F481206

General Info

Members Datasets Scaffolds Average Seq Length
796 242 1592 85

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0000352|Ga0495642_0000352_18617_18898
Length 93
Sequence LRFYSTDFMKINLRFFASVREAVGTSNETVDLPEDVATVGAVRAFLIARGGAWAEALGQERALRMAFDHVMCAPETPVREGGEVAFFPPVTGG

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
55 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
58 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
78 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
91 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
92 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
93 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
94 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
95 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
96 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
97 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
98 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
115 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
128 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
134 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
162 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
188 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
217 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
228 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
229 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
230 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
233 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
234 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
235 2643221638 Duganella sp. Root336D2 Isolate Unclassified
236 2643221664 Massilia sp. Root418 Isolate Unclassified
237 2738541280 Massilia sp. GV090 Isolate Unclassified
238 2738541300 Massilia sp. GV016 Isolate Unclassified
239 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
240 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
241 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
242 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.49
Metatranscriptomes 0.25
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.18
Nodule 0.25
Rhizoplane 6.03
Rhizosphere 78.89
Stem 0
Stem Tuber 0
Unclassified 0.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0000352 3300046528 Bacteria 24904
2 JGI25158J39367_1000579 3300002739 Bacteria 7293
3 JGI25158J39367_1002308 3300002739 Bacteria 3136
4 JGI25152J39213_1000071 3300002773 Bacteria 66888
5 JGI25150J39212_1000674 3300002774 Bacteria 12515
6 JGI25150J39212_1002059 3300002774 Bacteria 5226
7 JGI25159J45721_1008136 3300002987 Bacteria 2914
8 JGI25159J45721_1012506 3300002987 Bacteria 2022
9 JGI25159J45721_1012543 3300002987 Bacteria 2016
10 rootL2_10126347 3300003322 Bacteria 2318
11 rootL2_10147025 3300003322 Bacteria 1224
12 JGI25160J50197_1020158 3300003354 Bacteria 2022
13 JGI25161J50226_1000444 3300003374 Bacteria 19387
14 JGI25161J50226_1001769 3300003374 Bacteria 6094
15 Ga0055525_1000008 3300003759 Bacteria 604287
16 Ga0055526_1001492 3300003771 Bacteria 16562
17 Ga0055526_1006009 3300003771 Bacteria 6737
18 Ga0055537_1001232 3300003773 Bacteria 10749
19 Ga0055537_1013963 3300003773 Bacteria 1480
20 Ga0055537_1044583 3300003773 Bacteria 522
21 Ga0055537_1046777 3300003773 Bacteria 504
22 Ga0055524_1000112 3300003775 Bacteria 95840
23 Ga0055524_1000241 3300003775 Bacteria 57262
24 Ga0055524_1000430 3300003775 Bacteria 35254
25 Ga0055524_1001460 3300003775 Bacteria 13512
26 Ga0055524_1003339 3300003775 Bacteria 7825
27 Ga0055524_1005319 3300003775 Bacteria 5777
28 Ga0055534_1002678 3300003784 Bacteria 6022
29 Ga0055534_1021893 3300003784 Bacteria 1064
30 Ga0055528_1042731 3300003790 Bacteria 995
31 Ga0055528_1077201 3300003790 Unclassified 591
32 Ga0055530_10000365 3300003791 Bacteria 41004
33 Ga0055530_10002070 3300003791 Bacteria 13466
34 Ga0055530_10005292 3300003791 Bacteria 6198
35 Ga0055531_10001721 3300003794 Bacteria 15676
36 Ga0055531_10063307 3300003794 Bacteria 890
37 Ga0055543_1000231 3300004625 Bacteria 44323
38 Ga0055543_1011867 3300004625 Bacteria 1768
39 Ga0055543_1028851 3300004625 Bacteria 975
40 Ga0065165_1000524 3300005262 Bacteria 58631
41 Ga0065165_1001165 3300005262 Bacteria 30569
42 Ga0065165_1002198 3300005262 Bacteria 17494
43 Ga0065165_1023081 3300005262 Bacteria 2117
44 Ga0065165_1128847 3300005262 Bacteria 607
45 Ga0065714_10389072 3300005288 Bacteria 600
46 Ga0070658_10133976 3300005327 Bacteria 2066
47 Ga0070658_10203631 3300005327 Bacteria 1670
48 Ga0070658_10216881 3300005327 Bacteria 1617
49 Ga0070658_10475721 3300005327 Bacteria 1078
50 Ga0070658_10603431 3300005327 Bacteria 951
51 Ga0070680_100165357 3300005336 Bacteria 1860
52 Ga0070660_100243467 3300005339 Bacteria 1465
53 Ga0070660_100583750 3300005339 Bacteria 934
54 Ga0070661_100097890 3300005344 Bacteria 2179
55 Ga0070675_101509366 3300005354 Bacteria 620
56 Ga0070659_100008805 3300005366 Bacteria 7393
57 Ga0070659_100215526 3300005366 Bacteria 1583
58 Ga0070659_100542820 3300005366 Bacteria 995
59 Ga0068867_101987076 3300005459 Bacteria 549
60 Ga0068855_100019577 3300005563 Bacteria 8129
61 Ga0070664_100109699 3300005564 Bacteria 2407
62 Ga0068856_100221826 3300005614 Bacteria 1906
63 Ga0068862_102600123 3300005844 Bacteria 518
64 Ga0099826_10000001 3300006948 Bacteria 1155201
65 Ga0105243_10288279 3300009148 Bacteria 1482
66 Ga0105241_10051139 3300009174 Bacteria 3150
67 Ga0105242_10320572 3300009176 Bacteria 1421
68 Ga0105242_11415208 3300009176 Bacteria 723
69 Ga0105238_10454555 3300009551 Bacteria 1278
70 Ga0105239_10303242 3300010375 Bacteria 1799
71 Ga0105239_11684646 3300010375 Bacteria 734
72 Ga0105246_10393759 3300011119 Bacteria 1148
73 Ga0157373_10425748 3300013100 Bacteria 953
74 Ga0157378_12658677 3300013297 Bacteria 553
75 Ga0157372_10924647 3300013307 Bacteria 1011
76 Ga0157372_11024632 3300013307 Bacteria 956
77 Ga0157372_11254955 3300013307 Bacteria 856
78 Ga0182008_10000928 3300014497 Bacteria 20408
79 Ga0182006_1000006 3300015261 Bacteria 555811
80 Ga0182007_10000013 3300015262 Bacteria 231000
81 Ga0182005_1000001 3300015265 Bacteria 1014869
82 Ga0163161_10071036 3300017792 Bacteria 2546
83 Ga0209436_100068 3300025208 Bacteria 53437
84 Ga0209436_108578 3300025208 Bacteria 2022
85 Ga0209436_112327 3300025208 Bacteria 1457
86 Ga0209563_100003 3300025230 Bacteria 1932942
87 Ga0207425_1000001 3300025245 Bacteria 2525432
88 Ga0207425_1000406 3300025245 Bacteria 29017
89 Ga0207425_1008655 3300025245 Bacteria 2586
90 Ga0209677_110147 3300025253 Bacteria 1600
91 Ga0209148_1001390 3300025254 Bacteria 12483
92 Ga0209129_1000003 3300025258 Bacteria 903689
93 Ga0209129_1000629 3300025258 Bacteria 23556
94 Ga0209129_1012331 3300025258 Bacteria 1968
95 Ga0209565_1001956 3300025263 Bacteria 8076
96 Ga0209565_1002640 3300025263 Bacteria 6309
97 Ga0209565_1004025 3300025263 Bacteria 4578
98 Ga0209565_1019464 3300025263 Bacteria 1450
99 Ga0209565_1037685 3300025263 Bacteria 914
100 Ga0209673_1054516 3300025273 Unclassified 1035
101 Ga0209130_1000046 3300025284 Bacteria 236658
102 Ga0209130_1000439 3300025284 Bacteria 44337
103 Ga0209130_1014076 3300025284 Bacteria 2022
104 Ga0209675_1003121 3300025291 Bacteria 8076
105 Ga0209675_1008638 3300025291 Bacteria 3709
106 Ga0209564_1000199 3300025295 Bacteria 138027
107 Ga0209564_1003392 3300025295 Bacteria 10971
108 Ga0209564_1012833 3300025295 Bacteria 3614
109 Ga0209758_1000098 3300025297 Bacteria 230499
