F481195
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 796 | 315 | 796 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_11686937|Ga0207674_116869371 |
| Length | 115 |
| Sequence | MGLLSRKPDPTSQSKSAKELTIINRLGLHARPSAMFVKTASRFKCEVWVEKDGERVNGKSIMGLMMLAAGQGSKLLVSCEGTDGDKALAEIEEIIRRKFDEDSRQRAFSAHPPHT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908018 | Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2 v1 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 128 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 199 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 216 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 218 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 233 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 234 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 235 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 236 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 295 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 296 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 297 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 303 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 311 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 315 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0.5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.38 |
| Nodule | 0 |
| Rhizoplane | 7.41 |
| Rhizosphere | 90.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhBV22_Contig_4286 | 2124908018 | Bacteria | 743 |
| 2 | 2214801627 | 2209111006 | Bacteria | 706 |
| 3 | JGI24744J21845_10015577 | 3300002077 | Bacteria | 1518 |
| 4 | JGI24742J22300_10114521 | 3300002244 | Bacteria | 529 |
| 5 | JGI25405J52794_10140164 | 3300003911 | Bacteria | 549 |
| 6 | Ga0065704_10016897 | 3300005289 | Bacteria | 1268 |
| 7 | Ga0065704_10023391 | 3300005289 | Bacteria | 1538 |
| 8 | Ga0065704_10025131 | 3300005289 | Bacteria | 1113 |
| 9 | Ga0065712_10007221 | 3300005290 | Bacteria | 3134 |
| 10 | Ga0065712_10071598 | 3300005290 | Bacteria | 5159 |
| 11 | Ga0065712_10252632 | 3300005290 | Unclassified | 956 |
| 12 | Ga0065715_10001841 | 3300005293 | Bacteria | 5511 |
| 13 | Ga0065715_10009791 | 3300005293 | Unclassified | 2796 |
| 14 | Ga0065715_10010413 | 3300005293 | Bacteria | 4159 |
| 15 | Ga0065715_10200500 | 3300005293 | Bacteria | 1356 |
| 16 | Ga0065715_10262112 | 3300005293 | Unclassified | 1119 |
| 17 | Ga0065715_10529236 | 3300005293 | Unclassified | 755 |
| 18 | Ga0065707_10470852 | 3300005295 | Bacteria | 782 |
| 19 | Ga0070658_10004979 | 3300005327 | Bacteria | 10822 |
| 20 | Ga0070658_11118709 | 3300005327 | Bacteria | 685 |
| 21 | Ga0070676_10015290 | 3300005328 | Bacteria | 4233 |
| 22 | Ga0070676_10020144 | 3300005328 | Bacteria | 3719 |
| 23 | Ga0070676_10427984 | 3300005328 | Unclassified | 926 |
| 24 | Ga0070676_10670652 | 3300005328 | Unclassified | 754 |
| 25 | Ga0070676_10937765 | 3300005328 | Bacteria | 647 |
| 26 | Ga0070683_100119052 | 3300005329 | Bacteria | 2494 |
| 27 | Ga0070683_100167685 | 3300005329 | Bacteria | 2084 |
| 28 | Ga0070683_100279200 | 3300005329 | Bacteria | 1589 |
| 29 | Ga0070683_100296687 | 3300005329 | Unclassified | 1537 |
| 30 | Ga0070690_100122694 | 3300005330 | Unclassified | 1746 |
| 31 | Ga0070690_101152542 | 3300005330 | Unclassified | 617 |
| 32 | Ga0070690_101206321 | 3300005330 | Bacteria | 604 |
| 33 | Ga0070670_100014442 | 3300005331 | Bacteria | 6779 |
| 34 | Ga0070670_100054028 | 3300005331 | Bacteria | 3448 |
| 35 | Ga0070670_100612607 | 3300005331 | Bacteria | 975 |
| 36 | Ga0070677_10122457 | 3300005333 | Bacteria | 1176 |
| 37 | Ga0068869_100249434 | 3300005334 | Bacteria | 1417 |
| 38 | Ga0068869_101400217 | 3300005334 | Bacteria | 619 |
| 39 | Ga0070666_10032117 | 3300005335 | Unclassified | 3468 |
| 40 | Ga0070666_10840130 | 3300005335 | Bacteria | 677 |
| 41 | Ga0070666_11280780 | 3300005335 | Unclassified | 547 |
| 42 | Ga0070680_100159576 | 3300005336 | Bacteria | 1894 |
| 43 | Ga0070682_100128511 | 3300005337 | Bacteria | 1712 |
| 44 | Ga0070682_100269638 | 3300005337 | Bacteria | 1236 |
| 45 | Ga0070682_101319282 | 3300005337 | Unclassified | 614 |
| 46 | Ga0068868_100014966 | 3300005338 | Bacteria | 5728 |
| 47 | Ga0068868_100084610 | 3300005338 | Bacteria | 2547 |
| 48 | Ga0068868_100430792 | 3300005338 | Bacteria | 1144 |
| 49 | Ga0068868_101119140 | 3300005338 | Unclassified | 725 |
| 50 | Ga0070660_100018375 | 3300005339 | Bacteria | 5108 |
| 51 | Ga0070660_100262447 | 3300005339 | Bacteria | 1411 |
| 52 | Ga0070660_100547985 | 3300005339 | Bacteria | 965 |
| 53 | Ga0070660_101680443 | 3300005339 | Unclassified | 541 |
| 54 | Ga0070689_100028937 | 3300005340 | Bacteria | 4190 |
| 55 | Ga0070689_100127380 | 3300005340 | Bacteria | 2039 |
| 56 | Ga0070689_100203517 | 3300005340 | Bacteria | 1617 |
| 57 | Ga0070689_101200323 | 3300005340 | Bacteria | 681 |
| 58 | Ga0070691_10355129 | 3300005341 | Bacteria | 815 |
| 59 | Ga0070687_100414572 | 3300005343 | Unclassified | 887 |
| 60 | Ga0070661_100106886 | 3300005344 | Unclassified | 2086 |
| 61 | Ga0070661_100116256 | 3300005344 | Bacteria | 2001 |
| 62 | Ga0070661_100330819 | 3300005344 | Bacteria | 1192 |
| 63 | Ga0070668_100019359 | 3300005347 | Bacteria | 5123 |
| 64 | Ga0070668_100052697 | 3300005347 | Bacteria | 3136 |
| 65 | Ga0070668_100514564 | 3300005347 | Bacteria | 1038 |
| 66 | Ga0070669_100002855 | 3300005353 | Bacteria | 12482 |
| 67 | Ga0070669_100325477 | 3300005353 | Bacteria | 1242 |
| 68 | Ga0070669_100901555 | 3300005353 | Unclassified | 755 |
| 69 | Ga0070675_100012615 | 3300005354 | Bacteria | 6626 |
| 70 | Ga0070675_100016119 | 3300005354 | Bacteria | 5924 |
| 71 | Ga0070675_100027188 | 3300005354 | Bacteria | 4595 |
| 72 | Ga0070675_100127457 | 3300005354 | Bacteria | 2167 |
| 73 | Ga0070675_100147760 | 3300005354 | Unclassified | 2013 |
| 74 | Ga0070675_100187866 | 3300005354 | Unclassified | 1789 |
| 75 | Ga0070675_100458656 | 3300005354 | Bacteria | 1144 |
| 76 | Ga0070675_101242035 | 3300005354 | Bacteria | 686 |
| 77 | Ga0070675_101437073 | 3300005354 | Unclassified | 636 |
| 78 | Ga0070671_100001422 | 3300005355 | Bacteria | 17892 |
| 79 | Ga0070671_100031408 | 3300005355 | Bacteria | 4387 |
| 80 | Ga0070671_100816365 | 3300005355 | Bacteria | 812 |
| 81 | Ga0070674_100002179 | 3300005356 | Bacteria | 10766 |
| 82 | Ga0070674_100084695 | 3300005356 | Bacteria | 2274 |
| 83 | Ga0070674_101103438 | 3300005356 | Unclassified | 701 |
| 84 | Ga0070674_101577726 | 3300005356 | Bacteria | 591 |
| 85 | Ga0070673_100000434 | 3300005364 | Bacteria | 22067 |
| 86 | Ga0070673_100024350 | 3300005364 | Unclassified | 4438 |
| 87 | Ga0070673_100030668 | 3300005364 | Bacteria | 4028 |
| 88 | Ga0070673_100462143 | 3300005364 | Bacteria | 1143 |
| 89 | Ga0070688_100011701 | 3300005365 | Bacteria | 4887 |
| 90 | Ga0070688_100036100 | 3300005365 | Bacteria | 3005 |
| 91 | Ga0070688_100124857 | 3300005365 | Bacteria | 1729 |
| 92 | Ga0070688_100191855 | 3300005365 | Unclassified | 1424 |
| 93 | Ga0070688_100715429 | 3300005365 | Unclassified | 777 |
| 94 | Ga0070688_101238095 | 3300005365 | Unclassified | 601 |
| 95 | Ga0070659_100001816 | 3300005366 | Bacteria | 15366 |
| 96 | Ga0070659_100151911 | 3300005366 | Bacteria | 1889 |
| 97 | Ga0070659_100878177 | 3300005366 | Unclassified | 783 |
| 98 | Ga0070667_100030098 | 3300005367 | Bacteria | 4527 |
| 99 | Ga0070667_100075007 | 3300005367 | Bacteria | 2887 |
| 100 | Ga0070667_100100279 | 3300005367 | Unclassified | 2501 |
| 101 | Ga0070667_100538488 | 3300005367 | Bacteria | 1072 |
| 102 | Ga0070667_101970243 | 3300005367 | Bacteria | 550 |
| 103 | Ga0070709_11117078 | 3300005434 | Bacteria | 631 |
| 104 | Ga0070709_11795639 | 3300005434 | Bacteria | 502 |
| 105 | Ga0070714_100010616 | 3300005435 | Bacteria | 7287 |
| 106 | Ga0070714_100338086 | 3300005435 | Bacteria | 1411 |
| 107 | Ga0070714_100673824 | 3300005435 | Bacteria | 997 |
| 108 | Ga0070713_100027581 | 3300005436 | Bacteria | 4472 |
| 109 | Ga0070713_100058836 | 3300005436 | Bacteria | 3207 |
| 110 | Ga0070713_100180724 | 3300005436 | Bacteria | 1895 |
| 111 | Ga0070713_100375402 | 3300005436 | Unclassified | 1324 |
| 112 | Ga0070713_101019021 | 3300005436 | Unclassified | 799 |
| 113 | Ga0070710_10160008 | 3300005437 | Bacteria | 1395 |
| 114 | Ga0070711_100290062 | 3300005439 | Bacteria | 1297 |
| 115 | Ga0070711_100600374 | 3300005439 | Bacteria | 918 |
| 116 | Ga0070711_100906780 | 3300005439 | Bacteria | 752 |
| 117 | Ga0070705_100100550 | 3300005440 | Bacteria | 1825 |
| 118 | Ga0070705_100111839 | 3300005440 | Bacteria | 1746 |
| 119 | Ga0070700_100019271 | 3300005441 | Bacteria | 3935 |
| 120 | Ga0070694_100638455 | 3300005444 | Bacteria | 861 |
| 121 | Ga0070708_100050425 | 3300005445 | Bacteria | 3685 |
| 122 | Ga0070708_100057319 | 3300005445 | Bacteria | 3468 |
| 123 | Ga0070708_100259124 | 3300005445 | Bacteria | 1635 |
| 124 | Ga0070708_100738633 | 3300005445 | Unclassified | 926 |
| 125 | Ga0070663_100027393 | 3300005455 | Bacteria | 3870 |
| 126 | Ga0070663_100101409 | 3300005455 | Unclassified | 2148 |
| 127 | Ga0070663_100185891 | 3300005455 | Bacteria | 1614 |
| 128 | Ga0070663_101640344 | 3300005455 | Unclassified | 574 |
| 129 | Ga0070678_100128423 | 3300005456 | Bacteria | 2010 |
| 130 | Ga0070678_100701535 | 3300005456 | Unclassified | 912 |
| 131 | Ga0070662_100064088 | 3300005457 | Bacteria | 2690 |
| 132 | Ga0070662_100434665 | 3300005457 | Bacteria | 1087 |
| 133 | Ga0070662_100737825 | 3300005457 | Bacteria | 835 |
| 134 | Ga0070662_100842338 | 3300005457 | Bacteria | 781 |
| 135 | Ga0070681_10088153 | 3300005458 | Unclassified | 3055 |
| 136 | Ga0068867_100039740 | 3300005459 | Bacteria | 3431 |
| 137 | Ga0068867_100200835 | 3300005459 | Unclassified | 1596 |
| 138 | Ga0070685_10018866 | 3300005466 | Bacteria | 3715 |
| 139 | Ga0070706_100063533 | 3300005467 | Unclassified | 3412 |
| 140 | Ga0070706_100184319 | 3300005467 | Bacteria | 1950 |
| 141 | Ga0070706_100277823 | 3300005467 | Bacteria | 1563 |
| 142 | Ga0070706_100508317 | 3300005467 | Bacteria | 1121 |
| 143 | Ga0070706_100730522 | 3300005467 | Bacteria | 918 |
| 144 | Ga0070706_100902190 | 3300005467 | Unclassified | 816 |
| 145 | Ga0070706_101088350 | 3300005467 | Bacteria | 736 |
| 146 | Ga0070706_101385031 | 3300005467 | Bacteria | 644 |
| 147 | Ga0070707_100001892 | 3300005468 | Bacteria | 20056 |
| 148 | Ga0070707_100026239 | 3300005468 | Bacteria | 5530 |
| 149 | Ga0070707_100096169 | 3300005468 | Bacteria | 2868 |
| 150 | Ga0070707_100167231 | 3300005468 | Unclassified | 2143 |
| 151 | Ga0070707_101099745 | 3300005468 | Bacteria | 761 |
| 152 | Ga0070707_101696307 | 3300005468 | Bacteria | 599 |
| 153 | Ga0070707_101812734 | 3300005468 | Unclassified | 577 |
| 154 | Ga0070698_100000694 | 3300005471 | Bacteria | 35925 |
| 155 | Ga0070698_100001080 | 3300005471 | Bacteria | 29961 |
| 156 | Ga0070698_100047049 | 3300005471 | Unclassified | 4410 |
| 157 | Ga0070698_100065927 | 3300005471 | Bacteria | 3646 |
| 158 | Ga0070698_101603143 | 3300005471 | Bacteria | 603 |
| 159 | Ga0070699_100148455 | 3300005518 | Bacteria | 2072 |
| 160 | Ga0070699_100625174 | 3300005518 | Unclassified | 982 |
| 161 | Ga0070699_101785566 | 3300005518 | Bacteria | 563 |
| 162 | Ga0070679_100402944 | 3300005530 | Bacteria | 1314 |
| 163 | Ga0070684_100001876 | 3300005535 | Bacteria | 15383 |
| 164 | Ga0070684_100002566 | 3300005535 | Bacteria | 13413 |
| 165 | Ga0070684_101042196 | 3300005535 | Bacteria | 768 |
| 166 | Ga0070697_100013199 | 3300005536 | Bacteria | 6477 |
| 167 | Ga0070697_100044378 | 3300005536 | Bacteria | 3600 |
