F481206
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 796 | 242 | 1592 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300046528|Ga0495642_0000352|Ga0495642_0000352_18617_18898 |
| Length | 93 |
| Sequence | LRFYSTDFMKINLRFFASVREAVGTSNETVDLPEDVATVGAVRAFLIARGGAWAEALGQERALRMAFDHVMCAPETPVREGGEVAFFPPVTGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 32 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 42 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 47 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 52 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 53 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 56 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 78 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 79 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 80 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 83 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 84 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 85 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 86 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 87 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 90 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 91 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 92 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 93 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 94 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 95 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 96 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 97 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 98 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 99 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 100 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 101 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 102 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 103 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 104 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 105 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 106 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 107 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 108 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 109 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 110 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 111 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 112 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 113 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 114 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 215 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 216 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 217 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 218 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 219 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 220 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 228 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 233 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 234 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 235 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 236 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 237 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 238 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 239 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 240 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 241 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 242 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.49 |
| Metatranscriptomes | 0.25 |
| Isolates | 1.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.18 |
| Nodule | 0.25 |
| Rhizoplane | 6.03 |
| Rhizosphere | 78.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495642_0000352 | 3300046528 | Bacteria | 24904 |
| 2 | JGI25158J39367_1000579 | 3300002739 | Bacteria | 7293 |
| 3 | JGI25158J39367_1002308 | 3300002739 | Bacteria | 3136 |
| 4 | JGI25152J39213_1000071 | 3300002773 | Bacteria | 66888 |
| 5 | JGI25150J39212_1000674 | 3300002774 | Bacteria | 12515 |
| 6 | JGI25150J39212_1002059 | 3300002774 | Bacteria | 5226 |
| 7 | JGI25159J45721_1008136 | 3300002987 | Bacteria | 2914 |
| 8 | JGI25159J45721_1012506 | 3300002987 | Bacteria | 2022 |
| 9 | JGI25159J45721_1012543 | 3300002987 | Bacteria | 2016 |
| 10 | rootL2_10126347 | 3300003322 | Bacteria | 2318 |
| 11 | rootL2_10147025 | 3300003322 | Bacteria | 1224 |
| 12 | JGI25160J50197_1020158 | 3300003354 | Bacteria | 2022 |
| 13 | JGI25161J50226_1000444 | 3300003374 | Bacteria | 19387 |
| 14 | JGI25161J50226_1001769 | 3300003374 | Bacteria | 6094 |
| 15 | Ga0055525_1000008 | 3300003759 | Bacteria | 604287 |
| 16 | Ga0055526_1001492 | 3300003771 | Bacteria | 16562 |
| 17 | Ga0055526_1006009 | 3300003771 | Bacteria | 6737 |
| 18 | Ga0055537_1001232 | 3300003773 | Bacteria | 10749 |
| 19 | Ga0055537_1013963 | 3300003773 | Bacteria | 1480 |
| 20 | Ga0055537_1044583 | 3300003773 | Bacteria | 522 |
| 21 | Ga0055537_1046777 | 3300003773 | Bacteria | 504 |
| 22 | Ga0055524_1000112 | 3300003775 | Bacteria | 95840 |
| 23 | Ga0055524_1000241 | 3300003775 | Bacteria | 57262 |
| 24 | Ga0055524_1000430 | 3300003775 | Bacteria | 35254 |
| 25 | Ga0055524_1001460 | 3300003775 | Bacteria | 13512 |
| 26 | Ga0055524_1003339 | 3300003775 | Bacteria | 7825 |
| 27 | Ga0055524_1005319 | 3300003775 | Bacteria | 5777 |
| 28 | Ga0055534_1002678 | 3300003784 | Bacteria | 6022 |
| 29 | Ga0055534_1021893 | 3300003784 | Bacteria | 1064 |
| 30 | Ga0055528_1042731 | 3300003790 | Bacteria | 995 |
| 31 | Ga0055528_1077201 | 3300003790 | Unclassified | 591 |
| 32 | Ga0055530_10000365 | 3300003791 | Bacteria | 41004 |
| 33 | Ga0055530_10002070 | 3300003791 | Bacteria | 13466 |
| 34 | Ga0055530_10005292 | 3300003791 | Bacteria | 6198 |
| 35 | Ga0055531_10001721 | 3300003794 | Bacteria | 15676 |
| 36 | Ga0055531_10063307 | 3300003794 | Bacteria | 890 |
| 37 | Ga0055543_1000231 | 3300004625 | Bacteria | 44323 |
| 38 | Ga0055543_1011867 | 3300004625 | Bacteria | 1768 |
| 39 | Ga0055543_1028851 | 3300004625 | Bacteria | 975 |
| 40 | Ga0065165_1000524 | 3300005262 | Bacteria | 58631 |
| 41 | Ga0065165_1001165 | 3300005262 | Bacteria | 30569 |
| 42 | Ga0065165_1002198 | 3300005262 | Bacteria | 17494 |
| 43 | Ga0065165_1023081 | 3300005262 | Bacteria | 2117 |
| 44 | Ga0065165_1128847 | 3300005262 | Bacteria | 607 |
| 45 | Ga0065714_10389072 | 3300005288 | Bacteria | 600 |
| 46 | Ga0070658_10133976 | 3300005327 | Bacteria | 2066 |
| 47 | Ga0070658_10203631 | 3300005327 | Bacteria | 1670 |
| 48 | Ga0070658_10216881 | 3300005327 | Bacteria | 1617 |
| 49 | Ga0070658_10475721 | 3300005327 | Bacteria | 1078 |
| 50 | Ga0070658_10603431 | 3300005327 | Bacteria | 951 |
| 51 | Ga0070680_100165357 | 3300005336 | Bacteria | 1860 |
| 52 | Ga0070660_100243467 | 3300005339 | Bacteria | 1465 |
| 53 | Ga0070660_100583750 | 3300005339 | Bacteria | 934 |
| 54 | Ga0070661_100097890 | 3300005344 | Bacteria | 2179 |
| 55 | Ga0070675_101509366 | 3300005354 | Bacteria | 620 |
| 56 | Ga0070659_100008805 | 3300005366 | Bacteria | 7393 |
| 57 | Ga0070659_100215526 | 3300005366 | Bacteria | 1583 |
| 58 | Ga0070659_100542820 | 3300005366 | Bacteria | 995 |
| 59 | Ga0068867_101987076 | 3300005459 | Bacteria | 549 |
| 60 | Ga0068855_100019577 | 3300005563 | Bacteria | 8129 |
| 61 | Ga0070664_100109699 | 3300005564 | Bacteria | 2407 |
| 62 | Ga0068856_100221826 | 3300005614 | Bacteria | 1906 |
| 63 | Ga0068862_102600123 | 3300005844 | Bacteria | 518 |
| 64 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 65 | Ga0105243_10288279 | 3300009148 | Bacteria | 1482 |
| 66 | Ga0105241_10051139 | 3300009174 | Bacteria | 3150 |
| 67 | Ga0105242_10320572 | 3300009176 | Bacteria | 1421 |
| 68 | Ga0105242_11415208 | 3300009176 | Bacteria | 723 |
| 69 | Ga0105238_10454555 | 3300009551 | Bacteria | 1278 |
| 70 | Ga0105239_10303242 | 3300010375 | Bacteria | 1799 |
| 71 | Ga0105239_11684646 | 3300010375 | Bacteria | 734 |
| 72 | Ga0105246_10393759 | 3300011119 | Bacteria | 1148 |
| 73 | Ga0157373_10425748 | 3300013100 | Bacteria | 953 |
| 74 | Ga0157378_12658677 | 3300013297 | Bacteria | 553 |
| 75 | Ga0157372_10924647 | 3300013307 | Bacteria | 1011 |
| 76 | Ga0157372_11024632 | 3300013307 | Bacteria | 956 |
| 77 | Ga0157372_11254955 | 3300013307 | Bacteria | 856 |
| 78 | Ga0182008_10000928 | 3300014497 | Bacteria | 20408 |
| 79 | Ga0182006_1000006 | 3300015261 | Bacteria | 555811 |
| 80 | Ga0182007_10000013 | 3300015262 | Bacteria | 231000 |
| 81 | Ga0182005_1000001 | 3300015265 | Bacteria | 1014869 |
| 82 | Ga0163161_10071036 | 3300017792 | Bacteria | 2546 |
| 83 | Ga0209436_100068 | 3300025208 | Bacteria | 53437 |
| 84 | Ga0209436_108578 | 3300025208 | Bacteria | 2022 |
| 85 | Ga0209436_112327 | 3300025208 | Bacteria | 1457 |
| 86 | Ga0209563_100003 | 3300025230 | Bacteria | 1932942 |
| 87 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 88 | Ga0207425_1000406 | 3300025245 | Bacteria | 29017 |
| 89 | Ga0207425_1008655 | 3300025245 | Bacteria | 2586 |
| 90 | Ga0209677_110147 | 3300025253 | Bacteria | 1600 |
| 91 | Ga0209148_1001390 | 3300025254 | Bacteria | 12483 |
| 92 | Ga0209129_1000003 | 3300025258 | Bacteria | 903689 |
| 93 | Ga0209129_1000629 | 3300025258 | Bacteria | 23556 |
| 94 | Ga0209129_1012331 | 3300025258 | Bacteria | 1968 |
| 95 | Ga0209565_1001956 | 3300025263 | Bacteria | 8076 |
| 96 | Ga0209565_1002640 | 3300025263 | Bacteria | 6309 |
| 97 | Ga0209565_1004025 | 3300025263 | Bacteria | 4578 |
| 98 | Ga0209565_1019464 | 3300025263 | Bacteria | 1450 |
| 99 | Ga0209565_1037685 | 3300025263 | Bacteria | 914 |
| 100 | Ga0209673_1054516 | 3300025273 | Unclassified | 1035 |
| 101 | Ga0209130_1000046 | 3300025284 | Bacteria | 236658 |
| 102 | Ga0209130_1000439 | 3300025284 | Bacteria | 44337 |