110 Ga0209050_1000089 3300025298 Bacteria 256212
111 Ga0209050_1000293 3300025298 Bacteria 106097
112 Ga0209050_1002894 3300025298 Bacteria 13518
113 Ga0209050_1033313 3300025298 Bacteria 1564
114 Ga0209256_1000007 3300025299 Bacteria 1136599
115 Ga0209256_1000163 3300025299 Bacteria 136008
116 Ga0209256_1000334 3300025299 Bacteria 78875
117 Ga0209256_1003697 3300025299 Bacteria 10393
118 Ga0207426_1008182 3300025302 Bacteria 4258
119 Ga0207426_1029215 3300025302 Bacteria 1821
120 Ga0207426_1046051 3300025302 Bacteria 1323
121 Ga0209257_1000003 3300025304 Bacteria 1702593
122 Ga0209257_1002480 3300025304 Bacteria 18244
123 Ga0207705_10003593 3300025909 Bacteria 11816
124 Ga0207705_10254351 3300025909 Bacteria 1340
125 Ga0207705_10513200 3300025909 Bacteria 931
126 Ga0207705_10536186 3300025909 Bacteria 910
127 Ga0207654_10018085 3300025911 Bacteria 3695
128 Ga0207660_10289533 3300025917 Bacteria 1302
129 Ga0207657_10078851 3300025919 Bacteria 2772
130 Ga0207657_10079543 3300025919 Bacteria 2758
131 Ga0207657_10204679 3300025919 Bacteria 1586
132 Ga0207649_10548241 3300025920 Bacteria 884
133 Ga0207694_10418137 3300025924 Bacteria 1116
134 Ga0207659_11023002 3300025926 Bacteria 711
135 Ga0207690_10548683 3300025932 Bacteria 939
136 Ga0207690_10565467 3300025932 Bacteria 925
137 Ga0207686_10166257 3300025934 Bacteria 1551
138 Ga0207686_10592209 3300025934 Bacteria 872
139 Ga0207709_10072707 3300025935 Bacteria 2188
140 Ga0207679_10489915 3300025945 Bacteria 1096
141 Ga0207679_10703591 3300025945 Bacteria 917
142 Ga0207667_10079199 3300025949 Bacteria 3405
143 Ga0207667_10160470 3300025949 Bacteria 2313
144 Ga0207667_10749399 3300025949 Bacteria 976
145 Ga0207702_10417861 3300026078 Bacteria 1296
146 Ga0207648_11592376 3300026089 Bacteria 614
147 Ga0207674_10236175 3300026116 Bacteria 1776
148 Ga0209282_1000001 3300027666 Bacteria 2450367
149 Ga0316177_1132650 3300030731 Bacteria 531
150 Ga0307408_100000123 3300031548 Bacteria 85710
151 Ga0307408_100004417 3300031548 Bacteria 9546
152 Ga0307408_100029542 3300031548 Bacteria 3799
153 Ga0307408_100196188 3300031548 Bacteria 1630
154 Ga0307416_100315420 3300032002 Bacteria 1562
155 Ga0307414_10330545 3300032004 Bacteria 1301
156 Ga0307411_10660145 3300032005 Bacteria 906
157 Ga0373930_0143191 3300034816 Bacteria 595
158 Ga0395899_0009955 3300037312 Bacteria 7291
159 Ga0395899_0015351 3300037312 Bacteria 5837
160 Ga0395899_0105701 3300037312 Bacteria 2027
161 Ga0395899_0159133 3300037312 Bacteria 1597
162 Ga0395899_0211673 3300037312 Bacteria 1347
163 Ga0395899_0313513 3300037312 Bacteria 1058
164 Ga0395899_0343439 3300037312 Bacteria 1000
165 Ga0395899_0496487 3300037312 Bacteria 792
166 Ga0395900_0002250 3300037418 Bacteria 21465
167 Ga0395900_0015351 3300037418 Bacteria 7807
168 Ga0395900_0025781 3300037418 Bacteria 6017
169 Ga0395900_0105677 3300037418 Bacteria 2892
170 Ga0395900_0125215 3300037418 Bacteria 2635
171 Ga0395900_0320863 3300037418 Bacteria 1529
172 Ga0395900_0516832 3300037418 Bacteria 1142
173 Ga0395900_0571349 3300037418 Bacteria 1073
174 Ga0395900_0614249 3300037418 Bacteria 1026
175 Ga0395900_1108491 3300037418 Bacteria 709
176 Ga0395900_1678200 3300037418 Bacteria 546
177 Ga0395898_0012375 3300037466 Bacteria 8820
178 Ga0395898_0093030 3300037466 Bacteria 2898
179 Ga0395898_0295099 3300037466 Bacteria 1546
180 Ga0395898_1065840 3300037466 Bacteria 742
181 Ga0395898_1159007 3300037466 Bacteria 705
182 Ga0395905_0046228 3300037471 Bacteria 4082
183 Ga0395905_0064643 3300037471 Bacteria 3424
184 Ga0395905_0064975 3300037471 Bacteria 3415
185 Ga0395905_0069638 3300037471 Bacteria 3295
186 Ga0395905_0085384 3300037471 Bacteria 2958
187 Ga0395905_0234494 3300037471 Bacteria 1715
188 Ga0395905_0483815 3300037471 Bacteria 1137
189 Ga0395905_0614825 3300037471 Bacteria 988
190 Ga0395905_0622813 3300037471 Bacteria 981
191 Ga0395905_1226922 3300037471 Bacteria 653
192 Ga0395905_1256655 3300037471 Bacteria 644
193 Ga0395905_1506545 3300037471 Bacteria 577
194 Ga0395901_0067361 3300038443 Bacteria 3728
195 Ga0395901_0069009 3300038443 Bacteria 3681
196 Ga0395901_0369829 3300038443 Bacteria 1477
197 Ga0395901_0505784 3300038443 Bacteria 1229
198 Ga0395901_0596182 3300038443 Bacteria 1114
199 Ga0395901_0692724 3300038443 Bacteria 1017
200 Ga0395901_0715651 3300038443 Bacteria 997
201 Ga0395901_0751262 3300038443 Bacteria 968
202 Ga0395901_1094931 3300038443 Bacteria 767
203 Ga0395901_1355420 3300038443 Bacteria 671
204 Ga0395901_1503843 3300038443 Bacteria 629
205 Ga0439465_0013374 3300041413 Bacteria 2561
206 Ga0439448_0007022 3300042005 Bacteria 3251
207 Ga0439449_0020805 3300042007 Bacteria 2458
208 Ga0439450_008858 3300042008 Bacteria 1891
209 Ga0439450_059202 3300042008 Bacteria 923
210 Ga0439455_0008577 3300042012 Bacteria 2194
211 Ga0450904_002774 3300042139 Bacteria 2002
212 Ga0450906_080459 3300042145 Bacteria 588
213 Ga0439458_0011679 3300042157 Bacteria 1965
214 Ga0439458_0032427 3300042157 Bacteria 1249
215 Ga0439458_0078355 3300042157 Bacteria 841
216 Ga0439458_0103878 3300042157 Bacteria 739
217 Ga0450893_0096019 3300042532 Bacteria 600
218 Ga0466969_0319789 3300044656 Bacteria 702
219 Ga0466969_0549366 3300044656 Bacteria 528
220 Ga0466972_0000549 3300044658 Bacteria 18404
221 Ga0466972_0131866 3300044658 Bacteria 1177
222 Ga0453683_0073893 3300044673 Bacteria 2134
223 Ga0466965_0000621 3300044683 Bacteria 12951
224 Ga0466965_0075058 3300044683 Bacteria 1704
225 Ga0466965_0689312 3300044683 Bacteria 585
226 Ga0466966_0012545 3300044684 Bacteria 5613
227 Ga0466966_0034261 3300044684 Bacteria 3283
228 Ga0466966_0036911 3300044684 Bacteria 3153
229 Ga0466966_0067176 3300044684 Bacteria 2252
230 Ga0466966_0139170 3300044684 Bacteria 1484
231 Ga0466966_0171439 3300044684 Bacteria 1318
232 Ga0466966_0362998 3300044684 Bacteria 870
233 Ga0466966_0528990 3300044684 Bacteria 709
234 Ga0466961_0042988 3300044693 Bacteria 2895
235 Ga0466961_0329509 3300044693 Bacteria 930
236 Ga0466961_0379287 3300044693 Bacteria 859
237 Ga0466961_0401695 3300044693 Bacteria 832
238 Ga0466961_0875005 3300044693 Bacteria 535
239 Ga0466963_0081562 3300044694 Bacteria 2191
240 Ga0466964_0001638 3300044706 Bacteria 7729
241 Ga0466964_0270230 3300044706 Bacteria 846
242 Ga0466964_0367343 3300044706 Bacteria 743
243 Ga0466971_0458552 3300044719 Bacteria 626
244 Ga0466968_0010867 3300044735 Bacteria 3537
245 Ga0466968_0176250 3300044735 Bacteria 993
246 Ga0466970_0048267 3300044765 Bacteria 2270
247 Ga0466970_0152945 3300044765 Bacteria 1274
248 Ga0466970_0200617 3300044765 Bacteria 1110
249 Ga0466970_0635186 3300044765 Bacteria 621
250 Ga0466970_0728260 3300044765 Bacteria 579
251 Ga0466957_0000081 3300044842 Bacteria 38526
252 Ga0466957_0014682 3300044842 Bacteria 4563
253 Ga0466957_0155604 3300044842 Bacteria 1481
254 Ga0466957_0828195 3300044842 Bacteria 658
255 Ga0466960_0128844 3300044901 Bacteria 1333
256 Ga0466960_0598429 3300044901 Bacteria 654
257 Ga0466960_0678627 3300044901 Bacteria 617
258 Ga0466959_0029643 3300045049 Bacteria 4054
259 Ga0466959_0044919 3300045049 Bacteria 3254
260 Ga0466959_0179720 3300045049 Bacteria 1480
261 Ga0466959_0317495 3300045049 Bacteria 1065
262 Ga0466959_0344590 3300045049 Bacteria 1016
263 Ga0466959_0927794 3300045049 Bacteria 580
264 Ga0466958_0321197 3300045836 Bacteria 995
265 Ga0466958_0523941 3300045836 Bacteria 769
266 Ga0466967_0004448 3300045976 Bacteria 9455
267 Ga0466967_0124054 3300045976 Bacteria 2390