| 168 | Ga0070697_100090545 | 3300005536 | Unclassified | 2528 |
| 169 | Ga0070697_100711788 | 3300005536 | Bacteria | 886 |
| 170 | Ga0070697_101030954 | 3300005536 | Bacteria | 732 |
| 171 | Ga0068853_101657855 | 3300005539 | Unclassified | 620 |
| 172 | Ga0070672_100013002 | 3300005543 | Bacteria | 5866 |
| 173 | Ga0070672_100185002 | 3300005543 | Unclassified | 1737 |
| 174 | Ga0070672_100394302 | 3300005543 | Bacteria | 1186 |
| 175 | Ga0070672_100995905 | 3300005543 | Bacteria | 743 |
| 176 | Ga0070686_100073886 | 3300005544 | Bacteria | 2239 |
| 177 | Ga0070686_101400959 | 3300005544 | Unclassified | 587 |
| 178 | Ga0070695_100116340 | 3300005545 | Bacteria | 1823 |
| 179 | Ga0070695_100302844 | 3300005545 | Bacteria | 1182 |
| 180 | Ga0070696_101588245 | 3300005546 | Bacteria | 562 |
| 181 | Ga0070693_100719642 | 3300005547 | Bacteria | 733 |
| 182 | Ga0070693_100953371 | 3300005547 | Bacteria | 646 |
| 183 | Ga0070665_100004891 | 3300005548 | Bacteria | 13902 |
| 184 | Ga0070665_100029270 | 3300005548 | Bacteria | 5544 |
| 185 | Ga0070665_100216799 | 3300005548 | Bacteria | 1914 |
| 186 | Ga0070665_100293320 | 3300005548 | Unclassified | 1629 |
| 187 | Ga0070665_101982486 | 3300005548 | Unclassified | 587 |
| 188 | Ga0068855_100010853 | 3300005563 | Bacteria | 10998 |
| 189 | Ga0068855_102523784 | 3300005563 | Unclassified | 511 |
| 190 | Ga0070664_100043515 | 3300005564 | Bacteria | 3789 |
| 191 | Ga0070664_100068902 | 3300005564 | Bacteria | 3025 |
| 192 | Ga0070664_100267663 | 3300005564 | Bacteria | 1539 |
| 193 | Ga0070664_100616727 | 3300005564 | Bacteria | 1007 |
| 194 | Ga0068854_100374280 | 3300005578 | Bacteria | 1172 |
| 195 | Ga0068854_100460791 | 3300005578 | Unclassified | 1063 |
| 196 | Ga0068856_100073290 | 3300005614 | Bacteria | 3391 |
| 197 | Ga0068856_100306780 | 3300005614 | Bacteria | 1605 |
| 198 | Ga0068856_101144563 | 3300005614 | Bacteria | 795 |
| 199 | Ga0068856_101434394 | 3300005614 | Unclassified | 704 |
| 200 | Ga0070702_100419396 | 3300005615 | Bacteria | 963 |
| 201 | Ga0068859_100312430 | 3300005617 | Bacteria | 1665 |
| 202 | Ga0068859_103122426 | 3300005617 | Bacteria | 505 |
| 203 | Ga0068864_100328601 | 3300005618 | Bacteria | 1438 |
| 204 | Ga0068864_100345941 | 3300005618 | Unclassified | 1402 |
| 205 | Ga0068864_100415696 | 3300005618 | Bacteria | 1280 |
| 206 | Ga0068864_101221358 | 3300005618 | Unclassified | 751 |
| 207 | Ga0068864_101653289 | 3300005618 | Unclassified | 645 |
| 208 | Ga0068866_10360263 | 3300005718 | Bacteria | 927 |
| 209 | Ga0068866_10615549 | 3300005718 | Bacteria | 735 |
| 210 | Ga0068870_10777064 | 3300005840 | Bacteria | 667 |
| 211 | Ga0068863_100026675 | 3300005841 | Bacteria | 5509 |
| 212 | Ga0068863_100354495 | 3300005841 | Unclassified | 1429 |
| 213 | Ga0068863_100718501 | 3300005841 | Bacteria | 994 |
| 214 | Ga0068863_101120860 | 3300005841 | Unclassified | 792 |
| 215 | Ga0068858_100045107 | 3300005842 | Unclassified | 4085 |
| 216 | Ga0068858_100134412 | 3300005842 | Bacteria | 2320 |
| 217 | Ga0068858_100322499 | 3300005842 | Bacteria | 1477 |
| 218 | Ga0068858_100824044 | 3300005842 | Unclassified | 906 |
| 219 | Ga0068860_100000202 | 3300005843 | Bacteria | 94520 |
| 220 | Ga0068860_100129957 | 3300005843 | Bacteria | 2416 |
| 221 | Ga0068860_100335721 | 3300005843 | Bacteria | 1485 |
| 222 | Ga0068860_101228452 | 3300005843 | Bacteria | 770 |
| 223 | Ga0068862_100210711 | 3300005844 | Bacteria | 1756 |
| 224 | Ga0068862_102448839 | 3300005844 | Unclassified | 534 |
| 225 | Ga0081455_10002512 | 3300005937 | Bacteria | 21774 |
| 226 | Ga0081455_10021948 | 3300005937 | Bacteria | 5979 |
| 227 | Ga0081455_10023390 | 3300005937 | Bacteria | 5750 |
| 228 | Ga0081455_10034285 | 3300005937 | Bacteria | 4550 |
| 229 | Ga0081455_10078628 | 3300005937 | Bacteria | 2710 |
| 230 | Ga0081455_10127226 | 3300005937 | Bacteria | 1997 |
| 231 | Ga0081455_10138759 | 3300005937 | Unclassified | 1891 |
| 232 | Ga0081455_10449976 | 3300005937 | Bacteria | 880 |
| 233 | Ga0081540_1001119 | 3300005983 | Bacteria | 23729 |
| 234 | Ga0081540_1009553 | 3300005983 | Bacteria | 6674 |
| 235 | Ga0081540_1094483 | 3300005983 | Unclassified | 1306 |
| 236 | Ga0081540_1196661 | 3300005983 | Unclassified | 737 |
| 237 | Ga0081539_10000052 | 3300005985 | Bacteria | 268240 |
| 238 | Ga0081539_10000671 | 3300005985 | Bacteria | 68678 |
| 239 | Ga0081539_10021753 | 3300005985 | Unclassified | 4270 |
| 240 | Ga0081539_10107129 | 3300005985 | Bacteria | 1414 |
| 241 | Ga0081539_10133477 | 3300005985 | Bacteria | 1216 |
| 242 | Ga0070717_10007003 | 3300006028 | Bacteria | 8343 |
| 243 | Ga0070717_10072092 | 3300006028 | Bacteria | 2883 |
| 244 | Ga0070717_10147471 | 3300006028 | Bacteria | 2033 |
| 245 | Ga0070717_10158543 | 3300006028 | Unclassified | 1962 |
| 246 | Ga0070717_11368278 | 3300006028 | Bacteria | 643 |
| 247 | Ga0070717_11577386 | 3300006028 | Bacteria | 595 |
| 248 | Ga0075363_100599836 | 3300006048 | Bacteria | 660 |
| 249 | Ga0070715_10095844 | 3300006163 | Bacteria | 1374 |
| 250 | Ga0070715_10121076 | 3300006163 | Unclassified | 1248 |
| 251 | Ga0070716_100111540 | 3300006173 | Bacteria | 1696 |
| 252 | Ga0070716_100157119 | 3300006173 | Bacteria | 1469 |
| 253 | Ga0070712_100034753 | 3300006175 | Bacteria | 3417 |
| 254 | Ga0070712_100122098 | 3300006175 | Unclassified | 1961 |
| 255 | Ga0070712_100148771 | 3300006175 | Bacteria | 1795 |
| 256 | Ga0070712_100259798 | 3300006175 | Bacteria | 1391 |
| 257 | Ga0070712_100403413 | 3300006175 | Bacteria | 1130 |
| 258 | Ga0075362_10039378 | 3300006177 | Bacteria | 2078 |
| 259 | Ga0075362_10623669 | 3300006177 | Bacteria | 558 |
| 260 | Ga0075366_10094854 | 3300006195 | Bacteria | 1789 |
| 261 | Ga0075366_10167754 | 3300006195 | Bacteria | 1332 |
| 262 | Ga0097621_100008612 | 3300006237 | Bacteria | 7355 |
| 263 | Ga0097621_100018579 | 3300006237 | Bacteria | 5315 |
| 264 | Ga0068871_100025764 | 3300006358 | Bacteria | 4580 |
| 265 | Ga0068871_100051125 | 3300006358 | Bacteria | 3345 |
| 266 | Ga0068871_100223691 | 3300006358 | Unclassified | 1631 |
| 267 | Ga0068871_100443318 | 3300006358 | Bacteria | 1163 |
| 268 | Ga0068871_102028374 | 3300006358 | Unclassified | 548 |
| 269 | Ga0075428_100243578 | 3300006844 | Bacteria | 1940 |
| 270 | Ga0075433_10719387 | 3300006852 | Bacteria | 874 |
| 271 | Ga0075433_11461854 | 3300006852 | Bacteria | 591 |
| 272 | Ga0075434_100875689 | 3300006871 | Bacteria | 913 |
| 273 | Ga0075434_102006986 | 3300006871 | Bacteria | 584 |
| 274 | Ga0068865_100006676 | 3300006881 | Bacteria | 7057 |
| 275 | Ga0068865_100109714 | 3300006881 | Bacteria | 2034 |
| 276 | Ga0068865_100195749 | 3300006881 | Bacteria | 1566 |
| 277 | Ga0068865_100488740 | 3300006881 | Unclassified | 1024 |
| 278 | Ga0075436_100044115 | 3300006914 | Bacteria | 3074 |
| 279 | Ga0097620_100312468 | 3300006931 | Bacteria | 1665 |
| 280 | Ga0097620_103121585 | 3300006931 | Bacteria | 505 |
| 281 | Ga0075435_101512514 | 3300007076 | Bacteria | 589 |
| 282 | Ga0099794_10406574 | 3300007265 | Bacteria | 711 |
| 283 | Ga0099795_10107716 | 3300007788 | Bacteria | 1101 |
| 284 | Ga0105245_10327619 | 3300009098 | Bacteria | 1510 |
| 285 | Ga0105245_10718427 | 3300009098 | Bacteria | 1033 |
| 286 | Ga0105247_10097735 | 3300009101 | Unclassified | 1873 |
| 287 | Ga0114129_10631873 | 3300009147 | Bacteria | 1384 |
| 288 | Ga0114129_10647695 | 3300009147 | Bacteria | 1364 |
| 289 | Ga0114129_10702553 | 3300009147 | Bacteria | 1299 |
| 290 | Ga0105243_10159811 | 3300009148 | Bacteria | 1942 |
| 291 | Ga0105243_10973861 | 3300009148 | Bacteria | 849 |
| 292 | Ga0105241_11041825 | 3300009174 | Bacteria | 767 |
| 293 | Ga0105242_10363679 | 3300009176 | Bacteria | 1340 |
| 294 | Ga0105242_11989553 | 3300009176 | Bacteria | 623 |
| 295 | Ga0105242_12888484 | 3300009176 | Bacteria | 531 |
| 296 | Ga0105248_11110317 | 3300009177 | Bacteria | 894 |
| 297 | Ga0105248_12035804 | 3300009177 | Bacteria | 652 |
| 298 | Ga0105237_10015766 | 3300009545 | Bacteria | 7859 |
| 299 | Ga0105237_11684399 | 3300009545 | Bacteria | 641 |
| 300 | Ga0105237_11997933 | 3300009545 | Unclassified | 588 |
| 301 | Ga0105237_12093754 | 3300009545 | Bacteria | 575 |
| 302 | Ga0105238_11034795 | 3300009551 | Bacteria | 842 |
| 303 | Ga0105249_10186698 | 3300009553 | Bacteria | 2020 |
| 304 | Ga0105249_12064964 | 3300009553 | Bacteria | 643 |
| 305 | Ga0099796_10038160 | 3300010159 | Bacteria | 1610 |
| 306 | Ga0099796_10222535 | 3300010159 | Bacteria | 774 |
| 307 | Ga0105239_10211920 | 3300010375 | Unclassified | 2172 |
| 308 | Ga0105239_10437507 | 3300010375 | Bacteria | 1483 |
| 309 | Ga0105239_11326923 | 3300010375 | Bacteria | 830 |
| 310 | Ga0105239_12048462 | 3300010375 | Bacteria | 665 |
| 311 | Ga0105246_10815966 | 3300011119 | Bacteria | 829 |
| 312 | Ga0105246_10912459 | 3300011119 | Unclassified | 789 |
| 313 | Ga0157373_10549474 | 3300013100 | Bacteria | 837 |
| 314 | Ga0157371_10263893 | 3300013102 | Bacteria | 1242 |
| 315 | Ga0157371_10737881 | 3300013102 | Bacteria | 739 |
| 316 | Ga0157371_11104824 | 3300013102 | Bacteria | 608 |
| 317 | Ga0157370_10368050 | 3300013104 | Bacteria | 1324 |
| 318 | Ga0157374_10009530 | 3300013296 | Bacteria | 8338 |
| 319 | Ga0157374_10030397 | 3300013296 | Bacteria | 4904 |
| 320 | Ga0157374_10117230 | 3300013296 | Bacteria | 2566 |
| 321 | Ga0157374_10175300 | 3300013296 | Unclassified | 2093 |
| 322 | Ga0157374_10236283 | 3300013296 | Bacteria | 1796 |
| 323 | Ga0157374_10302879 | 3300013296 | Unclassified | 1581 |
| 324 | Ga0157374_10571099 | 3300013296 | Bacteria | 1139 |
| 325 | Ga0157374_11154256 | 3300013296 | Unclassified | 796 |
| 326 | Ga0157374_12249492 | 3300013296 | Bacteria | 572 |
| 327 | Ga0157378_10033410 | 3300013297 | Bacteria | 4547 |
| 328 | Ga0157378_10062015 | 3300013297 | Bacteria | 3338 |
| 329 | Ga0157378_10079408 | 3300013297 | Bacteria | 2963 |
| 330 | Ga0157378_10158723 | 3300013297 | Bacteria | 2113 |
| 331 | Ga0157378_11861491 | 3300013297 | Bacteria | 650 |
| 332 | Ga0157378_13082920 | 3300013297 | Unclassified | 517 |
| 333 | Ga0163162_10002841 | 3300013306 | Bacteria | 16482 |
| 334 | Ga0163162_10149344 | 3300013306 | Bacteria | 2454 |
| 335 | Ga0163162_10440967 | 3300013306 | Bacteria | 1434 |
| 336 | Ga0163162_10632206 | 3300013306 | Unclassified | 1195 |
| 337 | Ga0157372_10023674 | 3300013307 | Bacteria | 6662 |
| 338 | Ga0157372_10277298 | 3300013307 | Bacteria | 1949 |
| 339 | Ga0157372_11404020 | 3300013307 | Bacteria | 805 |
| 340 | Ga0157372_11920510 | 3300013307 | Unclassified | 680 |
| 341 | Ga0157375_10004600 | 3300013308 | Bacteria | 11990 |
| 342 | Ga0157375_10005288 | 3300013308 | Bacteria | 11210 |
| 343 | Ga0157375_10019367 | 3300013308 | Bacteria | 6189 |
| 344 | Ga0157375_10028471 | 3300013308 | Bacteria | 5236 |
| 345 | Ga0157375_11399458 | 3300013308 | Bacteria | 824 |
| 346 | Ga0157375_11549503 | 3300013308 | Unclassified | 783 |
| 347 | Ga0157375_12847759 | 3300013308 | Bacteria | 578 |
| 348 | Ga0157375_13319466 | 3300013308 | Unclassified | 536 |
| 349 | Ga0163163_10669810 | 3300014325 | Bacteria | 1101 |
| 350 | Ga0163163_10693307 | 3300014325 | Unclassified | 1082 |
| 351 | Ga0163163_11180473 | 3300014325 | Bacteria | 828 |
| 352 | Ga0163163_11832804 | 3300014325 | Bacteria | 667 |
| 353 | Ga0163163_12952853 | 3300014325 | Bacteria | 530 |
| 354 | Ga0157380_12644569 | 3300014326 | Bacteria | 568 |
| 355 | Ga0157377_10008830 | 3300014745 | Bacteria | 4929 |
| 356 | Ga0157377_11140444 | 3300014745 | Unclassified | 600 |
| 357 | Ga0157379_11017798 | 3300014968 | Bacteria | 790 |
