380_11549313 | 3300014326 | Bacteria | 717 |
| 300 | Ga0157380_12313283 | 3300014326 | Bacteria | 602 |
| 301 | Ga0157380_12457336 | 3300014326 | Unclassified | 587 |
| 302 | Ga0182008_10332692 | 3300014497 | Bacteria | 802 |
| 303 | Ga0182008_10435918 | 3300014497 | Bacteria | 710 |
| 304 | Ga0157377_10001619 | 3300014745 | Bacteria | 9818 |
| 305 | Ga0157377_10105818 | 3300014745 | Bacteria | 1684 |
| 306 | Ga0157377_10290588 | 3300014745 | Bacteria | 1075 |
| 307 | Ga0157377_11129389 | 3300014745 | Unclassified | 602 |
| 308 | Ga0157376_10009320 | 3300014969 | Bacteria | 7132 |
| 309 | Ga0157376_10286486 | 3300014969 | Bacteria | 1554 |
| 310 | Ga0157376_12065727 | 3300014969 | Bacteria | 608 |
| 311 | Ga0163161_11255799 | 3300017792 | Bacteria | 642 |
| 312 | Ga0197907_10141167 | 3300020069 | Bacteria | 1472 |
| 313 | Ga0206354_10283838 | 3300020081 | Bacteria | 1461 |
| 314 | Ga0206354_10594452 | 3300020081 | Bacteria | 1364 |
| 315 | Ga0206354_10639976 | 3300020081 | Bacteria | 1219 |
| 316 | Ga0206353_10073309 | 3300020082 | Unclassified | 1894 |
| 317 | Ga0206353_10500058 | 3300020082 | Bacteria | 734 |
| 318 | Ga0206353_11124550 | 3300020082 | Bacteria | 634 |
| 319 | Ga0207656_10423960 | 3300025321 | Bacteria | 670 |
| 320 | Ga0207692_10072332 | 3300025898 | Bacteria | 1821 |
| 321 | Ga0207688_10070534 | 3300025901 | Bacteria | 1982 |
| 322 | Ga0207688_10542456 | 3300025901 | Bacteria | 730 |
| 323 | Ga0207699_10641633 | 3300025906 | Bacteria | 775 |
| 324 | Ga0207645_10033932 | 3300025907 | Bacteria | 3279 |
| 325 | Ga0207645_10263217 | 3300025907 | Bacteria | 1143 |
| 326 | Ga0207643_10008879 | 3300025908 | Bacteria | 5396 |
| 327 | Ga0207705_10320974 | 3300025909 | Bacteria | 1190 |
| 328 | Ga0207654_11016690 | 3300025911 | Bacteria | 603 |
| 329 | Ga0207707_10004189 | 3300025912 | Bacteria | 12772 |
| 330 | Ga0207707_10010409 | 3300025912 | Bacteria | 8071 |
| 331 | Ga0207707_10065193 | 3300025912 | Bacteria | 3172 |
| 332 | Ga0207707_10122454 | 3300025912 | Bacteria | 2274 |
| 333 | Ga0207707_10440653 | 3300025912 | Bacteria | 1115 |
| 334 | Ga0207707_11252030 | 3300025912 | Bacteria | 598 |
| 335 | Ga0207695_11231085 | 3300025913 | Bacteria | 629 |
| 336 | Ga0207671_10124899 | 3300025914 | Bacteria | 1970 |
| 337 | Ga0207671_11424699 | 3300025914 | Bacteria | 537 |
| 338 | Ga0207693_10177483 | 3300025915 | Bacteria | 1676 |
| 339 | Ga0207693_10263573 | 3300025915 | Bacteria | 1351 |
| 340 | Ga0207663_10140095 | 3300025916 | Bacteria | 1684 |
| 341 | Ga0207660_10020669 | 3300025917 | Bacteria | 4422 |
| 342 | Ga0207660_10288500 | 3300025917 | Unclassified | 1304 |
| 343 | Ga0207660_10477680 | 3300025917 | Bacteria | 1010 |
| 344 | Ga0207660_10515997 | 3300025917 | Bacteria | 970 |
| 345 | Ga0207657_10016530 | 3300025919 | Bacteria | 7114 |
| 346 | Ga0207657_10100234 | 3300025919 | Bacteria | 2405 |
| 347 | Ga0207657_10175289 | 3300025919 | Bacteria | 1736 |
| 348 | Ga0207657_10904239 | 3300025919 | Bacteria | 680 |
| 349 | Ga0207657_10976329 | 3300025919 | Bacteria | 651 |
| 350 | Ga0207657_11128133 | 3300025919 | Unclassified | 598 |
| 351 | Ga0207649_10171804 | 3300025920 | Bacteria | 1510 |
| 352 | Ga0207649_10242439 | 3300025920 | Bacteria | 1294 |
| 353 | Ga0207649_10504041 | 3300025920 | Bacteria | 921 |
| 354 | Ga0207649_10987229 | 3300025920 | Bacteria | 662 |
| 355 | Ga0207652_10080559 | 3300025921 | Bacteria | 2846 |
| 356 | Ga0207652_10095929 | 3300025921 | Bacteria | 2613 |
| 357 | Ga0207652_10105736 | 3300025921 | Bacteria | 2490 |
| 358 | Ga0207652_10320382 | 3300025921 | Bacteria | 1400 |
| 359 | Ga0207652_11169949 | 3300025921 | Bacteria | 670 |
| 360 | Ga0207681_10236097 | 3300025923 | Bacteria | 1421 |
| 361 | Ga0207681_11299583 | 3300025923 | Bacteria | 611 |
| 362 | Ga0207694_10949967 | 3300025924 | Bacteria | 727 |
| 363 | Ga0207650_11071980 | 3300025925 | Unclassified | 686 |
| 364 | Ga0207659_10027279 | 3300025926 | Bacteria | 3864 |
| 365 | Ga0207659_10369075 | 3300025926 | Bacteria | 1194 |
| 366 | Ga0207687_10099997 | 3300025927 | Bacteria | 2132 |
| 367 | Ga0207687_10302480 | 3300025927 | Unclassified | 1289 |
| 368 | Ga0207687_10319909 | 3300025927 | Bacteria | 1256 |
| 369 | Ga0207687_10405342 | 3300025927 | Bacteria | 1122 |
| 370 | Ga0207687_10596562 | 3300025927 | Bacteria | 930 |
| 371 | Ga0207687_11226984 | 3300025927 | Bacteria | 644 |
| 372 | Ga0207700_10373836 | 3300025928 | Bacteria | 1245 |
| 373 | Ga0207700_10406126 | 3300025928 | Bacteria | 1194 |
| 374 | Ga0207700_10813960 | 3300025928 | Unclassified | 836 |
| 375 | Ga0207664_10087662 | 3300025929 | Bacteria | 2545 |
| 376 | Ga0207664_10194530 | 3300025929 | Bacteria | 1747 |
| 377 | Ga0207664_10282114 | 3300025929 | Bacteria | 1458 |
| 378 | Ga0207644_10064837 | 3300025931 | Bacteria | 2655 |
| 379 | Ga0207644_11219527 | 3300025931 | Bacteria | 632 |
| 380 | Ga0207690_10090121 | 3300025932 | Bacteria | 2164 |
| 381 | Ga0207690_10246130 | 3300025932 | Bacteria | 1379 |
| 382 | Ga0207706_10408571 | 3300025933 | Bacteria | 1177 |
| 383 | Ga0207706_11282435 | 3300025933 | Bacteria | 606 |
| 384 | Ga0207686_10055181 | 3300025934 | Bacteria | 2491 |
| 385 | Ga0207686_10112069 | 3300025934 | Bacteria | 1842 |
| 386 | Ga0207686_10115246 | 3300025934 | Bacteria | 1820 |
| 387 | Ga0207686_10525621 | 3300025934 | Bacteria | 921 |
| 388 | Ga0207686_10838947 | 3300025934 | Unclassified | 739 |
| 389 | Ga0207686_11499576 | 3300025934 | Unclassified | 556 |
| 390 | Ga0207709_10059114 | 3300025935 | Unclassified | 2385 |
| 391 | Ga0207709_10169346 | 3300025935 | Bacteria | 1531 |
| 392 | Ga0207709_10413869 | 3300025935 | Bacteria | 1034 |
| 393 | Ga0207709_10791989 | 3300025935 | Bacteria | 765 |
| 394 | Ga0207669_10005712 | 3300025937 | Bacteria | 5612 |
| 395 | Ga0207669_10039655 | 3300025937 | Bacteria | 2724 |
| 396 | Ga0207669_10499944 | 3300025937 | Bacteria | 972 |
| 397 | Ga0207669_10657338 | 3300025937 | Bacteria | 858 |
| 398 | Ga0207669_10997557 | 3300025937 | Bacteria | 703 |
| 399 | Ga0207669_11583616 | 3300025937 | Bacteria | 559 |
| 400 | Ga0207704_10056403 | 3300025938 | Bacteria | 2406 |
| 401 | Ga0207704_10072607 | 3300025938 | Unclassified | 2188 |
| 402 | Ga0207704_10196744 | 3300025938 | Bacteria | 1471 |
| 403 | Ga0207704_11377426 | 3300025938 | Bacteria | 604 |
| 404 | Ga0207665_10230103 | 3300025939 | Bacteria | 1362 |
| 405 | Ga0207691_10008423 | 3300025940 | Bacteria | 9905 |
| 406 | Ga0207691_10129912 | 3300025940 | Bacteria | 2226 |
| 407 | Ga0207691_10356729 | 3300025940 | Bacteria | 1250 |
| 408 | Ga0207691_10531864 | 3300025940 | Bacteria | 997 |
| 409 | Ga0207711_10153191 | 3300025941 | Bacteria | 2082 |
| 410 | Ga0207711_12016744 | 3300025941 | Bacteria | 520 |
| 411 | Ga0207689_10054461 | 3300025942 | Unclassified | 3294 |
| 412 | Ga0207661_10022510 | 3300025944 | Bacteria | 4749 |
| 413 | Ga0207661_10061508 | 3300025944 | Bacteria | 3034 |
| 414 | Ga0207661_10134639 | 3300025944 | Bacteria | 2121 |
| 415 | Ga0207661_10162260 | 3300025944 | Bacteria | 1940 |
| 416 | Ga0207661_10242603 | 3300025944 | Bacteria | 1599 |
| 417 | Ga0207661_10274221 | 3300025944 | Unclassified | 1506 |
| 418 | Ga0207661_10512367 | 3300025944 | Bacteria | 1097 |
| 419 | Ga0207661_10630526 | 3300025944 | Bacteria | 985 |
| 420 | Ga0207661_11114395 | 3300025944 | Bacteria | 727 |
| 421 | Ga0207661_11366418 | 3300025944 | Bacteria | 650 |