268 Ga0466967_1934530 3300045976 Bacteria 586
269 Ga0495617_000012 3300046452 Bacteria 295916
270 Ga0495617_016820 3300046452 Bacteria 2473
271 Ga0495617_021284 3300046452 Bacteria 2190
272 Ga0495617_034355 3300046452 Bacteria 1702
273 Ga0495627_000475 3300046453 Bacteria 33989
274 Ga0495627_003935 3300046453 Bacteria 6352
275 Ga0495627_062735 3300046453 Bacteria 1097
276 Ga0495603_0032245 3300046455 Bacteria 3153
277 Ga0495603_0178361 3300046455 Bacteria 1229
278 Ga0495590_0000498 3300046457 Bacteria 19291
279 Ga0495590_0001605 3300046457 Bacteria 9680
280 Ga0495590_0010457 3300046457 Bacteria 3488
281 Ga0495590_0069538 3300046457 Bacteria 1234
282 Ga0495590_0095945 3300046457 Bacteria 1051
283 Ga0495590_0368379 3300046457 Bacteria 548
284 Ga0495591_008285 3300046458 Bacteria 4279
285 Ga0495629_0004585 3300046459 Bacteria 10338
286 Ga0495629_0011922 3300046459 Bacteria 6304
287 Ga0495629_0724648 3300046459 Bacteria 659
288 Ga0495638_0002150 3300046460 Bacteria 16540
289 Ga0495638_0082402 3300046460 Bacteria 1951
290 Ga0495638_0112346 3300046460 Bacteria 1617
291 Ga0495638_0276680 3300046460 Bacteria 914
292 Ga0495653_0067100 3300046463 Bacteria 2695
293 Ga0495653_0109603 3300046463 Bacteria 1986
294 Ga0495653_0131685 3300046463 Bacteria 1769
295 Ga0495653_0155153 3300046463 Bacteria 1595
296 Ga0495650_0000001 3300046471 Bacteria 1085492
297 Ga0495650_0016048 3300046471 Bacteria 3813
298 Ga0495580_0054723 3300046472 Bacteria 2813
299 Ga0495582_0041498 3300046473 Bacteria 2535
300 Ga0495582_0073053 3300046473 Bacteria 1898
301 Ga0495605_0000138 3300046474 Bacteria 94241
302 Ga0495605_0000432 3300046474 Bacteria 37968
303 Ga0495605_0001199 3300046474 Bacteria 17258
304 Ga0495605_0012130 3300046474 Bacteria 4788
305 Ga0495605_0028552 3300046474 Bacteria 2878
306 Ga0495605_0395807 3300046474 Bacteria 575
307 Ga0495584_0001597 3300046491 Bacteria 13375
308 Ga0495584_0002301 3300046491 Bacteria 10898
309 Ga0495584_0006033 3300046491 Bacteria 6383
310 Ga0495584_0008438 3300046491 Bacteria 5338
311 Ga0495584_0036393 3300046491 Bacteria 2487
312 Ga0495584_0037484 3300046491 Bacteria 2450
313 Ga0495584_0043548 3300046491 Bacteria 2265
314 Ga0495584_0061006 3300046491 Bacteria 1895
315 Ga0495584_0068051 3300046491 Bacteria 1789
316 Ga0495585_0009363 3300046492 Bacteria 5877
317 Ga0495585_0021076 3300046492 Bacteria 3743
318 Ga0495585_0023784 3300046492 Bacteria 3515
319 Ga0495585_0041219 3300046492 Bacteria 2589
320 Ga0495585_0053894 3300046492 Bacteria 2225
321 Ga0495585_0072488 3300046492 Bacteria 1876
322 Ga0495585_0081578 3300046492 Bacteria 1752
323 Ga0495585_0324373 3300046492 Bacteria 752
324 Ga0495585_0410265 3300046492 Bacteria 651
325 Ga0495585_0410267 3300046492 Bacteria 651
326 Ga0495585_0526929 3300046492 Bacteria 559
327 Ga0495594_0067953 3300046499 Bacteria 1978
328 Ga0495594_0130298 3300046499 Bacteria 1424
329 Ga0495594_0306338 3300046499 Bacteria 905
330 Ga0495594_0482332 3300046499 Bacteria 704
331 Ga0495594_0559967 3300046499 Bacteria 648
332 Ga0495594_0572668 3300046499 Bacteria 640
333 Ga0495594_0587536 3300046499 Bacteria 631
334 Ga0495596_0005697 3300046500 Bacteria 5847
335 Ga0495596_0006440 3300046500 Bacteria 5402
336 Ga0495596_0015461 3300046500 Bacteria 3194
337 Ga0495596_0038264 3300046500 Bacteria 1896
338 Ga0495596_0044179 3300046500 Bacteria 1754
339 Ga0495596_0092449 3300046500 Bacteria 1174
340 Ga0495607_0002283 3300046501 Bacteria 15780
341 Ga0495607_0002389 3300046501 Bacteria 15303
342 Ga0495607_0004309 3300046501 Bacteria 10502
343 Ga0495607_0008277 3300046501 Bacteria 7115
344 Ga0495607_0008330 3300046501 Bacteria 7091
345 Ga0495607_0008584 3300046501 Bacteria 6976
346 Ga0495607_0032362 3300046501 Bacteria 3192
347 Ga0495607_0036971 3300046501 Bacteria 2936
348 Ga0495607_0057416 3300046501 Bacteria 2230
349 Ga0495607_0064713 3300046501 Bacteria 2064
350 Ga0495607_0070014 3300046501 Bacteria 1961
351 Ga0495607_0078079 3300046501 Bacteria 1827
352 Ga0495607_0080850 3300046501 Bacteria 1785
353 Ga0495607_0200618 3300046501 Bacteria 987
354 Ga0495607_0226698 3300046501 Bacteria 911
355 Ga0495583_0000026 3300046506 Bacteria 256777
356 Ga0495583_0000113 3300046506 Bacteria 136475
357 Ga0495583_0004818 3300046506 Bacteria 9457
358 Ga0495583_0008975 3300046506 Bacteria 6030
359 Ga0495583_0026429 3300046506 Bacteria 2878
360 Ga0495583_0143665 3300046506 Bacteria 992
361 Ga0495606_0002776 3300046507 Bacteria 19592
362 Ga0495606_0022152 3300046507 Bacteria 4638
363 Ga0495606_0166156 3300046507 Bacteria 1284
364 Ga0495606_0173188 3300046507 Bacteria 1250
365 Ga0495606_0240537 3300046507 Bacteria 1010
366 Ga0495606_0352223 3300046507 Bacteria 781
367 Ga0495606_0394492 3300046507 Bacteria 722
368 Ga0495606_0444586 3300046507 Bacteria 665
369 Ga0495606_0467192 3300046507 Bacteria 643
370 Ga0495606_0654141 3300046507 Bacteria 508
371 Ga0495610_0241736 3300046512 Bacteria 719
372 Ga0495616_0000037 3300046513 Bacteria 123624
373 Ga0495616_0002017 3300046513 Bacteria 13661
374 Ga0495616_0013490 3300046513 Bacteria 4608
375 Ga0495616_0015525 3300046513 Bacteria 4233
376 Ga0495616_0022187 3300046513 Bacteria 3429
377 Ga0495616_0033261 3300046513 Bacteria 2688
378 Ga0495616_0034392 3300046513 Bacteria 2632
379 Ga0495616_0074992 3300046513 Bacteria 1628
380 Ga0495616_0121975 3300046513 Bacteria 1202
381 Ga0495616_0152537 3300046513 Bacteria 1044
382 Ga0495630_0030210 3300046517 Bacteria 4030
383 Ga0495631_0000856 3300046518 Bacteria 19204
384 Ga0495631_0004211 3300046518 Bacteria 7693
385 Ga0495631_0024273 3300046518 Bacteria 2799
386 Ga0495631_0037819 3300046518 Bacteria 2148
387 Ga0495631_0041802 3300046518 Bacteria 2027
388 Ga0495631_0054934 3300046518 Bacteria 1735
389 Ga0495631_0073170 3300046518 Bacteria 1480
390 Ga0495631_0115868 3300046518 Bacteria 1152
391 Ga0495631_0148847 3300046518 Bacteria 1004
392 Ga0495631_0219104 3300046518 Bacteria 812
393 Ga0495631_0302447 3300046518 Bacteria 680
394 Ga0495631_0319674 3300046518 Bacteria 660
395 Ga0495631_0362976 3300046518 Bacteria 616
396 Ga0495632_0000018 3300046519 Bacteria 228282
397 Ga0495632_0000988 3300046519 Bacteria 24808
398 Ga0495632_0002964 3300046519 Bacteria 12438
399 Ga0495632_0040968 3300046519 Bacteria 2329
400 Ga0495632_0211667 3300046519 Bacteria 879
401 Ga0495637_0026325 3300046520 Bacteria 2612
402 Ga0495637_0229613 3300046520 Bacteria 673
403 Ga0495643_0004390 3300046522 Bacteria 9879
404 Ga0495643_0077916 3300046522 Bacteria 1731
405 Ga0495643_0101622 3300046522 Bacteria 1473
406 Ga0495643_0153784 3300046522 Bacteria 1137
407 Ga0495643_0253921 3300046522 Bacteria 819
408 Ga0495643_0285136 3300046522 Bacteria 758
409 Ga0495643_0288118 3300046522 Bacteria 753
410 Ga0495643_0430201 3300046522 Bacteria 577
411 Ga0495644_0000829 3300046523 Bacteria 12768
412 Ga0495644_0002102 3300046523 Bacteria 8009
413 Ga0495644_0004671 3300046523 Bacteria 5380
414 Ga0495644_0007037 3300046523 Bacteria 4352
415 Ga0495644_0020842 3300046523 Bacteria 2500
416 Ga0495644_0142204 3300046523 Bacteria 916
417 Ga0495648_0000607 3300046524 Bacteria 38333
418 Ga0495648_0002504 3300046524 Bacteria 16859
419 Ga0495648_0006132 3300046524 Bacteria 9854
420 Ga0495648_0006238 3300046524 Bacteria 9752
421 Ga0495648_0011054 3300046524 Bacteria 6838
422 Ga0495648_0017670 3300046524 Bacteria 5088
423 Ga0495648_0038433 3300046524 Bacteria 3060
424 Ga0495663_0002274 3300046525 Bacteria 5831
425 Ga0495663_0004275 3300046525 Bacteria 4025