| 358 | Ga0157379_11384942 | 3300014968 | Bacteria | 681 |
| 359 | Ga0157376_10079358 | 3300014969 | Unclassified | 2813 |
| 360 | Ga0157376_10103786 | 3300014969 | Unclassified | 2490 |
| 361 | Ga0157376_10291847 | 3300014969 | Bacteria | 1540 |
| 362 | Ga0157376_10737273 | 3300014969 | Unclassified | 993 |
| 363 | Ga0157376_12594521 | 3300014969 | Bacteria | 547 |
| 364 | Ga0157376_12684503 | 3300014969 | Bacteria | 538 |
| 365 | Ga0182007_10043093 | 3300015262 | Bacteria | 1501 |
| 366 | Ga0182007_10082446 | 3300015262 | Bacteria | 1055 |
| 367 | Ga0163161_10209079 | 3300017792 | Bacteria | 1507 |
| 368 | Ga0163161_10403271 | 3300017792 | Bacteria | 1097 |
| 369 | Ga0197907_10816653 | 3300020069 | Bacteria | 642 |
| 370 | Ga0206355_1274465 | 3300020076 | Bacteria | 700 |
| 371 | Ga0224712_10696313 | 3300022467 | Bacteria | 500 |
| 372 | Ga0207666_1000131 | 3300025271 | Bacteria | 11528 |
| 373 | Ga0207673_1000321 | 3300025290 | Bacteria | 4814 |
| 374 | Ga0207673_1009634 | 3300025290 | Bacteria | 1236 |
| 375 | Ga0207673_1025434 | 3300025290 | Bacteria | 810 |
| 376 | Ga0207697_10000116 | 3300025315 | Bacteria | 37551 |
| 377 | Ga0207697_10002751 | 3300025315 | Bacteria | 8971 |
| 378 | Ga0207697_10008048 | 3300025315 | Bacteria | 4651 |
| 379 | Ga0207697_10061473 | 3300025315 | Bacteria | 1563 |
| 380 | Ga0207697_10140126 | 3300025315 | Bacteria | 1049 |
| 381 | Ga0207697_10153082 | 3300025315 | Unclassified | 1004 |
| 382 | Ga0207697_10428559 | 3300025315 | Bacteria | 587 |
| 383 | Ga0207653_10004352 | 3300025885 | Bacteria | 4446 |
| 384 | Ga0207653_10055425 | 3300025885 | Bacteria | 1327 |
| 385 | Ga0207682_10156735 | 3300025893 | Bacteria | 1030 |
| 386 | Ga0207692_10064534 | 3300025898 | Unclassified | 1907 |
| 387 | Ga0207692_10171367 | 3300025898 | Bacteria | 1258 |
| 388 | Ga0207642_10514700 | 3300025899 | Bacteria | 734 |
| 389 | Ga0207642_10526858 | 3300025899 | Bacteria | 727 |
| 390 | Ga0207710_10073332 | 3300025900 | Unclassified | 1574 |
| 391 | Ga0207688_10003621 | 3300025901 | Bacteria | 8433 |
| 392 | Ga0207688_10046425 | 3300025901 | Bacteria | 2425 |
| 393 | Ga0207688_10283819 | 3300025901 | Bacteria | 1009 |
| 394 | Ga0207680_10046070 | 3300025903 | Bacteria | 2576 |
| 395 | Ga0207680_10399730 | 3300025903 | Bacteria | 971 |
| 396 | Ga0207647_10013194 | 3300025904 | Bacteria | 5738 |
| 397 | Ga0207685_10117831 | 3300025905 | Unclassified | 1161 |
| 398 | Ga0207699_10241843 | 3300025906 | Unclassified | 1240 |
| 399 | Ga0207699_10490193 | 3300025906 | Bacteria | 886 |
| 400 | Ga0207645_10019788 | 3300025907 | Bacteria | 4410 |
| 401 | Ga0207645_10089619 | 3300025907 | Bacteria | 1978 |
| 402 | Ga0207645_10154520 | 3300025907 | Bacteria | 1499 |
| 403 | Ga0207645_10398046 | 3300025907 | Unclassified | 926 |
| 404 | Ga0207705_10001641 | 3300025909 | Bacteria | 17746 |
| 405 | Ga0207705_10205921 | 3300025909 | Bacteria | 1491 |
| 406 | Ga0207705_10624364 | 3300025909 | Bacteria | 838 |
| 407 | Ga0207684_10000268 | 3300025910 | Bacteria | 77123 |
| 408 | Ga0207684_10005555 | 3300025910 | Bacteria | 11608 |
| 409 | Ga0207684_10100398 | 3300025910 | Bacteria | 2473 |
| 410 | Ga0207684_10103404 | 3300025910 | Bacteria | 2435 |
| 411 | Ga0207684_10116444 | 3300025910 | Bacteria | 2290 |
| 412 | Ga0207684_10159436 | 3300025910 | Unclassified | 1942 |
| 413 | Ga0207684_10197833 | 3300025910 | Bacteria | 1734 |
| 414 | Ga0207684_10685246 | 3300025910 | Bacteria | 872 |
| 415 | Ga0207684_10759992 | 3300025910 | Unclassified | 821 |
| 416 | Ga0207654_10160674 | 3300025911 | Unclassified | 1451 |
| 417 | Ga0207654_11007821 | 3300025911 | Bacteria | 606 |
| 418 | Ga0207707_10037297 | 3300025912 | Unclassified | 4247 |
| 419 | Ga0207671_10035366 | 3300025914 | Bacteria | 3707 |
| 420 | Ga0207671_10189393 | 3300025914 | Bacteria | 1604 |
| 421 | Ga0207693_10034854 | 3300025915 | Bacteria | 3969 |
| 422 | Ga0207693_10063500 | 3300025915 | Unclassified | 2893 |
| 423 | Ga0207693_10117541 | 3300025915 | Bacteria | 2088 |
| 424 | Ga0207693_10220603 | 3300025915 | Unclassified | 1490 |
| 425 | Ga0207693_10493657 | 3300025915 | Bacteria | 956 |
| 426 | Ga0207693_10655984 | 3300025915 | Bacteria | 815 |
| 427 | Ga0207693_10704491 | 3300025915 | Bacteria | 782 |
| 428 | Ga0207663_10436995 | 3300025916 | Unclassified | 1007 |
| 429 | Ga0207663_10662429 | 3300025916 | Bacteria | 824 |
| 430 | Ga0207660_10201542 | 3300025917 | Bacteria | 1554 |
| 431 | Ga0207660_10676125 | 3300025917 | Bacteria | 842 |
| 432 | Ga0207662_10075776 | 3300025918 | Bacteria | 2044 |
| 433 | Ga0207657_10018574 | 3300025919 | Bacteria | 6628 |
| 434 | Ga0207657_10183335 | 3300025919 | Bacteria | 1691 |
| 435 | Ga0207657_10190220 | 3300025919 | Bacteria | 1656 |
| 436 | Ga0207657_10232458 | 3300025919 | Bacteria | 1474 |
| 437 | Ga0207649_10178294 | 3300025920 | Unclassified | 1485 |
| 438 | Ga0207649_10372478 | 3300025920 | Unclassified | 1062 |
| 439 | Ga0207652_11113739 | 3300025921 | Bacteria | 690 |
| 440 | Ga0207646_10007983 | 3300025922 | Bacteria | 10673 |
| 441 | Ga0207646_10052919 | 3300025922 | Unclassified | 3632 |
| 442 | Ga0207646_10066543 | 3300025922 | Bacteria | 3218 |
| 443 | Ga0207646_10234015 | 3300025922 | Bacteria | 1660 |
| 444 | Ga0207646_10348789 | 3300025922 | Unclassified | 1338 |
| 445 | Ga0207646_10631726 | 3300025922 | Bacteria | 960 |
| 446 | Ga0207646_11292189 | 3300025922 | Unclassified | 637 |
| 447 | Ga0207681_10020375 | 3300025923 | Bacteria | 4201 |
| 448 | Ga0207681_10058229 | 3300025923 | Bacteria | 2645 |
| 449 | Ga0207681_10889715 | 3300025923 | Unclassified | 745 |
| 450 | Ga0207694_10888246 | 3300025924 | Bacteria | 753 |
| 451 | Ga0207650_10025433 | 3300025925 | Bacteria | 4217 |
| 452 | Ga0207650_10051417 | 3300025925 | Bacteria | 3049 |
| 453 | Ga0207659_10026322 | 3300025926 | Bacteria | 3923 |
| 454 | Ga0207659_10058831 | 3300025926 | Bacteria | 2760 |
| 455 | Ga0207659_10062176 | 3300025926 | Bacteria | 2694 |
| 456 | Ga0207659_10203878 | 3300025926 | Bacteria | 1581 |
| 457 | Ga0207659_10357383 | 3300025926 | Bacteria | 1213 |
| 458 | Ga0207659_10396809 | 3300025926 | Bacteria | 1153 |
| 459 | Ga0207659_10448956 | 3300025926 | Unclassified | 1086 |
| 460 | Ga0207687_10133580 | 3300025927 | Bacteria | 1874 |
| 461 | Ga0207687_10207559 | 3300025927 | Bacteria | 1535 |
| 462 | Ga0207700_10002998 | 3300025928 | Bacteria | 9735 |
| 463 | Ga0207700_10324518 | 3300025928 | Bacteria | 1335 |
| 464 | Ga0207700_10950405 | 3300025928 | Bacteria | 769 |
| 465 | Ga0207664_10071032 | 3300025929 | Bacteria | 2803 |
| 466 | Ga0207664_10279125 | 3300025929 | Unclassified | 1466 |
| 467 | Ga0207664_10452858 | 3300025929 | Bacteria | 1146 |
| 468 | Ga0207644_10069184 | 3300025931 | Bacteria | 2577 |
| 469 | Ga0207644_10116283 | 3300025931 | Unclassified | 2029 |
| 470 | Ga0207644_10194564 | 3300025931 | Bacteria | 1596 |
| 471 | Ga0207644_10531213 | 3300025931 | Unclassified | 972 |
| 472 | Ga0207690_10006971 | 3300025932 | Bacteria | 6698 |
| 473 | Ga0207690_10058662 | 3300025932 | Bacteria | 2604 |
| 474 | Ga0207690_10280027 | 3300025932 | Bacteria | 1299 |
| 475 | Ga0207706_10035568 | 3300025933 | Bacteria | 4427 |
| 476 | Ga0207706_10476560 | 3300025933 | Bacteria | 1078 |
| 477 | Ga0207706_10989284 | 3300025933 | Bacteria | 707 |
| 478 | Ga0207706_10995024 | 3300025933 | Bacteria | 705 |
| 479 | Ga0207686_10457804 | 3300025934 | Bacteria | 983 |
| 480 | Ga0207709_10201833 | 3300025935 | Bacteria | 1421 |
| 481 | Ga0207709_10777429 | 3300025935 | Bacteria | 771 |
| 482 | Ga0207670_10129317 | 3300025936 | Bacteria | 1847 |
| 483 | Ga0207670_10461746 | 3300025936 | Bacteria | 1025 |
| 484 | Ga0207670_10666650 | 3300025936 | Unclassified | 859 |
| 485 | Ga0207670_10686502 | 3300025936 | Unclassified | 847 |
| 486 | Ga0207669_10004922 | 3300025937 | Bacteria | 5939 |
| 487 | Ga0207669_10437739 | 3300025937 | Bacteria | 1033 |
| 488 | Ga0207704_10027297 | 3300025938 | Bacteria | 3148 |
| 489 | Ga0207704_10069471 | 3300025938 | Bacteria | 2226 |
| 490 | Ga0207704_10372992 | 3300025938 | Unclassified | 1118 |
| 491 | Ga0207665_10092552 | 3300025939 | Unclassified | 2098 |
| 492 | Ga0207665_10098473 | 3300025939 | Bacteria | 2037 |
| 493 | Ga0207665_11028182 | 3300025939 | Bacteria | 656 |
| 494 | Ga0207691_10001082 | 3300025940 | Bacteria | 27131 |
| 495 | Ga0207691_10119459 | 3300025940 | Bacteria | 2337 |
| 496 | Ga0207691_10276583 | 3300025940 | Unclassified | 1445 |
| 497 | Ga0207689_10110145 | 3300025942 | Bacteria | 2263 |
| 498 | Ga0207689_10797334 | 3300025942 | Bacteria | 797 |
| 499 | Ga0207661_10044464 | 3300025944 | Bacteria | 3510 |
| 500 | Ga0207661_10084479 | 3300025944 | Unclassified | 2629 |
| 501 | Ga0207661_10087176 | 3300025944 | Bacteria | 2592 |
| 502 | Ga0207661_10138610 | 3300025944 | Bacteria | 2091 |
| 503 | Ga0207661_10245701 | 3300025944 | Bacteria | 1589 |
| 504 | Ga0207679_10266427 | 3300025945 | Bacteria | 1463 |
| 505 | Ga0207667_10010863 | 3300025949 | Bacteria | 10618 |
| 506 | Ga0207651_10008503 | 3300025960 | Bacteria | 5548 |
| 507 | Ga0207651_10234408 | 3300025960 | Unclassified | 1492 |
| 508 | Ga0207712_10217965 | 3300025961 | Bacteria | 1524 |
| 509 | Ga0207712_11337169 | 3300025961 | Bacteria | 641 |
| 510 | Ga0207668_10034403 | 3300025972 | Bacteria | 3365 |
| 511 | Ga0207668_10107755 | 3300025972 | Bacteria | 2084 |
| 512 | Ga0207668_10652044 | 3300025972 | Bacteria | 921 |
| 513 | Ga0207668_11031982 | 3300025972 | Bacteria | 736 |
| 514 | Ga0207640_10106266 | 3300025981 | Bacteria | 1980 |
| 515 | Ga0207658_10068856 | 3300025986 | Bacteria | 2672 |
| 516 | Ga0207658_10149497 | 3300025986 | Bacteria | 1901 |
| 517 | Ga0207658_10689711 | 3300025986 | Bacteria | 922 |
| 518 | Ga0207677_10059389 | 3300026023 | Bacteria | 2637 |
| 519 | Ga0207677_10175799 | 3300026023 | Bacteria | 1679 |
| 520 | Ga0207677_10176510 | 3300026023 | Unclassified | 1676 |
| 521 | Ga0207677_10883069 | 3300026023 | Unclassified | 805 |
| 522 | Ga0207703_10017603 | 3300026035 | Bacteria | 5579 |
| 523 | Ga0207703_10467315 | 3300026035 | Bacteria | 1180 |
| 524 | Ga0207703_10981204 | 3300026035 | Unclassified | 810 |
| 525 | Ga0207703_11006802 | 3300026035 | Bacteria | 799 |
| 526 | Ga0207703_12046658 | 3300026035 | Unclassified | 549 |
| 527 | Ga0207639_10872408 | 3300026041 | Unclassified | 840 |
| 528 | Ga0207639_11254141 | 3300026041 | Unclassified | 696 |
| 529 | Ga0207639_12268985 | 3300026041 | Bacteria | 504 |
| 530 | Ga0207678_10017673 | 3300026067 | Bacteria | 6261 |
| 531 | Ga0207678_10566695 | 3300026067 | Bacteria | 994 |
| 532 | Ga0207702_10389092 | 3300026078 | Bacteria | 1342 |
| 533 | Ga0207702_10782873 | 3300026078 | Bacteria | 942 |
| 534 | Ga0207702_10850524 | 3300026078 | Bacteria | 903 |
| 535 | Ga0207641_10303989 | 3300026088 | Bacteria | 1507 |
| 536 | Ga0207641_11422971 | 3300026088 | Bacteria | 694 |
| 537 | Ga0207648_10110122 | 3300026089 | Bacteria | 2418 |
| 538 | Ga0207648_10133635 | 3300026089 | Bacteria | 2184 |
| 539 | Ga0207676_10618815 | 3300026095 | Bacteria | 1042 |
| 540 | Ga0207676_10755135 | 3300026095 | Unclassified | 946 |
| 541 | Ga0207676_11051941 | 3300026095 | Bacteria | 803 |
| 542 | Ga0207676_12216554 | 3300026095 | Unclassified | 547 |
| 543 | Ga0207674_10761200 | 3300026116 | Bacteria | 935 |
| 544 | Ga0207674_11686937 | 3300026116 | Bacteria | 602 |
| 545 | Ga0207675_100163902 | 3300026118 | Unclassified | 2122 |
| 546 | Ga0207683_10001621 | 3300026121 | Bacteria | 20182 |
| 547 | Ga0207683_10110618 | 3300026121 | Bacteria | 2460 |
| 548 | Ga0207683_10577610 | 3300026121 | Unclassified | 1040 |