| 103 | Ga0209130_1014076 | 3300025284 | Bacteria | 2022 |
| 104 | Ga0209675_1003121 | 3300025291 | Bacteria | 8076 |
| 105 | Ga0209675_1008638 | 3300025291 | Bacteria | 3709 |
| 106 | Ga0209564_1000199 | 3300025295 | Bacteria | 138027 |
| 107 | Ga0209564_1003392 | 3300025295 | Bacteria | 10971 |
| 108 | Ga0209564_1012833 | 3300025295 | Bacteria | 3614 |
| 109 | Ga0209758_1000098 | 3300025297 | Bacteria | 230499 |
| 110 | Ga0209050_1000089 | 3300025298 | Bacteria | 256212 |
| 111 | Ga0209050_1000293 | 3300025298 | Bacteria | 106097 |
| 112 | Ga0209050_1002894 | 3300025298 | Bacteria | 13518 |
| 113 | Ga0209050_1033313 | 3300025298 | Bacteria | 1564 |
| 114 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 115 | Ga0209256_1000163 | 3300025299 | Bacteria | 136008 |
| 116 | Ga0209256_1000334 | 3300025299 | Bacteria | 78875 |
| 117 | Ga0209256_1003697 | 3300025299 | Bacteria | 10393 |
| 118 | Ga0207426_1008182 | 3300025302 | Bacteria | 4258 |
| 119 | Ga0207426_1029215 | 3300025302 | Bacteria | 1821 |
| 120 | Ga0207426_1046051 | 3300025302 | Bacteria | 1323 |
| 121 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 122 | Ga0209257_1002480 | 3300025304 | Bacteria | 18244 |
| 123 | Ga0207705_10003593 | 3300025909 | Bacteria | 11816 |
| 124 | Ga0207705_10254351 | 3300025909 | Bacteria | 1340 |
| 125 | Ga0207705_10513200 | 3300025909 | Bacteria | 931 |
| 126 | Ga0207705_10536186 | 3300025909 | Bacteria | 910 |
| 127 | Ga0207654_10018085 | 3300025911 | Bacteria | 3695 |
| 128 | Ga0207660_10289533 | 3300025917 | Bacteria | 1302 |
| 129 | Ga0207657_10078851 | 3300025919 | Bacteria | 2772 |
| 130 | Ga0207657_10079543 | 3300025919 | Bacteria | 2758 |
| 131 | Ga0207657_10204679 | 3300025919 | Bacteria | 1586 |
| 132 | Ga0207649_10548241 | 3300025920 | Bacteria | 884 |
| 133 | Ga0207694_10418137 | 3300025924 | Bacteria | 1116 |
| 134 | Ga0207659_11023002 | 3300025926 | Bacteria | 711 |
| 135 | Ga0207690_10548683 | 3300025932 | Bacteria | 939 |
| 136 | Ga0207690_10565467 | 3300025932 | Bacteria | 925 |
| 137 | Ga0207686_10166257 | 3300025934 | Bacteria | 1551 |
| 138 | Ga0207686_10592209 | 3300025934 | Bacteria | 872 |
| 139 | Ga0207709_10072707 | 3300025935 | Bacteria | 2188 |
| 140 | Ga0207679_10489915 | 3300025945 | Bacteria | 1096 |
| 141 | Ga0207679_10703591 | 3300025945 | Bacteria | 917 |
| 142 | Ga0207667_10079199 | 3300025949 | Bacteria | 3405 |
| 143 | Ga0207667_10160470 | 3300025949 | Bacteria | 2313 |
| 144 | Ga0207667_10749399 | 3300025949 | Bacteria | 976 |
| 145 | Ga0207702_10417861 | 3300026078 | Bacteria | 1296 |
| 146 | Ga0207648_11592376 | 3300026089 | Bacteria | 614 |
| 147 | Ga0207674_10236175 | 3300026116 | Bacteria | 1776 |
| 148 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 149 | Ga0316177_1132650 | 3300030731 | Bacteria | 531 |
| 150 | Ga0307408_100000123 | 3300031548 | Bacteria | 85710 |
| 151 | Ga0307408_100004417 | 3300031548 | Bacteria | 9546 |
| 152 | Ga0307408_100029542 | 3300031548 | Bacteria | 3799 |
| 153 | Ga0307408_100196188 | 3300031548 | Bacteria | 1630 |
| 154 | Ga0307416_100315420 | 3300032002 | Bacteria | 1562 |
| 155 | Ga0307414_10330545 | 3300032004 | Bacteria | 1301 |
| 156 | Ga0307411_10660145 | 3300032005 | Bacteria | 906 |
| 157 | Ga0373930_0143191 | 3300034816 | Bacteria | 595 |
| 158 | Ga0395899_0009955 | 3300037312 | Bacteria | 7291 |
| 159 | Ga0395899_0015351 | 3300037312 | Bacteria | 5837 |
| 160 | Ga0395899_0105701 | 3300037312 | Bacteria | 2027 |
| 161 | Ga0395899_0159133 | 3300037312 | Bacteria | 1597 |
| 162 | Ga0395899_0211673 | 3300037312 | Bacteria | 1347 |
| 163 | Ga0395899_0313513 | 3300037312 | Bacteria | 1058 |
| 164 | Ga0395899_0343439 | 3300037312 | Bacteria | 1000 |
| 165 | Ga0395899_0496487 | 3300037312 | Bacteria | 792 |
| 166 | Ga0395900_0002250 | 3300037418 | Bacteria | 21465 |
| 167 | Ga0395900_0015351 | 3300037418 | Bacteria | 7807 |
| 168 | Ga0395900_0025781 | 3300037418 | Bacteria | 6017 |
| 169 | Ga0395900_0105677 | 3300037418 | Bacteria | 2892 |
| 170 | Ga0395900_0125215 | 3300037418 | Bacteria | 2635 |
| 171 | Ga0395900_0320863 | 3300037418 | Bacteria | 1529 |
| 172 | Ga0395900_0516832 | 3300037418 | Bacteria | 1142 |
| 173 | Ga0395900_0571349 | 3300037418 | Bacteria | 1073 |
| 174 | Ga0395900_0614249 | 3300037418 | Bacteria | 1026 |
| 175 | Ga0395900_1108491 | 3300037418 | Bacteria | 709 |
| 176 | Ga0395900_1678200 | 3300037418 | Bacteria | 546 |
| 177 | Ga0395898_0012375 | 3300037466 | Bacteria | 8820 |
| 178 | Ga0395898_0093030 | 3300037466 | Bacteria | 2898 |
| 179 | Ga0395898_0295099 | 3300037466 | Bacteria | 1546 |
| 180 | Ga0395898_1065840 | 3300037466 | Bacteria | 742 |
| 181 | Ga0395898_1159007 | 3300037466 | Bacteria | 705 |
| 182 | Ga0395905_0046228 | 3300037471 | Bacteria | 4082 |
| 183 | Ga0395905_0064643 | 3300037471 | Bacteria | 3424 |
| 184 | Ga0395905_0064975 | 3300037471 | Bacteria | 3415 |
| 185 | Ga0395905_0069638 | 3300037471 | Bacteria | 3295 |
| 186 | Ga0395905_0085384 | 3300037471 | Bacteria | 2958 |
| 187 | Ga0395905_0234494 | 3300037471 | Bacteria | 1715 |
| 188 | Ga0395905_0483815 | 3300037471 | Bacteria | 1137 |
| 189 | Ga0395905_0614825 | 3300037471 | Bacteria | 988 |
| 190 | Ga0395905_0622813 | 3300037471 | Bacteria | 981 |
| 191 | Ga0395905_1226922 | 3300037471 | Bacteria | 653 |
| 192 | Ga0395905_1256655 | 3300037471 | Bacteria | 644 |
| 193 | Ga0395905_1506545 | 3300037471 | Bacteria | 577 |
| 194 | Ga0395901_0067361 | 3300038443 | Bacteria | 3728 |
| 195 | Ga0395901_0069009 | 3300038443 | Bacteria | 3681 |
| 196 | Ga0395901_0369829 | 3300038443 | Bacteria | 1477 |
| 197 | Ga0395901_0505784 | 3300038443 | Bacteria | 1229 |
| 198 | Ga0395901_0596182 | 3300038443 | Bacteria | 1114 |
| 199 | Ga0395901_0692724 | 3300038443 | Bacteria | 1017 |
| 200 | Ga0395901_0715651 | 3300038443 | Bacteria | 997 |
| 201 | Ga0395901_0751262 | 3300038443 | Bacteria | 968 |
| 202 | Ga0395901_1094931 | 3300038443 | Bacteria | 767 |
| 203 | Ga0395901_1355420 | 3300038443 | Bacteria | 671 |
| 204 | Ga0395901_1503843 | 3300038443 | Bacteria | 629 |
| 205 | Ga0439465_0013374 | 3300041413 | Bacteria | 2561 |
| 206 | Ga0439448_0007022 | 3300042005 | Bacteria | 3251 |
| 207 | Ga0439449_0020805 | 3300042007 | Bacteria | 2458 |
| 208 | Ga0439450_008858 | 3300042008 | Bacteria | 1891 |
| 209 | Ga0439450_059202 | 3300042008 | Bacteria | 923 |
| 210 | Ga0439455_0008577 | 3300042012 | Bacteria | 2194 |
| 211 | Ga0450904_002774 | 3300042139 | Bacteria | 2002 |
| 212 | Ga0450906_080459 | 3300042145 | Bacteria | 588 |
| 213 | Ga0439458_0011679 | 3300042157 | Bacteria | 1965 |
| 214 | Ga0439458_0032427 | 3300042157 | Bacteria | 1249 |
| 215 | Ga0439458_0078355 | 3300042157 | Bacteria | 841 |
| 216 | Ga0439458_0103878 | 3300042157 | Bacteria | 739 |
| 217 | Ga0450893_0096019 | 3300042532 | Bacteria | 600 |
| 218 | Ga0466969_0319789 | 3300044656 | Bacteria | 702 |
| 219 | Ga0466969_0549366 | 3300044656 | Bacteria | 528 |
| 220 | Ga0466972_0000549 | 3300044658 | Bacteria | 18404 |
| 221 | Ga0466972_0131866 | 3300044658 | Bacteria | 1177 |
| 222 | Ga0453683_0073893 | 3300044673 | Bacteria | 2134 |
| 223 | Ga0466965_0000621 | 3300044683 | Bacteria | 12951 |
| 224 | Ga0466965_0075058 | 3300044683 | Bacteria | 1704 |
| 225 | Ga0466965_0689312 | 3300044683 | Bacteria | 585 |
| 226 | Ga0466966_0012545 | 3300044684 | Bacteria | 5613 |
| 227 | Ga0466966_0034261 | 3300044684 | Bacteria | 3283 |
| 228 | Ga0466966_0036911 | 3300044684 | Bacteria | 3153 |
| 229 | Ga0466966_0067176 | 3300044684 | Bacteria | 2252 |
| 230 | Ga0466966_0139170 | 3300044684 | Bacteria | 1484 |
| 231 | Ga0466966_0171439 | 3300044684 | Bacteria | 1318 |
| 232 | Ga0466966_0362998 | 3300044684 | Bacteria | 870 |
| 233 | Ga0466966_0528990 | 3300044684 | Bacteria | 709 |
| 234 | Ga0466961_0042988 | 3300044693 | Bacteria | 2895 |
| 235 | Ga0466961_0329509 | 3300044693 | Bacteria | 930 |
| 236 | Ga0466961_0379287 | 3300044693 | Bacteria | 859 |
| 237 | Ga0466961_0401695 | 3300044693 | Bacteria | 832 |
| 238 | Ga0466961_0875005 | 3300044693 | Bacteria | 535 |
| 239 | Ga0466963_0081562 | 3300044694 | Bacteria | 2191 |
| 240 | Ga0466964_0001638 | 3300044706 | Bacteria | 7729 |
| 241 | Ga0466964_0270230 | 3300044706 | Bacteria | 846 |
| 242 | Ga0466964_0367343 | 3300044706 | Bacteria | 743 |
| 243 | Ga0466971_0458552 | 3300044719 | Bacteria | 626 |
| 244 | Ga0466968_0010867 | 3300044735 | Bacteria | 3537 |
| 245 | Ga0466968_0176250 | 3300044735 | Bacteria | 993 |
| 246 | Ga0466970_0048267 | 3300044765 | Bacteria | 2270 |
| 247 | Ga0466970_0152945 | 3300044765 | Bacteria | 1274 |
| 248 | Ga0466970_0200617 | 3300044765 | Bacteria | 1110 |
| 249 | Ga0466970_0635186 | 3300044765 | Bacteria | 621 |
| 250 | Ga0466970_0728260 | 3300044765 | Bacteria | 579 |
| 251 | Ga0466957_0000081 | 3300044842 | Bacteria | 38526 |
| 252 | Ga0466957_0014682 | 3300044842 | Bacteria | 4563 |
| 253 | Ga0466957_0155604 | 3300044842 | Bacteria | 1481 |
| 254 | Ga0466957_0828195 | 3300044842 | Bacteria | 658 |
| 255 | Ga0466960_0128844 | 3300044901 | Bacteria | 1333 |
| 256 | Ga0466960_0598429 | 3300044901 | Bacteria | 654 |
| 257 | Ga0466960_0678627 | 3300044901 | Bacteria | 617 |
| 258 | Ga0466959_0029643 | 3300045049 | Bacteria | 4054 |
| 259 | Ga0466959_0044919 | 3300045049 | Bacteria | 3254 |
| 260 | Ga0466959_0179720 | 3300045049 | Bacteria | 1480 |
| 261 | Ga0466959_0317495 | 3300045049 | Bacteria | 1065 |
| 262 | Ga0466959_0344590 | 3300045049 | Bacteria | 1016 |
| 263 | Ga0466959_0927794 | 3300045049 | Bacteria | 580 |
| 264 | Ga0466958_0321197 | 3300045836 | Bacteria | 995 |
| 265 | Ga0466958_0523941 | 3300045836 | Bacteria | 769 |
| 266 | Ga0466967_0004448 | 3300045976 | Bacteria | 9455 |
| 267 | Ga0466967_0124054 | 3300045976 | Bacteria | 2390 |
| 268 | Ga0466967_1934530 | 3300045976 | Bacteria | 586 |