426 Ga0495663_0050714 3300046525 Bacteria 1284
427 Ga0495666_0009518 3300046526 Bacteria 4854
428 Ga0495642_0000010 3300046528 Bacteria 136557
429 Ga0495642_0000810 3300046528 Bacteria 15157
430 Ga0495642_0007615 3300046528 Bacteria 4150
431 Ga0495642_0008276 3300046528 Bacteria 3979
432 Ga0495642_0018015 3300046528 Bacteria 2762
433 Ga0495642_0045623 3300046528 Bacteria 1791
434 Ga0495642_0059301 3300046528 Bacteria 1586
435 Ga0495642_0078145 3300046528 Archaea 1391
436 Ga0495642_0103565 3300046528 Bacteria 1213
437 Ga0495642_0105842 3300046528 Bacteria 1200
438 Ga0495642_0122104 3300046528 Bacteria 1118
439 Ga0495642_0228107 3300046528 Bacteria 813
440 Ga0495642_0439893 3300046528 Bacteria 576
441 Ga0495652_0025910 3300046529 Bacteria 5181
442 Ga0495654_0004534 3300046530 Bacteria 8222
443 Ga0495654_0016780 3300046530 Bacteria 3860
444 Ga0495654_0019071 3300046530 Bacteria 3589
445 Ga0495654_0164804 3300046530 Bacteria 970
446 Ga0495654_0346460 3300046530 Bacteria 598
447 Ga0495654_0410524 3300046530 Bacteria 537
448 Ga0495665_0021110 3300046531 Bacteria 3498
449 Ga0495665_0190293 3300046531 Bacteria 1065
450 Ga0495586_0002254 3300046535 Bacteria 10496
451 Ga0495586_0102093 3300046535 Bacteria 1592
452 Ga0495587_0039023 3300046536 Bacteria 2845
453 Ga0495587_0048317 3300046536 Bacteria 2520
454 Ga0495609_0000001 3300046538 Bacteria 1060094
455 Ga0495609_0000142 3300046538 Bacteria 75002
456 Ga0495609_0001633 3300046538 Bacteria 14622
457 Ga0495609_0006249 3300046538 Bacteria 6113
458 Ga0495609_0008994 3300046538 Bacteria 4856
459 Ga0495609_0041688 3300046538 Bacteria 2062
460 Ga0495609_0110941 3300046538 Bacteria 1184
461 Ga0495609_0202904 3300046538 Bacteria 828
462 Ga0495609_0328276 3300046538 Bacteria 619
463 Ga0495609_0339717 3300046538 Bacteria 607
464 Ga0495597_0000967 3300046542 Bacteria 22208
465 Ga0495597_0001038 3300046542 Bacteria 21213
466 Ga0495597_0001317 3300046542 Bacteria 18177
467 Ga0495597_0002421 3300046542 Bacteria 11863
468 Ga0495597_0007941 3300046542 Bacteria 5345
469 Ga0495597_0009210 3300046542 Bacteria 4894
470 Ga0495597_0037773 3300046542 Bacteria 2167
471 Ga0495597_0084574 3300046542 Bacteria 1353
472 Ga0495597_0222786 3300046542 Bacteria 748
473 Ga0495645_0100590 3300046543 Bacteria 2056
474 Ga0495622_0001153 3300046557 Bacteria 13764
475 Ga0495622_0087447 3300046557 Bacteria 1433
476 Ga0495622_0148965 3300046557 Bacteria 1059
477 Ga0495622_0271177 3300046557 Bacteria 743
478 Ga0495622_0516203 3300046557 Bacteria 510
479 Ga0495633_0001497 3300046558 Bacteria 18105
480 Ga0495633_0004609 3300046558 Bacteria 8687
481 Ga0495633_0012049 3300046558 Bacteria 4618
482 Ga0495633_0076253 3300046558 Bacteria 1561
483 Ga0495633_0096639 3300046558 Bacteria 1372
484 Ga0495633_0413804 3300046558 Bacteria 609
485 Ga0495656_0003022 3300046615 Bacteria 5655
486 Ga0495656_0030945 3300046615 Bacteria 2167
487 Ga0495656_0031728 3300046615 Bacteria 2145
488 Ga0495656_0134824 3300046615 Bacteria 1178
489 Ga0495656_0371208 3300046615 Bacteria 744
490 Ga0495656_0548249 3300046615 Bacteria 616
491 Ga0495668_0000020 3300046616 Bacteria 411641
492 Ga0495668_0000448 3300046616 Bacteria 52646
493 Ga0495668_0001463 3300046616 Bacteria 22696
494 Ga0495668_0005020 3300046616 Bacteria 9131
495 Ga0495668_0005425 3300046616 Bacteria 8660
496 Ga0495668_0005806 3300046616 Bacteria 8250
497 Ga0495668_0006550 3300046616 Bacteria 7608
498 Ga0495668_0017187 3300046616 Bacteria 4200
499 Ga0495668_0074692 3300046616 Bacteria 1861
500 Ga0495668_0100758 3300046616 Bacteria 1580
501 Ga0495668_0374907 3300046616 Bacteria 781
502 Ga0495634_0022245 3300046642 Bacteria 4468
503 Ga0495611_0001473 3300046648 Bacteria 11705
504 Ga0495611_0001872 3300046648 Bacteria 10030
505 Ga0495611_0005286 3300046648 Bacteria 5531
506 Ga0495611_0006146 3300046648 Bacteria 5125
507 Ga0495611_0009096 3300046648 Bacteria 4199
508 Ga0495611_0029287 3300046648 Bacteria 2414
509 Ga0495611_0077310 3300046648 Bacteria 1526
510 Ga0495625_0011387 3300046660 Bacteria 7258
511 Ga0495625_0027230 3300046660 Bacteria 4307
512 Ga0495625_0038201 3300046660 Bacteria 3516
513 Ga0495625_0068427 3300046660 Bacteria 2496
514 Ga0495625_0093025 3300046660 Bacteria 2082
515 Ga0495625_0180046 3300046660 Bacteria 1406
516 Ga0495625_0204448 3300046660 Bacteria 1301
517 Ga0495625_0260969 3300046660 Bacteria 1121
518 Ga0495625_0571826 3300046660 Bacteria 682
519 Ga0495635_0002174 3300046663 Bacteria 13328
520 Ga0495635_0082269 3300046663 Bacteria 2203
521 Ga0495659_0000063 3300046664 Bacteria 47788
522 Ga0495659_0000393 3300046664 Bacteria 16723
523 Ga0495659_0001076 3300046664 Bacteria 9505
524 Ga0495659_0209956 3300046664 Bacteria 801
525 Ga0495661_0000082 3300046665 Bacteria 116600
526 Ga0495661_0001642 3300046665 Bacteria 18233
527 Ga0495661_0002755 3300046665 Bacteria 13352
528 Ga0495661_0003022 3300046665 Bacteria 12676
529 Ga0495661_0016241 3300046665 Bacteria 4941
530 Ga0495661_0025167 3300046665 Bacteria 3847
531 Ga0495661_0027959 3300046665 Bacteria 3617
532 Ga0495661_0057045 3300046665 Bacteria 2333
533 Ga0495661_0071242 3300046665 Bacteria 2031
534 Ga0495661_0076159 3300046665 Bacteria 1947
535 Ga0495661_0084795 3300046665 Bacteria 1817
536 Ga0495661_0156149 3300046665 Bacteria 1228
537 Ga0495661_0157339 3300046665 Bacteria 1222
538 Ga0495661_0229486 3300046665 Bacteria 958
539 Ga0495661_0264579 3300046665 Bacteria 872
540 Ga0495661_0328305 3300046665 Bacteria 758
541 Ga0495661_0340683 3300046665 Bacteria 740
542 Ga0495661_0411445 3300046665 Bacteria 656
543 Ga0495661_0461599 3300046665 Bacteria 610
544 Ga0495588_0000041 3300046674 Bacteria 377896
545 Ga0495588_0004219 3300046674 Bacteria 6335
546 Ga0495588_0028007 3300046674 Bacteria 2818
547 Ga0495588_0041796 3300046674 Bacteria 2342
548 Ga0495588_0076350 3300046674 Bacteria 1746
549 Ga0495588_0085442 3300046674 Bacteria 1649
550 Ga0495588_0106419 3300046674 Bacteria 1476
551 Ga0495588_0160522 3300046674 Bacteria 1189
552 Ga0495588_0241992 3300046674 Bacteria 952
553 Ga0495599_0664796 3300046678 Bacteria 603
554 Ga0495623_0011300 3300046679 Bacteria 5777
555 Ga0495623_0061097 3300046679 Bacteria 2363
556 Ga0495646_0665339 3300046680 Bacteria 525
557 Ga0495669_0000031 3300046684 Bacteria 101141
558 Ga0495669_0001229 3300046684 Bacteria 10642
559 Ga0495669_0006268 3300046684 Bacteria 4966
560 Ga0495669_0013036 3300046684 Bacteria 3542
561 Ga0495669_0045533 3300046684 Bacteria 1956
562 Ga0495669_0091264 3300046684 Bacteria 1406
563 Ga0495669_0281456 3300046684 Bacteria 800
564 Ga0495613_0132005 3300046689 Bacteria 1788
565 Ga0495670_0003564 3300046691 Bacteria 7648
566 Ga0495670_0003870 3300046691 Bacteria 7352
567 Ga0495670_0008414 3300046691 Bacteria 5072
568 Ga0495670_0026071 3300046691 Bacteria 2893
569 Ga0495670_0054327 3300046691 Bacteria 2006
570 Ga0495670_0424501 3300046691 Bacteria 719
571 Ga0495670_0626063 3300046691 Bacteria 586
572 Ga0495670_0659027 3300046691 Bacteria 570
573 Ga0495671_0000223 3300046692 Bacteria 49139
574 Ga0495671_0003296 3300046692 Bacteria 9987
575 Ga0495671_0010193 3300046692 Bacteria 5219
576 Ga0495671_0015755 3300046692 Bacteria 4044
577 Ga0495671_0472116 3300046692 Bacteria 599
578 Ga0495649_0060080 3300046694 Bacteria 2045
579 Ga0495649_0189040 3300046694 Bacteria 1072
580 Ga0495649_0326374 3300046694 Bacteria 778
581 Ga0495649_0437489 3300046694 Bacteria 654
582 Ga0495649_0603228 3300046694 Bacteria 541
583 Ga0495589_0000202 3300046794 Bacteria 51572