| 549 | Ga0207698_10884199 | 3300026142 | Bacteria | 900 |
| 550 | Ga0207698_11451033 | 3300026142 | Unclassified | 701 |
| 551 | Ga0207698_12394483 | 3300026142 | Bacteria | 539 |
| 552 | Ga0209974_10163426 | 3300027876 | Bacteria | 809 |
| 553 | Ga0268266_10043478 | 3300028379 | Bacteria | 3839 |
| 554 | Ga0268266_10056203 | 3300028379 | Unclassified | 3385 |
| 555 | Ga0268266_10276884 | 3300028379 | Unclassified | 1559 |
| 556 | Ga0268266_10319523 | 3300028379 | Bacteria | 1453 |
| 557 | Ga0268266_10345233 | 3300028379 | Bacteria | 1398 |
| 558 | Ga0268266_10522709 | 3300028379 | Bacteria | 1135 |
| 559 | Ga0268265_10152829 | 3300028380 | Bacteria | 1949 |
| 560 | Ga0268265_10883192 | 3300028380 | Bacteria | 877 |
| 561 | Ga0268265_11976313 | 3300028380 | Unclassified | 590 |
| 562 | Ga0268264_10000241 | 3300028381 | Bacteria | 103608 |
| 563 | Ga0268264_10122825 | 3300028381 | Unclassified | 2291 |
| 564 | Ga0268264_10541536 | 3300028381 | Bacteria | 1141 |
| 565 | Ga0268264_11142164 | 3300028381 | Bacteria | 788 |
| 566 | Ga0373926_0068650 | 3300035083 | Bacteria | 1300 |
| 567 | Ga0373934_0068216 | 3300035086 | Bacteria | 1421 |
| 568 | Ga0373934_0273956 | 3300035086 | Unclassified | 699 |
| 569 | Ga0373940_0286791 | 3300035088 | Bacteria | 564 |
| 570 | Ga0373944_0059956 | 3300035089 | Bacteria | 1219 |
| 571 | Ga0373923_0181340 | 3300035111 | Bacteria | 968 |
| 572 | Ga0373923_0546833 | 3300035111 | Unclassified | 567 |
| 573 | Ga0373945_0032318 | 3300035116 | Bacteria | 1854 |
| 574 | Ga0373945_0264920 | 3300035116 | Bacteria | 729 |
| 575 | Ga0373953_0018832 | 3300035117 | Bacteria | 2560 |
| 576 | Ga0373953_0168054 | 3300035117 | Unclassified | 944 |
| 577 | Ga0373954_0046839 | 3300035118 | Bacteria | 2022 |
| 578 | Ga0373956_0021811 | 3300035119 | Bacteria | 2734 |
| 579 | Ga0373957_0027985 | 3300035120 | Bacteria | 2051 |
| 580 | Ga0373957_0376806 | 3300035120 | Unclassified | 608 |
| 581 | Ga0373943_0178173 | 3300035170 | Bacteria | 1167 |
| 582 | Ga0373943_0283706 | 3300035170 | Bacteria | 937 |
| 583 | Ga0373946_0041419 | 3300035171 | Bacteria | 1889 |
| 584 | Ga0373955_0190430 | 3300035172 | Bacteria | 1219 |
| 585 | Ga0373955_0202384 | 3300035172 | Unclassified | 1182 |
| 586 | Ga0373955_0221747 | 3300035172 | Bacteria | 1129 |
| 587 | Ga0373942_0133971 | 3300035207 | Bacteria | 784 |
| 588 | Ga0373924_0048152 | 3300035410 | Unclassified | 1760 |
| 589 | Ga0373931_0112472 | 3300035691 | Bacteria | 1547 |
| 590 | Ga0373935_0289431 | 3300035692 | Bacteria | 1155 |
| 591 | Ga0373935_0310795 | 3300035692 | Bacteria | 1116 |
| 592 | Ga0373935_0530550 | 3300035692 | Bacteria | 857 |
| 593 | Ga0373935_0826476 | 3300035692 | Bacteria | 685 |
| 594 | Ga0373935_0901645 | 3300035692 | Bacteria | 655 |
| 595 | Ga0373927_0031919 | 3300035695 | Bacteria | 3431 |
| 596 | Ga0373927_0718714 | 3300035695 | Bacteria | 660 |
| 597 | Ga0373933_0183447 | 3300035724 | Bacteria | 1335 |
| 598 | Ga0373947_0217408 | 3300035725 | Bacteria | 1255 |
| 599 | Ga0373947_0329279 | 3300035725 | Bacteria | 1022 |
| 600 | Ga0373947_0507285 | 3300035725 | Bacteria | 820 |
| 601 | Ga0373937_0013425 | 3300036401 | Bacteria | 7215 |
| 602 | Ga0373937_0035953 | 3300036401 | Bacteria | 4512 |
| 603 | Ga0373937_0096255 | 3300036401 | Bacteria | 2745 |
| 604 | Ga0373937_0167954 | 3300036401 | Bacteria | 2058 |
| 605 | Ga0373937_0184059 | 3300036401 | Bacteria | 1962 |
| 606 | Ga0373937_1027433 | 3300036401 | Unclassified | 773 |
| 607 | Ga0373925_0027645 | 3300037068 | Bacteria | 4152 |
| 608 | Ga0373925_0628637 | 3300037068 | Bacteria | 885 |
| 609 | Ga0373925_1251300 | 3300037068 | Bacteria | 609 |
| 610 | Ga0395899_0759722 | 3300037312 | Bacteria | 603 |
| 611 | Ga0395898_0019724 | 3300037466 | Bacteria | 6857 |
| 612 | Ga0395898_1358703 | 3300037466 | Bacteria | 639 |
| 613 | Ga0395901_0269800 | 3300038443 | Bacteria | 1770 |
| 614 | Ga0395901_1892070 | 3300038443 | Bacteria | 544 |
| 615 | Ga0436365_0479463 | 3300039437 | Bacteria | 19101 |
| 616 | Ga0436365_1750414 | 3300039437 | Bacteria | 1627 |
| 617 | Ga0436363_1476289 | 3300039450 | Unclassified | 1073 |
| 618 | Ga0451793_0357197 | 3300041452 | Bacteria | 982 |
| 619 | Ga0451798_1121114 | 3300041458 | Bacteria | 636 |
| 620 | Ga0451807_0058604 | 3300041486 | Unclassified | 818 |
| 621 | Ga0451807_0777531 | 3300041486 | Bacteria | 562 |
| 622 | Ga0451837_1814547 | 3300041494 | Bacteria | 577 |
| 623 | Ga0451853_0874465 | 3300041512 | Bacteria | 680 |
| 624 | Ga0451853_3976838 | 3300041512 | Bacteria | 551 |
| 625 | Ga0439443_055059 | 3300042003 | Bacteria | 703 |
| 626 | Ga0439448_0167405 | 3300042005 | Bacteria | 766 |
| 627 | Ga0439450_038473 | 3300042008 | Bacteria | 1103 |
| 628 | Ga0439455_0036334 | 3300042012 | Bacteria | 1247 |
| 629 | Ga0439458_0029050 | 3300042157 | Bacteria | 1310 |
| 630 | Ga0439440_0070788 | 3300042993 | Bacteria | 907 |
| 631 | Ga0466964_0058486 | 3300044706 | Unclassified | 1598 |
| 632 | Ga0466967_1556467 | 3300045976 | Bacteria | 658 |
| 633 | Ga0495592_0011225 | 3300046454 | Bacteria | 6771 |
| 634 | Ga0495592_0055436 | 3300046454 | Unclassified | 2933 |
| 635 | Ga0495603_0051331 | 3300046455 | Bacteria | 2451 |
| 636 | Ga0495629_0208928 | 3300046459 | Bacteria | 1348 |
| 637 | Ga0495629_0258089 | 3300046459 | Bacteria | 1198 |
| 638 | Ga0495641_0056447 | 3300046461 | Bacteria | 1780 |
| 639 | Ga0495641_0097369 | 3300046461 | Bacteria | 1313 |
| 640 | Ga0495651_0051690 | 3300046462 | Unclassified | 3167 |
| 641 | Ga0495651_0160530 | 3300046462 | Bacteria | 1611 |
| 642 | Ga0495651_0463201 | 3300046462 | Bacteria | 817 |
| 643 | Ga0495653_0313310 | 3300046463 | Unclassified | 1019 |
| 644 | Ga0495653_0620513 | 3300046463 | Unclassified | 663 |
| 645 | Ga0495582_0185982 | 3300046473 | Bacteria | 1184 |
| 646 | Ga0495605_0346386 | 3300046474 | Bacteria | 624 |
| 647 | Ga0495662_0148882 | 3300046476 | Bacteria | 1153 |
| 648 | Ga0495664_0790960 | 3300046477 | Bacteria | 558 |
| 649 | Ga0495584_0151135 | 3300046491 | Bacteria | 1180 |
| 650 | Ga0495584_0257573 | 3300046491 | Bacteria | 887 |
| 651 | Ga0495594_0066156 | 3300046499 | Bacteria | 2005 |
| 652 | Ga0495608_0219869 | 3300046511 | Bacteria | 1192 |
| 653 | Ga0495608_0267853 | 3300046511 | Unclassified | 1062 |
| 654 | Ga0495608_0435782 | 3300046511 | Bacteria | 799 |
| 655 | Ga0495608_0862526 | 3300046511 | Bacteria | 532 |
| 656 | Ga0495618_0134761 | 3300046514 | Bacteria | 1580 |
| 657 | Ga0495618_0875463 | 3300046514 | Bacteria | 520 |
| 658 | Ga0495628_0030849 | 3300046516 | Bacteria | 4338 |
| 659 | Ga0495628_0258470 | 3300046516 | Bacteria | 1298 |
| 660 | Ga0495630_0050818 | 3300046517 | Bacteria | 3102 |
| 661 | Ga0495630_0210793 | 3300046517 | Unclassified | 1483 |
| 662 | Ga0495630_1176768 | 3300046517 | Bacteria | 580 |
| 663 | Ga0495637_0313631 | 3300046520 | Bacteria | 555 |
| 664 | Ga0495644_0152135 | 3300046523 | Bacteria | 886 |
| 665 | Ga0495652_0177757 | 3300046529 | Bacteria | 1636 |
| 666 | Ga0495652_0279458 | 3300046529 | Bacteria | 1223 |
| 667 | Ga0495665_0151866 | 3300046531 | Bacteria | 1209 |
| 668 | Ga0495665_0218404 | 3300046531 | Bacteria | 986 |
| 669 | Ga0495640_0054657 | 3300046533 | Bacteria | 2734 |
| 670 | Ga0495640_0232856 | 3300046533 | Bacteria | 1158 |
| 671 | Ga0495640_0305117 | 3300046533 | Bacteria | 988 |
| 672 | Ga0495586_0024694 | 3300046535 | Bacteria | 3214 |
| 673 | Ga0495587_0013515 | 3300046536 | Bacteria | 5129 |
| 674 | Ga0495645_0052406 | 3300046543 | Bacteria | 2968 |
| 675 | Ga0495645_0371841 | 3300046543 | Bacteria | 916 |
| 676 | Ga0495667_0232857 | 3300046559 | Bacteria | 1174 |
| 677 | Ga0495667_0333439 | 3300046559 | Bacteria | 959 |
| 678 | Ga0495667_0355320 | 3300046559 | Unclassified | 925 |
| 679 | Ga0495668_0323661 | 3300046616 | Bacteria | 846 |
| 680 | Ga0495611_0369835 | 3300046648 | Unclassified | 657 |
| 681 | Ga0495659_0093196 | 3300046664 | Bacteria | 1159 |
| 682 | Ga0495657_0203603 | 3300046675 | Unclassified | 1205 |
| 683 | Ga0495599_0043050 | 3300046678 | Bacteria | 2833 |
| 684 | Ga0495623_0010814 | 3300046679 | Bacteria | 5907 |
| 685 | Ga0495623_0697878 | 3300046679 | Bacteria | 520 |
| 686 | Ga0495646_0005936 | 3300046680 | Bacteria | 7742 |
| 687 | Ga0495658_0003395 | 3300046683 | Bacteria | 7893 |
| 688 | Ga0495658_0048384 | 3300046683 | Bacteria | 2397 |
| 689 | Ga0495669_0173178 | 3300046684 | Unclassified | 1027 |
| 690 | Ga0495669_0276398 | 3300046684 | Bacteria | 808 |
| 691 | Ga0495613_0295413 | 3300046689 | Bacteria | 1122 |
| 692 | Ga0495613_0768051 | 3300046689 | Unclassified | 631 |
| 693 | Ga0495613_0779941 | 3300046689 | Bacteria | 625 |
| 694 | Ga0495670_0320155 | 3300046691 | Bacteria | 833 |
| 695 | Ga0495600_0818914 | 3300046809 | Bacteria | 554 |
| 696 | Ga0495600_0876490 | 3300046809 | Bacteria | 531 |
| 697 | Ga0495604_0072297 | 3300047317 | Bacteria | 2607 |
| 698 | Ga0495604_0391913 | 3300047317 | Bacteria | 916 |
| 699 | Ga0495636_0355976 | 3300047318 | Bacteria | 692 |
| 700 | Ga0495674_0245478 | 3300047319 | Bacteria | 1474 |
| 701 | Ga0495674_0315550 | 3300047319 | Bacteria | 1274 |
| 702 | Ga0495676_0086573 | 3300047321 | Bacteria | 2357 |
| 703 | Ga0495676_0716209 | 3300047321 | Bacteria | 647 |
| 704 | Ga0495680_0143657 | 3300047322 | Bacteria | 1744 |
| 705 | Ga0495675_0034710 | 3300047444 | Bacteria | 3220 |
| 706 | Ga0495684_0116581 | 3300047471 | Bacteria | 2013 |
| 707 | Ga0495684_0285629 | 3300047471 | Unclassified | 1189 |
| 708 | Ga0495684_0396592 | 3300047471 | Bacteria | 970 |
| 709 | Ga0495593_0084185 | 3300047673 | Unclassified | 1642 |
| 710 | Ga0495602_0140797 | 3300048088 | Bacteria | 1909 |
| 711 | Ga0496100_0028956 | 3300048903 | Bacteria | 3421 |
| 712 | Ga0496100_0248221 | 3300048903 | Bacteria | 1316 |
| 713 | Ga0496101_0022753 | 3300048904 | Bacteria | 4319 |
| 714 | Ga0496101_0079978 | 3300048904 | Bacteria | 2414 |
| 715 | Ga0496101_0125680 | 3300048904 | Bacteria | 1943 |
| 716 | Ga0496101_0851479 | 3300048904 | Unclassified | 718 |
| 717 | Ga0496102_0067806 | 3300048905 | Bacteria | 3273 |
| 718 | Ga0496102_0114593 | 3300048905 | Bacteria | 2515 |
| 719 | Ga0496102_0235623 | 3300048905 | Bacteria | 1726 |
| 720 | Ga0496102_0328933 | 3300048905 | Bacteria | 1439 |
| 721 | Ga0496103_0220136 | 3300048906 | Bacteria | 1221 |
| 722 | Ga0496103_0351242 | 3300048906 | Unclassified | 948 |
| 723 | Ga0496103_0745857 | 3300048906 | Bacteria | 619 |
| 724 | Ga0496104_0036202 | 3300048907 | Bacteria | 4613 |
| 725 | Ga0496104_0126841 | 3300048907 | Bacteria | 2451 |
| 726 | Ga0496104_0133466 | 3300048907 | Bacteria | 2385 |
| 727 | Ga0496104_0169875 | 3300048907 | Unclassified | 2091 |
| 728 | Ga0496104_1314076 | 3300048907 | Bacteria | 626 |
| 729 | Ga0496105_0088006 | 3300048908 | Bacteria | 2566 |
| 730 | Ga0496105_0309640 | 3300048908 | Unclassified | 1268 |
| 731 | Ga0496105_0331260 | 3300048908 | Bacteria | 1218 |
| 732 | Ga0496105_0439212 | 3300048908 | Bacteria | 1031 |
| 733 | Ga0496105_1384553 | 3300048908 | Unclassified | 510 |
| 734 | Ga0496106_0110402 | 3300048909 | Bacteria | 2141 |
| 735 | Ga0496106_0367509 | 3300048909 | Unclassified | 1156 |
| 736 | Ga0496106_0540201 | 3300048909 | Bacteria | 935 |
| 737 | Ga0496108_0020745 | 3300048911 | Bacteria | 5401 |
| 738 | Ga0496108_0208330 | 3300048911 | Bacteria | 1697 |
| 739 | Ga0496108_0432284 | 3300048911 | Unclassified | 1150 |
| 740 | Ga0496108_0838520 | 3300048911 | Unclassified | 792 |
| 741 | Ga0496108_1109584 | 3300048911 | Bacteria | 672 |
| 742 | Ga0496108_1251783 | 3300048911 | Unclassified | 626 |
| 743 | Ga0496108_1627972 | 3300048911 | Bacteria | 533 |
| 744 | Ga0496109_0022499 | 3300048912 | Bacteria | 5584 |