| 269 | Ga0495617_000012 | 3300046452 | Bacteria | 295916 |
| 270 | Ga0495617_016820 | 3300046452 | Bacteria | 2473 |
| 271 | Ga0495617_021284 | 3300046452 | Bacteria | 2190 |
| 272 | Ga0495617_034355 | 3300046452 | Bacteria | 1702 |
| 273 | Ga0495627_000475 | 3300046453 | Bacteria | 33989 |
| 274 | Ga0495627_003935 | 3300046453 | Bacteria | 6352 |
| 275 | Ga0495627_062735 | 3300046453 | Bacteria | 1097 |
| 276 | Ga0495603_0032245 | 3300046455 | Bacteria | 3153 |
| 277 | Ga0495603_0178361 | 3300046455 | Bacteria | 1229 |
| 278 | Ga0495590_0000498 | 3300046457 | Bacteria | 19291 |
| 279 | Ga0495590_0001605 | 3300046457 | Bacteria | 9680 |
| 280 | Ga0495590_0010457 | 3300046457 | Bacteria | 3488 |
| 281 | Ga0495590_0069538 | 3300046457 | Bacteria | 1234 |
| 282 | Ga0495590_0095945 | 3300046457 | Bacteria | 1051 |
| 283 | Ga0495590_0368379 | 3300046457 | Bacteria | 548 |
| 284 | Ga0495591_008285 | 3300046458 | Bacteria | 4279 |
| 285 | Ga0495629_0004585 | 3300046459 | Bacteria | 10338 |
| 286 | Ga0495629_0011922 | 3300046459 | Bacteria | 6304 |
| 287 | Ga0495629_0724648 | 3300046459 | Bacteria | 659 |
| 288 | Ga0495638_0002150 | 3300046460 | Bacteria | 16540 |
| 289 | Ga0495638_0082402 | 3300046460 | Bacteria | 1951 |
| 290 | Ga0495638_0112346 | 3300046460 | Bacteria | 1617 |
| 291 | Ga0495638_0276680 | 3300046460 | Bacteria | 914 |
| 292 | Ga0495653_0067100 | 3300046463 | Bacteria | 2695 |
| 293 | Ga0495653_0109603 | 3300046463 | Bacteria | 1986 |
| 294 | Ga0495653_0131685 | 3300046463 | Bacteria | 1769 |
| 295 | Ga0495653_0155153 | 3300046463 | Bacteria | 1595 |
| 296 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 297 | Ga0495650_0016048 | 3300046471 | Bacteria | 3813 |
| 298 | Ga0495580_0054723 | 3300046472 | Bacteria | 2813 |
| 299 | Ga0495582_0041498 | 3300046473 | Bacteria | 2535 |
| 300 | Ga0495582_0073053 | 3300046473 | Bacteria | 1898 |
| 301 | Ga0495605_0000138 | 3300046474 | Bacteria | 94241 |
| 302 | Ga0495605_0000432 | 3300046474 | Bacteria | 37968 |
| 303 | Ga0495605_0001199 | 3300046474 | Bacteria | 17258 |
| 304 | Ga0495605_0012130 | 3300046474 | Bacteria | 4788 |
| 305 | Ga0495605_0028552 | 3300046474 | Bacteria | 2878 |
| 306 | Ga0495605_0395807 | 3300046474 | Bacteria | 575 |
| 307 | Ga0495584_0001597 | 3300046491 | Bacteria | 13375 |
| 308 | Ga0495584_0002301 | 3300046491 | Bacteria | 10898 |
| 309 | Ga0495584_0006033 | 3300046491 | Bacteria | 6383 |
| 310 | Ga0495584_0008438 | 3300046491 | Bacteria | 5338 |
| 311 | Ga0495584_0036393 | 3300046491 | Bacteria | 2487 |
| 312 | Ga0495584_0037484 | 3300046491 | Bacteria | 2450 |
| 313 | Ga0495584_0043548 | 3300046491 | Bacteria | 2265 |
| 314 | Ga0495584_0061006 | 3300046491 | Bacteria | 1895 |
| 315 | Ga0495584_0068051 | 3300046491 | Bacteria | 1789 |
| 316 | Ga0495585_0009363 | 3300046492 | Bacteria | 5877 |
| 317 | Ga0495585_0021076 | 3300046492 | Bacteria | 3743 |
| 318 | Ga0495585_0023784 | 3300046492 | Bacteria | 3515 |
| 319 | Ga0495585_0041219 | 3300046492 | Bacteria | 2589 |
| 320 | Ga0495585_0053894 | 3300046492 | Bacteria | 2225 |
| 321 | Ga0495585_0072488 | 3300046492 | Bacteria | 1876 |
| 322 | Ga0495585_0081578 | 3300046492 | Bacteria | 1752 |
| 323 | Ga0495585_0324373 | 3300046492 | Bacteria | 752 |
| 324 | Ga0495585_0410265 | 3300046492 | Bacteria | 651 |
| 325 | Ga0495585_0410267 | 3300046492 | Bacteria | 651 |
| 326 | Ga0495585_0526929 | 3300046492 | Bacteria | 559 |
| 327 | Ga0495594_0067953 | 3300046499 | Bacteria | 1978 |
| 328 | Ga0495594_0130298 | 3300046499 | Bacteria | 1424 |
| 329 | Ga0495594_0306338 | 3300046499 | Bacteria | 905 |
| 330 | Ga0495594_0482332 | 3300046499 | Bacteria | 704 |
| 331 | Ga0495594_0559967 | 3300046499 | Bacteria | 648 |
| 332 | Ga0495594_0572668 | 3300046499 | Bacteria | 640 |
| 333 | Ga0495594_0587536 | 3300046499 | Bacteria | 631 |
| 334 | Ga0495596_0005697 | 3300046500 | Bacteria | 5847 |
| 335 | Ga0495596_0006440 | 3300046500 | Bacteria | 5402 |
| 336 | Ga0495596_0015461 | 3300046500 | Bacteria | 3194 |
| 337 | Ga0495596_0038264 | 3300046500 | Bacteria | 1896 |
| 338 | Ga0495596_0044179 | 3300046500 | Bacteria | 1754 |
| 339 | Ga0495596_0092449 | 3300046500 | Bacteria | 1174 |
| 340 | Ga0495607_0002283 | 3300046501 | Bacteria | 15780 |
| 341 | Ga0495607_0002389 | 3300046501 | Bacteria | 15303 |
| 342 | Ga0495607_0004309 | 3300046501 | Bacteria | 10502 |
| 343 | Ga0495607_0008277 | 3300046501 | Bacteria | 7115 |
| 344 | Ga0495607_0008330 | 3300046501 | Bacteria | 7091 |
| 345 | Ga0495607_0008584 | 3300046501 | Bacteria | 6976 |
| 346 | Ga0495607_0032362 | 3300046501 | Bacteria | 3192 |
| 347 | Ga0495607_0036971 | 3300046501 | Bacteria | 2936 |
| 348 | Ga0495607_0057416 | 3300046501 | Bacteria | 2230 |
| 349 | Ga0495607_0064713 | 3300046501 | Bacteria | 2064 |
| 350 | Ga0495607_0070014 | 3300046501 | Bacteria | 1961 |
| 351 | Ga0495607_0078079 | 3300046501 | Bacteria | 1827 |
| 352 | Ga0495607_0080850 | 3300046501 | Bacteria | 1785 |
| 353 | Ga0495607_0200618 | 3300046501 | Bacteria | 987 |
| 354 | Ga0495607_0226698 | 3300046501 | Bacteria | 911 |
| 355 | Ga0495583_0000026 | 3300046506 | Bacteria | 256777 |
| 356 | Ga0495583_0000113 | 3300046506 | Bacteria | 136475 |
| 357 | Ga0495583_0004818 | 3300046506 | Bacteria | 9457 |
| 358 | Ga0495583_0008975 | 3300046506 | Bacteria | 6030 |
| 359 | Ga0495583_0026429 | 3300046506 | Bacteria | 2878 |
| 360 | Ga0495583_0143665 | 3300046506 | Bacteria | 992 |
| 361 | Ga0495606_0002776 | 3300046507 | Bacteria | 19592 |
| 362 | Ga0495606_0022152 | 3300046507 | Bacteria | 4638 |
| 363 | Ga0495606_0166156 | 3300046507 | Bacteria | 1284 |
| 364 | Ga0495606_0173188 | 3300046507 | Bacteria | 1250 |
| 365 | Ga0495606_0240537 | 3300046507 | Bacteria | 1010 |
| 366 | Ga0495606_0352223 | 3300046507 | Bacteria | 781 |
| 367 | Ga0495606_0394492 | 3300046507 | Bacteria | 722 |
| 368 | Ga0495606_0444586 | 3300046507 | Bacteria | 665 |
| 369 | Ga0495606_0467192 | 3300046507 | Bacteria | 643 |
| 370 | Ga0495606_0654141 | 3300046507 | Bacteria | 508 |
| 371 | Ga0495610_0241736 | 3300046512 | Bacteria | 719 |
| 372 | Ga0495616_0000037 | 3300046513 | Bacteria | 123624 |
| 373 | Ga0495616_0002017 | 3300046513 | Bacteria | 13661 |
| 374 | Ga0495616_0013490 | 3300046513 | Bacteria | 4608 |
| 375 | Ga0495616_0015525 | 3300046513 | Bacteria | 4233 |
| 376 | Ga0495616_0022187 | 3300046513 | Bacteria | 3429 |
| 377 | Ga0495616_0033261 | 3300046513 | Bacteria | 2688 |
| 378 | Ga0495616_0034392 | 3300046513 | Bacteria | 2632 |
| 379 | Ga0495616_0074992 | 3300046513 | Bacteria | 1628 |
| 380 | Ga0495616_0121975 | 3300046513 | Bacteria | 1202 |
| 381 | Ga0495616_0152537 | 3300046513 | Bacteria | 1044 |
| 382 | Ga0495630_0030210 | 3300046517 | Bacteria | 4030 |
| 383 | Ga0495631_0000856 | 3300046518 | Bacteria | 19204 |
| 384 | Ga0495631_0004211 | 3300046518 | Bacteria | 7693 |
| 385 | Ga0495631_0024273 | 3300046518 | Bacteria | 2799 |
| 386 | Ga0495631_0037819 | 3300046518 | Bacteria | 2148 |
| 387 | Ga0495631_0041802 | 3300046518 | Bacteria | 2027 |
| 388 | Ga0495631_0054934 | 3300046518 | Bacteria | 1735 |
| 389 | Ga0495631_0073170 | 3300046518 | Bacteria | 1480 |
| 390 | Ga0495631_0115868 | 3300046518 | Bacteria | 1152 |
| 391 | Ga0495631_0148847 | 3300046518 | Bacteria | 1004 |
| 392 | Ga0495631_0219104 | 3300046518 | Bacteria | 812 |
| 393 | Ga0495631_0302447 | 3300046518 | Bacteria | 680 |
| 394 | Ga0495631_0319674 | 3300046518 | Bacteria | 660 |
| 395 | Ga0495631_0362976 | 3300046518 | Bacteria | 616 |
| 396 | Ga0495632_0000018 | 3300046519 | Bacteria | 228282 |
| 397 | Ga0495632_0000988 | 3300046519 | Bacteria | 24808 |
| 398 | Ga0495632_0002964 | 3300046519 | Bacteria | 12438 |
| 399 | Ga0495632_0040968 | 3300046519 | Bacteria | 2329 |
| 400 | Ga0495632_0211667 | 3300046519 | Bacteria | 879 |
| 401 | Ga0495637_0026325 | 3300046520 | Bacteria | 2612 |
| 402 | Ga0495637_0229613 | 3300046520 | Bacteria | 673 |
| 403 | Ga0495643_0004390 | 3300046522 | Bacteria | 9879 |
| 404 | Ga0495643_0077916 | 3300046522 | Bacteria | 1731 |
| 405 | Ga0495643_0101622 | 3300046522 | Bacteria | 1473 |
| 406 | Ga0495643_0153784 | 3300046522 | Bacteria | 1137 |
| 407 | Ga0495643_0253921 | 3300046522 | Bacteria | 819 |
| 408 | Ga0495643_0285136 | 3300046522 | Bacteria | 758 |
| 409 | Ga0495643_0288118 | 3300046522 | Bacteria | 753 |
| 410 | Ga0495643_0430201 | 3300046522 | Bacteria | 577 |
| 411 | Ga0495644_0000829 | 3300046523 | Bacteria | 12768 |
| 412 | Ga0495644_0002102 | 3300046523 | Bacteria | 8009 |
| 413 | Ga0495644_0004671 | 3300046523 | Bacteria | 5380 |
| 414 | Ga0495644_0007037 | 3300046523 | Bacteria | 4352 |
| 415 | Ga0495644_0020842 | 3300046523 | Bacteria | 2500 |
| 416 | Ga0495644_0142204 | 3300046523 | Bacteria | 916 |
| 417 | Ga0495648_0000607 | 3300046524 | Bacteria | 38333 |
| 418 | Ga0495648_0002504 | 3300046524 | Bacteria | 16859 |
| 419 | Ga0495648_0006132 | 3300046524 | Bacteria | 9854 |
| 420 | Ga0495648_0006238 | 3300046524 | Bacteria | 9752 |
| 421 | Ga0495648_0011054 | 3300046524 | Bacteria | 6838 |
| 422 | Ga0495648_0017670 | 3300046524 | Bacteria | 5088 |
| 423 | Ga0495648_0038433 | 3300046524 | Bacteria | 3060 |
| 424 | Ga0495663_0002274 | 3300046525 | Bacteria | 5831 |
| 425 | Ga0495663_0004275 | 3300046525 | Bacteria | 4025 |
| 426 | Ga0495663_0050714 | 3300046525 | Bacteria | 1284 |
| 427 | Ga0495666_0009518 | 3300046526 | Bacteria | 4854 |
| 428 | Ga0495642_0000010 | 3300046528 | Bacteria | 136557 |
| 429 | Ga0495642_0000810 | 3300046528 | Bacteria | 15157 |
| 430 | Ga0495642_0007615 | 3300046528 | Bacteria | 4150 |
| 431 | Ga0495642_0008276 | 3300046528 | Bacteria | 3979 |
| 432 | Ga0495642_0018015 | 3300046528 | Bacteria | 2762 |
| 433 | Ga0495642_0045623 | 3300046528 | Bacteria | 1791 |
| 434 | Ga0495642_0059301 | 3300046528 | Bacteria | 1586 |