584 Ga0495589_0000512 3300046794 Bacteria 27325
585 Ga0495589_0000590 3300046794 Bacteria 24799
586 Ga0495589_0005802 3300046794 Bacteria 6510
587 Ga0495589_0010999 3300046794 Bacteria 4698
588 Ga0495589_0128372 3300046794 Bacteria 1218
589 Ga0495589_0202943 3300046794 Bacteria 935
590 Ga0495589_0213781 3300046794 Bacteria 907
591 Ga0495600_0109829 3300046809 Bacteria 1796
592 Ga0495600_0128180 3300046809 Bacteria 1650
593 Ga0495660_0000033 3300046810 Bacteria 212425
594 Ga0495660_0001217 3300046810 Bacteria 17977
595 Ga0495660_0009535 3300046810 Bacteria 5659
596 Ga0495660_0010304 3300046810 Bacteria 5434
597 Ga0495660_0020829 3300046810 Bacteria 3759
598 Ga0495660_0046568 3300046810 Bacteria 2378
599 Ga0495660_0057890 3300046810 Bacteria 2089
600 Ga0495660_0082669 3300046810 Bacteria 1681
601 Ga0495660_0158407 3300046810 Bacteria 1112
602 Ga0495660_0202860 3300046810 Bacteria 946
603 Ga0495581_0029044 3300047315 Bacteria 3206
604 Ga0495604_0010708 3300047317 Bacteria 7279
605 Ga0495604_0029427 3300047317 Bacteria 4369
606 Ga0495636_0027483 3300047318 Bacteria 2317
607 Ga0495636_0040418 3300047318 Bacteria 1933
608 Ga0495636_0047445 3300047318 Bacteria 1793
609 Ga0495636_0091011 3300047318 Bacteria 1324
610 Ga0495636_0179473 3300047318 Bacteria 960
611 Ga0495636_0190877 3300047318 Bacteria 932
612 Ga0495674_0027730 3300047319 Bacteria 5171
613 Ga0495672_0002906 3300047320 Bacteria 15161
614 Ga0495672_0006037 3300047320 Bacteria 9465
615 Ga0495672_0008060 3300047320 Bacteria 7833
616 Ga0495672_0018120 3300047320 Bacteria 4687
617 Ga0495672_0041145 3300047320 Bacteria 2797
618 Ga0495672_0251836 3300047320 Bacteria 857
619 Ga0495676_0000557 3300047321 Bacteria 30685
620 Ga0495676_0108630 3300047321 Bacteria 2040
621 Ga0495680_0002023 3300047322 Bacteria 21263
622 Ga0495683_0012165 3300047323 Bacteria 4522
623 Ga0495683_0015891 3300047323 Bacteria 3909
624 Ga0495683_0033055 3300047323 Bacteria 2634
625 Ga0495683_0055057 3300047323 Bacteria 1981
626 Ga0495683_0185289 3300047323 Bacteria 948
627 Ga0495683_0204142 3300047323 Bacteria 889
628 Ga0495683_0233045 3300047323 Bacteria 815
629 Ga0495687_000027 3300047443 Bacteria 299689
630 Ga0495687_000873 3300047443 Bacteria 31989
631 Ga0495687_001578 3300047443 Bacteria 20661
632 Ga0495687_001652 3300047443 Bacteria 20053
633 Ga0495687_125600 3300047443 Bacteria 918
634 Ga0495687_141437 3300047443 Bacteria 836
635 Ga0495687_210874 3300047443 Bacteria 608
636 Ga0495675_0025189 3300047444 Bacteria 3793
637 Ga0495675_0054323 3300047444 Bacteria 2542
638 Ga0495675_0075347 3300047444 Bacteria 2127
639 Ga0495677_0000001 3300047445 Bacteria 715000
640 Ga0495677_0001227 3300047445 Bacteria 10276
641 Ga0495677_0002166 3300047445 Bacteria 7775
642 Ga0495677_0002826 3300047445 Bacteria 6766
643 Ga0495677_0004714 3300047445 Bacteria 5199
644 Ga0495677_0008424 3300047445 Bacteria 3828
645 Ga0495677_0009451 3300047445 Bacteria 3601
646 Ga0495677_0027443 3300047445 Bacteria 2066
647 Ga0495677_0052856 3300047445 Bacteria 1497
648 Ga0495677_0133649 3300047445 Bacteria 950
649 Ga0495677_0302147 3300047445 Bacteria 629
650 Ga0495679_008820 3300047446 Bacteria 4071
651 Ga0495679_013635 3300047446 Bacteria 3040
652 Ga0495679_015106 3300047446 Bacteria 2834
653 Ga0495679_021968 3300047446 Bacteria 2192
654 Ga0495685_000064 3300047447 Bacteria 40085
655 Ga0495685_006568 3300047447 Bacteria 3815
656 Ga0495685_017181 3300047447 Bacteria 2476
657 Ga0495685_245879 3300047447 Bacteria 568
658 Ga0495673_0001902 3300047469 Bacteria 15634
659 Ga0495673_0268033 3300047469 Bacteria 619
660 Ga0495681_0001529 3300047470 Bacteria 17264
661 Ga0495681_0005675 3300047470 Bacteria 8310
662 Ga0495681_0021213 3300047470 Bacteria 3504
663 Ga0495681_0028278 3300047470 Bacteria 2887
664 Ga0495681_0085901 3300047470 Bacteria 1396
665 Ga0495681_0271662 3300047470 Bacteria 663
666 Ga0495686_0001196 3300047472 Bacteria 30003
667 Ga0495686_0028791 3300047472 Bacteria 3616
668 Ga0495686_0174505 3300047472 Bacteria 1249
669 Ga0495686_0196460 3300047472 Bacteria 1160
670 Ga0495686_0406145 3300047472 Bacteria 730
671 Ga0495593_0014985 3300047673 Bacteria 4401
672 Ga0495593_0048083 3300047673 Bacteria 2267
673 Ga0495602_0035851 3300048088 Bacteria 4622
674 Ga0495614_0000545 3300048089 Bacteria 15602
675 Ga0495614_0007999 3300048089 Bacteria 4699
676 Ga0495614_0277988 3300048089 Bacteria 770
677 Ga0495626_0000159 3300048091 Bacteria 83571
678 Ga0495626_0001535 3300048091 Bacteria 18118
679 Ga0495626_0010066 3300048091 Bacteria 5074
680 Ga0495626_0011759 3300048091 Bacteria 4615
681 Ga0495626_0033374 3300048091 Bacteria 2467
682 Ga0495626_0059779 3300048091 Bacteria 1738
683 Ga0495626_0115214 3300048091 Bacteria 1160
684 Ga0495626_0136195 3300048091 Bacteria 1044
685 Ga0495626_0251633 3300048091 Bacteria 708
686 Ga0496100_0429566 3300048903 Bacteria 1010
687 Ga0496100_0506678 3300048903 Bacteria 930
688 Ga0496100_0590989 3300048903 Bacteria 861
689 Ga0496101_0124556 3300048904 Bacteria 1952
690 Ga0496101_0167862 3300048904 Bacteria 1685
691 Ga0496101_0490652 3300048904 Bacteria 970
692 Ga0496102_0000150 3300048905 Bacteria 94718
693 Ga0496102_0000816 3300048905 Bacteria 30310
694 Ga0496102_0092747 3300048905 Bacteria 2797
695 Ga0496102_0165902 3300048905 Bacteria 2078
696 Ga0496102_0168007 3300048905 Bacteria 2065
697 Ga0496102_0754752 3300048905 Bacteria 896
698 Ga0496103_0029187 3300048906 Bacteria 3351
699 Ga0496103_0086436 3300048906 Bacteria 1976
700 Ga0496103_0380291 3300048906 Bacteria 907
701 Ga0496103_0469115 3300048906 Bacteria 807
702 Ga0496103_0720547 3300048906 Bacteria 632
703 Ga0496104_0299635 3300048907 Bacteria 1520
704 Ga0496104_0713267 3300048907 Bacteria 911
705 Ga0496105_0454230 3300048908 Bacteria 1011
706 Ga0496105_0558584 3300048908 Bacteria 893
707 Ga0496105_0849774 3300048908 Bacteria 691
708 Ga0496106_0017435 3300048909 Bacteria 5313
709 Ga0496107_0015847 3300048910 Bacteria 5288
710 Ga0496107_0329398 3300048910 Bacteria 1136
711 Ga0496107_0606913 3300048910 Bacteria 808
712 Ga0496107_0803235 3300048910 Bacteria 689
713 Ga0496107_1002236 3300048910 Bacteria 606
714 Ga0496108_0163188 3300048911 Bacteria 1926
715 Ga0496108_1680676 3300048911 Bacteria 523
716 Ga0496109_0908616 3300048912 Bacteria 818
717 Ga0496109_1610079 3300048912 Bacteria 584
718 Ga0496110_0000036 3300048913 Bacteria 64802
719 Ga0496110_0468673 3300048913 Bacteria 1148
720 Ga0496110_0625138 3300048913 Bacteria 976
721 Ga0496111_0049467 3300048914 Bacteria 3031
722 Ga0496111_0540277 3300048914 Bacteria 856
723 Ga0496111_0952526 3300048914 Bacteria 616
724 Ga0496111_0977582 3300048914 Bacteria 607
725 Ga0496112_0015901 3300048915 Bacteria 7033
726 Ga0496112_1231337 3300048915 Bacteria 665
727 Ga0496113_0009981 3300048916 Bacteria 6258
728 Ga0496113_0082996 3300048916 Bacteria 2458
729 Ga0496113_0958790 3300048916 Bacteria 675
730 Ga0496114_0074048 3300048917 Bacteria 2867
731 Ga0496115_0429508 3300048918 Bacteria 1069
732 Ga0496115_0471420 3300048918 Bacteria 1012
733 Ga0496116_0020670 3300048919 Bacteria 4992
734 Ga0496117_0000001 3300048920 Bacteria 2526244
735 Ga0496118_0000002 3300048921 Bacteria 1690764
736 Ga0496119_0442628 3300048922 Bacteria 613
737 Ga0496121_0000709 3300048924 Bacteria 61789
738 Ga0496121_0053734 3300048924 Bacteria 3372
739 Ga0496122_0000255 3300048925 Bacteria 120384
740 Ga0496122_0000660 3300048925 Bacteria 69382
741 Ga0496122_0006595 3300048925 Bacteria 13249