| 745 | Ga0496109_0278260 | 3300048912 | Bacteria | 1577 |
| 746 | Ga0496109_1479981 | 3300048912 | Bacteria | 614 |
| 747 | Ga0496110_0589995 | 3300048913 | Unclassified | 1008 |
| 748 | Ga0496110_0908138 | 3300048913 | Unclassified | 787 |
| 749 | Ga0496110_1049399 | 3300048913 | Bacteria | 723 |
| 750 | Ga0496110_1191644 | 3300048913 | Unclassified | 670 |
| 751 | Ga0496111_0341814 | 3300048914 | Bacteria | 1108 |
| 752 | Ga0496111_0925256 | 3300048914 | Bacteria | 627 |
| 753 | Ga0496112_0023027 | 3300048915 | Bacteria | 5944 |
| 754 | Ga0496112_0092375 | 3300048915 | Bacteria | 2996 |
| 755 | Ga0496112_0326535 | 3300048915 | Unclassified | 1478 |
| 756 | Ga0496112_0554406 | 3300048915 | Bacteria | 1083 |
| 757 | Ga0496112_0604247 | 3300048915 | Bacteria | 1029 |
| 758 | Ga0496113_0288167 | 3300048916 | Unclassified | 1313 |
| 759 | Ga0496114_0002874 | 3300048917 | Bacteria | 13206 |
| 760 | Ga0496114_0134745 | 3300048917 | Unclassified | 2135 |
| 761 | Ga0496114_0282762 | 3300048917 | Bacteria | 1463 |
| 762 | Ga0496115_0001553 | 3300048918 | Bacteria | 16496 |
| 763 | Ga0496115_0008087 | 3300048918 | Bacteria | 7769 |
| 764 | Ga0496115_0172757 | 3300048918 | Bacteria | 1787 |
| 765 | Ga0496115_0948939 | 3300048918 | Unclassified | 660 |
| 766 | Ga0501034_0156221 | 3300049571 | Bacteria | 2255 |
| 767 | Ga0501080_0016700 | 3300049742 | Bacteria | 6777 |
| 768 | Ga0501080_0858046 | 3300049742 | Bacteria | 793 |
| 769 | nmdc:mga03683_176160_c1 | 3300050489 | Bacteria | 974 |
| 770 | nmdc:mga03683_583488_c1 | 3300050489 | Bacteria | 546 |
| 771 | nmdc:mga0k408_311671_c1 | 3300050493 | Bacteria | 939 |
| 772 | nmdc:mga0k408_877908_c1 | 3300050493 | Bacteria | 521 |
| 773 | nmdc:mga05p37_2002467_c1 | 3300050507 | Bacteria | 548 |
| 774 | nmdc:mga05p37_242495_c1 | 3300050507 | Unclassified | 2166 |
| 775 | nmdc:mga05p37_376324_c1 | 3300050507 | Bacteria | 1665 |
| 776 | nmdc:mga0n895_1639780_c1 | 3300050512 | Bacteria | 607 |
| 777 | nmdc:mga0n895_1678316_c1 | 3300050512 | Bacteria | 598 |
| 778 | nmdc:mga0n895_642633_c1 | 3300050512 | Unclassified | 1060 |
| 779 | nmdc:mga0n895_791451_c1 | 3300050512 | Bacteria | 939 |
| 780 | nmdc:mga0n895_947940_c1 | 3300050512 | Unclassified | 844 |
| 781 | nmdc:mga0rr50_1321276_c1 | 3300050513 | Unclassified | 611 |
| 782 | nmdc:mga0rr50_369509_c1 | 3300050513 | Bacteria | 1208 |
| 783 | nmdc:mga08x19_148337_c1 | 3300050514 | Bacteria | 1587 |
| 784 | nmdc:mga0a205_230878_c1 | 3300050515 | Bacteria | 1733 |
| 785 | Ga0495601_0062152 | 3300053077 | Bacteria | 2371 |
| 786 | Ga0495601_0080488 | 3300053077 | Bacteria | 2090 |
| 787 | Ga0495612_0035773 | 3300053078 | Bacteria | 2013 |
| 788 | Ga0495612_0200838 | 3300053078 | Bacteria | 880 |
| 789 | Ga0500610_0143566 | 3300053079 | Bacteria | 1203 |
| 790 | Ga0495655_0146308 | 3300053083 | Unclassified | 740 |
| 791 | Ga0495595_0048848 | 3300053084 | Bacteria | 1955 |
| 792 | Ga0495619_0211239 | 3300053085 | Unclassified | 1344 |
| 793 | Ga0495619_0295705 | 3300053085 | Unclassified | 1122 |
| 794 | Ga0495619_1009061 | 3300053085 | Bacteria | 556 |
| 795 | Ga0500616_0007249 | 3300053153 | Bacteria | 7080 |
| 796 | Ga0587083_0221528 | 3300059505 | Bacteria | 550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049742 | Ga0501080_0016700 | Ga0501080_0016700_3207_3485 | 88 |
| 2 | 3300009176 | Ga0105242_12888484 | Ga0105242_128884841 | 90 |
| 3 | 3300005467 | Ga0070706_100277823 | Ga0070706_1002778231 | 93 |
| 4 | 3300005985 | Ga0081539_10107129 | Ga0081539_101071292 | 98 |
| 5 | 3300005435 | Ga0070714_100673824 | Ga0070714_1006738242 | 99 |
| 6 | 3300005436 | Ga0070713_100375402 | Ga0070713_1003754022 | 99 |
| 7 | 3300005467 | Ga0070706_100063533 | Ga0070706_1000635332 | 99 |
| 8 | 3300005467 | Ga0070706_100730522 | Ga0070706_1007305221 | 99 |
| 9 | 3300005468 | Ga0070707_100167231 | Ga0070707_1001672311 | 99 |
| 10 | 3300005468 | Ga0070707_101812734 | Ga0070707_1018127341 | 99 |
| 11 | 3300005471 | Ga0070698_100000694 | Ga0070698_10000069416 | 99 |
| 12 | 3300005518 | Ga0070699_100625174 | Ga0070699_1006251742 | 99 |
| 13 | 3300005536 | Ga0070697_100013199 | Ga0070697_1000131993 | 99 |
| 14 | 3300005536 | Ga0070697_100090545 | Ga0070697_1000905453 | 99 |
| 15 | 3300006028 | Ga0070717_10072092 | Ga0070717_100720922 | 99 |
| 16 | 3300006173 | Ga0070716_100111540 | Ga0070716_1001115402 | 99 |
| 17 | 3300007788 | Ga0099795_10107716 | Ga0099795_101077162 | 99 |
| 18 | 3300010159 | Ga0099796_10222535 | Ga0099796_102225352 | 99 |
| 19 | 3300025910 | Ga0207684_10159436 | Ga0207684_101594362 | 99 |
| 20 | 3300025922 | Ga0207646_10052919 | Ga0207646_100529192 | 99 |
| 21 | 3300025922 | Ga0207646_11292189 | Ga0207646_112921892 | 99 |
| 22 | 3300025924 | Ga0207694_10888246 | Ga0207694_108882461 | 99 |
| 23 | 3300025929 | Ga0207664_10279125 | Ga0207664_102791252 | 99 |
| 24 | 3300025939 | Ga0207665_10092552 | Ga0207665_100925522 | 99 |
| 25 | 3300039437 | Ga0436365_1750414 | Ga0436365_1750414_1276_1575 | 99 |
| 26 | 3300039450 | Ga0436363_1476289 | Ga0436363_1476289_210_509 | 99 |
| 27 | 3300039437 | Ga0436365_0479463 | Ga0436365_0479463_10354_10680 | 100 |
| 28 | 3300041486 | Ga0451807_0058604 | Ga0451807_0058604_76_378 | 100 |
| 29 | 3300041512 | Ga0451853_3976838 | Ga0451853_3976838_172_474 | 100 |
| 30 | 2209111006 | 2214801627 | 2213831403 | 101 |
| 31 | 3300006881 | Ga0068865_100195749 | Ga0068865_1001957492 | 101 |
| 32 | 3300013297 | Ga0157378_11861491 | Ga0157378_118614912 | 101 |
| 33 | 3300025939 | Ga0207665_11028182 | Ga0207665_110281822 | 101 |
| 34 | 3300041494 | Ga0451837_1814547 | Ga0451837_1814547_78_383 | 101 |
| 35 | 3300002077 | JGI24744J21845_10015577 | JGI24744J21845_100155772 | 102 |
| 36 | 3300002244 | JGI24742J22300_10114521 | JGI24742J22300_101145212 | 102 |
| 37 | 3300005327 | Ga0070658_10004979 | Ga0070658_100049792 | 102 |
| 38 | 3300005327 | Ga0070658_11118709 | Ga0070658_111187091 | 102 |
| 39 | 3300005328 | Ga0070676_10015290 | Ga0070676_100152904 | 102 |
| 40 | 3300005328 | Ga0070676_10020144 | Ga0070676_100201443 | 102 |
| 41 | 3300005328 | Ga0070676_10427984 | Ga0070676_104279842 | 102 |
| 42 | 3300005329 | Ga0070683_100119052 | Ga0070683_1001190522 | 102 |
| 43 | 3300005330 | Ga0070690_100122694 | Ga0070690_1001226942 | 102 |
| 44 | 3300005331 | Ga0070670_100014442 | Ga0070670_1000144424 | 102 |
| 45 | 3300005331 | Ga0070670_100054028 | Ga0070670_1000540282 | 102 |
| 46 | 3300005333 | Ga0070677_10122457 | Ga0070677_101224572 | 102 |
| 47 | 3300005334 | Ga0068869_100249434 | Ga0068869_1002494342 | 102 |
| 48 | 3300005335 | Ga0070666_10032117 | Ga0070666_100321173 | 102 |
| 49 | 3300005335 | Ga0070666_10840130 | Ga0070666_108401301 | 102 |
| 50 | 3300005338 | Ga0068868_100014966 | Ga0068868_1000149663 | 102 |
| 51 | 3300005338 | Ga0068868_101119140 | Ga0068868_1011191401 | 102 |
| 52 | 3300005339 | Ga0070660_100547985 | Ga0070660_1005479852 | 102 |
| 53 | 3300005340 | Ga0070689_100028937 | Ga0070689_1000289372 | 102 |
| 54 | 3300005340 | Ga0070689_101200323 | Ga0070689_1012003232 | 102 |
| 55 | 3300005341 | Ga0070691_10355129 | Ga0070691_103551292 | 102 |
| 56 | 3300005347 | Ga0070668_100019359 | Ga0070668_1000193594 | 102 |
| 57 | 3300005347 | Ga0070668_100052697 | Ga0070668_1000526973 | 102 |
| 58 | 3300005353 | Ga0070669_100002855 | Ga0070669_1000028554 | 102 |
| 59 | 3300005353 | Ga0070669_100325477 | Ga0070669_1003254772 | 102 |
| 60 | 3300005353 | Ga0070669_100901555 | Ga0070669_1009015552 | 102 |
| 61 | 3300005354 | Ga0070675_100016119 | Ga0070675_1000161194 | 102 |
| 62 | 3300005354 | Ga0070675_100187866 | Ga0070675_1001878662 | 102 |
| 63 | 3300005354 | Ga0070675_101242035 | Ga0070675_1012420352 | 102 |
| 64 | 3300005355 | Ga0070671_100001422 | Ga0070671_10000142210 | 102 |
| 65 | 3300005355 | Ga0070671_100031408 | Ga0070671_1000314084 | 102 |
| 66 | 3300005356 | Ga0070674_100002179 | Ga0070674_1000021794 | 102 |
| 67 | 3300005356 | Ga0070674_101577726 | Ga0070674_1015777261 | 102 |
| 68 | 3300005364 | Ga0070673_100000434 | Ga0070673_1000004346 | 102 |
| 69 | 3300005364 | Ga0070673_100024350 | Ga0070673_1000243502 | 102 |
| 70 | 3300005364 | Ga0070673_100462143 | Ga0070673_1004621432 | 102 |
| 71 | 3300005365 | Ga0070688_100036100 | Ga0070688_1000361003 | 102 |
| 72 | 3300005365 | Ga0070688_100191855 | Ga0070688_1001918552 | 102 |
| 73 | 3300005367 | Ga0070667_100030098 | Ga0070667_1000300984 | 102 |
| 74 | 3300005367 | Ga0070667_100100279 | Ga0070667_1001002793 | 102 |
| 75 | 3300005367 | Ga0070667_101970243 | Ga0070667_1019702432 | 102 |
| 76 | 3300005434 | Ga0070709_11117078 | Ga0070709_111170782 | 102 |
| 77 | 3300005436 | Ga0070713_100180724 | Ga0070713_1001807242 | 102 |
| 78 | 3300005439 | Ga0070711_100600374 | Ga0070711_1006003742 | 102 |
| 79 | 3300005455 | Ga0070663_100101409 | Ga0070663_1001014092 | 102 |
| 80 | 3300005456 | Ga0070678_100128423 | Ga0070678_1001284232 | 102 |
| 81 | 3300005457 | Ga0070662_100064088 | Ga0070662_1000640882 | 102 |
| 82 | 3300005459 | Ga0068867_100039740 | Ga0068867_1000397405 | 102 |
| 83 | 3300005459 | Ga0068867_100200835 | Ga0068867_1002008352 | 102 |
| 84 | 3300005543 | Ga0070672_100013002 | Ga0070672_1000130023 | 102 |
| 85 | 3300005543 | Ga0070672_100185002 | Ga0070672_1001850022 | 102 |
| 86 | 3300005545 | Ga0070695_100116340 | Ga0070695_1001163403 | 102 |
| 87 | 3300005545 | Ga0070695_100302844 | Ga0070695_1003028442 | 102 |
| 88 | 3300005547 | Ga0070693_100953371 | Ga0070693_1009533712 | 102 |
| 89 | 3300005548 | Ga0070665_100029270 | Ga0070665_1000292704 | 102 |
| 90 | 3300005548 | Ga0070665_100293320 | Ga0070665_1002933202 | 102 |
| 91 | 3300005563 | Ga0068855_100010853 | Ga0068855_1000108535 | 102 |
| 92 | 3300005564 | Ga0070664_100043515 | Ga0070664_1000435152 | 102 |
| 93 | 3300005578 | Ga0068854_100374280 | Ga0068854_1003742802 | 102 |
| 94 | 3300005614 | Ga0068856_100306780 | Ga0068856_1003067802 | 102 |
| 95 | 3300005614 | Ga0068856_101144563 | Ga0068856_1011445632 | 102 |
| 96 | 3300005617 | Ga0068859_100312430 | Ga0068859_1003124302 | 102 |
| 97 | 3300005618 | Ga0068864_100328601 | Ga0068864_1003286012 | 102 |
| 98 | 3300005618 | Ga0068864_101221358 | Ga0068864_1012213582 | 102 |
| 99 | 3300005718 | Ga0068866_10615549 | Ga0068866_106155491 | 102 |
| 100 | 3300005840 | Ga0068870_10777064 | Ga0068870_107770642 | 102 |
| 101 | 3300005841 | Ga0068863_100354495 | Ga0068863_1003544952 | 102 |
| 102 | 3300005842 | Ga0068858_100045107 | Ga0068858_1000451072 | 102 |
| 103 | 3300005842 | Ga0068858_100134412 | Ga0068858_1001344122 | 102 |
| 104 | 3300005843 | Ga0068860_100000202 | Ga0068860_10000020262 | 102 |
| 105 | 3300005843 | Ga0068860_100335721 | Ga0068860_1003357212 | 102 |
| 106 | 3300005843 | Ga0068860_101228452 | Ga0068860_1012284522 | 102 |
| 107 | 3300005844 | Ga0068862_100210711 | Ga0068862_1002107113 | 102 |
| 108 | 3300006048 | Ga0075363_100599836 | Ga0075363_1005998362 | 102 |
| 109 | 3300006175 | Ga0070712_100034753 | Ga0070712_1000347533 | 102 |
| 110 | 3300006177 | Ga0075362_10039378 | Ga0075362_100393782 | 102 |
| 111 | 3300006177 | Ga0075362_10623669 | Ga0075362_106236691 | 102 |
| 112 | 3300006195 | Ga0075366_10094854 | Ga0075366_100948542 | 102 |
| 113 | 3300006195 | Ga0075366_10167754 | Ga0075366_101677542 | 102 |
| 114 | 3300006237 | Ga0097621_100008612 | Ga0097621_1000086128 | 102 |
| 115 | 3300006237 | Ga0097621_100018579 | Ga0097621_1000185795 | 102 |
| 116 | 3300006358 | Ga0068871_100025764 | Ga0068871_1000257644 | 102 |
| 117 | 3300006358 | Ga0068871_100051125 | Ga0068871_1000511252 | 102 |
| 118 | 3300006358 | Ga0068871_100223691 | Ga0068871_1002236912 | 102 |