| 422 | Ga0207679_10100261 | 3300025945 | Bacteria | 2263 |
| 423 | Ga0207679_10437630 | 3300025945 | Bacteria | 1157 |
| 424 | Ga0207667_10110563 | 3300025949 | Bacteria | 2834 |
| 425 | Ga0207667_10609252 | 3300025949 | Unclassified | 1100 |
| 426 | Ga0207651_10389126 | 3300025960 | Bacteria | 1183 |
| 427 | Ga0207651_10825923 | 3300025960 | Bacteria | 823 |
| 428 | Ga0207668_10113975 | 3300025972 | Bacteria | 2034 |
| 429 | Ga0207668_10390679 | 3300025972 | Bacteria | 1174 |
| 430 | Ga0207640_10321155 | 3300025981 | Bacteria | 1233 |
| 431 | Ga0207677_10159410 | 3300026023 | Bacteria | 1751 |
| 432 | Ga0207639_10289525 | 3300026041 | Bacteria | 1444 |
| 433 | Ga0207639_10516280 | 3300026041 | Bacteria | 1093 |
| 434 | Ga0207639_10575552 | 3300026041 | Bacteria | 1036 |
| 435 | Ga0207678_10238648 | 3300026067 | Bacteria | 1557 |
| 436 | Ga0207678_10840586 | 3300026067 | Bacteria | 811 |
| 437 | Ga0207678_10972226 | 3300026067 | Bacteria | 751 |
| 438 | Ga0207678_11093246 | 3300026067 | Bacteria | 706 |
| 439 | Ga0207708_10012136 | 3300026075 | Bacteria | 6424 |
| 440 | Ga0207708_10138212 | 3300026075 | Bacteria | 1909 |
| 441 | Ga0207708_10765487 | 3300026075 | Unclassified | 829 |
| 442 | Ga0207702_10146248 | 3300026078 | Bacteria | 2145 |
| 443 | Ga0207702_10481079 | 3300026078 | Bacteria | 1208 |
| 444 | Ga0207648_10159110 | 3300026089 | Bacteria | 1995 |
| 445 | Ga0207648_10293618 | 3300026089 | Bacteria | 1456 |
| 446 | Ga0207648_10424449 | 3300026089 | Bacteria | 1208 |
| 447 | Ga0207648_11419656 | 3300026089 | Unclassified | 652 |
| 448 | Ga0207674_10008792 | 3300026116 | Bacteria | 11627 |
| 449 | Ga0207674_10038188 | 3300026116 | Bacteria | 4988 |
| 450 | Ga0207674_10071831 | 3300026116 | Bacteria | 3477 |
| 451 | Ga0207674_11323975 | 3300026116 | Bacteria | 690 |
| 452 | Ga0207675_100311458 | 3300026118 | Bacteria | 1535 |
| 453 | Ga0207683_10080971 | 3300026121 | Bacteria | 2881 |
| 454 | Ga0207683_10178665 | 3300026121 | Bacteria | 1924 |
| 455 | Ga0207683_10468414 | 3300026121 | Bacteria | 1162 |
| 456 | Ga0207683_10702459 | 3300026121 | Bacteria | 938 |
| 457 | Ga0207683_10965039 | 3300026121 | Bacteria | 791 |
| 458 | Ga0207698_11243257 | 3300026142 | Bacteria | 759 |
| 459 | Ga0207428_10103560 | 3300027907 | Bacteria | 2197 |
| 460 | Ga0268266_10099810 | 3300028379 | Bacteria | 2556 |
| 461 | Ga0268266_11107053 | 3300028379 | Bacteria | 766 |
| 462 | Ga0268265_11092158 | 3300028380 | Bacteria | 792 |
| 463 | Ga0265318_10105638 | 3300028577 | Bacteria | 1036 |
| 464 | Ga0265338_10511828 | 3300028800 | Bacteria | 844 |
| 465 | Ga0265338_10751577 | 3300028800 | Bacteria | 670 |
| 466 | Ga0265316_10350309 | 3300031344 | Bacteria | 1069 |
| 467 | Ga0307408_101725083 | 3300031548 | Unclassified | 597 |
| 468 | Ga0307413_10121614 | 3300031824 | Bacteria | 1770 |
| 469 | Ga0307413_10417305 | 3300031824 | Bacteria | 1056 |
| 470 | Ga0307410_11867303 | 3300031852 | Unclassified | 534 |
| 471 | Ga0307406_11960943 | 3300031901 | Bacteria | 523 |
| 472 | Ga0307414_11909354 | 3300032004 | Bacteria | 554 |
| 473 | Ga0307411_11916313 | 3300032005 | Unclassified | 552 |
| 474 | Ga0307415_100570212 | 3300032126 | Bacteria | 1002 |
| 475 | Ga0373944_0035657 | 3300035089 | Bacteria | 1517 |
| 476 | Ga0373923_0252164 | 3300035111 | Bacteria | 826 |
| 477 | Ga0373936_0294493 | 3300035113 | Bacteria | 731 |
| 478 | Ga0373945_0042537 | 3300035116 | Bacteria | 1647 |
| 479 | Ga0373954_0181339 | 3300035118 | Unclassified | 1033 |
| 480 | Ga0373943_0091204 | 3300035170 | Bacteria | 1578 |
| 481 | Ga0373955_0043789 | 3300035172 | Bacteria | 2409 |
| 482 | Ga0373924_0473202 | 3300035410 | Bacteria | 562 |
| 483 | Ga0373935_0767479 | 3300035692 | Bacteria | 711 |
| 484 | Ga0373927_0717307 | 3300035695 | Bacteria | 661 |
| 485 | Ga0373933_0326765 | 3300035724 | Bacteria | 995 |
| 486 | Ga0373947_0009634 | 3300035725 | Bacteria | 5545 |
| 487 | Ga0373937_2143340 | 3300036401 | Bacteria | 505 |
| 488 | Ga0373925_0070181 | 3300037068 | Bacteria | 2648 |
| 489 | Ga0395899_0084744 | 3300037312 | Bacteria | 2303 |
| 490 | Ga0395899_0103852 | 3300037312 | Bacteria | 2049 |
| 491 | Ga0395899_0166173 | 3300037312 | Bacteria | 1556 |
| 492 | Ga0395900_0048314 | 3300037418 | Bacteria | 4383 |
| 493 | Ga0395900_0149764 | 3300037418 | Bacteria | 2384 |
| 494 | Ga0395900_0206126 | 3300037418 | Bacteria | 1987 |
| 495 | Ga0395900_0422808 | 3300037418 | Bacteria | 1293 |
| 496 | Ga0395898_0003007 | 3300037466 | Bacteria | 19113 |
| 497 | Ga0395898_0028740 | 3300037466 | Bacteria | 5572 |
| 498 | Ga0395898_0210390 | 3300037466 | Bacteria | 1855 |
| 499 | Ga0395905_0019388 | 3300037471 | Bacteria | 6448 |
| 500 | Ga0395905_0093451 | 3300037471 | Bacteria | 2821 |
| 501 | Ga0395905_0152044 | 3300037471 | Bacteria | 2177 |
| 502 | Ga0395905_0616269 | 3300037471 | Bacteria | 987 |
| 503 | Ga0395905_0680617 | 3300037471 | Bacteria | 931 |
| 504 | Ga0395905_0814674 | 3300037471 | Bacteria | 837 |
| 505 | Ga0395901_0007137 | 3300038443 | Bacteria | 11279 |
| 506 | Ga0395901_0021400 | 3300038443 | Bacteria | 6625 |
| 507 | Ga0395901_0039769 | 3300038443 | Bacteria | 4867 |
| 508 | Ga0395901_0392998 | 3300038443 | Bacteria | 1426 |
| 509 | Ga0395901_0613682 | 3300038443 | Bacteria | 1095 |
| 510 | Ga0395901_0616173 | 3300038443 | Bacteria | 1093 |
| 511 | Ga0439466_0193021 | 3300041411 | Unclassified | 620 |
| 512 | Ga0451802_0647905 | 3300041460 | Bacteria | 811 |
| 513 | Ga0451807_1619306 | 3300041486 | Bacteria | 542 |
| 514 | Ga0451837_0325315 | 3300041494 | Bacteria | 600 |
| 515 | Ga0451849_0780287 | 3300041505 | Bacteria | 546 |
| 516 | Ga0451853_2274916 | 3300041512 | Bacteria | 1512 |
| 517 | Ga0450912_016684 | 3300042116 | Bacteria | 682 |
| 518 | Ga0450914_012499 | 3300042118 | Bacteria | 852 |
| 519 | Ga0450917_013989 | 3300042120 | Bacteria | 665 |
| 520 | Ga0450890_048050 | 3300042127 | Bacteria | 646 |
| 521 | Ga0450892_042581 | 3300042130 | Bacteria | 503 |
| 522 | Ga0450907_020184 | 3300042146 | Bacteria | 1118 |
| 523 | Ga0450918_051385 | 3300042531 | Bacteria | 751 |
| 524 | Ga0466972_0392019 | 3300044658 | Bacteria | 651 |
| 525 | Ga0466965_0139313 | 3300044683 | Bacteria | 1262 |
| 526 | Ga0466961_0032195 | 3300044693 | Bacteria | 3368 |
| 527 | Ga0466963_0004119 | 3300044694 | Bacteria | 8408 |
| 528 | Ga0466963_0029977 | 3300044694 | Bacteria | 3506 |
| 529 | Ga0466964_0215875 | 3300044706 | Bacteria | 929 |
| 530 | Ga0466964_0647095 | 3300044706 | Bacteria | 584 |
| 531 | Ga0466971_0001478 | 3300044719 | Bacteria | 9925 |
| 532 | Ga0466971_0134567 | 3300044719 | Bacteria | 1149 |
| 533 | Ga0466968_0242631 | 3300044735 | Bacteria | 854 |
| 534 | Ga0466970_0230831 | 3300044765 | Bacteria | 1034 |
| 535 | Ga0466957_0025960 | 3300044842 | Bacteria | 3473 |
| 536 | Ga0466957_0133177 | 3300044842 | Bacteria | 1595 |
| 537 | Ga0466959_0142817 | 3300045049 | Bacteria | 1691 |
| 538 | Ga0466959_0292410 | 3300045049 | Bacteria | 1117 |
| 539 | Ga0451576_0036505 | 3300045051 | Bacteria | 5209 |
| 540 | Ga0466958_0009005 | 3300045836 | Bacteria | 5543 |
| 541 | Ga0466958_0116965 | 3300045836 | Bacteria | 1667 |
| 542 | Ga0466967_0000221 | 3300045976 | Bacteria | 24435 |
| 543 | Ga0466967_0014571 | 3300045976 | Bacteria | 6130 |
| 544 | Ga0466967_0046998 | 3300045976 | Bacteria | 3761 |
| 545 | Ga0466967_0170081 | 3300045976 | Bacteria | 2050 |