742 Ga0496122_0014117 3300048925 Bacteria 7747
743 Ga0496122_0278087 3300048925 Bacteria 917
744 Ga0496123_0000936 3300048926 Bacteria 45579
745 Ga0496123_0002832 3300048926 Bacteria 20510
746 Ga0496123_0007467 3300048926 Bacteria 10280
747 Ga0496123_0123759 3300048926 Bacteria 1448
748 Ga0496123_0252167 3300048926 Bacteria 870
749 Ga0496124_0013535 3300048927 Bacteria 7956
750 Ga0496124_0067859 3300048927 Bacteria 2966
751 Ga0496124_0100106 3300048927 Bacteria 2350
752 Ga0496124_0532066 3300048927 Bacteria 780
753 Ga0496124_0546748 3300048927 Bacteria 765
754 Ga0496124_0675300 3300048927 Bacteria 659
755 Ga0496125_0049086 3300048928 Bacteria 3511
756 Ga0496125_0119039 3300048928 Bacteria 1889
757 Ga0496125_0170718 3300048928 Bacteria 1462
758 Ga0496125_0401794 3300048928 Bacteria 800
759 Ga0496125_0433316 3300048928 Bacteria 758
760 Ga0496125_0457406 3300048928 Bacteria 729
761 Ga0496126_0870075 3300048929 Bacteria 686
762 Ga0501308_000396 3300049128 Bacteria 2777
763 Ga0501309_041317 3300049129 Bacteria 705
764 Ga0495678_000396 3300049459 Bacteria 43995
765 Ga0495678_000436 3300049459 Bacteria 41678
766 Ga0495678_018442 3300049459 Bacteria 3137
767 Ga0495678_032135 3300049459 Bacteria 2180
768 Ga0495678_128130 3300049459 Bacteria 844
769 Ga0495682_0000354 3300049460 Bacteria 33649
770 Ga0495682_0001087 3300049460 Bacteria 15940
771 Ga0495682_0006848 3300049460 Bacteria 4588
772 Ga0495682_0014657 3300049460 Bacteria 2971
773 Ga0495682_0155721 3300049460 Bacteria 814
774 Ga0501034_0747747 3300049571 Bacteria 873
775 Ga0501036_0845636 3300049572 Bacteria 752
776 Ga0501047_0225511 3300049581 Bacteria 1729
777 Ga0501227_010529 3300049665 Bacteria 2006
778 Ga0501235_176935 3300049669 Bacteria 567
779 Ga0501248_004688 3300049678 Bacteria 1045
780 Ga0501279_000371 3300049775 Bacteria 5993
781 Ga0501044_0514858 3300049823 Bacteria 1097
782 Ga0466962_0030852 3300061719 Bacteria 2566
783 Ga0466962_0166831 3300061719 Bacteria 1071
784 Ga0466962_0245428 3300061719 Bacteria 879
785 Ga0466962_0485485 3300061719 Bacteria 624
786 Ga0466962_0610881 3300061719 Bacteria 556
787 2601668744 2600255292 Bacteria 6300551
788 2643791416 2643221554 Bacteria 6603920
789 2644212775 2643221638 Bacteria 6579467
790 2644354879 2643221664 Bacteria 7272945
791 2738737977 2738541280 Bacteria 6630198
792 2738842187 2738541300 Bacteria 6675882
793 2857551441 2857547612 Bacteria 6179999
794 2885082732 2885080285 Bacteria 6355622
795 2932414295 2932410948 Bacteria 6312192
796 2932416904 2932416698 Bacteria 6315112
797 Ga0495642_0000352
798 JGI25158J39367_1000579
799 JGI25158J39367_1002308
800 JGI25152J39213_1000071
801 JGI25150J39212_1000674
802 JGI25150J39212_1002059
803 JGI25159J45721_1008136
804 JGI25159J45721_1012506
805 JGI25159J45721_1012543
806 rootL2_10126347
807 rootL2_10147025
808 JGI25160J50197_1020158
809 JGI25161J50226_1000444
810 JGI25161J50226_1001769
811 Ga0055525_1000008
812 Ga0055526_1001492
813 Ga0055526_1006009
814 Ga0055537_1001232
815 Ga0055537_1013963
816 Ga0055537_1044583
817 Ga0055537_1046777
818 Ga0055524_1000112
819 Ga0055524_1000241
820 Ga0055524_1000430
821 Ga0055524_1001460
822 Ga0055524_1003339
823 Ga0055524_1005319
824 Ga0055534_1002678
825 Ga0055534_1021893
826 Ga0055528_1042731
827 Ga0055528_1077201
828 Ga0055530_10000365
829 Ga0055530_10002070
830 Ga0055530_10005292
831 Ga0055531_10001721
832 Ga0055531_10063307
833 Ga0055543_1000231
834 Ga0055543_1011867
835 Ga0055543_1028851
836 Ga0065165_1000524
837 Ga0065165_1001165
838 Ga0065165_1002198
839 Ga0065165_1023081
840 Ga0065165_1128847
841 Ga0065714_10389072
842 Ga0070658_10133976
843 Ga0070658_10203631
844 Ga0070658_10216881
845 Ga0070658_10475721
846 Ga0070658_10603431
847 Ga0070680_100165357
848 Ga0070660_100243467
849 Ga0070660_100583750
850 Ga0070661_100097890
851 Ga0070675_101509366
852 Ga0070659_100008805
853 Ga0070659_100215526
854 Ga0070659_100542820
855 Ga0068867_101987076
856 Ga0068855_100019577
857 Ga0070664_100109699
858 Ga0068856_100221826
859 Ga0068862_102600123
860 Ga0099826_10000001
861 Ga0105243_10288279
862 Ga0105241_10051139
863 Ga0105242_10320572
864 Ga0105242_11415208
865 Ga0105238_10454555
866 Ga0105239_10303242
867 Ga0105239_11684646
868 Ga0105246_10393759
869 Ga0157373_10425748
870 Ga0157378_12658677
871 Ga0157372_10924647
872 Ga0157372_11024632
873 Ga0157372_11254955
874 Ga0182008_10000928
875 Ga0182006_1000006
876 Ga0182007_10000013
877 Ga0182005_1000001
878 Ga0163161_10071036
879 Ga0209436_100068
880 Ga0209436_108578
881 Ga0209436_112327
882 Ga0209563_100003
883 Ga0207425_1000001
884 Ga0207425_1000406
885 Ga0207425_1008655
886 Ga0209677_110147
887 Ga0209148_1001390
888 Ga0209129_1000003
889 Ga0209129_1000629
890 Ga0209129_1012331
891 Ga0209565_1001956
892 Ga0209565_1002640
893 Ga0209565_1004025
894 Ga0209565_1019464
895 Ga0209565_1037685
896 Ga0209673_1054516
897 Ga0209130_1000046
898 Ga0209130_1000439
899 Ga0209130_1014076
900 Ga0209675_1003121
901 Ga0209675_1008638
902 Ga0209564_1000199
903 Ga0209564_1003392
904 Ga0209564_1012833
905 Ga0209758_1000098
906 Ga0209050_1000089
907 Ga0209050_1000293
908 Ga0209050_1002894
909 Ga0209050_1033313
910 Ga0209256_1000007
911 Ga0209256_1000163
912 Ga0209256_1000334
913 Ga0209256_1003697
914 Ga0207426_1008182
915 Ga0207426_1029215
916 Ga0207426_1046051
917 Ga0209257_1000003
918 Ga0209257_1002480
919 Ga0207705_10003593
920 Ga0207705_10254351
921 Ga0207705_10513200
922 Ga0207705_10536186
923 Ga0207654_10018085
924 Ga0207660_10289533
925 Ga0207657_10078851
926 Ga0207657_10079543
927 Ga0207657_10204679
928 Ga0207649_10548241
929 Ga0207694_10418137
930 Ga0207659_11023002
931 Ga0207690_10548683
932 Ga0207690_10565467
933 Ga0207686_10166257
934 Ga0207686_10592209
935 Ga0207709_10072707
936 Ga0207679_10489915
937 Ga0207679_10703591
938 Ga0207667_10079199
939 Ga0207667_10160470
940 Ga0207667_10749399
941 Ga0207702_10417861
942 Ga0207648_11592376
943 Ga0207674_10236175
944 Ga0209282_1000001
945 Ga0316177_1132650
946 Ga0307408_100000123
947 Ga0307408_100004417
948 Ga0307408_100029542
949 Ga0307408_100196188
950 Ga0307416_100315420
951 Ga0307414_10330545
952 Ga0307411_10660145
953 Ga0373930_0143191
954 Ga0395899_0009955
955 Ga0395899_0015351
956 Ga0395899_0105701
957 Ga0395899_0159133
958 Ga0395899_0211673
959 Ga0395899_0313513
960 Ga0395899_0343439
961 Ga0395899_0496487
962 Ga0395900_0002250
963 Ga0395900_0015351
964 Ga0395900_0025781
965 Ga0395900_0105677
966 Ga0395900_0125215
967 Ga0395900_0320863
968 Ga0395900_0516832
969 Ga0395900_0571349
970 Ga0395900_0614249
971 Ga0395900_1108491
972 Ga0395900_1678200
973 Ga0395898_0012375
974 Ga0395898_0093030
975 Ga0395898_0295099
976 Ga0395898_1065840
977 Ga0395898_1159007
978 Ga0395905_0046228
979 Ga0395905_0064643
980 Ga0395905_0064975
981 Ga0395905_0069638
982 Ga0395905_0085384
983 Ga0395905_0234494
984 Ga0395905_0483815
985 Ga0395905_0614825
986 Ga0395905_0622813
987 Ga0395905_1226922
988 Ga0395905_1256655
989 Ga0395905_1506545
990 Ga0395901_0067361
991 Ga0395901_0069009
992 Ga0395901_0369829
993 Ga0395901_0505784
994 Ga0395901_0596182
995 Ga0395901_0692724
996 Ga0395901_0715651
997 Ga0395901_0751262
998 Ga0395901_1094931
999 Ga0395901_1355420
1000 Ga0395901_1503843
1001 Ga0439465_0013374
1002 Ga0439448_0007022
1003 Ga0439449_0020805
1004 Ga0439450_008858
1005 Ga0439450_059202
1006 Ga0439455_0008577
1007 Ga0450904_002774
1008 Ga0450906_080459
1009 Ga0439458_0011679
1010 Ga0439458_0032427
1011 Ga0439458_0078355
1012 Ga0439458_0103878