| 119 | 3300006852 | Ga0075433_10719387 | Ga0075433_107193872 | 102 |
| 120 | 3300006871 | Ga0075434_100875689 | Ga0075434_1008756892 | 102 |
| 121 | 3300006881 | Ga0068865_100006676 | Ga0068865_1000066765 | 102 |
| 122 | 3300006881 | Ga0068865_100488740 | Ga0068865_1004887402 | 102 |
| 123 | 3300006914 | Ga0075436_100044115 | Ga0075436_1000441152 | 102 |
| 124 | 3300006931 | Ga0097620_100312468 | Ga0097620_1003124682 | 102 |
| 125 | 3300009176 | Ga0105242_10363679 | Ga0105242_103636792 | 102 |
| 126 | 3300009176 | Ga0105242_11989553 | Ga0105242_119895532 | 102 |
| 127 | 3300009545 | Ga0105237_10015766 | Ga0105237_100157667 | 102 |
| 128 | 3300009545 | Ga0105237_11684399 | Ga0105237_116843992 | 102 |
| 129 | 3300009553 | Ga0105249_12064964 | Ga0105249_120649642 | 102 |
| 130 | 3300010375 | Ga0105239_10211920 | Ga0105239_102119202 | 102 |
| 131 | 3300010375 | Ga0105239_12048462 | Ga0105239_120484622 | 102 |
| 132 | 3300013102 | Ga0157371_10737881 | Ga0157371_107378812 | 102 |
| 133 | 3300013296 | Ga0157374_10009530 | Ga0157374_100095308 | 102 |
| 134 | 3300013296 | Ga0157374_10030397 | Ga0157374_100303973 | 102 |
| 135 | 3300013296 | Ga0157374_10236283 | Ga0157374_102362832 | 102 |
| 136 | 3300013297 | Ga0157378_10062015 | Ga0157378_100620152 | 102 |
| 137 | 3300013297 | Ga0157378_10079408 | Ga0157378_100794083 | 102 |
| 138 | 3300013297 | Ga0157378_10158723 | Ga0157378_101587232 | 102 |
| 139 | 3300013297 | Ga0157378_13082920 | Ga0157378_130829202 | 102 |
| 140 | 3300013306 | Ga0163162_10002841 | Ga0163162_1000284114 | 102 |
| 141 | 3300013306 | Ga0163162_10632206 | Ga0163162_106322062 | 102 |
| 142 | 3300013307 | Ga0157372_10023674 | Ga0157372_100236744 | 102 |
| 143 | 3300013307 | Ga0157372_10277298 | Ga0157372_102772982 | 102 |
| 144 | 3300013308 | Ga0157375_10005288 | Ga0157375_100052887 | 102 |
| 145 | 3300013308 | Ga0157375_10028471 | Ga0157375_100284714 | 102 |
| 146 | 3300013308 | Ga0157375_11399458 | Ga0157375_113994582 | 102 |
| 147 | 3300014325 | Ga0163163_10669810 | Ga0163163_106698102 | 102 |
| 148 | 3300014969 | Ga0157376_10103786 | Ga0157376_101037864 | 102 |
| 149 | 3300014969 | Ga0157376_10291847 | Ga0157376_102918472 | 102 |
| 150 | 3300014969 | Ga0157376_12684503 | Ga0157376_126845032 | 102 |
| 151 | 3300015262 | Ga0182007_10082446 | Ga0182007_100824462 | 102 |
| 152 | 3300017792 | Ga0163161_10403271 | Ga0163161_104032712 | 102 |
| 153 | 3300020069 | Ga0197907_10816653 | Ga0197907_108166532 | 102 |
| 154 | 3300020076 | Ga0206355_1274465 | Ga0206355_12744652 | 102 |
| 155 | 3300022467 | Ga0224712_10696313 | Ga0224712_106963131 | 102 |
| 156 | 3300025290 | Ga0207673_1025434 | Ga0207673_10254342 | 102 |
| 157 | 3300025315 | Ga0207697_10000116 | Ga0207697_1000011619 | 102 |
| 158 | 3300025315 | Ga0207697_10428559 | Ga0207697_104285591 | 102 |
| 159 | 3300025893 | Ga0207682_10156735 | Ga0207682_101567352 | 102 |
| 160 | 3300025899 | Ga0207642_10514700 | Ga0207642_105147001 | 102 |
| 161 | 3300025901 | Ga0207688_10003621 | Ga0207688_100036218 | 102 |
| 162 | 3300025903 | Ga0207680_10046070 | Ga0207680_100460702 | 102 |
| 163 | 3300025903 | Ga0207680_10399730 | Ga0207680_103997302 | 102 |
| 164 | 3300025907 | Ga0207645_10019788 | Ga0207645_100197882 | 102 |
| 165 | 3300025907 | Ga0207645_10089619 | Ga0207645_100896192 | 102 |
| 166 | 3300025907 | Ga0207645_10398046 | Ga0207645_103980462 | 102 |
| 167 | 3300025909 | Ga0207705_10001641 | Ga0207705_100016416 | 102 |
| 168 | 3300025909 | Ga0207705_10624364 | Ga0207705_106243641 | 102 |
| 169 | 3300025914 | Ga0207671_10035366 | Ga0207671_100353662 | 102 |
| 170 | 3300025915 | Ga0207693_10117541 | Ga0207693_101175412 | 102 |
| 171 | 3300025916 | Ga0207663_10662429 | Ga0207663_106624292 | 102 |
| 172 | 3300025923 | Ga0207681_10020375 | Ga0207681_100203753 | 102 |
| 173 | 3300025923 | Ga0207681_10058229 | Ga0207681_100582294 | 102 |
| 174 | 3300025923 | Ga0207681_10889715 | Ga0207681_108897152 | 102 |
| 175 | 3300025925 | Ga0207650_10025433 | Ga0207650_100254333 | 102 |
| 176 | 3300025925 | Ga0207650_10051417 | Ga0207650_100514171 | 102 |
| 177 | 3300025926 | Ga0207659_10058831 | Ga0207659_100588312 | 102 |
| 178 | 3300025926 | Ga0207659_10448956 | Ga0207659_104489562 | 102 |
| 179 | 3300025928 | Ga0207700_10324518 | Ga0207700_103245182 | 102 |
| 180 | 3300025931 | Ga0207644_10116283 | Ga0207644_101162832 | 102 |
| 181 | 3300025932 | Ga0207690_10280027 | Ga0207690_102800271 | 102 |
| 182 | 3300025933 | Ga0207706_10035568 | Ga0207706_100355685 | 102 |
| 183 | 3300025936 | Ga0207670_10666650 | Ga0207670_106666502 | 102 |
| 184 | 3300025937 | Ga0207669_10004922 | Ga0207669_100049225 | 102 |
| 185 | 3300025938 | Ga0207704_10027297 | Ga0207704_100272972 | 102 |
| 186 | 3300025938 | Ga0207704_10372992 | Ga0207704_103729923 | 102 |
| 187 | 3300025940 | Ga0207691_10001082 | Ga0207691_1000108217 | 102 |
| 188 | 3300025940 | Ga0207691_10276583 | Ga0207691_102765832 | 102 |
| 189 | 3300025942 | Ga0207689_10797334 | Ga0207689_107973342 | 102 |
| 190 | 3300025944 | Ga0207661_10087176 | Ga0207661_100871763 | 102 |
| 191 | 3300025949 | Ga0207667_10010863 | Ga0207667_100108638 | 102 |
| 192 | 3300025960 | Ga0207651_10008503 | Ga0207651_100085034 | 102 |
| 193 | 3300025960 | Ga0207651_10234408 | Ga0207651_102344082 | 102 |
| 194 | 3300025972 | Ga0207668_10034403 | Ga0207668_100344032 | 102 |
| 195 | 3300025972 | Ga0207668_10107755 | Ga0207668_101077552 | 102 |
| 196 | 3300025986 | Ga0207658_10068856 | Ga0207658_100688562 | 102 |
| 197 | 3300026023 | Ga0207677_10059389 | Ga0207677_100593892 | 102 |
| 198 | 3300026023 | Ga0207677_10883069 | Ga0207677_108830692 | 102 |
| 199 | 3300026035 | Ga0207703_10017603 | Ga0207703_100176034 | 102 |
| 200 | 3300026035 | Ga0207703_12046658 | Ga0207703_120466582 | 102 |
| 201 | 3300026041 | Ga0207639_12268985 | Ga0207639_122689852 | 102 |
| 202 | 3300026078 | Ga0207702_10389092 | Ga0207702_103890922 | 102 |
| 203 | 3300026089 | Ga0207648_10110122 | Ga0207648_101101222 | 102 |
| 204 | 3300026089 | Ga0207648_10133635 | Ga0207648_101336352 | 102 |
| 205 | 3300026116 | Ga0207674_10761200 | Ga0207674_107612002 | 102 |
| 206 | 3300026116 | Ga0207674_11686937 | Ga0207674_116869371 | 102 |
| 207 | 3300026121 | Ga0207683_10001621 | Ga0207683_100016217 | 102 |
| 208 | 3300026121 | Ga0207683_10110618 | Ga0207683_101106182 | 102 |
| 209 | 3300026142 | Ga0207698_10884199 | Ga0207698_108841992 | 102 |
| 210 | 3300026142 | Ga0207698_11451033 | Ga0207698_114510332 | 102 |
| 211 | 3300026142 | Ga0207698_12394483 | Ga0207698_123944832 | 102 |
| 212 | 3300028379 | Ga0268266_10276884 | Ga0268266_102768842 | 102 |
| 213 | 3300028379 | Ga0268266_10319523 | Ga0268266_103195232 | 102 |
| 214 | 3300028380 | Ga0268265_10152829 | Ga0268265_101528292 | 102 |
| 215 | 3300028380 | Ga0268265_10883192 | Ga0268265_108831922 | 102 |
| 216 | 3300028381 | Ga0268264_10000241 | Ga0268264_1000024175 | 102 |
| 217 | 3300028381 | Ga0268264_10122825 | Ga0268264_101228252 | 102 |
| 218 | 3300028381 | Ga0268264_10541536 | Ga0268264_105415362 | 102 |
| 219 | 3300028381 | Ga0268264_11142164 | Ga0268264_111421642 | 102 |
| 220 | 3300035086 | Ga0373934_0273956 | Ga0373934_0273956_378_686 | 102 |
| 221 | 3300035111 | Ga0373923_0546833 | Ga0373923_0546833_242_550 | 102 |
| 222 | 3300035117 | Ga0373953_0168054 | Ga0373953_0168054_147_455 | 102 |
| 223 | 3300035170 | Ga0373943_0283706 | Ga0373943_0283706_73_381 | 102 |
| 224 | 3300035172 | Ga0373955_0190430 | Ga0373955_0190430_128_436 | 102 |
| 225 | 3300035410 | Ga0373924_0048152 | Ga0373924_0048152_463_771 | 102 |
| 226 | 3300035692 | Ga0373935_0310795 | Ga0373935_0310795_648_956 | 102 |
| 227 | 3300036401 | Ga0373937_0013425 | Ga0373937_0013425_220_528 | 102 |
| 228 | 3300036401 | Ga0373937_0035953 | Ga0373937_0035953_2183_2491 | 102 |
| 229 | 3300036401 | Ga0373937_0167954 | Ga0373937_0167954_363_671 | 102 |
| 230 | 3300037068 | Ga0373925_0628637 | Ga0373925_0628637_456_764 | 102 |
| 231 | 3300041458 | Ga0451798_1121114 | Ga0451798_1121114_59_367 | 102 |
| 232 | 3300041486 | Ga0451807_0777531 | Ga0451807_0777531_93_401 | 102 |
| 233 | 3300046454 | Ga0495592_0055436 | Ga0495592_0055436_2536_2844 | 102 |
| 234 | 3300046462 | Ga0495651_0051690 | Ga0495651_0051690_2802_3110 | 102 |
| 235 | 3300046463 | Ga0495653_0620513 | Ga0495653_0620513_105_413 | 102 |
| 236 | 3300046511 | Ga0495608_0435782 | Ga0495608_0435782_184_492 | 102 |
| 237 | 3300046516 | Ga0495628_0258470 | Ga0495628_0258470_55_363 | 102 |
| 238 | 3300046517 | Ga0495630_0210793 | Ga0495630_0210793_351_659 | 102 |
| 239 | 3300046533 | Ga0495640_0232856 | Ga0495640_0232856_155_463 | 102 |
| 240 | 3300046543 | Ga0495645_0371841 | Ga0495645_0371841_70_378 | 102 |
| 241 | 3300046648 | Ga0495611_0369835 | Ga0495611_0369835_285_593 | 102 |
| 242 | 3300046679 | Ga0495623_0697878 | Ga0495623_0697878_103_411 | 102 |
| 243 | 3300046683 | Ga0495658_0003395 | Ga0495658_0003395_4139_4447 | 102 |
| 244 | 3300046684 | Ga0495669_0276398 | Ga0495669_0276398_447_755 | 102 |
| 245 | 3300046689 | Ga0495613_0779941 | Ga0495613_0779941_147_455 | 102 |
| 246 | 3300047471 | Ga0495684_0285629 | Ga0495684_0285629_413_721 | 102 |
| 247 | 3300048903 | Ga0496100_0028956 | Ga0496100_0028956_656_964 | 102 |
| 248 | 3300048904 | Ga0496101_0022753 | Ga0496101_0022753_3177_3485 | 102 |
| 249 | 3300048907 | Ga0496104_0126841 | Ga0496104_0126841_456_764 | 102 |
| 250 | 3300048907 | Ga0496104_0133466 | Ga0496104_0133466_1396_1704 | 102 |
| 251 | 3300048908 | Ga0496105_0439212 | Ga0496105_0439212_574_882 | 102 |
| 252 | 3300048909 | Ga0496106_0110402 | Ga0496106_0110402_963_1271 | 102 |
| 253 | 3300048911 | Ga0496108_0208330 | Ga0496108_0208330_1016_1324 | 102 |
| 254 | 3300048911 | Ga0496108_1251783 | Ga0496108_1251783_172_480 | 102 |
| 255 | 3300048911 | Ga0496108_1627972 | Ga0496108_1627972_155_463 | 102 |
| 256 | 3300048913 | Ga0496110_1191644 | Ga0496110_1191644_148_456 | 102 |
| 257 | 3300048915 | Ga0496112_0023027 | Ga0496112_0023027_1660_1968 | 102 |
| 258 | 3300048915 | Ga0496112_0554406 | Ga0496112_0554406_588_896 | 102 |
| 259 | 3300048918 | Ga0496115_0008087 | Ga0496115_0008087_726_1034 | 102 |
| 260 | 3300049571 | Ga0501034_0156221 | Ga0501034_0156221_441_749 | 102 |
| 261 | 3300049742 | Ga0501080_0858046 | Ga0501080_0858046_32_340 | 102 |
| 262 | 3300050489 | nmdc:mga03683_176160_c1 | nmdc:mga03683_176160_c1_255_563 | 102 |
| 263 | 3300050489 | nmdc:mga03683_583488_c1 | nmdc:mga03683_583488_c1_74_382 | 102 |
| 264 | 3300050493 | nmdc:mga0k408_311671_c1 | nmdc:mga0k408_311671_c1_322_630 | 102 |
| 265 | 3300050512 | nmdc:mga0n895_791451_c1 | nmdc:mga0n895_791451_c1_135_443 | 102 |
| 266 | 3300050512 | nmdc:mga0n895_947940_c1 | nmdc:mga0n895_947940_c1_524_832 | 102 |
| 267 | 3300050514 | nmdc:mga08x19_148337_c1 | nmdc:mga08x19_148337_c1_349_657 | 102 |
| 268 | 3300053077 | Ga0495601_0080488 | Ga0495601_0080488_1718_2026 | 102 |
| 269 | 3300053079 | Ga0500610_0143566 | Ga0500610_0143566_532_840 | 102 |
| 270 | 3300053085 | Ga0495619_0295705 | Ga0495619_0295705_354_662 | 102 |
| 271 | 3300053153 | Ga0500616_0007249 | Ga0500616_0007249_1422_1730 | 102 |
| 272 | 3300059505 | Ga0587083_0221528 | Ga0587083_0221528_166_474 | 102 |
| 273 | 2124908018 | SwRhBV22_Contig_4286 | SwRhBV22_00037310 | 103 |
| 274 | 3300003911 | JGI25405J52794_10140164 | JGI25405J52794_101401642 | 103 |
| 275 | 3300005289 | Ga0065704_10016897 | Ga0065704_100168972 | 103 |
| 276 | 3300005289 | Ga0065704_10023391 | Ga0065704_100233912 | 103 |
| 277 | 3300005289 | Ga0065704_10025131 | Ga0065704_100251312 | 103 |
| 278 | 3300005290 | Ga0065712_10007221 | Ga0065712_100072211 | 103 |