| 546 | Ga0466967_0259621 | 3300045976 | Bacteria | 1662 |
| 547 | Ga0466967_1115973 | 3300045976 | Bacteria | 786 |
| 548 | Ga0466967_1503686 | 3300045976 | Bacteria | 671 |
| 549 | Ga0466967_1731597 | 3300045976 | Unclassified | 622 |
| 550 | Ga0495592_0294663 | 3300046454 | Unclassified | 1056 |
| 551 | Ga0495592_0306537 | 3300046454 | Unclassified | 1031 |
| 552 | Ga0495592_0624114 | 3300046454 | Unclassified | 655 |
| 553 | Ga0495629_0180488 | 3300046459 | Unclassified | 1463 |
| 554 | Ga0495651_0013329 | 3300046462 | Bacteria | 6359 |
| 555 | Ga0495651_0146848 | 3300046462 | Unclassified | 1704 |
| 556 | Ga0495653_0036071 | 3300046463 | Bacteria | 3898 |
| 557 | Ga0495582_0734468 | 3300046473 | Bacteria | 571 |
| 558 | Ga0495639_0042673 | 3300046475 | Unclassified | 2047 |
| 559 | Ga0495662_0166002 | 3300046476 | Unclassified | 1088 |
| 560 | Ga0495664_0191741 | 3300046477 | Unclassified | 1239 |
| 561 | Ga0495664_0421185 | 3300046477 | Bacteria | 801 |
| 562 | Ga0495584_0419018 | 3300046491 | Bacteria | 681 |
| 563 | Ga0495594_0440077 | 3300046499 | Bacteria | 741 |
| 564 | Ga0495596_0221655 | 3300046500 | Bacteria | 735 |
| 565 | Ga0495608_0015441 | 3300046511 | Bacteria | 5296 |
| 566 | Ga0495608_0026725 | 3300046511 | Bacteria | 3933 |
| 567 | Ga0495616_0293109 | 3300046513 | Bacteria | 689 |
| 568 | Ga0495618_0322086 | 3300046514 | Unclassified | 957 |
| 569 | Ga0495628_0069678 | 3300046516 | Bacteria | 2743 |
| 570 | Ga0495628_0353045 | 3300046516 | Bacteria | 1081 |
| 571 | Ga0495628_0403022 | 3300046516 | Unclassified | 999 |
| 572 | Ga0495630_0000487 | 3300046517 | Bacteria | 29460 |
| 573 | Ga0495630_0105785 | 3300046517 | Bacteria | 2131 |
| 574 | Ga0495630_0178435 | 3300046517 | Bacteria | 1619 |
| 575 | Ga0495630_0957320 | 3300046517 | Bacteria | 651 |
| 576 | Ga0495631_0076489 | 3300046518 | Bacteria | 1445 |
| 577 | Ga0495631_0157368 | 3300046518 | Unclassified | 975 |
| 578 | Ga0495644_0039481 | 3300046523 | Bacteria | 1780 |
| 579 | Ga0495644_0084757 | 3300046523 | Bacteria | 1195 |
| 580 | Ga0495666_0340323 | 3300046526 | Unclassified | 676 |
| 581 | Ga0495652_0369053 | 3300046529 | Unclassified | 1023 |
| 582 | Ga0495665_0506662 | 3300046531 | Unclassified | 608 |
| 583 | Ga0495640_0012100 | 3300046533 | Bacteria | 6609 |
| 584 | Ga0495640_0162756 | 3300046533 | Bacteria | 1429 |
| 585 | Ga0495587_0047453 | 3300046536 | Bacteria | 2546 |
| 586 | Ga0495587_0126840 | 3300046536 | Unclassified | 1460 |
| 587 | Ga0495598_0419500 | 3300046537 | Unclassified | 526 |
| 588 | Ga0495597_0302974 | 3300046542 | Bacteria | 620 |
| 589 | Ga0495645_0113258 | 3300046543 | Bacteria | 1918 |
| 590 | Ga0495645_0126931 | 3300046543 | Bacteria | 1792 |
| 591 | Ga0495645_0182379 | 3300046543 | Bacteria | 1437 |
| 592 | Ga0495667_0006264 | 3300046559 | Bacteria | 8067 |
| 593 | Ga0495667_0019324 | 3300046559 | Bacteria | 4597 |
| 594 | Ga0495667_0110615 | 3300046559 | Bacteria | 1775 |
| 595 | Ga0495634_0153776 | 3300046642 | Unclassified | 1453 |
| 596 | Ga0495634_0185634 | 3300046642 | Bacteria | 1300 |
| 597 | Ga0495635_0134521 | 3300046663 | Bacteria | 1685 |
| 598 | Ga0495635_0149462 | 3300046663 | Unclassified | 1590 |
| 599 | Ga0495659_0049897 | 3300046664 | Bacteria | 1521 |
| 600 | Ga0495657_0059732 | 3300046675 | Unclassified | 2528 |
| 601 | Ga0495657_0132592 | 3300046675 | Unclassified | 1559 |
| 602 | Ga0495599_0123827 | 3300046678 | Bacteria | 1607 |
| 603 | Ga0495599_0157208 | 3300046678 | Unclassified | 1406 |
| 604 | Ga0495623_0095691 | 3300046679 | Unclassified | 1815 |
| 605 | Ga0495623_0505146 | 3300046679 | Unclassified | 638 |
| 606 | Ga0495623_0541944 | 3300046679 | Bacteria | 610 |
| 607 | Ga0495658_0270283 | 3300046683 | Bacteria | 1071 |
| 608 | Ga0495658_0373192 | 3300046683 | Bacteria | 908 |
| 609 | Ga0495613_0043848 | 3300046689 | Bacteria | 3310 |
| 610 | Ga0495613_0617957 | 3300046689 | Unclassified | 720 |
| 611 | Ga0495624_0483630 | 3300046690 | Unclassified | 741 |
| 612 | Ga0495600_0058872 | 3300046809 | Bacteria | 2509 |
| 613 | Ga0495600_0130755 | 3300046809 | Unclassified | 1632 |
| 614 | Ga0495581_0403295 | 3300047315 | Unclassified | 797 |
| 615 | Ga0495604_0016554 | 3300047317 | Bacteria | 5895 |
| 616 | Ga0495604_0085024 | 3300047317 | Bacteria | 2361 |
| 617 | Ga0495604_0151383 | 3300047317 | Bacteria | 1648 |
| 618 | Ga0495604_0460936 | 3300047317 | Bacteria | 829 |
| 619 | Ga0495604_0614830 | 3300047317 | Bacteria | 696 |
| 620 | Ga0495636_0645641 | 3300047318 | Bacteria | 520 |
| 621 | Ga0495674_0008409 | 3300047319 | Bacteria | 9832 |
| 622 | Ga0495674_0422875 | 3300047319 | Bacteria | 1073 |
| 623 | Ga0495676_0214362 | 3300047321 | Bacteria | 1330 |
| 624 | Ga0495680_0002804 | 3300047322 | Bacteria | 17542 |
| 625 | Ga0495680_0091968 | 3300047322 | Bacteria | 2273 |
| 626 | Ga0495680_0149374 | 3300047322 | Unclassified | 1705 |
| 627 | Ga0495675_0435223 | 3300047444 | Bacteria | 760 |
| 628 | Ga0495684_0025474 | 3300047471 | Bacteria | 4546 |
| 629 | Ga0495593_0450631 | 3300047673 | Bacteria | 644 |
| 630 | Ga0495602_0066480 | 3300048088 | Bacteria | 3105 |
| 631 | Ga0495602_0089118 | 3300048088 | Bacteria | 2566 |
| 632 | Ga0495602_0148093 | 3300048088 | Unclassified | 1849 |
| 633 | Ga0495614_0299428 | 3300048089 | Bacteria | 743 |
| 634 | Ga0495615_0109517 | 3300048090 | Bacteria | 789 |
| 635 | Ga0496100_0010820 | 3300048903 | Bacteria | 5177 |
| 636 | Ga0496100_0015526 | 3300048903 | Bacteria | 4448 |
| 637 | Ga0496100_0023089 | 3300048903 | Bacteria | 3773 |
| 638 | Ga0496100_0153122 | 3300048903 | Bacteria | 1647 |
| 639 | Ga0496101_0002017 | 3300048904 | Bacteria | 12331 |
| 640 | Ga0496101_0056778 | 3300048904 | Bacteria | 2830 |
| 641 | Ga0496101_0478748 | 3300048904 | Bacteria | 983 |
| 642 | Ga0496101_0983269 | 3300048904 | Bacteria | 664 |
| 643 | Ga0496101_1169567 | 3300048904 | Unclassified | 603 |
| 644 | Ga0496102_0007890 | 3300048905 | Bacteria | 9096 |
| 645 | Ga0496102_0342985 | 3300048905 | Bacteria | 1407 |
| 646 | Ga0496102_0745115 | 3300048905 | Bacteria | 902 |
| 647 | Ga0496102_1612872 | 3300048905 | Unclassified | 567 |
| 648 | Ga0496102_1816674 | 3300048905 | Unclassified | 527 |
| 649 | Ga0496103_0037233 | 3300048906 | Bacteria | 2980 |
| 650 | Ga0496103_0048912 | 3300048906 | Bacteria | 2614 |
| 651 | Ga0496103_0085205 | 3300048906 | Bacteria | 1991 |
| 652 | Ga0496103_0337391 | 3300048906 | Bacteria | 969 |
| 653 | Ga0496103_1042496 | 3300048906 | Bacteria | 508 |
| 654 | Ga0496104_0005537 | 3300048907 | Bacteria | 11063 |
| 655 | Ga0496104_0063467 | 3300048907 | Bacteria | 3503 |
| 656 | Ga0496105_0000489 | 3300048908 | Bacteria | 26072 |
| 657 | Ga0496105_0161459 | 3300048908 | Bacteria | 1840 |
| 658 | Ga0496105_0266677 | 3300048908 | Bacteria | 1384 |
| 659 | Ga0496105_0558672 | 3300048908 | Bacteria | 892 |
| 660 | Ga0496105_0824435 | 3300048908 | Unclassified | 704 |
| 661 | Ga0496106_0005043 | 3300048909 | Bacteria | 9770 |
| 662 | Ga0496106_0062702 | 3300048909 | Bacteria | 2823 |
| 663 | Ga0496106_0090798 | 3300048909 | Bacteria | 2357 |
| 664 | Ga0496107_0002143 | 3300048910 | Bacteria | 12664 |
| 665 | Ga0496107_0003268 | 3300048910 | Bacteria | 10805 |
| 666 | Ga0496107_0003366 | 3300048910 | Bacteria | 10686 |
| 667 | Ga0496108_0050746 | 3300048911 | Unclassified | 3474 |
| 668 | Ga0496108_0169283 | 3300048911 | Bacteria | 1890 |
| 669 | Ga0496108_0352584 | 3300048911 | Bacteria | 1284 |