| 435 | Ga0495642_0078145 | 3300046528 | Archaea | 1391 |
| 436 | Ga0495642_0103565 | 3300046528 | Bacteria | 1213 |
| 437 | Ga0495642_0105842 | 3300046528 | Bacteria | 1200 |
| 438 | Ga0495642_0122104 | 3300046528 | Bacteria | 1118 |
| 439 | Ga0495642_0228107 | 3300046528 | Bacteria | 813 |
| 440 | Ga0495642_0439893 | 3300046528 | Bacteria | 576 |
| 441 | Ga0495652_0025910 | 3300046529 | Bacteria | 5181 |
| 442 | Ga0495654_0004534 | 3300046530 | Bacteria | 8222 |
| 443 | Ga0495654_0016780 | 3300046530 | Bacteria | 3860 |
| 444 | Ga0495654_0019071 | 3300046530 | Bacteria | 3589 |
| 445 | Ga0495654_0164804 | 3300046530 | Bacteria | 970 |
| 446 | Ga0495654_0346460 | 3300046530 | Bacteria | 598 |
| 447 | Ga0495654_0410524 | 3300046530 | Bacteria | 537 |
| 448 | Ga0495665_0021110 | 3300046531 | Bacteria | 3498 |
| 449 | Ga0495665_0190293 | 3300046531 | Bacteria | 1065 |
| 450 | Ga0495586_0002254 | 3300046535 | Bacteria | 10496 |
| 451 | Ga0495586_0102093 | 3300046535 | Bacteria | 1592 |
| 452 | Ga0495587_0039023 | 3300046536 | Bacteria | 2845 |
| 453 | Ga0495587_0048317 | 3300046536 | Bacteria | 2520 |
| 454 | Ga0495609_0000001 | 3300046538 | Bacteria | 1060094 |
| 455 | Ga0495609_0000142 | 3300046538 | Bacteria | 75002 |
| 456 | Ga0495609_0001633 | 3300046538 | Bacteria | 14622 |
| 457 | Ga0495609_0006249 | 3300046538 | Bacteria | 6113 |
| 458 | Ga0495609_0008994 | 3300046538 | Bacteria | 4856 |
| 459 | Ga0495609_0041688 | 3300046538 | Bacteria | 2062 |
| 460 | Ga0495609_0110941 | 3300046538 | Bacteria | 1184 |
| 461 | Ga0495609_0202904 | 3300046538 | Bacteria | 828 |
| 462 | Ga0495609_0328276 | 3300046538 | Bacteria | 619 |
| 463 | Ga0495609_0339717 | 3300046538 | Bacteria | 607 |
| 464 | Ga0495597_0000967 | 3300046542 | Bacteria | 22208 |
| 465 | Ga0495597_0001038 | 3300046542 | Bacteria | 21213 |
| 466 | Ga0495597_0001317 | 3300046542 | Bacteria | 18177 |
| 467 | Ga0495597_0002421 | 3300046542 | Bacteria | 11863 |
| 468 | Ga0495597_0007941 | 3300046542 | Bacteria | 5345 |
| 469 | Ga0495597_0009210 | 3300046542 | Bacteria | 4894 |
| 470 | Ga0495597_0037773 | 3300046542 | Bacteria | 2167 |
| 471 | Ga0495597_0084574 | 3300046542 | Bacteria | 1353 |
| 472 | Ga0495597_0222786 | 3300046542 | Bacteria | 748 |
| 473 | Ga0495645_0100590 | 3300046543 | Bacteria | 2056 |
| 474 | Ga0495622_0001153 | 3300046557 | Bacteria | 13764 |
| 475 | Ga0495622_0087447 | 3300046557 | Bacteria | 1433 |
| 476 | Ga0495622_0148965 | 3300046557 | Bacteria | 1059 |
| 477 | Ga0495622_0271177 | 3300046557 | Bacteria | 743 |
| 478 | Ga0495622_0516203 | 3300046557 | Bacteria | 510 |
| 479 | Ga0495633_0001497 | 3300046558 | Bacteria | 18105 |
| 480 | Ga0495633_0004609 | 3300046558 | Bacteria | 8687 |
| 481 | Ga0495633_0012049 | 3300046558 | Bacteria | 4618 |
| 482 | Ga0495633_0076253 | 3300046558 | Bacteria | 1561 |
| 483 | Ga0495633_0096639 | 3300046558 | Bacteria | 1372 |
| 484 | Ga0495633_0413804 | 3300046558 | Bacteria | 609 |
| 485 | Ga0495656_0003022 | 3300046615 | Bacteria | 5655 |
| 486 | Ga0495656_0030945 | 3300046615 | Bacteria | 2167 |
| 487 | Ga0495656_0031728 | 3300046615 | Bacteria | 2145 |
| 488 | Ga0495656_0134824 | 3300046615 | Bacteria | 1178 |
| 489 | Ga0495656_0371208 | 3300046615 | Bacteria | 744 |
| 490 | Ga0495656_0548249 | 3300046615 | Bacteria | 616 |
| 491 | Ga0495668_0000020 | 3300046616 | Bacteria | 411641 |
| 492 | Ga0495668_0000448 | 3300046616 | Bacteria | 52646 |
| 493 | Ga0495668_0001463 | 3300046616 | Bacteria | 22696 |
| 494 | Ga0495668_0005020 | 3300046616 | Bacteria | 9131 |
| 495 | Ga0495668_0005425 | 3300046616 | Bacteria | 8660 |
| 496 | Ga0495668_0005806 | 3300046616 | Bacteria | 8250 |
| 497 | Ga0495668_0006550 | 3300046616 | Bacteria | 7608 |
| 498 | Ga0495668_0017187 | 3300046616 | Bacteria | 4200 |
| 499 | Ga0495668_0074692 | 3300046616 | Bacteria | 1861 |
| 500 | Ga0495668_0100758 | 3300046616 | Bacteria | 1580 |
| 501 | Ga0495668_0374907 | 3300046616 | Bacteria | 781 |
| 502 | Ga0495634_0022245 | 3300046642 | Bacteria | 4468 |
| 503 | Ga0495611_0001473 | 3300046648 | Bacteria | 11705 |
| 504 | Ga0495611_0001872 | 3300046648 | Bacteria | 10030 |
| 505 | Ga0495611_0005286 | 3300046648 | Bacteria | 5531 |
| 506 | Ga0495611_0006146 | 3300046648 | Bacteria | 5125 |
| 507 | Ga0495611_0009096 | 3300046648 | Bacteria | 4199 |
| 508 | Ga0495611_0029287 | 3300046648 | Bacteria | 2414 |
| 509 | Ga0495611_0077310 | 3300046648 | Bacteria | 1526 |
| 510 | Ga0495625_0011387 | 3300046660 | Bacteria | 7258 |
| 511 | Ga0495625_0027230 | 3300046660 | Bacteria | 4307 |
| 512 | Ga0495625_0038201 | 3300046660 | Bacteria | 3516 |
| 513 | Ga0495625_0068427 | 3300046660 | Bacteria | 2496 |
| 514 | Ga0495625_0093025 | 3300046660 | Bacteria | 2082 |
| 515 | Ga0495625_0180046 | 3300046660 | Bacteria | 1406 |
| 516 | Ga0495625_0204448 | 3300046660 | Bacteria | 1301 |
| 517 | Ga0495625_0260969 | 3300046660 | Bacteria | 1121 |
| 518 | Ga0495625_0571826 | 3300046660 | Bacteria | 682 |
| 519 | Ga0495635_0002174 | 3300046663 | Bacteria | 13328 |
| 520 | Ga0495635_0082269 | 3300046663 | Bacteria | 2203 |
| 521 | Ga0495659_0000063 | 3300046664 | Bacteria | 47788 |
| 522 | Ga0495659_0000393 | 3300046664 | Bacteria | 16723 |
| 523 | Ga0495659_0001076 | 3300046664 | Bacteria | 9505 |
| 524 | Ga0495659_0209956 | 3300046664 | Bacteria | 801 |
| 525 | Ga0495661_0000082 | 3300046665 | Bacteria | 116600 |
| 526 | Ga0495661_0001642 | 3300046665 | Bacteria | 18233 |
| 527 | Ga0495661_0002755 | 3300046665 | Bacteria | 13352 |
| 528 | Ga0495661_0003022 | 3300046665 | Bacteria | 12676 |
| 529 | Ga0495661_0016241 | 3300046665 | Bacteria | 4941 |
| 530 | Ga0495661_0025167 | 3300046665 | Bacteria | 3847 |
| 531 | Ga0495661_0027959 | 3300046665 | Bacteria | 3617 |
| 532 | Ga0495661_0057045 | 3300046665 | Bacteria | 2333 |
| 533 | Ga0495661_0071242 | 3300046665 | Bacteria | 2031 |
| 534 | Ga0495661_0076159 | 3300046665 | Bacteria | 1947 |
| 535 | Ga0495661_0084795 | 3300046665 | Bacteria | 1817 |
| 536 | Ga0495661_0156149 | 3300046665 | Bacteria | 1228 |
| 537 | Ga0495661_0157339 | 3300046665 | Bacteria | 1222 |
| 538 | Ga0495661_0229486 | 3300046665 | Bacteria | 958 |
| 539 | Ga0495661_0264579 | 3300046665 | Bacteria | 872 |
| 540 | Ga0495661_0328305 | 3300046665 | Bacteria | 758 |
| 541 | Ga0495661_0340683 | 3300046665 | Bacteria | 740 |
| 542 | Ga0495661_0411445 | 3300046665 | Bacteria | 656 |
| 543 | Ga0495661_0461599 | 3300046665 | Bacteria | 610 |
| 544 | Ga0495588_0000041 | 3300046674 | Bacteria | 377896 |
| 545 | Ga0495588_0004219 | 3300046674 | Bacteria | 6335 |
| 546 | Ga0495588_0028007 | 3300046674 | Bacteria | 2818 |
| 547 | Ga0495588_0041796 | 3300046674 | Bacteria | 2342 |
| 548 | Ga0495588_0076350 | 3300046674 | Bacteria | 1746 |
| 549 | Ga0495588_0085442 | 3300046674 | Bacteria | 1649 |
| 550 | Ga0495588_0106419 | 3300046674 | Bacteria | 1476 |
| 551 | Ga0495588_0160522 | 3300046674 | Bacteria | 1189 |
| 552 | Ga0495588_0241992 | 3300046674 | Bacteria | 952 |
| 553 | Ga0495599_0664796 | 3300046678 | Bacteria | 603 |
| 554 | Ga0495623_0011300 | 3300046679 | Bacteria | 5777 |
| 555 | Ga0495623_0061097 | 3300046679 | Bacteria | 2363 |
| 556 | Ga0495646_0665339 | 3300046680 | Bacteria | 525 |
| 557 | Ga0495669_0000031 | 3300046684 | Bacteria | 101141 |
| 558 | Ga0495669_0001229 | 3300046684 | Bacteria | 10642 |
| 559 | Ga0495669_0006268 | 3300046684 | Bacteria | 4966 |
| 560 | Ga0495669_0013036 | 3300046684 | Bacteria | 3542 |
| 561 | Ga0495669_0045533 | 3300046684 | Bacteria | 1956 |
| 562 | Ga0495669_0091264 | 3300046684 | Bacteria | 1406 |
| 563 | Ga0495669_0281456 | 3300046684 | Bacteria | 800 |
| 564 | Ga0495613_0132005 | 3300046689 | Bacteria | 1788 |
| 565 | Ga0495670_0003564 | 3300046691 | Bacteria | 7648 |
| 566 | Ga0495670_0003870 | 3300046691 | Bacteria | 7352 |
| 567 | Ga0495670_0008414 | 3300046691 | Bacteria | 5072 |
| 568 | Ga0495670_0026071 | 3300046691 | Bacteria | 2893 |
| 569 | Ga0495670_0054327 | 3300046691 | Bacteria | 2006 |
| 570 | Ga0495670_0424501 | 3300046691 | Bacteria | 719 |
| 571 | Ga0495670_0626063 | 3300046691 | Bacteria | 586 |
| 572 | Ga0495670_0659027 | 3300046691 | Bacteria | 570 |
| 573 | Ga0495671_0000223 | 3300046692 | Bacteria | 49139 |
| 574 | Ga0495671_0003296 | 3300046692 | Bacteria | 9987 |
| 575 | Ga0495671_0010193 | 3300046692 | Bacteria | 5219 |
| 576 | Ga0495671_0015755 | 3300046692 | Bacteria | 4044 |
| 577 | Ga0495671_0472116 | 3300046692 | Bacteria | 599 |
| 578 | Ga0495649_0060080 | 3300046694 | Bacteria | 2045 |
| 579 | Ga0495649_0189040 | 3300046694 | Bacteria | 1072 |
| 580 | Ga0495649_0326374 | 3300046694 | Bacteria | 778 |
| 581 | Ga0495649_0437489 | 3300046694 | Bacteria | 654 |
| 582 | Ga0495649_0603228 | 3300046694 | Bacteria | 541 |
| 583 | Ga0495589_0000202 | 3300046794 | Bacteria | 51572 |
| 584 | Ga0495589_0000512 | 3300046794 | Bacteria | 27325 |
| 585 | Ga0495589_0000590 | 3300046794 | Bacteria | 24799 |
| 586 | Ga0495589_0005802 | 3300046794 | Bacteria | 6510 |
| 587 | Ga0495589_0010999 | 3300046794 | Bacteria | 4698 |
| 588 | Ga0495589_0128372 | 3300046794 | Bacteria | 1218 |
| 589 | Ga0495589_0202943 | 3300046794 | Bacteria | 935 |
| 590 | Ga0495589_0213781 | 3300046794 | Bacteria | 907 |
| 591 | Ga0495600_0109829 | 3300046809 | Bacteria | 1796 |
| 592 | Ga0495600_0128180 | 3300046809 | Bacteria | 1650 |
| 593 | Ga0495660_0000033 | 3300046810 | Bacteria | 212425 |
| 594 | Ga0495660_0001217 | 3300046810 | Bacteria | 17977 |
| 595 | Ga0495660_0009535 | 3300046810 | Bacteria | 5659 |
| 596 | Ga0495660_0010304 | 3300046810 | Bacteria | 5434 |
| 597 | Ga0495660_0020829 | 3300046810 | Bacteria | 3759 |
| 598 | Ga0495660_0046568 | 3300046810 | Bacteria | 2378 |
| 599 | Ga0495660_0057890 | 3300046810 | Bacteria | 2089 |
| 600 | Ga0495660_0082669 | 3300046810 | Bacteria | 1681 |