1013 Ga0450893_0096019
1014 Ga0466969_0319789
1015 Ga0466969_0549366
1016 Ga0466972_0000549
1017 Ga0466972_0131866
1018 Ga0453683_0073893
1019 Ga0466965_0000621
1020 Ga0466965_0075058
1021 Ga0466965_0689312
1022 Ga0466966_0012545
1023 Ga0466966_0034261
1024 Ga0466966_0036911
1025 Ga0466966_0067176
1026 Ga0466966_0139170
1027 Ga0466966_0171439
1028 Ga0466966_0362998
1029 Ga0466966_0528990
1030 Ga0466961_0042988
1031 Ga0466961_0329509
1032 Ga0466961_0379287
1033 Ga0466961_0401695
1034 Ga0466961_0875005
1035 Ga0466963_0081562
1036 Ga0466964_0001638
1037 Ga0466964_0270230
1038 Ga0466964_0367343
1039 Ga0466971_0458552
1040 Ga0466968_0010867
1041 Ga0466968_0176250
1042 Ga0466970_0048267
1043 Ga0466970_0152945
1044 Ga0466970_0200617
1045 Ga0466970_0635186
1046 Ga0466970_0728260
1047 Ga0466957_0000081
1048 Ga0466957_0014682
1049 Ga0466957_0155604
1050 Ga0466957_0828195
1051 Ga0466960_0128844
1052 Ga0466960_0598429
1053 Ga0466960_0678627
1054 Ga0466959_0029643
1055 Ga0466959_0044919
1056 Ga0466959_0179720
1057 Ga0466959_0317495
1058 Ga0466959_0344590
1059 Ga0466959_0927794
1060 Ga0466958_0321197
1061 Ga0466958_0523941
1062 Ga0466967_0004448
1063 Ga0466967_0124054
1064 Ga0466967_1934530
1065 Ga0495617_000012
1066 Ga0495617_016820
1067 Ga0495617_021284
1068 Ga0495617_034355
1069 Ga0495627_000475
1070 Ga0495627_003935
1071 Ga0495627_062735
1072 Ga0495603_0032245
1073 Ga0495603_0178361
1074 Ga0495590_0000498
1075 Ga0495590_0001605
1076 Ga0495590_0010457
1077 Ga0495590_0069538
1078 Ga0495590_0095945
1079 Ga0495590_0368379
1080 Ga0495591_008285
1081 Ga0495629_0004585
1082 Ga0495629_0011922
1083 Ga0495629_0724648
1084 Ga0495638_0002150
1085 Ga0495638_0082402
1086 Ga0495638_0112346
1087 Ga0495638_0276680
1088 Ga0495653_0067100
1089 Ga0495653_0109603
1090 Ga0495653_0131685
1091 Ga0495653_0155153
1092 Ga0495650_0000001
1093 Ga0495650_0016048
1094 Ga0495580_0054723
1095 Ga0495582_0041498
1096 Ga0495582_0073053
1097 Ga0495605_0000138
1098 Ga0495605_0000432
1099 Ga0495605_0001199
1100 Ga0495605_0012130
1101 Ga0495605_0028552
1102 Ga0495605_0395807
1103 Ga0495584_0001597
1104 Ga0495584_0002301
1105 Ga0495584_0006033
1106 Ga0495584_0008438
1107 Ga0495584_0036393
1108 Ga0495584_0037484
1109 Ga0495584_0043548
1110 Ga0495584_0061006
1111 Ga0495584_0068051
1112 Ga0495585_0009363
1113 Ga0495585_0021076
1114 Ga0495585_0023784
1115 Ga0495585_0041219
1116 Ga0495585_0053894
1117 Ga0495585_0072488
1118 Ga0495585_0081578
1119 Ga0495585_0324373
1120 Ga0495585_0410265
1121 Ga0495585_0410267
1122 Ga0495585_0526929
1123 Ga0495594_0067953
1124 Ga0495594_0130298
1125 Ga0495594_0306338
1126 Ga0495594_0482332
1127 Ga0495594_0559967
1128 Ga0495594_0572668
1129 Ga0495594_0587536
1130 Ga0495596_0005697
1131 Ga0495596_0006440
1132 Ga0495596_0015461
1133 Ga0495596_0038264
1134 Ga0495596_0044179
1135 Ga0495596_0092449
1136 Ga0495607_0002283
1137 Ga0495607_0002389
1138 Ga0495607_0004309
1139 Ga0495607_0008277
1140 Ga0495607_0008330
1141 Ga0495607_0008584
1142 Ga0495607_0032362
1143 Ga0495607_0036971
1144 Ga0495607_0057416
1145 Ga0495607_0064713
1146 Ga0495607_0070014
1147 Ga0495607_0078079
1148 Ga0495607_0080850
1149 Ga0495607_0200618
1150 Ga0495607_0226698
1151 Ga0495583_0000026
1152 Ga0495583_0000113
1153 Ga0495583_0004818
1154 Ga0495583_0008975
1155 Ga0495583_0026429
1156 Ga0495583_0143665
1157 Ga0495606_0002776
1158 Ga0495606_0022152
1159 Ga0495606_0166156
1160 Ga0495606_0173188
1161 Ga0495606_0240537
1162 Ga0495606_0352223
1163 Ga0495606_0394492
1164 Ga0495606_0444586
1165 Ga0495606_0467192
1166 Ga0495606_0654141
1167 Ga0495610_0241736
1168 Ga0495616_0000037
1169 Ga0495616_0002017
1170 Ga0495616_0013490
1171 Ga0495616_0015525
1172 Ga0495616_0022187
1173 Ga0495616_0033261
1174 Ga0495616_0034392
1175 Ga0495616_0074992
1176 Ga0495616_0121975
1177 Ga0495616_0152537
1178 Ga0495630_0030210
1179 Ga0495631_0000856
1180 Ga0495631_0004211
1181 Ga0495631_0024273
1182 Ga0495631_0037819
1183 Ga0495631_0041802
1184 Ga0495631_0054934
1185 Ga0495631_0073170
1186 Ga0495631_0115868
1187 Ga0495631_0148847
1188 Ga0495631_0219104
1189 Ga0495631_0302447
1190 Ga0495631_0319674
1191 Ga0495631_0362976
1192 Ga0495632_0000018
1193 Ga0495632_0000988
1194 Ga0495632_0002964
1195 Ga0495632_0040968
1196 Ga0495632_0211667
1197 Ga0495637_0026325
1198 Ga0495637_0229613
1199 Ga0495643_0004390
1200 Ga0495643_0077916
1201 Ga0495643_0101622
1202 Ga0495643_0153784
1203 Ga0495643_0253921
1204 Ga0495643_0285136
1205 Ga0495643_0288118
1206 Ga0495643_0430201
1207 Ga0495644_0000829
1208 Ga0495644_0002102
1209 Ga0495644_0004671
1210 Ga0495644_0007037
1211 Ga0495644_0020842
1212 Ga0495644_0142204
1213 Ga0495648_0000607
1214 Ga0495648_0002504
1215 Ga0495648_0006132
1216 Ga0495648_0006238
1217 Ga0495648_0011054
1218 Ga0495648_0017670
1219 Ga0495648_0038433
1220 Ga0495663_0002274
1221 Ga0495663_0004275
1222 Ga0495663_0050714
1223 Ga0495666_0009518
1224 Ga0495642_0000010
1225 Ga0495642_0000810
1226 Ga0495642_0007615
1227 Ga0495642_0008276
1228 Ga0495642_0018015
1229 Ga0495642_0045623
1230 Ga0495642_0059301
1231 Ga0495642_0078145
1232 Ga0495642_0103565
1233 Ga0495642_0105842
1234 Ga0495642_0122104
1235 Ga0495642_0228107
1236 Ga0495642_0439893
1237 Ga0495652_0025910
1238 Ga0495654_0004534
1239 Ga0495654_0016780
1240 Ga0495654_0019071
1241 Ga0495654_0164804
1242 Ga0495654_0346460
1243 Ga0495654_0410524
1244 Ga0495665_0021110
1245 Ga0495665_0190293
1246 Ga0495586_0002254
1247 Ga0495586_0102093
1248 Ga0495587_0039023
1249 Ga0495587_0048317
1250 Ga0495609_0000001
1251 Ga0495609_0000142
1252 Ga0495609_0001633
1253 Ga0495609_0006249
1254 Ga0495609_0008994
1255 Ga0495609_0041688
1256 Ga0495609_0110941
1257 Ga0495609_0202904
1258 Ga0495609_0328276
1259 Ga0495609_0339717
1260 Ga0495597_0000967
1261 Ga0495597_0001038
1262 Ga0495597_0001317
1263 Ga0495597_0002421
1264 Ga0495597_0007941
1265 Ga0495597_0009210
1266 Ga0495597_0037773
1267 Ga0495597_0084574
1268 Ga0495597_0222786
1269 Ga0495645_0100590
1270 Ga0495622_0001153
1271 Ga0495622_0087447
1272 Ga0495622_0148965
1273 Ga0495622_0271177
1274 Ga0495622_0516203
1275 Ga0495633_0001497
1276 Ga0495633_0004609
1277 Ga0495633_0012049
1278 Ga0495633_0076253
1279 Ga0495633_0096639
1280 Ga0495633_0413804
1281 Ga0495656_0003022
1282 Ga0495656_0030945
1283 Ga0495656_0031728
1284 Ga0495656_0134824
1285 Ga0495656_0371208
1286 Ga0495656_0548249
1287 Ga0495668_0000020
1288 Ga0495668_0000448
1289 Ga0495668_0001463
1290 Ga0495668_0005020
1291 Ga0495668_0005425
1292 Ga0495668_0005806
1293 Ga0495668_0006550
1294 Ga0495668_0017187
1295 Ga0495668_0074692
1296 Ga0495668_0100758
1297 Ga0495668_0374907
1298 Ga0495634_0022245
1299 Ga0495611_0001473
1300 Ga0495611_0001872
1301 Ga0495611_0005286
1302 Ga0495611_0006146
1303 Ga0495611_0009096
1304 Ga0495611_0029287
1305 Ga0495611_0077310
1306 Ga0495625_0011387
1307 Ga0495625_0027230
1308 Ga0495625_0038201
1309 Ga0495625_0068427
1310 Ga0495625_0093025
1311 Ga0495625_0180046
1312 Ga0495625_0204448
1313 Ga0495625_0260969
1314 Ga0495625_0571826
1315 Ga0495635_0002174
1316 Ga0495635_0082269
1317 Ga0495659_0000063
1318 Ga0495659_0000393
1319 Ga0495659_0001076
1320 Ga0495659_0209956
1321 Ga0495661_0000082
1322 Ga0495661_0001642
1323 Ga0495661_0002755
1324 Ga0495661_0003022
1325 Ga0495661_0016241
1326 Ga0495661_0025167
1327 Ga0495661_0027959
1328 Ga0495661_0057045
1329 Ga0495661_0071242
1330 Ga0495661_0076159
1331 Ga0495661_0084795
1332 Ga0495661_0156149
1333 Ga0495661_0157339
1334 Ga0495661_0229486
1335 Ga0495661_0264579