| 670 | Ga0496108_0669193 | 3300048911 | Unclassified | 902 |
| 671 | Ga0496108_1127932 | 3300048911 | Bacteria | 665 |
| 672 | Ga0496109_0023202 | 3300048912 | Bacteria | 5505 |
| 673 | Ga0496109_0159906 | 3300048912 | Bacteria | 2110 |
| 674 | Ga0496109_0228721 | 3300048912 | Bacteria | 1749 |
| 675 | Ga0496109_0229269 | 3300048912 | Bacteria | 1747 |
| 676 | Ga0496109_1166919 | 3300048912 | Bacteria | 707 |
| 677 | Ga0496109_1439960 | 3300048912 | Bacteria | 624 |
| 678 | Ga0496110_0003945 | 3300048913 | Bacteria | 11411 |
| 679 | Ga0496110_0054056 | 3300048913 | Bacteria | 3532 |
| 680 | Ga0496110_0075600 | 3300048913 | Bacteria | 2993 |
| 681 | Ga0496110_0081974 | 3300048913 | Bacteria | 2876 |
| 682 | Ga0496110_0221571 | 3300048913 | Unclassified | 1720 |
| 683 | Ga0496110_0304373 | 3300048913 | Unclassified | 1452 |
| 684 | Ga0496110_0714802 | 3300048913 | Bacteria | 904 |
| 685 | Ga0496111_0101515 | 3300048914 | Bacteria | 2113 |
| 686 | Ga0496111_0244850 | 3300048914 | Bacteria | 1331 |
| 687 | Ga0496111_0422302 | 3300048914 | Unclassified | 985 |
| 688 | Ga0496111_0983049 | 3300048914 | Unclassified | 605 |
| 689 | Ga0496112_0011597 | 3300048915 | Bacteria | 8059 |
| 690 | Ga0496112_0026519 | 3300048915 | Bacteria | 5576 |
| 691 | Ga0496112_0190754 | 3300048915 | Bacteria | 2011 |
| 692 | Ga0496112_0196655 | 3300048915 | Bacteria | 1977 |
| 693 | Ga0496112_0232034 | 3300048915 | Bacteria | 1800 |
| 694 | Ga0496112_0475684 | 3300048915 | Bacteria | 1186 |
| 695 | Ga0496112_1050921 | 3300048915 | Bacteria | 733 |
| 696 | Ga0496112_1848453 | 3300048915 | Bacteria | 516 |
| 697 | Ga0496113_0141520 | 3300048916 | Bacteria | 1893 |
| 698 | Ga0496113_0318781 | 3300048916 | Unclassified | 1246 |
| 699 | Ga0496113_1329639 | 3300048916 | Bacteria | 558 |
| 700 | Ga0496114_0011178 | 3300048917 | Bacteria | 7166 |
| 701 | Ga0496114_0027774 | 3300048917 | Bacteria | 4638 |
| 702 | Ga0496114_0824396 | 3300048917 | Bacteria | 807 |
| 703 | Ga0496114_0891273 | 3300048917 | Bacteria | 770 |
| 704 | Ga0496114_0995300 | 3300048917 | Bacteria | 721 |
| 705 | Ga0496114_1190757 | 3300048917 | Unclassified | 648 |
| 706 | Ga0496115_0006491 | 3300048918 | Bacteria | 8574 |
| 707 | Ga0496115_0045342 | 3300048918 | Bacteria | 3509 |
| 708 | Ga0496115_0680245 | 3300048918 | Bacteria | 811 |
| 709 | Ga0496115_1210365 | 3300048918 | Bacteria | 567 |
| 710 | Ga0501031_0068456 | 3300049568 | Bacteria | 2313 |
| 711 | Ga0501031_0944088 | 3300049568 | Unclassified | 552 |
| 712 | Ga0501034_0314169 | 3300049571 | Unclassified | 1501 |
| 713 | Ga0501036_0212904 | 3300049572 | Bacteria | 1624 |
| 714 | Ga0501036_0832064 | 3300049572 | Bacteria | 759 |
| 715 | Ga0501036_1404167 | 3300049572 | Unclassified | 566 |
| 716 | Ga0501037_0624345 | 3300049573 | Unclassified | 722 |
| 717 | Ga0501037_0811818 | 3300049573 | Bacteria | 617 |
| 718 | Ga0501039_1048721 | 3300049575 | Bacteria | 633 |
| 719 | Ga0501039_1296034 | 3300049575 | Bacteria | 562 |
| 720 | Ga0501040_0243880 | 3300049576 | Unclassified | 1281 |
| 721 | Ga0501040_1203139 | 3300049576 | Unclassified | 550 |
| 722 | Ga0501042_0104948 | 3300049578 | Bacteria | 2034 |
| 723 | Ga0501042_0446465 | 3300049578 | Bacteria | 938 |
| 724 | Ga0501042_1330404 | 3300049578 | Bacteria | 524 |
| 725 | Ga0501043_0828540 | 3300049579 | Bacteria | 668 |
| 726 | Ga0501043_0986475 | 3300049579 | Bacteria | 600 |
| 727 | Ga0501046_0729610 | 3300049580 | Bacteria | 697 |
| 728 | Ga0501046_0740647 | 3300049580 | Bacteria | 691 |
| 729 | Ga0501047_0020883 | 3300049581 | Bacteria | 6290 |
| 730 | Ga0501048_0561741 | 3300049582 | Bacteria | 819 |
| 731 | Ga0501067_0113651 | 3300049583 | Bacteria | 1506 |
| 732 | Ga0501067_0518884 | 3300049583 | Bacteria | 667 |
| 733 | Ga0501067_0780332 | 3300049583 | Bacteria | 538 |
| 734 | Ga0501070_0836704 | 3300049586 | Bacteria | 721 |
| 735 | Ga0501070_1242871 | 3300049586 | Bacteria | 570 |
| 736 | Ga0501071_0033604 | 3300049587 | Bacteria | 3644 |
| 737 | Ga0501071_0240154 | 3300049587 | Unclassified | 1366 |
| 738 | Ga0501071_0361056 | 3300049587 | Bacteria | 1106 |
| 739 | Ga0501071_0561044 | 3300049587 | Bacteria | 877 |
| 740 | Ga0501071_0714862 | 3300049587 | Bacteria | 771 |
| 741 | Ga0501071_0734001 | 3300049587 | Unclassified | 761 |
| 742 | Ga0501072_0215369 | 3300049588 | Bacteria | 1531 |
| 743 | Ga0501072_0992144 | 3300049588 | Bacteria | 655 |
| 744 | Ga0501074_0033400 | 3300049590 | Bacteria | 3728 |
| 745 | Ga0501075_0198844 | 3300049591 | Bacteria | 1529 |
| 746 | Ga0501075_0730595 | 3300049591 | Bacteria | 754 |
| 747 | Ga0501076_0947686 | 3300049592 | Bacteria | 709 |
| 748 | Ga0501076_1023203 | 3300049592 | Bacteria | 681 |
| 749 | Ga0501077_0216067 | 3300049593 | Bacteria | 1219 |
| 750 | Ga0501077_0555070 | 3300049593 | Unclassified | 737 |
| 751 | Ga0501077_0600865 | 3300049593 | Unclassified | 707 |
| 752 | Ga0501077_0908403 | 3300049593 | Unclassified | 566 |
| 753 | Ga0501079_0158581 | 3300049741 | Bacteria | 1764 |
| 754 | Ga0501079_0189221 | 3300049741 | Unclassified | 1606 |
| 755 | Ga0501080_0113166 | 3300049742 | Bacteria | 2516 |
| 756 | Ga0501080_0665769 | 3300049742 | Bacteria | 920 |
| 757 | Ga0501080_1201463 | 3300049742 | Bacteria | 652 |
| 758 | Ga0501081_0152958 | 3300049743 | Bacteria | 1658 |
| 759 | Ga0501081_0297258 | 3300049743 | Bacteria | 1184 |
| 760 | Ga0501081_1004968 | 3300049743 | Bacteria | 630 |
| 761 | Ga0501081_1021458 | 3300049743 | Bacteria | 625 |
| 762 | Ga0501083_0339413 | 3300049744 | Bacteria | 977 |
| 763 | Ga0501035_0261249 | 3300049822 | Bacteria | 1468 |
| 764 | Ga0501035_0845006 | 3300049822 | Bacteria | 729 |
| 765 | Ga0501044_1635371 | 3300049823 | Bacteria | 509 |
| 766 | Ga0501045_0369357 | 3300049824 | Bacteria | 1068 |
| 767 | Ga0501045_0419362 | 3300049824 | Bacteria | 996 |
| 768 | nmdc:mga0yw44_193835_c1 | 3300050492 | Bacteria | 1341 |
| 769 | nmdc:mga05p37_694803_c1 | 3300050507 | Bacteria | 1131 |
| 770 | nmdc:mga05p37_770478_c1 | 3300050507 | Bacteria | 1057 |
| 771 | nmdc:mga05p37_933801_c1 | 3300050507 | Bacteria | 931 |
| 772 | nmdc:mga09592_1334628_c1 | 3300050508 | Bacteria | 588 |
| 773 | nmdc:mga08y16_167764_c1 | 3300050511 | Bacteria | 2281 |
| 774 | nmdc:mga08y16_323059_c1 | 3300050511 | Unclassified | 1588 |
| 775 | nmdc:mga08y16_330747_c1 | 3300050511 | Bacteria | 1567 |
| 776 | nmdc:mga0n895_27170_c1 | 3300050512 | Bacteria | 5434 |
| 777 | nmdc:mga0n895_81981_c1 | 3300050512 | Bacteria | 3215 |
| 778 | nmdc:mga0rr50_29090_c1 | 3300050513 | Bacteria | 3892 |
| 779 | nmdc:mga0rr50_66710_c1 | 3300050513 | Bacteria | 2731 |
| 780 | nmdc:mga0rr50_771624_c1 | 3300050513 | Bacteria | 820 |
| 781 | nmdc:mga08x19_183519_c1 | 3300050514 | Bacteria | 1429 |
| 782 | nmdc:mga0a205_3140_c1 | 3300050515 | Bacteria | 14650 |
| 783 | nmdc:mga0a205_31476_c1 | 3300050515 | Bacteria | 5082 |
| 784 | nmdc:mga0a205_937391_c1 | 3300050515 | Bacteria | 713 |
| 785 | Ga0495601_0127023 | 3300053077 | Unclassified | 1659 |
| 786 | Ga0495601_0444880 | 3300053077 | Bacteria | 838 |
| 787 | Ga0495601_0552118 | 3300053077 | Bacteria | 741 |
| 788 | Ga0495612_0162247 | 3300053078 | Unclassified | 976 |
| 789 | Ga0495619_0108865 | 3300053085 | Unclassified | 1892 |
| 790 | Ga0495619_0599799 | 3300053085 | Unclassified | 753 |
| 791 | Ga0501084_0150233 | 3300054114 | Bacteria | 1963 |