| 601 | Ga0495660_0158407 | 3300046810 | Bacteria | 1112 |
| 602 | Ga0495660_0202860 | 3300046810 | Bacteria | 946 |
| 603 | Ga0495581_0029044 | 3300047315 | Bacteria | 3206 |
| 604 | Ga0495604_0010708 | 3300047317 | Bacteria | 7279 |
| 605 | Ga0495604_0029427 | 3300047317 | Bacteria | 4369 |
| 606 | Ga0495636_0027483 | 3300047318 | Bacteria | 2317 |
| 607 | Ga0495636_0040418 | 3300047318 | Bacteria | 1933 |
| 608 | Ga0495636_0047445 | 3300047318 | Bacteria | 1793 |
| 609 | Ga0495636_0091011 | 3300047318 | Bacteria | 1324 |
| 610 | Ga0495636_0179473 | 3300047318 | Bacteria | 960 |
| 611 | Ga0495636_0190877 | 3300047318 | Bacteria | 932 |
| 612 | Ga0495674_0027730 | 3300047319 | Bacteria | 5171 |
| 613 | Ga0495672_0002906 | 3300047320 | Bacteria | 15161 |
| 614 | Ga0495672_0006037 | 3300047320 | Bacteria | 9465 |
| 615 | Ga0495672_0008060 | 3300047320 | Bacteria | 7833 |
| 616 | Ga0495672_0018120 | 3300047320 | Bacteria | 4687 |
| 617 | Ga0495672_0041145 | 3300047320 | Bacteria | 2797 |
| 618 | Ga0495672_0251836 | 3300047320 | Bacteria | 857 |
| 619 | Ga0495676_0000557 | 3300047321 | Bacteria | 30685 |
| 620 | Ga0495676_0108630 | 3300047321 | Bacteria | 2040 |
| 621 | Ga0495680_0002023 | 3300047322 | Bacteria | 21263 |
| 622 | Ga0495683_0012165 | 3300047323 | Bacteria | 4522 |
| 623 | Ga0495683_0015891 | 3300047323 | Bacteria | 3909 |
| 624 | Ga0495683_0033055 | 3300047323 | Bacteria | 2634 |
| 625 | Ga0495683_0055057 | 3300047323 | Bacteria | 1981 |
| 626 | Ga0495683_0185289 | 3300047323 | Bacteria | 948 |
| 627 | Ga0495683_0204142 | 3300047323 | Bacteria | 889 |
| 628 | Ga0495683_0233045 | 3300047323 | Bacteria | 815 |
| 629 | Ga0495687_000027 | 3300047443 | Bacteria | 299689 |
| 630 | Ga0495687_000873 | 3300047443 | Bacteria | 31989 |
| 631 | Ga0495687_001578 | 3300047443 | Bacteria | 20661 |
| 632 | Ga0495687_001652 | 3300047443 | Bacteria | 20053 |
| 633 | Ga0495687_125600 | 3300047443 | Bacteria | 918 |
| 634 | Ga0495687_141437 | 3300047443 | Bacteria | 836 |
| 635 | Ga0495687_210874 | 3300047443 | Bacteria | 608 |
| 636 | Ga0495675_0025189 | 3300047444 | Bacteria | 3793 |
| 637 | Ga0495675_0054323 | 3300047444 | Bacteria | 2542 |
| 638 | Ga0495675_0075347 | 3300047444 | Bacteria | 2127 |
| 639 | Ga0495677_0000001 | 3300047445 | Bacteria | 715000 |
| 640 | Ga0495677_0001227 | 3300047445 | Bacteria | 10276 |
| 641 | Ga0495677_0002166 | 3300047445 | Bacteria | 7775 |
| 642 | Ga0495677_0002826 | 3300047445 | Bacteria | 6766 |
| 643 | Ga0495677_0004714 | 3300047445 | Bacteria | 5199 |
| 644 | Ga0495677_0008424 | 3300047445 | Bacteria | 3828 |
| 645 | Ga0495677_0009451 | 3300047445 | Bacteria | 3601 |
| 646 | Ga0495677_0027443 | 3300047445 | Bacteria | 2066 |
| 647 | Ga0495677_0052856 | 3300047445 | Bacteria | 1497 |
| 648 | Ga0495677_0133649 | 3300047445 | Bacteria | 950 |
| 649 | Ga0495677_0302147 | 3300047445 | Bacteria | 629 |
| 650 | Ga0495679_008820 | 3300047446 | Bacteria | 4071 |
| 651 | Ga0495679_013635 | 3300047446 | Bacteria | 3040 |
| 652 | Ga0495679_015106 | 3300047446 | Bacteria | 2834 |
| 653 | Ga0495679_021968 | 3300047446 | Bacteria | 2192 |
| 654 | Ga0495685_000064 | 3300047447 | Bacteria | 40085 |
| 655 | Ga0495685_006568 | 3300047447 | Bacteria | 3815 |
| 656 | Ga0495685_017181 | 3300047447 | Bacteria | 2476 |
| 657 | Ga0495685_245879 | 3300047447 | Bacteria | 568 |
| 658 | Ga0495673_0001902 | 3300047469 | Bacteria | 15634 |
| 659 | Ga0495673_0268033 | 3300047469 | Bacteria | 619 |
| 660 | Ga0495681_0001529 | 3300047470 | Bacteria | 17264 |
| 661 | Ga0495681_0005675 | 3300047470 | Bacteria | 8310 |
| 662 | Ga0495681_0021213 | 3300047470 | Bacteria | 3504 |
| 663 | Ga0495681_0028278 | 3300047470 | Bacteria | 2887 |
| 664 | Ga0495681_0085901 | 3300047470 | Bacteria | 1396 |
| 665 | Ga0495681_0271662 | 3300047470 | Bacteria | 663 |
| 666 | Ga0495686_0001196 | 3300047472 | Bacteria | 30003 |
| 667 | Ga0495686_0028791 | 3300047472 | Bacteria | 3616 |
| 668 | Ga0495686_0174505 | 3300047472 | Bacteria | 1249 |
| 669 | Ga0495686_0196460 | 3300047472 | Bacteria | 1160 |
| 670 | Ga0495686_0406145 | 3300047472 | Bacteria | 730 |
| 671 | Ga0495593_0014985 | 3300047673 | Bacteria | 4401 |
| 672 | Ga0495593_0048083 | 3300047673 | Bacteria | 2267 |
| 673 | Ga0495602_0035851 | 3300048088 | Bacteria | 4622 |
| 674 | Ga0495614_0000545 | 3300048089 | Bacteria | 15602 |
| 675 | Ga0495614_0007999 | 3300048089 | Bacteria | 4699 |
| 676 | Ga0495614_0277988 | 3300048089 | Bacteria | 770 |
| 677 | Ga0495626_0000159 | 3300048091 | Bacteria | 83571 |
| 678 | Ga0495626_0001535 | 3300048091 | Bacteria | 18118 |
| 679 | Ga0495626_0010066 | 3300048091 | Bacteria | 5074 |
| 680 | Ga0495626_0011759 | 3300048091 | Bacteria | 4615 |
| 681 | Ga0495626_0033374 | 3300048091 | Bacteria | 2467 |
| 682 | Ga0495626_0059779 | 3300048091 | Bacteria | 1738 |
| 683 | Ga0495626_0115214 | 3300048091 | Bacteria | 1160 |
| 684 | Ga0495626_0136195 | 3300048091 | Bacteria | 1044 |
| 685 | Ga0495626_0251633 | 3300048091 | Bacteria | 708 |
| 686 | Ga0496100_0429566 | 3300048903 | Bacteria | 1010 |
| 687 | Ga0496100_0506678 | 3300048903 | Bacteria | 930 |
| 688 | Ga0496100_0590989 | 3300048903 | Bacteria | 861 |
| 689 | Ga0496101_0124556 | 3300048904 | Bacteria | 1952 |
| 690 | Ga0496101_0167862 | 3300048904 | Bacteria | 1685 |
| 691 | Ga0496101_0490652 | 3300048904 | Bacteria | 970 |
| 692 | Ga0496102_0000150 | 3300048905 | Bacteria | 94718 |
| 693 | Ga0496102_0000816 | 3300048905 | Bacteria | 30310 |
| 694 | Ga0496102_0092747 | 3300048905 | Bacteria | 2797 |
| 695 | Ga0496102_0165902 | 3300048905 | Bacteria | 2078 |
| 696 | Ga0496102_0168007 | 3300048905 | Bacteria | 2065 |
| 697 | Ga0496102_0754752 | 3300048905 | Bacteria | 896 |
| 698 | Ga0496103_0029187 | 3300048906 | Bacteria | 3351 |
| 699 | Ga0496103_0086436 | 3300048906 | Bacteria | 1976 |
| 700 | Ga0496103_0380291 | 3300048906 | Bacteria | 907 |
| 701 | Ga0496103_0469115 | 3300048906 | Bacteria | 807 |
| 702 | Ga0496103_0720547 | 3300048906 | Bacteria | 632 |
| 703 | Ga0496104_0299635 | 3300048907 | Bacteria | 1520 |
| 704 | Ga0496104_0713267 | 3300048907 | Bacteria | 911 |
| 705 | Ga0496105_0454230 | 3300048908 | Bacteria | 1011 |
| 706 | Ga0496105_0558584 | 3300048908 | Bacteria | 893 |
| 707 | Ga0496105_0849774 | 3300048908 | Bacteria | 691 |
| 708 | Ga0496106_0017435 | 3300048909 | Bacteria | 5313 |
| 709 | Ga0496107_0015847 | 3300048910 | Bacteria | 5288 |
| 710 | Ga0496107_0329398 | 3300048910 | Bacteria | 1136 |
| 711 | Ga0496107_0606913 | 3300048910 | Bacteria | 808 |
| 712 | Ga0496107_0803235 | 3300048910 | Bacteria | 689 |
| 713 | Ga0496107_1002236 | 3300048910 | Bacteria | 606 |
| 714 | Ga0496108_0163188 | 3300048911 | Bacteria | 1926 |
| 715 | Ga0496108_1680676 | 3300048911 | Bacteria | 523 |
| 716 | Ga0496109_0908616 | 3300048912 | Bacteria | 818 |
| 717 | Ga0496109_1610079 | 3300048912 | Bacteria | 584 |
| 718 | Ga0496110_0000036 | 3300048913 | Bacteria | 64802 |
| 719 | Ga0496110_0468673 | 3300048913 | Bacteria | 1148 |
| 720 | Ga0496110_0625138 | 3300048913 | Bacteria | 976 |
| 721 | Ga0496111_0049467 | 3300048914 | Bacteria | 3031 |
| 722 | Ga0496111_0540277 | 3300048914 | Bacteria | 856 |
| 723 | Ga0496111_0952526 | 3300048914 | Bacteria | 616 |
| 724 | Ga0496111_0977582 | 3300048914 | Bacteria | 607 |
| 725 | Ga0496112_0015901 | 3300048915 | Bacteria | 7033 |
| 726 | Ga0496112_1231337 | 3300048915 | Bacteria | 665 |
| 727 | Ga0496113_0009981 | 3300048916 | Bacteria | 6258 |
| 728 | Ga0496113_0082996 | 3300048916 | Bacteria | 2458 |
| 729 | Ga0496113_0958790 | 3300048916 | Bacteria | 675 |
| 730 | Ga0496114_0074048 | 3300048917 | Bacteria | 2867 |
| 731 | Ga0496115_0429508 | 3300048918 | Bacteria | 1069 |
| 732 | Ga0496115_0471420 | 3300048918 | Bacteria | 1012 |
| 733 | Ga0496116_0020670 | 3300048919 | Bacteria | 4992 |
| 734 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 735 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 736 | Ga0496119_0442628 | 3300048922 | Bacteria | 613 |
| 737 | Ga0496121_0000709 | 3300048924 | Bacteria | 61789 |
| 738 | Ga0496121_0053734 | 3300048924 | Bacteria | 3372 |
| 739 | Ga0496122_0000255 | 3300048925 | Bacteria | 120384 |
| 740 | Ga0496122_0000660 | 3300048925 | Bacteria | 69382 |
| 741 | Ga0496122_0006595 | 3300048925 | Bacteria | 13249 |
| 742 | Ga0496122_0014117 | 3300048925 | Bacteria | 7747 |
| 743 | Ga0496122_0278087 | 3300048925 | Bacteria | 917 |
| 744 | Ga0496123_0000936 | 3300048926 | Bacteria | 45579 |
| 745 | Ga0496123_0002832 | 3300048926 | Bacteria | 20510 |
| 746 | Ga0496123_0007467 | 3300048926 | Bacteria | 10280 |
| 747 | Ga0496123_0123759 | 3300048926 | Bacteria | 1448 |
| 748 | Ga0496123_0252167 | 3300048926 | Bacteria | 870 |
| 749 | Ga0496124_0013535 | 3300048927 | Bacteria | 7956 |
| 750 | Ga0496124_0067859 | 3300048927 | Bacteria | 2966 |
| 751 | Ga0496124_0100106 | 3300048927 | Bacteria | 2350 |
| 752 | Ga0496124_0532066 | 3300048927 | Bacteria | 780 |
| 753 | Ga0496124_0546748 | 3300048927 | Bacteria | 765 |
| 754 | Ga0496124_0675300 | 3300048927 | Bacteria | 659 |
| 755 | Ga0496125_0049086 | 3300048928 | Bacteria | 3511 |
| 756 | Ga0496125_0119039 | 3300048928 | Bacteria | 1889 |
| 757 | Ga0496125_0170718 | 3300048928 | Bacteria | 1462 |
| 758 | Ga0496125_0401794 | 3300048928 | Bacteria | 800 |
| 759 | Ga0496125_0433316 | 3300048928 | Bacteria | 758 |
| 760 | Ga0496125_0457406 | 3300048928 | Bacteria | 729 |
| 761 | Ga0496126_0870075 | 3300048929 | Bacteria | 686 |
| 762 | Ga0501308_000396 | 3300049128 | Bacteria | 2777 |
| 763 | Ga0501309_041317 | 3300049129 | Bacteria | 705 |
| 764 | Ga0495678_000396 | 3300049459 | Bacteria | 43995 |
| 765 | Ga0495678_000436 | 3300049459 | Bacteria | 41678 |
| 766 | Ga0495678_018442 | 3300049459 | Bacteria | 3137 |
| 767 | Ga0495678_032135 | 3300049459 | Bacteria | 2180 |