1336 Ga0495661_0328305
1337 Ga0495661_0340683
1338 Ga0495661_0411445
1339 Ga0495661_0461599
1340 Ga0495588_0000041
1341 Ga0495588_0004219
1342 Ga0495588_0028007
1343 Ga0495588_0041796
1344 Ga0495588_0076350
1345 Ga0495588_0085442
1346 Ga0495588_0106419
1347 Ga0495588_0160522
1348 Ga0495588_0241992
1349 Ga0495599_0664796
1350 Ga0495623_0011300
1351 Ga0495623_0061097
1352 Ga0495646_0665339
1353 Ga0495669_0000031
1354 Ga0495669_0001229
1355 Ga0495669_0006268
1356 Ga0495669_0013036
1357 Ga0495669_0045533
1358 Ga0495669_0091264
1359 Ga0495669_0281456
1360 Ga0495613_0132005
1361 Ga0495670_0003564
1362 Ga0495670_0003870
1363 Ga0495670_0008414
1364 Ga0495670_0026071
1365 Ga0495670_0054327
1366 Ga0495670_0424501
1367 Ga0495670_0626063
1368 Ga0495670_0659027
1369 Ga0495671_0000223
1370 Ga0495671_0003296
1371 Ga0495671_0010193
1372 Ga0495671_0015755
1373 Ga0495671_0472116
1374 Ga0495649_0060080
1375 Ga0495649_0189040
1376 Ga0495649_0326374
1377 Ga0495649_0437489
1378 Ga0495649_0603228
1379 Ga0495589_0000202
1380 Ga0495589_0000512
1381 Ga0495589_0000590
1382 Ga0495589_0005802
1383 Ga0495589_0010999
1384 Ga0495589_0128372
1385 Ga0495589_0202943
1386 Ga0495589_0213781
1387 Ga0495600_0109829
1388 Ga0495600_0128180
1389 Ga0495660_0000033
1390 Ga0495660_0001217
1391 Ga0495660_0009535
1392 Ga0495660_0010304
1393 Ga0495660_0020829
1394 Ga0495660_0046568
1395 Ga0495660_0057890
1396 Ga0495660_0082669
1397 Ga0495660_0158407
1398 Ga0495660_0202860
1399 Ga0495581_0029044
1400 Ga0495604_0010708
1401 Ga0495604_0029427
1402 Ga0495636_0027483
1403 Ga0495636_0040418
1404 Ga0495636_0047445
1405 Ga0495636_0091011
1406 Ga0495636_0179473
1407 Ga0495636_0190877
1408 Ga0495674_0027730
1409 Ga0495672_0002906
1410 Ga0495672_0006037
1411 Ga0495672_0008060
1412 Ga0495672_0018120
1413 Ga0495672_0041145
1414 Ga0495672_0251836
1415 Ga0495676_0000557
1416 Ga0495676_0108630
1417 Ga0495680_0002023
1418 Ga0495683_0012165
1419 Ga0495683_0015891
1420 Ga0495683_0033055
1421 Ga0495683_0055057
1422 Ga0495683_0185289
1423 Ga0495683_0204142
1424 Ga0495683_0233045
1425 Ga0495687_000027
1426 Ga0495687_000873
1427 Ga0495687_001578
1428 Ga0495687_001652
1429 Ga0495687_125600
1430 Ga0495687_141437
1431 Ga0495687_210874
1432 Ga0495675_0025189
1433 Ga0495675_0054323
1434 Ga0495675_0075347
1435 Ga0495677_0000001
1436 Ga0495677_0001227
1437 Ga0495677_0002166
1438 Ga0495677_0002826
1439 Ga0495677_0004714
1440 Ga0495677_0008424
1441 Ga0495677_0009451
1442 Ga0495677_0027443
1443 Ga0495677_0052856
1444 Ga0495677_0133649
1445 Ga0495677_0302147
1446 Ga0495679_008820
1447 Ga0495679_013635
1448 Ga0495679_015106
1449 Ga0495679_021968
1450 Ga0495685_000064
1451 Ga0495685_006568
1452 Ga0495685_017181
1453 Ga0495685_245879
1454 Ga0495673_0001902
1455 Ga0495673_0268033
1456 Ga0495681_0001529
1457 Ga0495681_0005675
1458 Ga0495681_0021213
1459 Ga0495681_0028278
1460 Ga0495681_0085901
1461 Ga0495681_0271662
1462 Ga0495686_0001196
1463 Ga0495686_0028791
1464 Ga0495686_0174505
1465 Ga0495686_0196460
1466 Ga0495686_0406145
1467 Ga0495593_0014985
1468 Ga0495593_0048083
1469 Ga0495602_0035851
1470 Ga0495614_0000545
1471 Ga0495614_0007999
1472 Ga0495614_0277988
1473 Ga0495626_0000159
1474 Ga0495626_0001535
1475 Ga0495626_0010066
1476 Ga0495626_0011759
1477 Ga0495626_0033374
1478 Ga0495626_0059779
1479 Ga0495626_0115214
1480 Ga0495626_0136195
1481 Ga0495626_0251633
1482 Ga0496100_0429566
1483 Ga0496100_0506678
1484 Ga0496100_0590989
1485 Ga0496101_0124556
1486 Ga0496101_0167862
1487 Ga0496101_0490652
1488 Ga0496102_0000150
1489 Ga0496102_0000816
1490 Ga0496102_0092747
1491 Ga0496102_0165902
1492 Ga0496102_0168007
1493 Ga0496102_0754752
1494 Ga0496103_0029187
1495 Ga0496103_0086436
1496 Ga0496103_0380291
1497 Ga0496103_0469115
1498 Ga0496103_0720547
1499 Ga0496104_0299635
1500 Ga0496104_0713267
1501 Ga0496105_0454230
1502 Ga0496105_0558584
1503 Ga0496105_0849774
1504 Ga0496106_0017435
1505 Ga0496107_0015847
1506 Ga0496107_0329398
1507 Ga0496107_0606913
1508 Ga0496107_0803235
1509 Ga0496107_1002236
1510 Ga0496108_0163188
1511 Ga0496108_1680676
1512 Ga0496109_0908616
1513 Ga0496109_1610079
1514 Ga0496110_0000036
1515 Ga0496110_0468673
1516 Ga0496110_0625138
1517 Ga0496111_0049467
1518 Ga0496111_0540277
1519 Ga0496111_0952526
1520 Ga0496111_0977582
1521 Ga0496112_0015901
1522 Ga0496112_1231337
1523 Ga0496113_0009981
1524 Ga0496113_0082996
1525 Ga0496113_0958790
1526 Ga0496114_0074048
1527 Ga0496115_0429508
1528 Ga0496115_0471420
1529 Ga0496116_0020670
1530 Ga0496117_0000001
1531 Ga0496118_0000002
1532 Ga0496119_0442628
1533 Ga0496121_0000709
1534 Ga0496121_0053734
1535 Ga0496122_0000255
1536 Ga0496122_0000660
1537 Ga0496122_0006595
1538 Ga0496122_0014117
1539 Ga0496122_0278087
1540 Ga0496123_0000936
1541 Ga0496123_0002832
1542 Ga0496123_0007467
1543 Ga0496123_0123759
1544 Ga0496123_0252167
1545 Ga0496124_0013535
1546 Ga0496124_0067859
1547 Ga0496124_0100106
1548 Ga0496124_0532066
1549 Ga0496124_0546748
1550 Ga0496124_0675300
1551 Ga0496125_0049086
1552 Ga0496125_0119039
1553 Ga0496125_0170718
1554 Ga0496125_0401794
1555 Ga0496125_0433316
1556 Ga0496125_0457406
1557 Ga0496126_0870075
1558 Ga0501308_000396
1559 Ga0501309_041317
1560 Ga0495678_000396
1561 Ga0495678_000436
1562 Ga0495678_018442
1563 Ga0495678_032135
1564 Ga0495678_128130
1565 Ga0495682_0000354
1566 Ga0495682_0001087
1567 Ga0495682_0006848
1568 Ga0495682_0014657
1569 Ga0495682_0155721
1570 Ga0501034_0747747
1571 Ga0501036_0845636
1572 Ga0501047_0225511
1573 Ga0501227_010529
1574 Ga0501235_176935
1575 Ga0501248_004688
1576 Ga0501279_000371
1577 Ga0501044_0514858
1578 Ga0466962_0030852
1579 Ga0466962_0166831
1580 Ga0466962_0245428
1581 Ga0466962_0485485
1582 Ga0466962_0610881
1583 2601668744
1584 2643791416
1585 2644212775
1586 2644354879
1587 2738737977
1588 2738842187
1589 2857551441
1590 2885082732
1591 2932414295
1592 2932416904

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02597

ThiS

ThiS family

13

93

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mdb-assembly2.cif.gz_B crystal structure of the ternary complex of full length centaurin alpha-1, kif13b fha domain, and ip4 0.8414 55 78
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8365 4 84
5djo-assembly1.cif.gz_A crystal structure of the cc1-fha tandem of kinesin-3 kif13a 0.8346 54 77
6jbz-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.8202 1 84
1jwb-assembly1.cif.gz_D-2 structure of the covalent acyl-adenylate form of the moeb-moad protein complex 0.8179 4 84
ID Description Score Start End Superfamily
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8798 3 84 3.10.20.30
af_P30748_1_81_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8599 3 84 3.10.20.30
af_D3ZM20_384_492_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8563 54 78 2.60.200.20
af_Q9VN82_366_475_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8523 56 77 2.60.200.20
af_F1RCT7_451_562_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.8461 54 78 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A7C4U1E9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.988 1 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A4R5W6M9-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9877 1 84 GO:0000166
GO:0006777
GO:1990133
AF-A0A840RNX6-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9866 1 84
AF-A0A839VF36-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9843 1 84
AF-A0A658R4Q9-F1-model_v4 Molybdopterin converting factor subunit 1 0.9828 1 84

Map