| 792 | Ga0590071_005020 | 3300059421 | Bacteria | 3193 |
| 793 | Ga0590075_023585 | 3300059424 | Bacteria | 1542 |
| 794 | Ga0590075_064370 | 3300059424 | Bacteria | 946 |
| 795 | Ga0590077_009569 | 3300059426 | Bacteria | 1990 |
| 796 | Ga0501082_0140669 | 3300060353 | Bacteria | 2095 |
| 797 | Ga0501082_0329541 | 3300060353 | Bacteria | 1330 |
| 798 | Ga0501082_0824096 | 3300060353 | Bacteria | 812 |
| 799 | Ga0466962_0002804 | 3300061719 | Bacteria | 8290 |
| 800 | Ga0466962_0330536 | 3300061719 | Bacteria | 757 |
| 801 | Ga0530510_0145829 | 3300061734 | Bacteria | 1746 |
| 802 | Ga0530510_0464526 | 3300061734 | Bacteria | 958 |
| 803 | Ga0530510_0716377 | 3300061734 | Bacteria | 763 |
| 804 | Ga0530510_1254014 | 3300061734 | Unclassified | 568 |
| 805 | Ga0530510_1389286 | |||
| 806 | JGI25406J46586_10038609 | |||
| 807 | Ga0070658_10070898 | |||
| 808 | Ga0070658_10085138 | |||
| 809 | Ga0070683_100022300 | |||
| 810 | Ga0070683_100033626 | |||
| 811 | Ga0070683_100196247 | |||
| 812 | Ga0070683_100214552 | |||
| 813 | Ga0070683_100473622 | |||
| 814 | Ga0070683_100860116 | |||
| 815 | Ga0070690_100973518 | |||
| 816 | Ga0070670_100073978 | |||
| 817 | Ga0070670_100595417 | |||
| 818 | Ga0070670_102111310 | |||
| 819 | Ga0068869_100465105 | |||
| 820 | Ga0068869_100739178 | |||
| 821 | Ga0070680_100074635 | |||
| 822 | Ga0070680_100075036 | |||
| 823 | Ga0070680_100869142 | |||
| 824 | Ga0070682_100104543 | |||
| 825 | Ga0070682_100132681 | |||
| 826 | Ga0070682_100652933 | |||
| 827 | Ga0070682_100707224 | |||
| 828 | Ga0070682_101590426 | |||
| 829 | Ga0070682_101639741 | |||
| 830 | Ga0068868_100136303 | |||
| 831 | Ga0068868_100635729 | |||
| 832 | Ga0068868_101083055 | |||
| 833 | Ga0068868_101086107 | |||
| 834 | Ga0068868_102220285 | |||
| 835 | Ga0070660_100005964 | |||
| 836 | Ga0070660_100037919 | |||
| 837 | Ga0070660_100236663 | |||
| 838 | Ga0070660_100269032 | |||
| 839 | Ga0070660_100391618 | |||
| 840 | Ga0070660_100616736 | |||
| 841 | Ga0070660_100816839 | |||
| 842 | Ga0070660_101437292 | |||
| 843 | Ga0070660_101653094 | |||
| 844 | Ga0070689_100077889 | |||
| 845 | Ga0070691_10623401 | |||
| 846 | Ga0070661_100028321 | |||
| 847 | Ga0070661_100062241 | |||
| 848 | Ga0070661_100075714 | |||
| 849 | Ga0070661_100384826 | |||
| 850 | Ga0070661_100594566 | |||
| 851 | Ga0070661_100647582 | |||
| 852 | Ga0070661_100968852 | |||
| 853 | Ga0070692_10406338 | |||
| 854 | Ga0070692_10576630 | |||
| 855 | Ga0070692_10869358 | |||
| 856 | Ga0070692_10928147 | |||
| 857 | Ga0070669_100042810 | |||
| 858 | Ga0070669_101585602 | |||
| 859 | Ga0070675_100060434 | |||
| 860 | Ga0070675_101176820 | |||
| 861 | Ga0070671_100179784 | |||
| 862 | Ga0070671_101925713 | |||
| 863 | Ga0070674_100019958 | |||
| 864 | Ga0070674_100088469 | |||
| 865 | Ga0070674_100123355 | |||
| 866 | Ga0070674_100384518 | |||
| 867 | Ga0070674_100964793 | |||
| 868 | Ga0070674_101030379 | |||
| 869 | Ga0070673_100066342 | |||
| 870 | Ga0070673_100619959 | |||
| 871 | Ga0070688_100010786 | |||
| 872 | Ga0070688_100128286 | |||
| 873 | Ga0070659_100004790 | |||
| 874 | Ga0070659_100107485 | |||
| 875 | Ga0070659_100190058 | |||
| 876 | Ga0070659_100243159 | |||
| 877 | Ga0070659_100294174 | |||
| 878 | Ga0070709_11084390 | |||
| 879 | Ga0070714_100063831 | |||
| 880 | Ga0070714_100104492 | |||
| 881 | Ga0070714_100395699 | |||
| 882 | Ga0070713_100358939 | |||
| 883 | Ga0070713_100908579 | |||
| 884 | Ga0070710_10093813 | |||
| 885 | Ga0070701_10675589 | |||
| 886 | Ga0070711_100007272 | |||
| 887 | Ga0070711_100129140 | |||
| 888 | Ga0070705_100942792 | |||
| 889 | Ga0070700_100008195 | |||
| 890 | Ga0070700_100115443 | |||
| 891 | Ga0070700_100173889 | |||
| 892 | Ga0070700_100205343 | |||
| 893 | Ga0070700_100584489 | |||
| 894 | Ga0070700_100781373 | |||
| 895 | Ga0070694_100065825 | |||
| 896 | Ga0070694_101859176 | |||
| 897 | Ga0070663_100718251 | |||
| 898 | Ga0070663_101442372 | |||
| 899 | Ga0070678_100273024 | |||
| 900 | Ga0070678_100347060 | |||
| 901 | Ga0070678_101026281 | |||
| 902 | Ga0070662_100042467 | |||
| 903 | Ga0070662_100724822 | |||
| 904 | Ga0070681_10050932 | |||
| 905 | Ga0070681_10081936 | |||
| 906 | Ga0070681_10085320 | |||
| 907 | Ga0070681_10159971 | |||
| 908 | Ga0070681_10261518 | |||
| 909 | Ga0070681_10573238 | |||
| 910 | Ga0070681_10742950 | |||
| 911 | Ga0070681_11604551 | |||
| 912 | Ga0068867_100168662 | |||
| 913 | Ga0068867_100373002 | |||
| 914 | Ga0068867_100692197 | |||
| 915 | Ga0068867_101317145 | |||
| 916 | Ga0070685_10001824 | |||
| 917 | Ga0070706_101083380 | |||
| 918 | Ga0070698_100203948 | |||
| 919 | Ga0070679_100053213 | |||
| 920 | Ga0070679_100113753 | |||
| 921 | Ga0070679_100167250 | |||
| 922 | Ga0070679_100212918 | |||
| 923 | Ga0070679_100216205 | |||
| 924 | Ga0070679_100616269 | |||
| 925 | Ga0070679_100957288 | |||
| 926 | Ga0070684_100052752 | |||
| 927 | Ga0070684_100077408 | |||
| 928 | Ga0070684_100086146 | |||
| 929 | Ga0070684_100094207 | |||
| 930 | Ga0070684_100121060 | |||
| 931 | Ga0070684_100140602 | |||
| 932 | Ga0070684_100151055 | |||
| 933 | Ga0070684_100413993 | |||
| 934 | Ga0070684_100653543 | |||
| 935 | Ga0070684_101200090 | |||
| 936 | Ga0068853_100093313 | |||
| 937 | Ga0068853_100333777 | |||
| 938 | Ga0068853_100417520 | |||
| 939 | Ga0068853_100716782 | |||
| 940 | Ga0070672_100051256 | |||
| 941 | Ga0070672_101275188 | |||
| 942 | Ga0070686_100096511 | |||
| 943 | Ga0070686_100286447 | |||
| 944 | Ga0070686_100454365 | |||
| 945 | Ga0070686_100781546 | |||
| 946 | Ga0070695_100406724 | |||
| 947 | Ga0070695_100867520 | |||
| 948 | Ga0070696_100890161 | |||
| 949 | Ga0070693_100392196 | |||
| 950 | Ga0070693_100815329 | |||
| 951 | Ga0070665_100584496 | |||
| 952 | Ga0070704_100539681 | |||
| 953 | Ga0070704_100710533 | |||
| 954 | Ga0070704_101463507 | |||
| 955 | Ga0068855_100047783 | |||
| 956 | Ga0068855_100134067 | |||
| 957 | Ga0068855_100273503 | |||
| 958 | Ga0068855_100298523 | |||
| 959 | Ga0068855_100305430 | |||
| 960 | Ga0068855_101484718 | |||
| 961 | Ga0070664_100264773 | |||
| 962 | Ga0070664_101753244 | |||
| 963 | Ga0068857_100041175 | |||
| 964 | Ga0068857_100168748 | |||
| 965 | Ga0068857_100268831 | |||
| 966 | Ga0068857_101240442 | |||
| 967 | Ga0068854_100719165 | |||
| 968 | Ga0068854_101589583 | |||
| 969 | Ga0068856_100076108 | |||
| 970 | Ga0068856_100581263 | |||
| 971 | Ga0070702_100061131 | |||
| 972 | Ga0070702_100570202 | |||
| 973 | Ga0068852_100511013 | |||
| 974 | Ga0068864_100031233 | |||
| 975 | Ga0068861_100674626 | |||
| 976 | Ga0068851_10296375 | |||
| 977 | Ga0068870_10507897 | |||
| 978 | Ga0068863_100166037 | |||
| 979 | Ga0068860_101426292 | |||
| 980 | Ga0068862_100355635 | |||
| 981 | Ga0081455_10032806 | |||
| 982 | Ga0081455_10084700 | |||
| 983 | Ga0081455_10210192 | |||
| 984 | Ga0081455_10686943 | |||
| 985 | Ga0070717_10536906 | |||
| 986 | Ga0070717_12029165 | |||
| 987 | Ga0075365_10055162 | |||
| 988 | Ga0075365_10100188 | |||
| 989 | Ga0075365_10268127 | |||
| 990 | Ga0075432_10133618 | |||
| 991 | Ga0070716_100652723 | |||
| 992 | Ga0070712_100109253 | |||
| 993 | Ga0070712_100123760 | |||
| 994 | Ga0070712_101053823 | |||
| 995 | Ga0070712_101521894 | |||
| 996 | Ga0097621_100215680 | |||
| 997 | Ga0075428_100136065 | |||
| 998 | Ga0075428_101293291 | |||
| 999 | Ga0075428_102591377 | |||
| 1000 | Ga0075430_101382370 | |||