| 768 | Ga0495678_128130 | 3300049459 | Bacteria | 844 |
| 769 | Ga0495682_0000354 | 3300049460 | Bacteria | 33649 |
| 770 | Ga0495682_0001087 | 3300049460 | Bacteria | 15940 |
| 771 | Ga0495682_0006848 | 3300049460 | Bacteria | 4588 |
| 772 | Ga0495682_0014657 | 3300049460 | Bacteria | 2971 |
| 773 | Ga0495682_0155721 | 3300049460 | Bacteria | 814 |
| 774 | Ga0501034_0747747 | 3300049571 | Bacteria | 873 |
| 775 | Ga0501036_0845636 | 3300049572 | Bacteria | 752 |
| 776 | Ga0501047_0225511 | 3300049581 | Bacteria | 1729 |
| 777 | Ga0501227_010529 | 3300049665 | Bacteria | 2006 |
| 778 | Ga0501235_176935 | 3300049669 | Bacteria | 567 |
| 779 | Ga0501248_004688 | 3300049678 | Bacteria | 1045 |
| 780 | Ga0501279_000371 | 3300049775 | Bacteria | 5993 |
| 781 | Ga0501044_0514858 | 3300049823 | Bacteria | 1097 |
| 782 | Ga0466962_0030852 | 3300061719 | Bacteria | 2566 |
| 783 | Ga0466962_0166831 | 3300061719 | Bacteria | 1071 |
| 784 | Ga0466962_0245428 | 3300061719 | Bacteria | 879 |
| 785 | Ga0466962_0485485 | 3300061719 | Bacteria | 624 |
| 786 | Ga0466962_0610881 | 3300061719 | Bacteria | 556 |
| 787 | 2601668744 | 2600255292 | Bacteria | 6300551 |
| 788 | 2643791416 | 2643221554 | Bacteria | 6603920 |
| 789 | 2644212775 | 2643221638 | Bacteria | 6579467 |
| 790 | 2644354879 | 2643221664 | Bacteria | 7272945 |
| 791 | 2738737977 | 2738541280 | Bacteria | 6630198 |
| 792 | 2738842187 | 2738541300 | Bacteria | 6675882 |
| 793 | 2857551441 | 2857547612 | Bacteria | 6179999 |
| 794 | 2885082732 | 2885080285 | Bacteria | 6355622 |
| 795 | 2932414295 | 2932410948 | Bacteria | 6312192 |
| 796 | 2932416904 | 2932416698 | Bacteria | 6315112 |
| 797 | Ga0495642_0000352 | |||
| 798 | JGI25158J39367_1000579 | |||
| 799 | JGI25158J39367_1002308 | |||
| 800 | JGI25152J39213_1000071 | |||
| 801 | JGI25150J39212_1000674 | |||
| 802 | JGI25150J39212_1002059 | |||
| 803 | JGI25159J45721_1008136 | |||
| 804 | JGI25159J45721_1012506 | |||
| 805 | JGI25159J45721_1012543 | |||
| 806 | rootL2_10126347 | |||
| 807 | rootL2_10147025 | |||
| 808 | JGI25160J50197_1020158 | |||
| 809 | JGI25161J50226_1000444 | |||
| 810 | JGI25161J50226_1001769 | |||
| 811 | Ga0055525_1000008 | |||
| 812 | Ga0055526_1001492 | |||
| 813 | Ga0055526_1006009 | |||
| 814 | Ga0055537_1001232 | |||
| 815 | Ga0055537_1013963 | |||
| 816 | Ga0055537_1044583 | |||
| 817 | Ga0055537_1046777 | |||
| 818 | Ga0055524_1000112 | |||
| 819 | Ga0055524_1000241 | |||
| 820 | Ga0055524_1000430 | |||
| 821 | Ga0055524_1001460 | |||
| 822 | Ga0055524_1003339 | |||
| 823 | Ga0055524_1005319 | |||
| 824 | Ga0055534_1002678 | |||
| 825 | Ga0055534_1021893 | |||
| 826 | Ga0055528_1042731 | |||
| 827 | Ga0055528_1077201 | |||
| 828 | Ga0055530_10000365 | |||
| 829 | Ga0055530_10002070 | |||
| 830 | Ga0055530_10005292 | |||
| 831 | Ga0055531_10001721 | |||
| 832 | Ga0055531_10063307 | |||
| 833 | Ga0055543_1000231 | |||
| 834 | Ga0055543_1011867 | |||
| 835 | Ga0055543_1028851 | |||
| 836 | Ga0065165_1000524 | |||
| 837 | Ga0065165_1001165 | |||
| 838 | Ga0065165_1002198 | |||
| 839 | Ga0065165_1023081 | |||
| 840 | Ga0065165_1128847 | |||
| 841 | Ga0065714_10389072 | |||
| 842 | Ga0070658_10133976 | |||
| 843 | Ga0070658_10203631 | |||
| 844 | Ga0070658_10216881 | |||
| 845 | Ga0070658_10475721 | |||
| 846 | Ga0070658_10603431 | |||
| 847 | Ga0070680_100165357 | |||
| 848 | Ga0070660_100243467 | |||
| 849 | Ga0070660_100583750 | |||
| 850 | Ga0070661_100097890 | |||
| 851 | Ga0070675_101509366 | |||
| 852 | Ga0070659_100008805 | |||
| 853 | Ga0070659_100215526 | |||
| 854 | Ga0070659_100542820 | |||
| 855 | Ga0068867_101987076 | |||
| 856 | Ga0068855_100019577 | |||
| 857 | Ga0070664_100109699 | |||
| 858 | Ga0068856_100221826 | |||
| 859 | Ga0068862_102600123 | |||
| 860 | Ga0099826_10000001 | |||
| 861 | Ga0105243_10288279 | |||
| 862 | Ga0105241_10051139 | |||
| 863 | Ga0105242_10320572 | |||
| 864 | Ga0105242_11415208 | |||
| 865 | Ga0105238_10454555 | |||
| 866 | Ga0105239_10303242 | |||
| 867 | Ga0105239_11684646 | |||
| 868 | Ga0105246_10393759 | |||
| 869 | Ga0157373_10425748 | |||
| 870 | Ga0157378_12658677 | |||
| 871 | Ga0157372_10924647 | |||
| 872 | Ga0157372_11024632 | |||
| 873 | Ga0157372_11254955 | |||
| 874 | Ga0182008_10000928 | |||
| 875 | Ga0182006_1000006 | |||
| 876 | Ga0182007_10000013 | |||
| 877 | Ga0182005_1000001 | |||
| 878 | Ga0163161_10071036 | |||
| 879 | Ga0209436_100068 | |||
| 880 | Ga0209436_108578 | |||
| 881 | Ga0209436_112327 | |||
| 882 | Ga0209563_100003 | |||
| 883 | Ga0207425_1000001 | |||
| 884 | Ga0207425_1000406 | |||
| 885 | Ga0207425_1008655 | |||
| 886 | Ga0209677_110147 | |||
| 887 | Ga0209148_1001390 | |||
| 888 | Ga0209129_1000003 | |||
| 889 | Ga0209129_1000629 | |||
| 890 | Ga0209129_1012331 | |||
| 891 | Ga0209565_1001956 | |||
| 892 | Ga0209565_1002640 | |||
| 893 | Ga0209565_1004025 | |||
| 894 | Ga0209565_1019464 | |||
| 895 | Ga0209565_1037685 | |||
| 896 | Ga0209673_1054516 | |||
| 897 | Ga0209130_1000046 | |||
| 898 | Ga0209130_1000439 | |||
| 899 | Ga0209130_1014076 | |||
| 900 | Ga0209675_1003121 | |||
| 901 | Ga0209675_1008638 | |||
| 902 | Ga0209564_1000199 | |||
| 903 | Ga0209564_1003392 | |||
| 904 | Ga0209564_1012833 | |||
| 905 | Ga0209758_1000098 | |||
| 906 | Ga0209050_1000089 | |||
| 907 | Ga0209050_1000293 | |||
| 908 | Ga0209050_1002894 | |||
| 909 | Ga0209050_1033313 | |||
| 910 | Ga0209256_1000007 | |||
| 911 | Ga0209256_1000163 | |||
| 912 | Ga0209256_1000334 | |||
| 913 | Ga0209256_1003697 | |||
| 914 | Ga0207426_1008182 | |||
| 915 | Ga0207426_1029215 | |||
| 916 | Ga0207426_1046051 | |||
| 917 | Ga0209257_1000003 | |||
| 918 | Ga0209257_1002480 | |||
| 919 | Ga0207705_10003593 | |||
| 920 | Ga0207705_10254351 | |||
| 921 | Ga0207705_10513200 | |||
| 922 | Ga0207705_10536186 | |||
| 923 | Ga0207654_10018085 | |||
| 924 | Ga0207660_10289533 | |||
| 925 | Ga0207657_10078851 | |||
| 926 | Ga0207657_10079543 | |||
| 927 | Ga0207657_10204679 | |||
| 928 | Ga0207649_10548241 | |||
| 929 | Ga0207694_10418137 | |||
| 930 | Ga0207659_11023002 | |||
| 931 | Ga0207690_10548683 | |||
| 932 | Ga0207690_10565467 | |||
| 933 | Ga0207686_10166257 | |||
| 934 | Ga0207686_10592209 | |||
| 935 | Ga0207709_10072707 | |||
| 936 | Ga0207679_10489915 | |||
| 937 | Ga0207679_10703591 | |||
| 938 | Ga0207667_10079199 | |||
| 939 | Ga0207667_10160470 | |||
| 940 | Ga0207667_10749399 | |||
| 941 | Ga0207702_10417861 | |||
| 942 | Ga0207648_11592376 | |||
| 943 | Ga0207674_10236175 | |||
| 944 | Ga0209282_1000001 | |||
| 945 | Ga0316177_1132650 | |||
| 946 | Ga0307408_100000123 | |||
| 947 | Ga0307408_100004417 | |||
| 948 | Ga0307408_100029542 | |||
| 949 | Ga0307408_100196188 | |||
| 950 | Ga0307416_100315420 | |||
| 951 | Ga0307414_10330545 | |||
| 952 | Ga0307411_10660145 | |||
| 953 | Ga0373930_0143191 | |||
| 954 | Ga0395899_0009955 | |||
| 955 | Ga0395899_0015351 | |||
| 956 | Ga0395899_0105701 | |||
| 957 | Ga0395899_0159133 | |||
| 958 | Ga0395899_0211673 | |||
| 959 | Ga0395899_0313513 | |||
| 960 | Ga0395899_0343439 | |||
| 961 | Ga0395899_0496487 | |||
| 962 | Ga0395900_0002250 | |||
| 963 | Ga0395900_0015351 | |||
| 964 | Ga0395900_0025781 | |||
| 965 | Ga0395900_0105677 | |||
| 966 | Ga0395900_0125215 | |||
| 967 | Ga0395900_0320863 | |||
| 968 | Ga0395900_0516832 | |||
| 969 | Ga0395900_0571349 | |||
| 970 | Ga0395900_0614249 | |||
| 971 | Ga0395900_1108491 | |||
| 972 | Ga0395900_1678200 | |||
| 973 | Ga0395898_0012375 | |||
| 974 | Ga0395898_0093030 | |||
| 975 | Ga0395898_0295099 | |||
| 976 | Ga0395898_1065840 | |||
| 977 | Ga0395898_1159007 | |||
| 978 | Ga0395905_0046228 | |||
| 979 | Ga0395905_0064643 | |||
| 980 | Ga0395905_0064975 | |||
| 981 | Ga0395905_0069638 | |||
| 982 | Ga0395905_0085384 | |||
| 983 | Ga0395905_0234494 | |||
| 984 | Ga0395905_0483815 | |||
| 985 | Ga0395905_0614825 | |||
| 986 | Ga0395905_0622813 | |||
| 987 | Ga0395905_1226922 | |||
| 988 | Ga0395905_1256655 | |||
| 989 | Ga0395905_1506545 | |||
| 990 | Ga0395901_0067361 | |||
| 991 | Ga0395901_0069009 | |||
| 992 | Ga0395901_0369829 | |||
| 993 | Ga0395901_0505784 | |||
| 994 | Ga0395901_0596182 | |||
| 995 | Ga0395901_0692724 | |||
| 996 | Ga0395901_0715651 | |||
| 997 | Ga0395901_0751262 | |||
| 998 | Ga0395901_1094931 | |||
| 999 | Ga0395901_1355420 | |||
| 1000 | Ga0395901_1503843 | |||
| 1001 | Ga0439465_0013374 | |||
| 1002 | Ga0439448_0007022 | |||
| 1003 | Ga0439449_0020805 | |||
| 1004 | Ga0439450_008858 | |||
| 1005 | Ga0439450_059202 | |||
| 1006 | Ga0439455_0008577 | |||
| 1007 | Ga0450904_002774 | |||
| 1008 | Ga0450906_080459 | |||
| 1009 | Ga0439458_0011679 | |||
| 1010 | Ga0439458_0032427 | |||
| 1011 | Ga0439458_0078355 | |||
| 1012 | Ga0439458_0103878 | |||
| 1013 | Ga0450893_0096019 | |||
| 1014 | Ga0466969_0319789 | |||
| 1015 | Ga0466969_0549366 | |||
| 1016 | Ga0466972_0000549 | |||
| 1017 | Ga0466972_0131866 | |||
| 1018 | Ga0453683_0073893 | |||
| 1019 | Ga0466965_0000621 | |||
| 1020 | Ga0466965_0075058 | |||
| 1021 | Ga0466965_0689312 | |||
| 1022 | Ga0466966_0012545 | |||
| 1023 | Ga0466966_0034261 | |||
| 1024 | Ga0466966_0036911 | |||
| 1025 | Ga0466966_0067176 | |||
| 1026 | Ga0466966_0139170 | |||
| 1027 | Ga0466966_0171439 | |||
| 1028 | Ga0466966_0362998 | |||
| 1029 | Ga0466966_0528990 | |||
| 1030 | Ga0466961_0042988 | |||
| 1031 | Ga0466961_0329509 | |||
| 1032 | Ga0466961_0379287 | |||
| 1033 | Ga0466961_0401695 | |||
| 1034 | Ga0466961_0875005 | |||
| 1035 | Ga0466963_0081562 | |||
| 1036 | Ga0466964_0001638 | |||
| 1037 | Ga0466964_0270230 | |||
| 1038 | Ga0466964_0367343 | |||
| 1039 | Ga0466971_0458552 | |||
| 1040 | Ga0466968_0010867 | |||
| 1041 | Ga0466968_0176250 | |||
| 1042 | Ga0466970_0048267 | |||
| 1043 | Ga0466970_0152945 | |||
| 1044 | Ga0466970_0200617 | |||
| 1045 | Ga0466970_0635186 | |||
| 1046 | Ga0466970_0728260 | |||