| 279 | 3300005290 | Ga0065712_10071598 | Ga0065712_100715985 | 103 |
| 280 | 3300005290 | Ga0065712_10252632 | Ga0065712_102526322 | 103 |
| 281 | 3300005293 | Ga0065715_10001841 | Ga0065715_100018412 | 103 |
| 282 | 3300005293 | Ga0065715_10009791 | Ga0065715_100097912 | 103 |
| 283 | 3300005293 | Ga0065715_10010413 | Ga0065715_100104132 | 103 |
| 284 | 3300005293 | Ga0065715_10200500 | Ga0065715_102005002 | 103 |
| 285 | 3300005293 | Ga0065715_10262112 | Ga0065715_102621122 | 103 |
| 286 | 3300005293 | Ga0065715_10529236 | Ga0065715_105292361 | 103 |
| 287 | 3300005295 | Ga0065707_10470852 | Ga0065707_104708522 | 103 |
| 288 | 3300005328 | Ga0070676_10670652 | Ga0070676_106706521 | 103 |
| 289 | 3300005328 | Ga0070676_10937765 | Ga0070676_109377652 | 103 |
| 290 | 3300005329 | Ga0070683_100167685 | Ga0070683_1001676852 | 103 |
| 291 | 3300005329 | Ga0070683_100279200 | Ga0070683_1002792002 | 103 |
| 292 | 3300005329 | Ga0070683_100296687 | Ga0070683_1002966872 | 103 |
| 293 | 3300005330 | Ga0070690_101152542 | Ga0070690_1011525421 | 103 |
| 294 | 3300005330 | Ga0070690_101206321 | Ga0070690_1012063212 | 103 |
| 295 | 3300005331 | Ga0070670_100612607 | Ga0070670_1006126072 | 103 |
| 296 | 3300005334 | Ga0068869_101400217 | Ga0068869_1014002172 | 103 |
| 297 | 3300005335 | Ga0070666_11280780 | Ga0070666_112807801 | 103 |
| 298 | 3300005336 | Ga0070680_100159576 | Ga0070680_1001595761 | 103 |
| 299 | 3300005337 | Ga0070682_100128511 | Ga0070682_1001285112 | 103 |
| 300 | 3300005337 | Ga0070682_100269638 | Ga0070682_1002696382 | 103 |
| 301 | 3300005337 | Ga0070682_101319282 | Ga0070682_1013192821 | 103 |
| 302 | 3300005338 | Ga0068868_100084610 | Ga0068868_1000846102 | 103 |
| 303 | 3300005338 | Ga0068868_100430792 | Ga0068868_1004307921 | 103 |
| 304 | 3300005339 | Ga0070660_100018375 | Ga0070660_1000183752 | 103 |
| 305 | 3300005339 | Ga0070660_100262447 | Ga0070660_1002624472 | 103 |
| 306 | 3300005339 | Ga0070660_101680443 | Ga0070660_1016804431 | 103 |
| 307 | 3300005340 | Ga0070689_100127380 | Ga0070689_1001273802 | 103 |
| 308 | 3300005340 | Ga0070689_100203517 | Ga0070689_1002035172 | 103 |
| 309 | 3300005343 | Ga0070687_100414572 | Ga0070687_1004145722 | 103 |
| 310 | 3300005344 | Ga0070661_100106886 | Ga0070661_1001068862 | 103 |
| 311 | 3300005344 | Ga0070661_100116256 | Ga0070661_1001162562 | 103 |
| 312 | 3300005344 | Ga0070661_100330819 | Ga0070661_1003308192 | 103 |
| 313 | 3300005347 | Ga0070668_100514564 | Ga0070668_1005145641 | 103 |
| 314 | 3300005354 | Ga0070675_100012615 | Ga0070675_1000126159 | 103 |
| 315 | 3300005354 | Ga0070675_100027188 | Ga0070675_1000271887 | 103 |
| 316 | 3300005354 | Ga0070675_100127457 | Ga0070675_1001274572 | 103 |
| 317 | 3300005354 | Ga0070675_100147760 | Ga0070675_1001477602 | 103 |
| 318 | 3300005354 | Ga0070675_100458656 | Ga0070675_1004586562 | 103 |
| 319 | 3300005354 | Ga0070675_101437073 | Ga0070675_1014370732 | 103 |
| 320 | 3300005355 | Ga0070671_100816365 | Ga0070671_1008163652 | 103 |
| 321 | 3300005356 | Ga0070674_100084695 | Ga0070674_1000846952 | 103 |
| 322 | 3300005356 | Ga0070674_101103438 | Ga0070674_1011034382 | 103 |
| 323 | 3300005364 | Ga0070673_100030668 | Ga0070673_1000306682 | 103 |
| 324 | 3300005365 | Ga0070688_100011701 | Ga0070688_1000117011 | 103 |
| 325 | 3300005365 | Ga0070688_100124857 | Ga0070688_1001248572 | 103 |
| 326 | 3300005365 | Ga0070688_100715429 | Ga0070688_1007154291 | 103 |
| 327 | 3300005365 | Ga0070688_101238095 | Ga0070688_1012380952 | 103 |
| 328 | 3300005366 | Ga0070659_100001816 | Ga0070659_1000018164 | 103 |
| 329 | 3300005366 | Ga0070659_100151911 | Ga0070659_1001519112 | 103 |
| 330 | 3300005366 | Ga0070659_100878177 | Ga0070659_1008781771 | 103 |
| 331 | 3300005367 | Ga0070667_100075007 | Ga0070667_1000750075 | 103 |
| 332 | 3300005367 | Ga0070667_100538488 | Ga0070667_1005384882 | 103 |
| 333 | 3300005434 | Ga0070709_11795639 | Ga0070709_117956391 | 103 |
| 334 | 3300005435 | Ga0070714_100010616 | Ga0070714_1000106163 | 103 |
| 335 | 3300005435 | Ga0070714_100338086 | Ga0070714_1003380862 | 103 |
| 336 | 3300005436 | Ga0070713_100027581 | Ga0070713_1000275814 | 103 |
| 337 | 3300005436 | Ga0070713_100058836 | Ga0070713_1000588362 | 103 |
| 338 | 3300005436 | Ga0070713_101019021 | Ga0070713_1010190212 | 103 |
| 339 | 3300005437 | Ga0070710_10160008 | Ga0070710_101600082 | 103 |
| 340 | 3300005439 | Ga0070711_100290062 | Ga0070711_1002900622 | 103 |
| 341 | 3300005439 | Ga0070711_100906780 | Ga0070711_1009067802 | 103 |
| 342 | 3300005440 | Ga0070705_100100550 | Ga0070705_1001005502 | 103 |
| 343 | 3300005440 | Ga0070705_100111839 | Ga0070705_1001118392 | 103 |
| 344 | 3300005441 | Ga0070700_100019271 | Ga0070700_1000192714 | 103 |
| 345 | 3300005444 | Ga0070694_100638455 | Ga0070694_1006384552 | 103 |
| 346 | 3300005445 | Ga0070708_100050425 | Ga0070708_1000504252 | 103 |
| 347 | 3300005445 | Ga0070708_100057319 | Ga0070708_1000573195 | 103 |
| 348 | 3300005445 | Ga0070708_100259124 | Ga0070708_1002591242 | 103 |
| 349 | 3300005445 | Ga0070708_100738633 | Ga0070708_1007386331 | 103 |
| 350 | 3300005455 | Ga0070663_100027393 | Ga0070663_1000273932 | 103 |
| 351 | 3300005455 | Ga0070663_100185891 | Ga0070663_1001858912 | 103 |
| 352 | 3300005455 | Ga0070663_101640344 | Ga0070663_1016403442 | 103 |
| 353 | 3300005456 | Ga0070678_100701535 | Ga0070678_1007015352 | 103 |
| 354 | 3300005457 | Ga0070662_100434665 | Ga0070662_1004346652 | 103 |
| 355 | 3300005457 | Ga0070662_100737825 | Ga0070662_1007378251 | 103 |
| 356 | 3300005457 | Ga0070662_100842338 | Ga0070662_1008423381 | 103 |
| 357 | 3300005458 | Ga0070681_10088153 | Ga0070681_100881535 | 103 |
| 358 | 3300005466 | Ga0070685_10018866 | Ga0070685_100188664 | 103 |
| 359 | 3300005467 | Ga0070706_100184319 | Ga0070706_1001843192 | 103 |
| 360 | 3300005467 | Ga0070706_100508317 | Ga0070706_1005083172 | 103 |
| 361 | 3300005467 | Ga0070706_100902190 | Ga0070706_1009021902 | 103 |
| 362 | 3300005467 | Ga0070706_101088350 | Ga0070706_1010883501 | 103 |
| 363 | 3300005467 | Ga0070706_101385031 | Ga0070706_1013850311 | 103 |
| 364 | 3300005468 | Ga0070707_100001892 | Ga0070707_1000018925 | 103 |
| 365 | 3300005468 | Ga0070707_100026239 | Ga0070707_1000262396 | 103 |
| 366 | 3300005468 | Ga0070707_100096169 | Ga0070707_1000961693 | 103 |
| 367 | 3300005468 | Ga0070707_101099745 | Ga0070707_1010997452 | 103 |
| 368 | 3300005468 | Ga0070707_101696307 | Ga0070707_1016963072 | 103 |
| 369 | 3300005471 | Ga0070698_100001080 | Ga0070698_10000108030 | 103 |
| 370 | 3300005471 | Ga0070698_100047049 | Ga0070698_1000470499 | 103 |
| 371 | 3300005471 | Ga0070698_100065927 | Ga0070698_1000659273 | 103 |
| 372 | 3300005471 | Ga0070698_101603143 | Ga0070698_1016031431 | 103 |
| 373 | 3300005518 | Ga0070699_100148455 | Ga0070699_1001484552 | 103 |
| 374 | 3300005518 | Ga0070699_101785566 | Ga0070699_1017855661 | 103 |
| 375 | 3300005530 | Ga0070679_100402944 | Ga0070679_1004029441 | 103 |
| 376 | 3300005535 | Ga0070684_100001876 | Ga0070684_10000187610 | 103 |
| 377 | 3300005535 | Ga0070684_100002566 | Ga0070684_10000256612 | 103 |
| 378 | 3300005535 | Ga0070684_101042196 | Ga0070684_1010421961 | 103 |
| 379 | 3300005536 | Ga0070697_100044378 | Ga0070697_1000443782 | 103 |
| 380 | 3300005536 | Ga0070697_100711788 | Ga0070697_1007117882 | 103 |
| 381 | 3300005536 | Ga0070697_101030954 | Ga0070697_1010309542 | 103 |
| 382 | 3300005539 | Ga0068853_101657855 | Ga0068853_1016578551 | 103 |
| 383 | 3300005543 | Ga0070672_100394302 | Ga0070672_1003943022 | 103 |
| 384 | 3300005543 | Ga0070672_100995905 | Ga0070672_1009959052 | 103 |
| 385 | 3300005544 | Ga0070686_100073886 | Ga0070686_1000738862 | 103 |
| 386 | 3300005544 | Ga0070686_101400959 | Ga0070686_1014009591 | 103 |
| 387 | 3300005546 | Ga0070696_101588245 | Ga0070696_1015882451 | 103 |
| 388 | 3300005547 | Ga0070693_100719642 | Ga0070693_1007196422 | 103 |
| 389 | 3300005548 | Ga0070665_100004891 | Ga0070665_1000048916 | 103 |
| 390 | 3300005548 | Ga0070665_100216799 | Ga0070665_1002167992 | 103 |
| 391 | 3300005548 | Ga0070665_101982486 | Ga0070665_1019824862 | 103 |
| 392 | 3300005563 | Ga0068855_102523784 | Ga0068855_1025237841 | 103 |
| 393 | 3300005564 | Ga0070664_100068902 | Ga0070664_1000689023 | 103 |
| 394 | 3300005564 | Ga0070664_100267663 | Ga0070664_1002676632 | 103 |
| 395 | 3300005564 | Ga0070664_100616727 | Ga0070664_1006167272 | 103 |
| 396 | 3300005578 | Ga0068854_100460791 | Ga0068854_1004607911 | 103 |
| 397 | 3300005614 | Ga0068856_100073290 | Ga0068856_1000732902 | 103 |
| 398 | 3300005614 | Ga0068856_101434394 | Ga0068856_1014343941 | 103 |
| 399 | 3300005615 | Ga0070702_100419396 | Ga0070702_1004193961 | 103 |
| 400 | 3300005617 | Ga0068859_103122426 | Ga0068859_1031224261 | 103 |
| 401 | 3300005618 | Ga0068864_100345941 | Ga0068864_1003459412 | 103 |
| 402 | 3300005618 | Ga0068864_100415696 | Ga0068864_1004156962 | 103 |
| 403 | 3300005618 | Ga0068864_101653289 | Ga0068864_1016532892 | 103 |
| 404 | 3300005718 | Ga0068866_10360263 | Ga0068866_103602632 | 103 |
| 405 | 3300005841 | Ga0068863_100026675 | Ga0068863_1000266758 | 103 |
| 406 | 3300005841 | Ga0068863_100718501 | Ga0068863_1007185011 | 103 |
| 407 | 3300005841 | Ga0068863_101120860 | Ga0068863_1011208602 | 103 |
| 408 | 3300005842 | Ga0068858_100322499 | Ga0068858_1003224992 | 103 |
| 409 | 3300005842 | Ga0068858_100824044 | Ga0068858_1008240442 | 103 |
| 410 | 3300005843 | Ga0068860_100129957 | Ga0068860_1001299572 | 103 |
| 411 | 3300005844 | Ga0068862_102448839 | Ga0068862_1024488391 | 103 |
| 412 | 3300005937 | Ga0081455_10002512 | Ga0081455_100025129 | 103 |
| 413 | 3300005937 | Ga0081455_10021948 | Ga0081455_100219482 | 103 |
| 414 | 3300005937 | Ga0081455_10023390 | Ga0081455_100233903 | 103 |
| 415 | 3300005937 | Ga0081455_10034285 | Ga0081455_100342855 | 103 |
| 416 | 3300005937 | Ga0081455_10078628 | Ga0081455_100786285 | 103 |
| 417 | 3300005937 | Ga0081455_10127226 | Ga0081455_101272262 | 103 |
| 418 | 3300005937 | Ga0081455_10138759 | Ga0081455_101387591 | 103 |
| 419 | 3300005937 | Ga0081455_10449976 | Ga0081455_104499761 | 103 |
| 420 | 3300005983 | Ga0081540_1001119 | Ga0081540_10011196 | 103 |
| 421 | 3300005983 | Ga0081540_1009553 | Ga0081540_10095532 | 103 |
| 422 | 3300005983 | Ga0081540_1094483 | Ga0081540_10944832 | 103 |
| 423 | 3300005983 | Ga0081540_1196661 | Ga0081540_11966612 | 103 |
| 424 | 3300005985 | Ga0081539_10000052 | Ga0081539_1000005276 | 103 |
| 425 | 3300005985 | Ga0081539_10000671 | Ga0081539_100006717 | 103 |
| 426 | 3300005985 | Ga0081539_10021753 | Ga0081539_100217533 | 103 |
| 427 | 3300005985 | Ga0081539_10133477 | Ga0081539_101334772 | 103 |
| 428 | 3300006028 | Ga0070717_10007003 | Ga0070717_100070032 | 103 |
| 429 | 3300006028 | Ga0070717_10147471 | Ga0070717_101474712 | 103 |
| 430 | 3300006028 | Ga0070717_10158543 | Ga0070717_101585432 | 103 |
| 431 | 3300006028 | Ga0070717_11368278 | Ga0070717_113682781 | 103 |
| 432 | 3300006028 | Ga0070717_11577386 | Ga0070717_115773861 | 103 |
| 433 | 3300006163 | Ga0070715_10095844 | Ga0070715_100958442 | 103 |
| 434 | 3300006163 | Ga0070715_10121076 | Ga0070715_101210762 | 103 |
| 435 | 3300006173 | Ga0070716_100157119 | Ga0070716_1001571192 | 103 |
| 436 | 3300006175 | Ga0070712_100122098 | Ga0070712_1001220982 | 103 |
| 437 | 3300006175 | Ga0070712_100148771 | Ga0070712_1001487711 | 103 |
| 438 | 3300006175 | Ga0070712_100259798 | Ga0070712_1002597982 | 103 |
| 439 | 3300006175 | Ga0070712_100403413 | Ga0070712_1004034132 | 103 |
| 440 | 3300006358 | Ga0068871_100443318 | Ga0068871_1004433181 | 103 |
| 441 | 3300006358 | Ga0068871_102028374 | Ga0068871_1020283742 | 103 |