| 1001 | Ga0075431_101202254 | |||
| 1002 | Ga0075433_10005010 | |||
| 1003 | Ga0075433_10043675 | |||
| 1004 | Ga0075433_10397229 | |||
| 1005 | Ga0075433_10490523 | |||
| 1006 | Ga0075434_100001065 | |||
| 1007 | Ga0075434_100738100 | |||
| 1008 | Ga0075429_100435993 | |||
| 1009 | Ga0075429_100512852 | |||
| 1010 | Ga0075429_101363831 | |||
| 1011 | Ga0068865_100065984 | |||
| 1012 | Ga0068865_100103918 | |||
| 1013 | Ga0068865_100291046 | |||
| 1014 | Ga0068865_100329773 | |||
| 1015 | Ga0068865_100448374 | |||
| 1016 | Ga0075436_100127934 | |||
| 1017 | Ga0075435_100023195 | |||
| 1018 | Ga0075435_100155328 | |||
| 1019 | Ga0105240_10316438 | |||
| 1020 | Ga0111539_10057188 | |||
| 1021 | Ga0111539_10215201 | |||
| 1022 | Ga0111539_10802849 | |||
| 1023 | Ga0111539_10991640 | |||
| 1024 | Ga0111539_12334375 | |||
| 1025 | Ga0105245_10035841 | |||
| 1026 | Ga0105245_10126164 | |||
| 1027 | Ga0105245_10358041 | |||
| 1028 | Ga0105245_10672384 | |||
| 1029 | Ga0105245_10688752 | |||
| 1030 | Ga0105245_11262744 | |||
| 1031 | Ga0114129_10125205 | |||
| 1032 | Ga0114129_10624707 | |||
| 1033 | Ga0114129_11488675 | |||
| 1034 | Ga0114129_11941027 | |||
| 1035 | Ga0114129_12357330 | |||
| 1036 | Ga0105243_10051308 | |||
| 1037 | Ga0105243_10652290 | |||
| 1038 | Ga0105243_10992156 | |||
| 1039 | Ga0105243_11016294 | |||
| 1040 | Ga0105243_11709145 | |||
| 1041 | Ga0105241_11153615 | |||
| 1042 | Ga0105241_11363332 | |||
| 1043 | Ga0105241_11390379 | |||
| 1044 | Ga0105241_11690072 | |||
| 1045 | Ga0105242_10228249 | |||
| 1046 | Ga0105242_10308915 | |||
| 1047 | Ga0105242_10610071 | |||
| 1048 | Ga0105242_10723630 | |||
| 1049 | Ga0105242_10872172 | |||
| 1050 | Ga0105242_11053390 | |||
| 1051 | Ga0105242_11331890 | |||
| 1052 | Ga0105242_11549417 | |||
| 1053 | Ga0105248_10298867 | |||
| 1054 | Ga0105248_10508092 | |||
| 1055 | Ga0105248_11405324 | |||
| 1056 | Ga0105248_12681710 | |||
| 1057 | Ga0105248_13280456 | |||
| 1058 | Ga0105237_12513026 | |||
| 1059 | Ga0105238_10013829 | |||
| 1060 | Ga0105249_10339996 | |||
| 1061 | Ga0105249_10855296 | |||
| 1062 | Ga0105249_13194119 | |||
| 1063 | Ga0105239_10072533 | |||
| 1064 | Ga0105239_10563482 | |||
| 1065 | Ga0105239_10953381 | |||
| 1066 | Ga0105239_13030178 | |||
| 1067 | Ga0105239_13294269 | |||
| 1068 | Ga0105246_10494201 | |||
| 1069 | Ga0105246_11030419 | |||
| 1070 | Ga0105246_11114198 | |||
| 1071 | Ga0105246_12407322 | |||
| 1072 | Ga0157317_1029794 | |||
| 1073 | Ga0157373_10127963 | |||
| 1074 | Ga0157371_10726034 | |||
| 1075 | Ga0157370_10233973 | |||
| 1076 | Ga0157370_11714525 | |||
| 1077 | Ga0157369_10107096 | |||
| 1078 | Ga0157369_10472349 | |||
| 1079 | Ga0157369_10547687 | |||
| 1080 | Ga0157374_10020787 | |||
| 1081 | Ga0157374_10237229 | |||
| 1082 | Ga0157374_10747000 | |||
| 1083 | Ga0157378_10532829 | |||
| 1084 | Ga0157378_10641998 | |||
| 1085 | Ga0157378_13310620 | |||
| 1086 | Ga0163162_10595720 | |||
| 1087 | Ga0163162_11987259 | |||
| 1088 | Ga0163162_12889255 | |||
| 1089 | Ga0157372_10208878 | |||
| 1090 | Ga0157372_10369616 | |||
| 1091 | Ga0157372_10520295 | |||
| 1092 | Ga0157372_11615214 | |||
| 1093 | Ga0157372_11963494 | |||
| 1094 | Ga0157372_12557212 | |||
| 1095 | Ga0157375_11036870 | |||
| 1096 | Ga0157375_11714812 | |||
| 1097 | Ga0163163_10295744 | |||
| 1098 | Ga0163163_10592253 | |||
| 1099 | Ga0163163_11673729 | |||
| 1100 | Ga0157380_10012612 | |||
| 1101 | Ga0157380_10062172 | |||
| 1102 | Ga0157380_10339412 | |||
| 1103 | Ga0157380_11549313 | |||
| 1104 | Ga0157380_12313283 | |||
| 1105 | Ga0157380_12457336 | |||
| 1106 | Ga0182008_10332692 | |||
| 1107 | Ga0182008_10435918 | |||
| 1108 | Ga0157377_10001619 | |||
| 1109 | Ga0157377_10105818 | |||
| 1110 | Ga0157377_10290588 | |||
| 1111 | Ga0157377_11129389 | |||
| 1112 | Ga0157376_10009320 | |||
| 1113 | Ga0157376_10286486 | |||
| 1114 | Ga0157376_12065727 | |||
| 1115 | Ga0163161_11255799 | |||
| 1116 | Ga0197907_10141167 | |||
| 1117 | Ga0206354_10283838 | |||
| 1118 | Ga0206354_10594452 | |||
| 1119 | Ga0206354_10639976 | |||
| 1120 | Ga0206353_10073309 | |||
| 1121 | Ga0206353_10500058 | |||
| 1122 | Ga0206353_11124550 | |||
| 1123 | Ga0207656_10423960 | |||
| 1124 | Ga0207692_10072332 | |||
| 1125 | Ga0207688_10070534 | |||
| 1126 | Ga0207688_10542456 | |||
| 1127 | Ga0207699_10641633 | |||
| 1128 | Ga0207645_10033932 | |||
| 1129 | Ga0207645_10263217 | |||
| 1130 | Ga0207643_10008879 | |||
| 1131 | Ga0207705_10320974 | |||
| 1132 | Ga0207654_11016690 | |||
| 1133 | Ga0207707_10004189 | |||
| 1134 | Ga0207707_10010409 | |||
| 1135 | Ga0207707_10065193 | |||
| 1136 | Ga0207707_10122454 | |||
| 1137 | Ga0207707_10440653 | |||
| 1138 | Ga0207707_11252030 | |||
| 1139 | Ga0207695_11231085 | |||
| 1140 | Ga0207671_10124899 | |||
| 1141 | Ga0207671_11424699 | |||
| 1142 | Ga0207693_10177483 | |||
| 1143 | Ga0207693_10263573 | |||
| 1144 | Ga0207663_10140095 | |||
| 1145 | Ga0207660_10020669 | |||
| 1146 | Ga0207660_10288500 | |||
| 1147 | Ga0207660_10477680 | |||
| 1148 | Ga0207660_10515997 | |||
| 1149 | Ga0207657_10016530 | |||
| 1150 | Ga0207657_10100234 | |||
| 1151 | Ga0207657_10175289 | |||
| 1152 | Ga0207657_10904239 | |||
| 1153 | Ga0207657_10976329 | |||
| 1154 | Ga0207657_11128133 | |||
| 1155 | Ga0207649_10171804 | |||
| 1156 | Ga0207649_10242439 | |||
| 1157 | Ga0207649_10504041 | |||
| 1158 | Ga0207649_10987229 | |||
| 1159 | Ga0207652_10080559 | |||
| 1160 | Ga0207652_10095929 | |||
| 1161 | Ga0207652_10105736 | |||
| 1162 | Ga0207652_10320382 | |||
| 1163 | Ga0207652_11169949 | |||
| 1164 | Ga0207681_10236097 | |||
| 1165 | Ga0207681_11299583 | |||
| 1166 | Ga0207694_10949967 | |||
| 1167 | Ga0207650_11071980 | |||
| 1168 | Ga0207659_10027279 | |||
| 1169 | Ga0207659_10369075 | |||
| 1170 | Ga0207687_10099997 | |||
| 1171 | Ga0207687_10302480 | |||
| 1172 | Ga0207687_10319909 | |||
| 1173 | Ga0207687_10405342 | |||
| 1174 | Ga0207687_10596562 | |||
| 1175 | Ga0207687_11226984 | |||
| 1176 | Ga0207700_10373836 | |||
| 1177 | Ga0207700_10406126 | |||
| 1178 | Ga0207700_10813960 | |||
| 1179 | Ga0207664_10087662 | |||
| 1180 | Ga0207664_10194530 | |||
| 1181 | Ga0207664_10282114 | |||
| 1182 | Ga0207644_10064837 | |||
| 1183 | Ga0207644_11219527 | |||
| 1184 | Ga0207690_10090121 | |||
| 1185 | Ga0207690_10246130 | |||
| 1186 | Ga0207706_10408571 | |||
| 1187 | Ga0207706_11282435 | |||
| 1188 | Ga0207686_10055181 | |||
| 1189 | Ga0207686_10112069 | |||
| 1190 | Ga0207686_10115246 | |||
| 1191 | Ga0207686_10525621 | |||
| 1192 | Ga0207686_10838947 | |||
| 1193 | Ga0207686_11499576 | |||
| 1194 | Ga0207709_10059114 | |||
| 1195 | Ga0207709_10169346 | |||
| 1196 | Ga0207709_10413869 | |||
| 1197 | Ga0207709_10791989 | |||
| 1198 | Ga0207669_10005712 | |||
| 1199 | Ga0207669_10039655 | |||
| 1200 | Ga0207669_10499944 | |||
| 1201 | Ga0207669_10657338 | |||
| 1202 | Ga0207669_10997557 | |||
| 1203 | Ga0207669_11583616 | |||
| 1204 | Ga0207704_10056403 | |||
| 1205 | Ga0207704_10072607 | |||
| 1206 | Ga0207704_10196744 | |||
| 1207 | Ga0207704_11377426 | |||
| 1208 | Ga0207665_10230103 | |||
| 1209 | Ga0207691_10008423 | |||
| 1210 | Ga0207691_10129912 | |||
| 1211 | Ga0207691_10356729 | |||
| 1212 | Ga0207691_10531864 | |||
| 1213 | Ga0207711_10153191 | |||
| 1214 | Ga0207711_12016744 | |||
| 1215 | Ga0207689_10054461 | |||
| 1216 | Ga0207661_10022510 | |||