| 1047 | Ga0466957_0000081 | |||
| 1048 | Ga0466957_0014682 | |||
| 1049 | Ga0466957_0155604 | |||
| 1050 | Ga0466957_0828195 | |||
| 1051 | Ga0466960_0128844 | |||
| 1052 | Ga0466960_0598429 | |||
| 1053 | Ga0466960_0678627 | |||
| 1054 | Ga0466959_0029643 | |||
| 1055 | Ga0466959_0044919 | |||
| 1056 | Ga0466959_0179720 | |||
| 1057 | Ga0466959_0317495 | |||
| 1058 | Ga0466959_0344590 | |||
| 1059 | Ga0466959_0927794 | |||
| 1060 | Ga0466958_0321197 | |||
| 1061 | Ga0466958_0523941 | |||
| 1062 | Ga0466967_0004448 | |||
| 1063 | Ga0466967_0124054 | |||
| 1064 | Ga0466967_1934530 | |||
| 1065 | Ga0495617_000012 | |||
| 1066 | Ga0495617_016820 | |||
| 1067 | Ga0495617_021284 | |||
| 1068 | Ga0495617_034355 | |||
| 1069 | Ga0495627_000475 | |||
| 1070 | Ga0495627_003935 | |||
| 1071 | Ga0495627_062735 | |||
| 1072 | Ga0495603_0032245 | |||
| 1073 | Ga0495603_0178361 | |||
| 1074 | Ga0495590_0000498 | |||
| 1075 | Ga0495590_0001605 | |||
| 1076 | Ga0495590_0010457 | |||
| 1077 | Ga0495590_0069538 | |||
| 1078 | Ga0495590_0095945 | |||
| 1079 | Ga0495590_0368379 | |||
| 1080 | Ga0495591_008285 | |||
| 1081 | Ga0495629_0004585 | |||
| 1082 | Ga0495629_0011922 | |||
| 1083 | Ga0495629_0724648 | |||
| 1084 | Ga0495638_0002150 | |||
| 1085 | Ga0495638_0082402 | |||
| 1086 | Ga0495638_0112346 | |||
| 1087 | Ga0495638_0276680 | |||
| 1088 | Ga0495653_0067100 | |||
| 1089 | Ga0495653_0109603 | |||
| 1090 | Ga0495653_0131685 | |||
| 1091 | Ga0495653_0155153 | |||
| 1092 | Ga0495650_0000001 | |||
| 1093 | Ga0495650_0016048 | |||
| 1094 | Ga0495580_0054723 | |||
| 1095 | Ga0495582_0041498 | |||
| 1096 | Ga0495582_0073053 | |||
| 1097 | Ga0495605_0000138 | |||
| 1098 | Ga0495605_0000432 | |||
| 1099 | Ga0495605_0001199 | |||
| 1100 | Ga0495605_0012130 | |||
| 1101 | Ga0495605_0028552 | |||
| 1102 | Ga0495605_0395807 | |||
| 1103 | Ga0495584_0001597 | |||
| 1104 | Ga0495584_0002301 | |||
| 1105 | Ga0495584_0006033 | |||
| 1106 | Ga0495584_0008438 | |||
| 1107 | Ga0495584_0036393 | |||
| 1108 | Ga0495584_0037484 | |||
| 1109 | Ga0495584_0043548 | |||
| 1110 | Ga0495584_0061006 | |||
| 1111 | Ga0495584_0068051 | |||
| 1112 | Ga0495585_0009363 | |||
| 1113 | Ga0495585_0021076 | |||
| 1114 | Ga0495585_0023784 | |||
| 1115 | Ga0495585_0041219 | |||
| 1116 | Ga0495585_0053894 | |||
| 1117 | Ga0495585_0072488 | |||
| 1118 | Ga0495585_0081578 | |||
| 1119 | Ga0495585_0324373 | |||
| 1120 | Ga0495585_0410265 | |||
| 1121 | Ga0495585_0410267 | |||
| 1122 | Ga0495585_0526929 | |||
| 1123 | Ga0495594_0067953 | |||
| 1124 | Ga0495594_0130298 | |||
| 1125 | Ga0495594_0306338 | |||
| 1126 | Ga0495594_0482332 | |||
| 1127 | Ga0495594_0559967 | |||
| 1128 | Ga0495594_0572668 | |||
| 1129 | Ga0495594_0587536 | |||
| 1130 | Ga0495596_0005697 | |||
| 1131 | Ga0495596_0006440 | |||
| 1132 | Ga0495596_0015461 | |||
| 1133 | Ga0495596_0038264 | |||
| 1134 | Ga0495596_0044179 | |||
| 1135 | Ga0495596_0092449 | |||
| 1136 | Ga0495607_0002283 | |||
| 1137 | Ga0495607_0002389 | |||
| 1138 | Ga0495607_0004309 | |||
| 1139 | Ga0495607_0008277 | |||
| 1140 | Ga0495607_0008330 | |||
| 1141 | Ga0495607_0008584 | |||
| 1142 | Ga0495607_0032362 | |||
| 1143 | Ga0495607_0036971 | |||
| 1144 | Ga0495607_0057416 | |||
| 1145 | Ga0495607_0064713 | |||
| 1146 | Ga0495607_0070014 | |||
| 1147 | Ga0495607_0078079 | |||
| 1148 | Ga0495607_0080850 | |||
| 1149 | Ga0495607_0200618 | |||
| 1150 | Ga0495607_0226698 | |||
| 1151 | Ga0495583_0000026 | |||
| 1152 | Ga0495583_0000113 | |||
| 1153 | Ga0495583_0004818 | |||
| 1154 | Ga0495583_0008975 | |||
| 1155 | Ga0495583_0026429 | |||
| 1156 | Ga0495583_0143665 | |||
| 1157 | Ga0495606_0002776 | |||
| 1158 | Ga0495606_0022152 | |||
| 1159 | Ga0495606_0166156 | |||
| 1160 | Ga0495606_0173188 | |||
| 1161 | Ga0495606_0240537 | |||
| 1162 | Ga0495606_0352223 | |||
| 1163 | Ga0495606_0394492 | |||
| 1164 | Ga0495606_0444586 | |||
| 1165 | Ga0495606_0467192 | |||
| 1166 | Ga0495606_0654141 | |||
| 1167 | Ga0495610_0241736 | |||
| 1168 | Ga0495616_0000037 | |||
| 1169 | Ga0495616_0002017 | |||
| 1170 | Ga0495616_0013490 | |||
| 1171 | Ga0495616_0015525 | |||
| 1172 | Ga0495616_0022187 | |||
| 1173 | Ga0495616_0033261 | |||
| 1174 | Ga0495616_0034392 | |||
| 1175 | Ga0495616_0074992 | |||
| 1176 | Ga0495616_0121975 | |||
| 1177 | Ga0495616_0152537 | |||
| 1178 | Ga0495630_0030210 | |||
| 1179 | Ga0495631_0000856 | |||
| 1180 | Ga0495631_0004211 | |||
| 1181 | Ga0495631_0024273 | |||
| 1182 | Ga0495631_0037819 | |||
| 1183 | Ga0495631_0041802 | |||
| 1184 | Ga0495631_0054934 | |||
| 1185 | Ga0495631_0073170 | |||
| 1186 | Ga0495631_0115868 | |||
| 1187 | Ga0495631_0148847 | |||
| 1188 | Ga0495631_0219104 | |||
| 1189 | Ga0495631_0302447 | |||
| 1190 | Ga0495631_0319674 | |||
| 1191 | Ga0495631_0362976 | |||
| 1192 | Ga0495632_0000018 | |||
| 1193 | Ga0495632_0000988 | |||
| 1194 | Ga0495632_0002964 | |||
| 1195 | Ga0495632_0040968 | |||
| 1196 | Ga0495632_0211667 | |||
| 1197 | Ga0495637_0026325 | |||
| 1198 | Ga0495637_0229613 | |||
| 1199 | Ga0495643_0004390 | |||
| 1200 | Ga0495643_0077916 | |||
| 1201 | Ga0495643_0101622 | |||
| 1202 | Ga0495643_0153784 | |||
| 1203 | Ga0495643_0253921 | |||
| 1204 | Ga0495643_0285136 | |||
| 1205 | Ga0495643_0288118 | |||
| 1206 | Ga0495643_0430201 | |||
| 1207 | Ga0495644_0000829 | |||
| 1208 | Ga0495644_0002102 | |||
| 1209 | Ga0495644_0004671 | |||
| 1210 | Ga0495644_0007037 | |||
| 1211 | Ga0495644_0020842 | |||
| 1212 | Ga0495644_0142204 | |||
| 1213 | Ga0495648_0000607 | |||
| 1214 | Ga0495648_0002504 | |||
| 1215 | Ga0495648_0006132 | |||
| 1216 | Ga0495648_0006238 | |||
| 1217 | Ga0495648_0011054 | |||
| 1218 | Ga0495648_0017670 | |||
| 1219 | Ga0495648_0038433 | |||
| 1220 | Ga0495663_0002274 | |||
| 1221 | Ga0495663_0004275 | |||
| 1222 | Ga0495663_0050714 | |||
| 1223 | Ga0495666_0009518 | |||
| 1224 | Ga0495642_0000010 | |||
| 1225 | Ga0495642_0000810 | |||
| 1226 | Ga0495642_0007615 | |||
| 1227 | Ga0495642_0008276 | |||
| 1228 | Ga0495642_0018015 | |||
| 1229 | Ga0495642_0045623 | |||
| 1230 | Ga0495642_0059301 | |||
| 1231 | Ga0495642_0078145 | |||
| 1232 | Ga0495642_0103565 | |||
| 1233 | Ga0495642_0105842 | |||
| 1234 | Ga0495642_0122104 | |||
| 1235 | Ga0495642_0228107 | |||
| 1236 | Ga0495642_0439893 | |||
| 1237 | Ga0495652_0025910 | |||
| 1238 | Ga0495654_0004534 | |||
| 1239 | Ga0495654_0016780 | |||
| 1240 | Ga0495654_0019071 | |||
| 1241 | Ga0495654_0164804 | |||
| 1242 | Ga0495654_0346460 | |||
| 1243 | Ga0495654_0410524 | |||
| 1244 | Ga0495665_0021110 | |||
| 1245 | Ga0495665_0190293 | |||
| 1246 | Ga0495586_0002254 | |||
| 1247 | Ga0495586_0102093 | |||
| 1248 | Ga0495587_0039023 | |||
| 1249 | Ga0495587_0048317 | |||
| 1250 | Ga0495609_0000001 | |||
| 1251 | Ga0495609_0000142 | |||
| 1252 | Ga0495609_0001633 | |||
| 1253 | Ga0495609_0006249 | |||
| 1254 | Ga0495609_0008994 | |||
| 1255 | Ga0495609_0041688 | |||
| 1256 | Ga0495609_0110941 | |||
| 1257 | Ga0495609_0202904 | |||
| 1258 | Ga0495609_0328276 | |||
| 1259 | Ga0495609_0339717 | |||
| 1260 | Ga0495597_0000967 | |||
| 1261 | Ga0495597_0001038 | |||
| 1262 | Ga0495597_0001317 | |||
| 1263 | Ga0495597_0002421 | |||
| 1264 | Ga0495597_0007941 | |||
| 1265 | Ga0495597_0009210 | |||
| 1266 | Ga0495597_0037773 | |||
| 1267 | Ga0495597_0084574 | |||
| 1268 | Ga0495597_0222786 | |||
| 1269 | Ga0495645_0100590 | |||
| 1270 | Ga0495622_0001153 | |||
| 1271 | Ga0495622_0087447 | |||
| 1272 | Ga0495622_0148965 | |||
| 1273 | Ga0495622_0271177 | |||
| 1274 | Ga0495622_0516203 | |||
| 1275 | Ga0495633_0001497 | |||
| 1276 | Ga0495633_0004609 | |||
| 1277 | Ga0495633_0012049 | |||
| 1278 | Ga0495633_0076253 | |||
| 1279 | Ga0495633_0096639 | |||
| 1280 | Ga0495633_0413804 | |||
| 1281 | Ga0495656_0003022 | |||
| 1282 | Ga0495656_0030945 | |||
| 1283 | Ga0495656_0031728 | |||
| 1284 | Ga0495656_0134824 | |||
| 1285 | Ga0495656_0371208 | |||
| 1286 | Ga0495656_0548249 | |||
| 1287 | Ga0495668_0000020 | |||
| 1288 | Ga0495668_0000448 | |||
| 1289 | Ga0495668_0001463 | |||
| 1290 | Ga0495668_0005020 | |||
| 1291 | Ga0495668_0005425 | |||
| 1292 | Ga0495668_0005806 | |||
| 1293 | Ga0495668_0006550 | |||
| 1294 | Ga0495668_0017187 | |||
| 1295 | Ga0495668_0074692 | |||
| 1296 | Ga0495668_0100758 | |||
| 1297 | Ga0495668_0374907 | |||
| 1298 | Ga0495634_0022245 | |||
| 1299 | Ga0495611_0001473 | |||
| 1300 | Ga0495611_0001872 | |||
| 1301 | Ga0495611_0005286 | |||
| 1302 | Ga0495611_0006146 | |||
| 1303 | Ga0495611_0009096 | |||
| 1304 | Ga0495611_0029287 | |||
| 1305 | Ga0495611_0077310 | |||
| 1306 | Ga0495625_0011387 | |||
| 1307 | Ga0495625_0027230 | |||
| 1308 | Ga0495625_0038201 | |||
| 1309 | Ga0495625_0068427 | |||
| 1310 | Ga0495625_0093025 | |||
| 1311 | Ga0495625_0180046 | |||
| 1312 | Ga0495625_0204448 | |||
| 1313 | Ga0495625_0260969 | |||
| 1314 | Ga0495625_0571826 | |||
| 1315 | Ga0495635_0002174 | |||
| 1316 | Ga0495635_0082269 | |||
| 1317 | Ga0495659_0000063 | |||
| 1318 | Ga0495659_0000393 | |||
| 1319 | Ga0495659_0001076 | |||
| 1320 | Ga0495659_0209956 | |||
| 1321 | Ga0495661_0000082 | |||
| 1322 | Ga0495661_0001642 | |||
| 1323 | Ga0495661_0002755 | |||
| 1324 | Ga0495661_0003022 | |||
| 1325 | Ga0495661_0016241 | |||
| 1326 | Ga0495661_0025167 | |||
| 1327 | Ga0495661_0027959 | |||
| 1328 | Ga0495661_0057045 | |||
| 1329 | Ga0495661_0071242 | |||
| 1330 | Ga0495661_0076159 | |||
| 1331 | Ga0495661_0084795 | |||
| 1332 | Ga0495661_0156149 | |||
| 1333 | Ga0495661_0157339 | |||
| 1334 | Ga0495661_0229486 | |||
| 1335 | Ga0495661_0264579 | |||
| 1336 | Ga0495661_0328305 | |||
| 1337 | Ga0495661_0340683 | |||
| 1338 | Ga0495661_0411445 | |||
| 1339 | Ga0495661_0461599 | |||
| 1340 | Ga0495588_0000041 | |||
| 1341 | Ga0495588_0004219 | |||
| 1342 | Ga0495588_0028007 | |||
| 1343 | Ga0495588_0041796 | |||