| 1217 | Ga0207661_10061508 | |||
| 1218 | Ga0207661_10134639 | |||
| 1219 | Ga0207661_10162260 | |||
| 1220 | Ga0207661_10242603 | |||
| 1221 | Ga0207661_10274221 | |||
| 1222 | Ga0207661_10512367 | |||
| 1223 | Ga0207661_10630526 | |||
| 1224 | Ga0207661_11114395 | |||
| 1225 | Ga0207661_11366418 | |||
| 1226 | Ga0207679_10100261 | |||
| 1227 | Ga0207679_10437630 | |||
| 1228 | Ga0207667_10110563 | |||
| 1229 | Ga0207667_10609252 | |||
| 1230 | Ga0207651_10389126 | |||
| 1231 | Ga0207651_10825923 | |||
| 1232 | Ga0207668_10113975 | |||
| 1233 | Ga0207668_10390679 | |||
| 1234 | Ga0207640_10321155 | |||
| 1235 | Ga0207677_10159410 | |||
| 1236 | Ga0207639_10289525 | |||
| 1237 | Ga0207639_10516280 | |||
| 1238 | Ga0207639_10575552 | |||
| 1239 | Ga0207678_10238648 | |||
| 1240 | Ga0207678_10840586 | |||
| 1241 | Ga0207678_10972226 | |||
| 1242 | Ga0207678_11093246 | |||
| 1243 | Ga0207708_10012136 | |||
| 1244 | Ga0207708_10138212 | |||
| 1245 | Ga0207708_10765487 | |||
| 1246 | Ga0207702_10146248 | |||
| 1247 | Ga0207702_10481079 | |||
| 1248 | Ga0207648_10159110 | |||
| 1249 | Ga0207648_10293618 | |||
| 1250 | Ga0207648_10424449 | |||
| 1251 | Ga0207648_11419656 | |||
| 1252 | Ga0207674_10008792 | |||
| 1253 | Ga0207674_10038188 | |||
| 1254 | Ga0207674_10071831 | |||
| 1255 | Ga0207674_11323975 | |||
| 1256 | Ga0207675_100311458 | |||
| 1257 | Ga0207683_10080971 | |||
| 1258 | Ga0207683_10178665 | |||
| 1259 | Ga0207683_10468414 | |||
| 1260 | Ga0207683_10702459 | |||
| 1261 | Ga0207683_10965039 | |||
| 1262 | Ga0207698_11243257 | |||
| 1263 | Ga0207428_10103560 | |||
| 1264 | Ga0268266_10099810 | |||
| 1265 | Ga0268266_11107053 | |||
| 1266 | Ga0268265_11092158 | |||
| 1267 | Ga0265318_10105638 | |||
| 1268 | Ga0265338_10511828 | |||
| 1269 | Ga0265338_10751577 | |||
| 1270 | Ga0265316_10350309 | |||
| 1271 | Ga0307408_101725083 | |||
| 1272 | Ga0307413_10121614 | |||
| 1273 | Ga0307413_10417305 | |||
| 1274 | Ga0307410_11867303 | |||
| 1275 | Ga0307406_11960943 | |||
| 1276 | Ga0307414_11909354 | |||
| 1277 | Ga0307411_11916313 | |||
| 1278 | Ga0307415_100570212 | |||
| 1279 | Ga0373944_0035657 | |||
| 1280 | Ga0373923_0252164 | |||
| 1281 | Ga0373936_0294493 | |||
| 1282 | Ga0373945_0042537 | |||
| 1283 | Ga0373954_0181339 | |||
| 1284 | Ga0373943_0091204 | |||
| 1285 | Ga0373955_0043789 | |||
| 1286 | Ga0373924_0473202 | |||
| 1287 | Ga0373935_0767479 | |||
| 1288 | Ga0373927_0717307 | |||
| 1289 | Ga0373933_0326765 | |||
| 1290 | Ga0373947_0009634 | |||
| 1291 | Ga0373937_2143340 | |||
| 1292 | Ga0373925_0070181 | |||
| 1293 | Ga0395899_0084744 | |||
| 1294 | Ga0395899_0103852 | |||
| 1295 | Ga0395899_0166173 | |||
| 1296 | Ga0395900_0048314 | |||
| 1297 | Ga0395900_0149764 | |||
| 1298 | Ga0395900_0206126 | |||
| 1299 | Ga0395900_0422808 | |||
| 1300 | Ga0395898_0003007 | |||
| 1301 | Ga0395898_0028740 | |||
| 1302 | Ga0395898_0210390 | |||
| 1303 | Ga0395905_0019388 | |||
| 1304 | Ga0395905_0093451 | |||
| 1305 | Ga0395905_0152044 | |||
| 1306 | Ga0395905_0616269 | |||
| 1307 | Ga0395905_0680617 | |||
| 1308 | Ga0395905_0814674 | |||
| 1309 | Ga0395901_0007137 | |||
| 1310 | Ga0395901_0021400 | |||
| 1311 | Ga0395901_0039769 | |||
| 1312 | Ga0395901_0392998 | |||
| 1313 | Ga0395901_0613682 | |||
| 1314 | Ga0395901_0616173 | |||
| 1315 | Ga0439466_0193021 | |||
| 1316 | Ga0451802_0647905 | |||
| 1317 | Ga0451807_1619306 | |||
| 1318 | Ga0451837_0325315 | |||
| 1319 | Ga0451849_0780287 | |||
| 1320 | Ga0451853_2274916 | |||
| 1321 | Ga0450912_016684 | |||
| 1322 | Ga0450914_012499 | |||
| 1323 | Ga0450917_013989 | |||
| 1324 | Ga0450890_048050 | |||
| 1325 | Ga0450892_042581 | |||
| 1326 | Ga0450907_020184 | |||
| 1327 | Ga0450918_051385 | |||
| 1328 | Ga0466972_0392019 | |||
| 1329 | Ga0466965_0139313 | |||
| 1330 | Ga0466961_0032195 | |||
| 1331 | Ga0466963_0004119 | |||
| 1332 | Ga0466963_0029977 | |||
| 1333 | Ga0466964_0215875 | |||
| 1334 | Ga0466964_0647095 | |||
| 1335 | Ga0466971_0001478 | |||
| 1336 | Ga0466971_0134567 | |||
| 1337 | Ga0466968_0242631 | |||
| 1338 | Ga0466970_0230831 | |||
| 1339 | Ga0466957_0025960 | |||
| 1340 | Ga0466957_0133177 | |||
| 1341 | Ga0466959_0142817 | |||
| 1342 | Ga0466959_0292410 | |||
| 1343 | Ga0451576_0036505 | |||
| 1344 | Ga0466958_0009005 | |||
| 1345 | Ga0466958_0116965 | |||
| 1346 | Ga0466967_0000221 | |||
| 1347 | Ga0466967_0014571 | |||
| 1348 | Ga0466967_0046998 | |||
| 1349 | Ga0466967_0170081 | |||
| 1350 | Ga0466967_0259621 | |||
| 1351 | Ga0466967_1115973 | |||
| 1352 | Ga0466967_1503686 | |||
| 1353 | Ga0466967_1731597 | |||
| 1354 | Ga0495592_0294663 | |||
| 1355 | Ga0495592_0306537 | |||
| 1356 | Ga0495592_0624114 | |||
| 1357 | Ga0495629_0180488 | |||
| 1358 | Ga0495651_0013329 | |||
| 1359 | Ga0495651_0146848 | |||
| 1360 | Ga0495653_0036071 | |||
| 1361 | Ga0495582_0734468 | |||
| 1362 | Ga0495639_0042673 | |||
| 1363 | Ga0495662_0166002 | |||
| 1364 | Ga0495664_0191741 | |||
| 1365 | Ga0495664_0421185 | |||
| 1366 | Ga0495584_0419018 | |||
| 1367 | Ga0495594_0440077 | |||
| 1368 | Ga0495596_0221655 | |||
| 1369 | Ga0495608_0015441 | |||
| 1370 | Ga0495608_0026725 | |||
| 1371 | Ga0495616_0293109 | |||
| 1372 | Ga0495618_0322086 | |||
| 1373 | Ga0495628_0069678 | |||
| 1374 | Ga0495628_0353045 | |||
| 1375 | Ga0495628_0403022 | |||
| 1376 | Ga0495630_0000487 | |||
| 1377 | Ga0495630_0105785 | |||
| 1378 | Ga0495630_0178435 | |||
| 1379 | Ga0495630_0957320 | |||
| 1380 | Ga0495631_0076489 | |||
| 1381 | Ga0495631_0157368 | |||
| 1382 | Ga0495644_0039481 | |||
| 1383 | Ga0495644_0084757 | |||
| 1384 | Ga0495666_0340323 | |||
| 1385 | Ga0495652_0369053 | |||
| 1386 | Ga0495665_0506662 | |||
| 1387 | Ga0495640_0012100 | |||
| 1388 | Ga0495640_0162756 | |||
| 1389 | Ga0495587_0047453 | |||
| 1390 | Ga0495587_0126840 | |||
| 1391 | Ga0495598_0419500 | |||
| 1392 | Ga0495597_0302974 | |||
| 1393 | Ga0495645_0113258 | |||
| 1394 | Ga0495645_0126931 | |||
| 1395 | Ga0495645_0182379 | |||
| 1396 | Ga0495667_0006264 | |||
| 1397 | Ga0495667_0019324 | |||
| 1398 | Ga0495667_0110615 | |||
| 1399 | Ga0495634_0153776 | |||
| 1400 | Ga0495634_0185634 | |||
| 1401 | Ga0495635_0134521 | |||
| 1402 | Ga0495635_0149462 | |||
| 1403 | Ga0495659_0049897 | |||
| 1404 | Ga0495657_0059732 | |||
| 1405 | Ga0495657_0132592 | |||
| 1406 | Ga0495599_0123827 | |||
| 1407 | Ga0495599_0157208 | |||
| 1408 | Ga0495623_0095691 | |||
| 1409 | Ga0495623_0505146 | |||
| 1410 | Ga0495623_0541944 | |||
| 1411 | Ga0495658_0270283 | |||
| 1412 | Ga0495658_0373192 | |||
| 1413 | Ga0495613_0043848 | |||
| 1414 | Ga0495613_0617957 | |||
| 1415 | Ga0495624_0483630 | |||
| 1416 | Ga0495600_0058872 | |||
| 1417 | Ga0495600_0130755 | |||
| 1418 | Ga0495581_0403295 | |||
| 1419 | Ga0495604_0016554 | |||
| 1420 | Ga0495604_0085024 | |||
| 1421 | Ga0495604_0151383 | |||
| 1422 | Ga0495604_0460936 | |||
| 1423 | Ga0495604_0614830 | |||
| 1424 | Ga0495636_0645641 | |||
| 1425 | Ga0495674_0008409 | |||
| 1426 | Ga0495674_0422875 | |||
| 1427 | Ga0495676_0214362 | |||
| 1428 | Ga0495680_0002804 | |||
| 1429 | Ga0495680_0091968 | |||
| 1430 | Ga0495680_0149374 | |||
| 1431 | Ga0495675_0435223 | |||
| 1432 | Ga0495684_0025474 | |||
| 1433 | Ga0495593_0450631 | |||
| 1434 | Ga0495602_0066480 | |||
| 1435 | Ga0495602_0089118 | |||
| 1436 | Ga0495602_0148093 | |||
| 1437 | Ga0495614_0299428 | |||
| 1438 | Ga0495615_0109517 | |||