| 1344 | Ga0495588_0076350 | |||
| 1345 | Ga0495588_0085442 | |||
| 1346 | Ga0495588_0106419 | |||
| 1347 | Ga0495588_0160522 | |||
| 1348 | Ga0495588_0241992 | |||
| 1349 | Ga0495599_0664796 | |||
| 1350 | Ga0495623_0011300 | |||
| 1351 | Ga0495623_0061097 | |||
| 1352 | Ga0495646_0665339 | |||
| 1353 | Ga0495669_0000031 | |||
| 1354 | Ga0495669_0001229 | |||
| 1355 | Ga0495669_0006268 | |||
| 1356 | Ga0495669_0013036 | |||
| 1357 | Ga0495669_0045533 | |||
| 1358 | Ga0495669_0091264 | |||
| 1359 | Ga0495669_0281456 | |||
| 1360 | Ga0495613_0132005 | |||
| 1361 | Ga0495670_0003564 | |||
| 1362 | Ga0495670_0003870 | |||
| 1363 | Ga0495670_0008414 | |||
| 1364 | Ga0495670_0026071 | |||
| 1365 | Ga0495670_0054327 | |||
| 1366 | Ga0495670_0424501 | |||
| 1367 | Ga0495670_0626063 | |||
| 1368 | Ga0495670_0659027 | |||
| 1369 | Ga0495671_0000223 | |||
| 1370 | Ga0495671_0003296 | |||
| 1371 | Ga0495671_0010193 | |||
| 1372 | Ga0495671_0015755 | |||
| 1373 | Ga0495671_0472116 | |||
| 1374 | Ga0495649_0060080 | |||
| 1375 | Ga0495649_0189040 | |||
| 1376 | Ga0495649_0326374 | |||
| 1377 | Ga0495649_0437489 | |||
| 1378 | Ga0495649_0603228 | |||
| 1379 | Ga0495589_0000202 | |||
| 1380 | Ga0495589_0000512 | |||
| 1381 | Ga0495589_0000590 | |||
| 1382 | Ga0495589_0005802 | |||
| 1383 | Ga0495589_0010999 | |||
| 1384 | Ga0495589_0128372 | |||
| 1385 | Ga0495589_0202943 | |||
| 1386 | Ga0495589_0213781 | |||
| 1387 | Ga0495600_0109829 | |||
| 1388 | Ga0495600_0128180 | |||
| 1389 | Ga0495660_0000033 | |||
| 1390 | Ga0495660_0001217 | |||
| 1391 | Ga0495660_0009535 | |||
| 1392 | Ga0495660_0010304 | |||
| 1393 | Ga0495660_0020829 | |||
| 1394 | Ga0495660_0046568 | |||
| 1395 | Ga0495660_0057890 | |||
| 1396 | Ga0495660_0082669 | |||
| 1397 | Ga0495660_0158407 | |||
| 1398 | Ga0495660_0202860 | |||
| 1399 | Ga0495581_0029044 | |||
| 1400 | Ga0495604_0010708 | |||
| 1401 | Ga0495604_0029427 | |||
| 1402 | Ga0495636_0027483 | |||
| 1403 | Ga0495636_0040418 | |||
| 1404 | Ga0495636_0047445 | |||
| 1405 | Ga0495636_0091011 | |||
| 1406 | Ga0495636_0179473 | |||
| 1407 | Ga0495636_0190877 | |||
| 1408 | Ga0495674_0027730 | |||
| 1409 | Ga0495672_0002906 | |||
| 1410 | Ga0495672_0006037 | |||
| 1411 | Ga0495672_0008060 | |||
| 1412 | Ga0495672_0018120 | |||
| 1413 | Ga0495672_0041145 | |||
| 1414 | Ga0495672_0251836 | |||
| 1415 | Ga0495676_0000557 | |||
| 1416 | Ga0495676_0108630 | |||
| 1417 | Ga0495680_0002023 | |||
| 1418 | Ga0495683_0012165 | |||
| 1419 | Ga0495683_0015891 | |||
| 1420 | Ga0495683_0033055 | |||
| 1421 | Ga0495683_0055057 | |||
| 1422 | Ga0495683_0185289 | |||
| 1423 | Ga0495683_0204142 | |||
| 1424 | Ga0495683_0233045 | |||
| 1425 | Ga0495687_000027 | |||
| 1426 | Ga0495687_000873 | |||
| 1427 | Ga0495687_001578 | |||
| 1428 | Ga0495687_001652 | |||
| 1429 | Ga0495687_125600 | |||
| 1430 | Ga0495687_141437 | |||
| 1431 | Ga0495687_210874 | |||
| 1432 | Ga0495675_0025189 | |||
| 1433 | Ga0495675_0054323 | |||
| 1434 | Ga0495675_0075347 | |||
| 1435 | Ga0495677_0000001 | |||
| 1436 | Ga0495677_0001227 | |||
| 1437 | Ga0495677_0002166 | |||
| 1438 | Ga0495677_0002826 | |||
| 1439 | Ga0495677_0004714 | |||
| 1440 | Ga0495677_0008424 | |||
| 1441 | Ga0495677_0009451 | |||
| 1442 | Ga0495677_0027443 | |||
| 1443 | Ga0495677_0052856 | |||
| 1444 | Ga0495677_0133649 | |||
| 1445 | Ga0495677_0302147 | |||
| 1446 | Ga0495679_008820 | |||
| 1447 | Ga0495679_013635 | |||
| 1448 | Ga0495679_015106 | |||
| 1449 | Ga0495679_021968 | |||
| 1450 | Ga0495685_000064 | |||
| 1451 | Ga0495685_006568 | |||
| 1452 | Ga0495685_017181 | |||
| 1453 | Ga0495685_245879 | |||
| 1454 | Ga0495673_0001902 | |||
| 1455 | Ga0495673_0268033 | |||
| 1456 | Ga0495681_0001529 | |||
| 1457 | Ga0495681_0005675 | |||
| 1458 | Ga0495681_0021213 | |||
| 1459 | Ga0495681_0028278 | |||
| 1460 | Ga0495681_0085901 | |||
| 1461 | Ga0495681_0271662 | |||
| 1462 | Ga0495686_0001196 | |||
| 1463 | Ga0495686_0028791 | |||
| 1464 | Ga0495686_0174505 | |||
| 1465 | Ga0495686_0196460 | |||
| 1466 | Ga0495686_0406145 | |||
| 1467 | Ga0495593_0014985 | |||
| 1468 | Ga0495593_0048083 | |||
| 1469 | Ga0495602_0035851 | |||
| 1470 | Ga0495614_0000545 | |||
| 1471 | Ga0495614_0007999 | |||
| 1472 | Ga0495614_0277988 | |||
| 1473 | Ga0495626_0000159 | |||
| 1474 | Ga0495626_0001535 | |||
| 1475 | Ga0495626_0010066 | |||
| 1476 | Ga0495626_0011759 | |||
| 1477 | Ga0495626_0033374 | |||
| 1478 | Ga0495626_0059779 | |||
| 1479 | Ga0495626_0115214 | |||
| 1480 | Ga0495626_0136195 | |||
| 1481 | Ga0495626_0251633 | |||
| 1482 | Ga0496100_0429566 | |||
| 1483 | Ga0496100_0506678 | |||
| 1484 | Ga0496100_0590989 | |||
| 1485 | Ga0496101_0124556 | |||
| 1486 | Ga0496101_0167862 | |||
| 1487 | Ga0496101_0490652 | |||
| 1488 | Ga0496102_0000150 | |||
| 1489 | Ga0496102_0000816 | |||
| 1490 | Ga0496102_0092747 | |||
| 1491 | Ga0496102_0165902 | |||
| 1492 | Ga0496102_0168007 | |||
| 1493 | Ga0496102_0754752 | |||
| 1494 | Ga0496103_0029187 | |||
| 1495 | Ga0496103_0086436 | |||
| 1496 | Ga0496103_0380291 | |||
| 1497 | Ga0496103_0469115 | |||
| 1498 | Ga0496103_0720547 | |||
| 1499 | Ga0496104_0299635 | |||
| 1500 | Ga0496104_0713267 | |||
| 1501 | Ga0496105_0454230 | |||
| 1502 | Ga0496105_0558584 | |||
| 1503 | Ga0496105_0849774 | |||
| 1504 | Ga0496106_0017435 | |||
| 1505 | Ga0496107_0015847 | |||
| 1506 | Ga0496107_0329398 | |||
| 1507 | Ga0496107_0606913 | |||
| 1508 | Ga0496107_0803235 | |||
| 1509 | Ga0496107_1002236 | |||
| 1510 | Ga0496108_0163188 | |||
| 1511 | Ga0496108_1680676 | |||
| 1512 | Ga0496109_0908616 | |||
| 1513 | Ga0496109_1610079 | |||
| 1514 | Ga0496110_0000036 | |||
| 1515 | Ga0496110_0468673 | |||
| 1516 | Ga0496110_0625138 | |||
| 1517 | Ga0496111_0049467 | |||
| 1518 | Ga0496111_0540277 | |||
| 1519 | Ga0496111_0952526 | |||
| 1520 | Ga0496111_0977582 | |||
| 1521 | Ga0496112_0015901 | |||
| 1522 | Ga0496112_1231337 | |||
| 1523 | Ga0496113_0009981 | |||
| 1524 | Ga0496113_0082996 | |||
| 1525 | Ga0496113_0958790 | |||
| 1526 | Ga0496114_0074048 | |||
| 1527 | Ga0496115_0429508 | |||
| 1528 | Ga0496115_0471420 | |||
| 1529 | Ga0496116_0020670 | |||
| 1530 | Ga0496117_0000001 | |||
| 1531 | Ga0496118_0000002 | |||
| 1532 | Ga0496119_0442628 | |||
| 1533 | Ga0496121_0000709 | |||
| 1534 | Ga0496121_0053734 | |||
| 1535 | Ga0496122_0000255 | |||
| 1536 | Ga0496122_0000660 | |||
| 1537 | Ga0496122_0006595 | |||
| 1538 | Ga0496122_0014117 | |||
| 1539 | Ga0496122_0278087 | |||
| 1540 | Ga0496123_0000936 | |||
| 1541 | Ga0496123_0002832 | |||
| 1542 | Ga0496123_0007467 | |||
| 1543 | Ga0496123_0123759 | |||
| 1544 | Ga0496123_0252167 | |||
| 1545 | Ga0496124_0013535 | |||
| 1546 | Ga0496124_0067859 | |||
| 1547 | Ga0496124_0100106 | |||
| 1548 | Ga0496124_0532066 | |||
| 1549 | Ga0496124_0546748 | |||
| 1550 | Ga0496124_0675300 | |||
| 1551 | Ga0496125_0049086 | |||
| 1552 | Ga0496125_0119039 | |||
| 1553 | Ga0496125_0170718 | |||
| 1554 | Ga0496125_0401794 | |||
| 1555 | Ga0496125_0433316 | |||
| 1556 | Ga0496125_0457406 | |||
| 1557 | Ga0496126_0870075 | |||
| 1558 | Ga0501308_000396 | |||
| 1559 | Ga0501309_041317 | |||
| 1560 | Ga0495678_000396 | |||
| 1561 | Ga0495678_000436 | |||
| 1562 | Ga0495678_018442 | |||
| 1563 | Ga0495678_032135 | |||
| 1564 | Ga0495678_128130 | |||
| 1565 | Ga0495682_0000354 | |||
| 1566 | Ga0495682_0001087 | |||
| 1567 | Ga0495682_0006848 | |||
| 1568 | Ga0495682_0014657 | |||
| 1569 | Ga0495682_0155721 | |||
| 1570 | Ga0501034_0747747 | |||
| 1571 | Ga0501036_0845636 | |||
| 1572 | Ga0501047_0225511 | |||
| 1573 | Ga0501227_010529 | |||
| 1574 | Ga0501235_176935 | |||
| 1575 | Ga0501248_004688 | |||
| 1576 | Ga0501279_000371 | |||
| 1577 | Ga0501044_0514858 | |||
| 1578 | Ga0466962_0030852 | |||
| 1579 | Ga0466962_0166831 | |||
| 1580 | Ga0466962_0245428 | |||
| 1581 | Ga0466962_0485485 | |||
| 1582 | Ga0466962_0610881 | |||
| 1583 | 2601668744 | |||
| 1584 | 2643791416 | |||
| 1585 | 2644212775 | |||
| 1586 | 2644354879 | |||
| 1587 | 2738737977 | |||
| 1588 | 2738842187 | |||
| 1589 | 2857551441 | |||
| 1590 | 2885082732 | |||
| 1591 | 2932414295 | |||
| 1592 | 2932416904 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mdb-assembly2.cif.gz_B | crystal structure of the ternary complex of full length centaurin alpha-1, kif13b fha domain, and ip4 | 0.8414 | 55 | 78 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8365 | 4 | 84 |
| 5djo-assembly1.cif.gz_A | crystal structure of the cc1-fha tandem of kinesin-3 kif13a | 0.8346 | 54 | 77 |
| 6jbz-assembly1.cif.gz_D | structural analysis of molybdopterin synthases from two mycobacteria pathogens | 0.8202 | 1 | 84 |
| 1jwb-assembly1.cif.gz_D-2 | structure of the covalent acyl-adenylate form of the moeb-moad protein complex | 0.8179 | 4 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8798 | 3 | 84 | 3.10.20.30 |
| af_P30748_1_81_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8599 | 3 | 84 | 3.10.20.30 |
| af_D3ZM20_384_492_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8563 | 54 | 78 | 2.60.200.20 |
| af_Q9VN82_366_475_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8523 | 56 | 77 | 2.60.200.20 |
| af_F1RCT7_451_562_2.60.200.20 | Mainly Beta;Sandwich;Tumour Suppressor Smad4; | 0.8461 | 54 | 78 | 2.60.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4U1E9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.988 | 1 | 84 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A4R5W6M9-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9877 | 1 | 84 |
GO:0000166
GO:0006777 GO:1990133 |
| AF-A0A840RNX6-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9866 | 1 | 84 |
|
| AF-A0A839VF36-F1-model_v4 | Molybdopterin synthase sulfur carrier subunit | 0.9843 | 1 | 84 |
|
| AF-A0A658R4Q9-F1-model_v4 | Molybdopterin converting factor subunit 1 | 0.9828 | 1 | 84 |
|