| 1439 | Ga0496100_0010820 | |||
| 1440 | Ga0496100_0015526 | |||
| 1441 | Ga0496100_0023089 | |||
| 1442 | Ga0496100_0153122 | |||
| 1443 | Ga0496101_0002017 | |||
| 1444 | Ga0496101_0056778 | |||
| 1445 | Ga0496101_0478748 | |||
| 1446 | Ga0496101_0983269 | |||
| 1447 | Ga0496101_1169567 | |||
| 1448 | Ga0496102_0007890 | |||
| 1449 | Ga0496102_0342985 | |||
| 1450 | Ga0496102_0745115 | |||
| 1451 | Ga0496102_1612872 | |||
| 1452 | Ga0496102_1816674 | |||
| 1453 | Ga0496103_0037233 | |||
| 1454 | Ga0496103_0048912 | |||
| 1455 | Ga0496103_0085205 | |||
| 1456 | Ga0496103_0337391 | |||
| 1457 | Ga0496103_1042496 | |||
| 1458 | Ga0496104_0005537 | |||
| 1459 | Ga0496104_0063467 | |||
| 1460 | Ga0496105_0000489 | |||
| 1461 | Ga0496105_0161459 | |||
| 1462 | Ga0496105_0266677 | |||
| 1463 | Ga0496105_0558672 | |||
| 1464 | Ga0496105_0824435 | |||
| 1465 | Ga0496106_0005043 | |||
| 1466 | Ga0496106_0062702 | |||
| 1467 | Ga0496106_0090798 | |||
| 1468 | Ga0496107_0002143 | |||
| 1469 | Ga0496107_0003268 | |||
| 1470 | Ga0496107_0003366 | |||
| 1471 | Ga0496108_0050746 | |||
| 1472 | Ga0496108_0169283 | |||
| 1473 | Ga0496108_0352584 | |||
| 1474 | Ga0496108_0669193 | |||
| 1475 | Ga0496108_1127932 | |||
| 1476 | Ga0496109_0023202 | |||
| 1477 | Ga0496109_0159906 | |||
| 1478 | Ga0496109_0228721 | |||
| 1479 | Ga0496109_0229269 | |||
| 1480 | Ga0496109_1166919 | |||
| 1481 | Ga0496109_1439960 | |||
| 1482 | Ga0496110_0003945 | |||
| 1483 | Ga0496110_0054056 | |||
| 1484 | Ga0496110_0075600 | |||
| 1485 | Ga0496110_0081974 | |||
| 1486 | Ga0496110_0221571 | |||
| 1487 | Ga0496110_0304373 | |||
| 1488 | Ga0496110_0714802 | |||
| 1489 | Ga0496111_0101515 | |||
| 1490 | Ga0496111_0244850 | |||
| 1491 | Ga0496111_0422302 | |||
| 1492 | Ga0496111_0983049 | |||
| 1493 | Ga0496112_0011597 | |||
| 1494 | Ga0496112_0026519 | |||
| 1495 | Ga0496112_0190754 | |||
| 1496 | Ga0496112_0196655 | |||
| 1497 | Ga0496112_0232034 | |||
| 1498 | Ga0496112_0475684 | |||
| 1499 | Ga0496112_1050921 | |||
| 1500 | Ga0496112_1848453 | |||
| 1501 | Ga0496113_0141520 | |||
| 1502 | Ga0496113_0318781 | |||
| 1503 | Ga0496113_1329639 | |||
| 1504 | Ga0496114_0011178 | |||
| 1505 | Ga0496114_0027774 | |||
| 1506 | Ga0496114_0824396 | |||
| 1507 | Ga0496114_0891273 | |||
| 1508 | Ga0496114_0995300 | |||
| 1509 | Ga0496114_1190757 | |||
| 1510 | Ga0496115_0006491 | |||
| 1511 | Ga0496115_0045342 | |||
| 1512 | Ga0496115_0680245 | |||
| 1513 | Ga0496115_1210365 | |||
| 1514 | Ga0501031_0068456 | |||
| 1515 | Ga0501031_0944088 | |||
| 1516 | Ga0501034_0314169 | |||
| 1517 | Ga0501036_0212904 | |||
| 1518 | Ga0501036_0832064 | |||
| 1519 | Ga0501036_1404167 | |||
| 1520 | Ga0501037_0624345 | |||
| 1521 | Ga0501037_0811818 | |||
| 1522 | Ga0501039_1048721 | |||
| 1523 | Ga0501039_1296034 | |||
| 1524 | Ga0501040_0243880 | |||
| 1525 | Ga0501040_1203139 | |||
| 1526 | Ga0501042_0104948 | |||
| 1527 | Ga0501042_0446465 | |||
| 1528 | Ga0501042_1330404 | |||
| 1529 | Ga0501043_0828540 | |||
| 1530 | Ga0501043_0986475 | |||
| 1531 | Ga0501046_0729610 | |||
| 1532 | Ga0501046_0740647 | |||
| 1533 | Ga0501047_0020883 | |||
| 1534 | Ga0501048_0561741 | |||
| 1535 | Ga0501067_0113651 | |||
| 1536 | Ga0501067_0518884 | |||
| 1537 | Ga0501067_0780332 | |||
| 1538 | Ga0501070_0836704 | |||
| 1539 | Ga0501070_1242871 | |||
| 1540 | Ga0501071_0033604 | |||
| 1541 | Ga0501071_0240154 | |||
| 1542 | Ga0501071_0361056 | |||
| 1543 | Ga0501071_0561044 | |||
| 1544 | Ga0501071_0714862 | |||
| 1545 | Ga0501071_0734001 | |||
| 1546 | Ga0501072_0215369 | |||
| 1547 | Ga0501072_0992144 | |||
| 1548 | Ga0501074_0033400 | |||
| 1549 | Ga0501075_0198844 | |||
| 1550 | Ga0501075_0730595 | |||
| 1551 | Ga0501076_0947686 | |||
| 1552 | Ga0501076_1023203 | |||
| 1553 | Ga0501077_0216067 | |||
| 1554 | Ga0501077_0555070 | |||
| 1555 | Ga0501077_0600865 | |||
| 1556 | Ga0501077_0908403 | |||
| 1557 | Ga0501079_0158581 | |||
| 1558 | Ga0501079_0189221 | |||
| 1559 | Ga0501080_0113166 | |||
| 1560 | Ga0501080_0665769 | |||
| 1561 | Ga0501080_1201463 | |||
| 1562 | Ga0501081_0152958 | |||
| 1563 | Ga0501081_0297258 | |||
| 1564 | Ga0501081_1004968 | |||
| 1565 | Ga0501081_1021458 | |||
| 1566 | Ga0501083_0339413 | |||
| 1567 | Ga0501035_0261249 | |||
| 1568 | Ga0501035_0845006 | |||
| 1569 | Ga0501044_1635371 | |||
| 1570 | Ga0501045_0369357 | |||
| 1571 | Ga0501045_0419362 | |||
| 1572 | nmdc:mga0yw44_193835_c1 | |||
| 1573 | nmdc:mga05p37_694803_c1 | |||
| 1574 | nmdc:mga05p37_770478_c1 | |||
| 1575 | nmdc:mga05p37_933801_c1 | |||
| 1576 | nmdc:mga09592_1334628_c1 | |||
| 1577 | nmdc:mga08y16_167764_c1 | |||
| 1578 | nmdc:mga08y16_323059_c1 | |||
| 1579 | nmdc:mga08y16_330747_c1 | |||
| 1580 | nmdc:mga0n895_27170_c1 | |||
| 1581 | nmdc:mga0n895_81981_c1 | |||
| 1582 | nmdc:mga0rr50_29090_c1 | |||
| 1583 | nmdc:mga0rr50_66710_c1 | |||
| 1584 | nmdc:mga0rr50_771624_c1 | |||
| 1585 | nmdc:mga08x19_183519_c1 | |||
| 1586 | nmdc:mga0a205_3140_c1 | |||
| 1587 | nmdc:mga0a205_31476_c1 | |||
| 1588 | nmdc:mga0a205_937391_c1 | |||
| 1589 | Ga0495601_0127023 | |||
| 1590 | Ga0495601_0444880 | |||
| 1591 | Ga0495601_0552118 | |||
| 1592 | Ga0495612_0162247 | |||
| 1593 | Ga0495619_0108865 | |||
| 1594 | Ga0495619_0599799 | |||
| 1595 | Ga0501084_0150233 | |||
| 1596 | Ga0590071_005020 | |||
| 1597 | Ga0590075_023585 | |||
| 1598 | Ga0590075_064370 | |||
| 1599 | Ga0590077_009569 | |||
| 1600 | Ga0501082_0140669 | |||
| 1601 | Ga0501082_0329541 | |||
| 1602 | Ga0501082_0824096 | |||
| 1603 | Ga0466962_0002804 | |||
| 1604 | Ga0466962_0330536 | |||
| 1605 | Ga0530510_0145829 | |||
| 1606 | Ga0530510_0464526 | |||
| 1607 | Ga0530510_0716377 | |||
| 1608 | Ga0530510_1254014 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l0y-assembly5.cif.gz_H | crystal structure of a sec72-ssa1 c-terminal peptide fusion protein | 0.951 | 7 | 41 |
| 3qtm-assembly2.cif.gz_B | structure of s. pombe nuclear import adaptor nro1 (space group p21) | 0.9399 | 3 | 44 |
| 3msv-assembly3.cif.gz_B | the hypoxic regulator of sterol synthesis nro1 is a nuclear import adaptor | 0.9352 | 3 | 44 |
| 5l0y-assembly3.cif.gz_C | crystal structure of a sec72-ssa1 c-terminal peptide fusion protein | 0.933 | 6 | 41 |
| 1elw-assembly1.cif.gz_A | crystal structure of the tpr1 domain of hop in complex with a hsc70 peptide | 0.9321 | 10 | 39 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F1M369_597_759_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9581 | 5 | 40 | 1.25.40.10 |
| af_P39742_49_193_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.948 | 6 | 41 | 1.25.40.10 |
| af_O44951_9_156_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.9432 | 5 | 40 | 1.25.40.10 |
| af_A0A368UI47_479_586_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.94 | 4 | 40 | 1.25.40.10 |
| af_Q9USJ7_63_377_1.25.40.1040 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.9391 | 6 | 43 | 1.25.40.1040 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524F0W9-F1-model_v4 | Uncharacterized protein | 0.9276 | 4 | 63 |
|
| AF-A0A7J2RH48-F1-model_v4 | Tetratricopeptide repeat protein | 0.9097 | 2 | 64 |
|
| AF-A0A358R6C2-F1-model_v4 | Tetratricopeptide repeat protein | 0.8981 | 4 | 61 |
|
| AF-A0A5C5VIY3-F1-model_v4 | Tetratricopeptide repeat protein | 0.8978 | 4 | 61 |
|
| AF-A0A1T4WIQ3-F1-model_v4 | Tetratricopeptide repeat-containing protein | 0.8968 | 1 | 63 |
|