| 442 | 3300006844 | Ga0075428_100243578 | Ga0075428_1002435782 | 103 |
| 443 | 3300006852 | Ga0075433_11461854 | Ga0075433_114618541 | 103 |
| 444 | 3300006871 | Ga0075434_102006986 | Ga0075434_1020069861 | 103 |
| 445 | 3300006881 | Ga0068865_100109714 | Ga0068865_1001097142 | 103 |
| 446 | 3300006931 | Ga0097620_103121585 | Ga0097620_1031215851 | 103 |
| 447 | 3300007076 | Ga0075435_101512514 | Ga0075435_1015125142 | 103 |
| 448 | 3300007265 | Ga0099794_10406574 | Ga0099794_104065741 | 103 |
| 449 | 3300009098 | Ga0105245_10327619 | Ga0105245_103276192 | 103 |
| 450 | 3300009098 | Ga0105245_10718427 | Ga0105245_107184272 | 103 |
| 451 | 3300009101 | Ga0105247_10097735 | Ga0105247_100977352 | 103 |
| 452 | 3300009147 | Ga0114129_10631873 | Ga0114129_106318731 | 103 |
| 453 | 3300009147 | Ga0114129_10647695 | Ga0114129_106476951 | 103 |
| 454 | 3300009147 | Ga0114129_10702553 | Ga0114129_107025532 | 103 |
| 455 | 3300009148 | Ga0105243_10159811 | Ga0105243_101598112 | 103 |
| 456 | 3300009148 | Ga0105243_10973861 | Ga0105243_109738612 | 103 |
| 457 | 3300009174 | Ga0105241_11041825 | Ga0105241_110418252 | 103 |
| 458 | 3300009177 | Ga0105248_11110317 | Ga0105248_111103172 | 103 |
| 459 | 3300009177 | Ga0105248_12035804 | Ga0105248_120358041 | 103 |
| 460 | 3300009545 | Ga0105237_11997933 | Ga0105237_119979332 | 103 |
| 461 | 3300009545 | Ga0105237_12093754 | Ga0105237_120937541 | 103 |
| 462 | 3300009551 | Ga0105238_11034795 | Ga0105238_110347951 | 103 |
| 463 | 3300009553 | Ga0105249_10186698 | Ga0105249_101866982 | 103 |
| 464 | 3300010159 | Ga0099796_10038160 | Ga0099796_100381602 | 103 |
| 465 | 3300010375 | Ga0105239_10437507 | Ga0105239_104375072 | 103 |
| 466 | 3300010375 | Ga0105239_11326923 | Ga0105239_113269231 | 103 |
| 467 | 3300011119 | Ga0105246_10815966 | Ga0105246_108159662 | 103 |
| 468 | 3300011119 | Ga0105246_10912459 | Ga0105246_109124591 | 103 |
| 469 | 3300013100 | Ga0157373_10549474 | Ga0157373_105494742 | 103 |
| 470 | 3300013102 | Ga0157371_10263893 | Ga0157371_102638932 | 103 |
| 471 | 3300013102 | Ga0157371_11104824 | Ga0157371_111048241 | 103 |
| 472 | 3300013104 | Ga0157370_10368050 | Ga0157370_103680502 | 103 |
| 473 | 3300013296 | Ga0157374_10117230 | Ga0157374_101172303 | 103 |
| 474 | 3300013296 | Ga0157374_10175300 | Ga0157374_101753001 | 103 |
| 475 | 3300013296 | Ga0157374_10302879 | Ga0157374_103028792 | 103 |
| 476 | 3300013296 | Ga0157374_10571099 | Ga0157374_105710992 | 103 |
| 477 | 3300013296 | Ga0157374_11154256 | Ga0157374_111542562 | 103 |
| 478 | 3300013296 | Ga0157374_12249492 | Ga0157374_122494921 | 103 |
| 479 | 3300013297 | Ga0157378_10033410 | Ga0157378_100334102 | 103 |
| 480 | 3300013306 | Ga0163162_10149344 | Ga0163162_101493442 | 103 |
| 481 | 3300013306 | Ga0163162_10440967 | Ga0163162_104409672 | 103 |
| 482 | 3300013307 | Ga0157372_11404020 | Ga0157372_114040201 | 103 |
| 483 | 3300013307 | Ga0157372_11920510 | Ga0157372_119205102 | 103 |
| 484 | 3300013308 | Ga0157375_10004600 | Ga0157375_1000460017 | 103 |
| 485 | 3300013308 | Ga0157375_10019367 | Ga0157375_100193672 | 103 |
| 486 | 3300013308 | Ga0157375_11549503 | Ga0157375_115495031 | 103 |
| 487 | 3300013308 | Ga0157375_12847759 | Ga0157375_128477592 | 103 |
| 488 | 3300013308 | Ga0157375_13319466 | Ga0157375_133194662 | 103 |
| 489 | 3300014325 | Ga0163163_10693307 | Ga0163163_106933072 | 103 |
| 490 | 3300014325 | Ga0163163_11180473 | Ga0163163_111804732 | 103 |
| 491 | 3300014325 | Ga0163163_11832804 | Ga0163163_118328041 | 103 |
| 492 | 3300014325 | Ga0163163_12952853 | Ga0163163_129528532 | 103 |
| 493 | 3300014326 | Ga0157380_12644569 | Ga0157380_126445692 | 103 |
| 494 | 3300014745 | Ga0157377_10008830 | Ga0157377_100088302 | 103 |
| 495 | 3300014745 | Ga0157377_11140444 | Ga0157377_111404441 | 103 |
| 496 | 3300014968 | Ga0157379_11017798 | Ga0157379_110177981 | 103 |
| 497 | 3300014968 | Ga0157379_11384942 | Ga0157379_113849421 | 103 |
| 498 | 3300014969 | Ga0157376_10079358 | Ga0157376_100793582 | 103 |
| 499 | 3300014969 | Ga0157376_10737273 | Ga0157376_107372732 | 103 |
| 500 | 3300014969 | Ga0157376_12594521 | Ga0157376_125945212 | 103 |
| 501 | 3300015262 | Ga0182007_10043093 | Ga0182007_100430932 | 103 |
| 502 | 3300017792 | Ga0163161_10209079 | Ga0163161_102090792 | 103 |
| 503 | 3300025271 | Ga0207666_1000131 | Ga0207666_10001316 | 103 |
| 504 | 3300025290 | Ga0207673_1000321 | Ga0207673_10003214 | 103 |
| 505 | 3300025290 | Ga0207673_1009634 | Ga0207673_10096341 | 103 |
| 506 | 3300025315 | Ga0207697_10002751 | Ga0207697_100027515 | 103 |
| 507 | 3300025315 | Ga0207697_10008048 | Ga0207697_100080483 | 103 |
| 508 | 3300025315 | Ga0207697_10061473 | Ga0207697_100614732 | 103 |
| 509 | 3300025315 | Ga0207697_10140126 | Ga0207697_101401262 | 103 |
| 510 | 3300025315 | Ga0207697_10153082 | Ga0207697_101530822 | 103 |
| 511 | 3300025885 | Ga0207653_10004352 | Ga0207653_100043525 | 103 |
| 512 | 3300025885 | Ga0207653_10055425 | Ga0207653_100554252 | 103 |
| 513 | 3300025898 | Ga0207692_10064534 | Ga0207692_100645342 | 103 |
| 514 | 3300025898 | Ga0207692_10171367 | Ga0207692_101713672 | 103 |
| 515 | 3300025899 | Ga0207642_10526858 | Ga0207642_105268581 | 103 |
| 516 | 3300025900 | Ga0207710_10073332 | Ga0207710_100733322 | 103 |
| 517 | 3300025901 | Ga0207688_10046425 | Ga0207688_100464252 | 103 |
| 518 | 3300025901 | Ga0207688_10283819 | Ga0207688_102838192 | 103 |
| 519 | 3300025904 | Ga0207647_10013194 | Ga0207647_100131942 | 103 |
| 520 | 3300025905 | Ga0207685_10117831 | Ga0207685_101178312 | 103 |
| 521 | 3300025906 | Ga0207699_10241843 | Ga0207699_102418432 | 103 |
| 522 | 3300025906 | Ga0207699_10490193 | Ga0207699_104901932 | 103 |
| 523 | 3300025907 | Ga0207645_10154520 | Ga0207645_101545202 | 103 |
| 524 | 3300025909 | Ga0207705_10205921 | Ga0207705_102059212 | 103 |
| 525 | 3300025910 | Ga0207684_10000268 | Ga0207684_1000026859 | 103 |
| 526 | 3300025910 | Ga0207684_10005555 | Ga0207684_100055557 | 103 |
| 527 | 3300025910 | Ga0207684_10100398 | Ga0207684_101003982 | 103 |
| 528 | 3300025910 | Ga0207684_10103404 | Ga0207684_101034042 | 103 |
| 529 | 3300025910 | Ga0207684_10116444 | Ga0207684_101164442 | 103 |
| 530 | 3300025910 | Ga0207684_10197833 | Ga0207684_101978332 | 103 |
| 531 | 3300025910 | Ga0207684_10685246 | Ga0207684_106852461 | 103 |
| 532 | 3300025910 | Ga0207684_10759992 | Ga0207684_107599921 | 103 |
| 533 | 3300025911 | Ga0207654_10160674 | Ga0207654_101606742 | 103 |
| 534 | 3300025911 | Ga0207654_11007821 | Ga0207654_110078212 | 103 |
| 535 | 3300025912 | Ga0207707_10037297 | Ga0207707_100372973 | 103 |
| 536 | 3300025914 | Ga0207671_10189393 | Ga0207671_101893932 | 103 |
| 537 | 3300025915 | Ga0207693_10034854 | Ga0207693_100348542 | 103 |
| 538 | 3300025915 | Ga0207693_10063500 | Ga0207693_100635003 | 103 |
| 539 | 3300025915 | Ga0207693_10220603 | Ga0207693_102206032 | 103 |
| 540 | 3300025915 | Ga0207693_10493657 | Ga0207693_104936572 | 103 |
| 541 | 3300025915 | Ga0207693_10655984 | Ga0207693_106559842 | 103 |
| 542 | 3300025915 | Ga0207693_10704491 | Ga0207693_107044912 | 103 |
| 543 | 3300025916 | Ga0207663_10436995 | Ga0207663_104369952 | 103 |
| 544 | 3300025917 | Ga0207660_10201542 | Ga0207660_102015422 | 103 |
| 545 | 3300025917 | Ga0207660_10676125 | Ga0207660_106761252 | 103 |
| 546 | 3300025918 | Ga0207662_10075776 | Ga0207662_100757762 | 103 |
| 547 | 3300025919 | Ga0207657_10018574 | Ga0207657_100185744 | 103 |
| 548 | 3300025919 | Ga0207657_10183335 | Ga0207657_101833352 | 103 |
| 549 | 3300025919 | Ga0207657_10190220 | Ga0207657_101902202 | 103 |
| 550 | 3300025919 | Ga0207657_10232458 | Ga0207657_102324582 | 103 |
| 551 | 3300025920 | Ga0207649_10178294 | Ga0207649_101782942 | 103 |
| 552 | 3300025920 | Ga0207649_10372478 | Ga0207649_103724782 | 103 |
| 553 | 3300025921 | Ga0207652_11113739 | Ga0207652_111137391 | 103 |
| 554 | 3300025922 | Ga0207646_10007983 | Ga0207646_100079834 | 103 |
| 555 | 3300025922 | Ga0207646_10066543 | Ga0207646_100665432 | 103 |
| 556 | 3300025922 | Ga0207646_10234015 | Ga0207646_102340152 | 103 |
| 557 | 3300025922 | Ga0207646_10348789 | Ga0207646_103487892 | 103 |
| 558 | 3300025922 | Ga0207646_10631726 | Ga0207646_106317262 | 103 |
| 559 | 3300025926 | Ga0207659_10026322 | Ga0207659_100263226 | 103 |
| 560 | 3300025926 | Ga0207659_10062176 | Ga0207659_100621762 | 103 |
| 561 | 3300025926 | Ga0207659_10203878 | Ga0207659_102038782 | 103 |
| 562 | 3300025926 | Ga0207659_10357383 | Ga0207659_103573831 | 103 |
| 563 | 3300025926 | Ga0207659_10396809 | Ga0207659_103968092 | 103 |
| 564 | 3300025927 | Ga0207687_10133580 | Ga0207687_101335802 | 103 |
| 565 | 3300025927 | Ga0207687_10207559 | Ga0207687_102075592 | 103 |
| 566 | 3300025928 | Ga0207700_10002998 | Ga0207700_100029986 | 103 |
| 567 | 3300025928 | Ga0207700_10950405 | Ga0207700_109504051 | 103 |
| 568 | 3300025929 | Ga0207664_10071032 | Ga0207664_100710323 | 103 |
| 569 | 3300025929 | Ga0207664_10452858 | Ga0207664_104528582 | 103 |
| 570 | 3300025931 | Ga0207644_10069184 | Ga0207644_100691842 | 103 |
| 571 | 3300025931 | Ga0207644_10194564 | Ga0207644_101945642 | 103 |
| 572 | 3300025931 | Ga0207644_10531213 | Ga0207644_105312132 | 103 |
| 573 | 3300025932 | Ga0207690_10006971 | Ga0207690_100069719 | 103 |
| 574 | 3300025932 | Ga0207690_10058662 | Ga0207690_100586622 | 103 |
| 575 | 3300025933 | Ga0207706_10476560 | Ga0207706_104765602 | 103 |
| 576 | 3300025933 | Ga0207706_10989284 | Ga0207706_109892842 | 103 |
| 577 | 3300025933 | Ga0207706_10995024 | Ga0207706_109950242 | 103 |
| 578 | 3300025934 | Ga0207686_10457804 | Ga0207686_104578042 | 103 |
| 579 | 3300025935 | Ga0207709_10201833 | Ga0207709_102018332 | 103 |
| 580 | 3300025935 | Ga0207709_10777429 | Ga0207709_107774291 | 103 |
| 581 | 3300025936 | Ga0207670_10129317 | Ga0207670_101293173 | 103 |
| 582 | 3300025936 | Ga0207670_10461746 | Ga0207670_104617462 | 103 |
| 583 | 3300025936 | Ga0207670_10686502 | Ga0207670_106865022 | 103 |
| 584 | 3300025937 | Ga0207669_10437739 | Ga0207669_104377392 | 103 |
| 585 | 3300025938 | Ga0207704_10069471 | Ga0207704_100694712 | 103 |
| 586 | 3300025939 | Ga0207665_10098473 | Ga0207665_100984733 | 103 |
| 587 | 3300025940 | Ga0207691_10119459 | Ga0207691_101194592 | 103 |
| 588 | 3300025942 | Ga0207689_10110145 | Ga0207689_101101452 | 103 |
| 589 | 3300025944 | Ga0207661_10044464 | Ga0207661_100444642 | 103 |
| 590 | 3300025944 | Ga0207661_10084479 | Ga0207661_100844792 | 103 |
| 591 | 3300025944 | Ga0207661_10138610 | Ga0207661_101386102 | 103 |
| 592 | 3300025944 | Ga0207661_10245701 | Ga0207661_102457012 | 103 |
| 593 | 3300025945 | Ga0207679_10266427 | Ga0207679_102664272 | 103 |
| 594 | 3300025961 | Ga0207712_10217965 | Ga0207712_102179652 | 103 |
| 595 | 3300025961 | Ga0207712_11337169 | Ga0207712_113371692 | 103 |
| 596 | 3300025972 | Ga0207668_10652044 | Ga0207668_106520442 | 103 |
| 597 | 3300025972 | Ga0207668_11031982 | Ga0207668_110319822 | 103 |
| 598 | 3300025981 | Ga0207640_10106266 | Ga0207640_101062662 | 103 |
| 599 | 3300025986 | Ga0207658_10149497 | Ga0207658_101494973 | 103 |
| 600 | 3300025986 | Ga0207658_10689711 | Ga0207658_106897112 | 103 |
| 601 | 3300026023 | Ga0207677_10175799 | Ga0207677_101757992 | 103 |
| 602 | 3300026023 | Ga0207677_10176510 | Ga0207677_101765102 | 103 |
| 603 | 3300026035 | Ga0207703_10467315 | Ga0207703_104673151 | 103 |
| 604 | 3300026035 | Ga0207703_10981204 | Ga0207703_109812041 | 103 |
| 605 | 3300026035 | Ga0207703_11006802 | Ga0207703_110068021 | 103 |
| 606 | 3300026041 | Ga0207639_10872408 | Ga0207639_108724082 | 103 |
| 607 | 3300026041 | Ga0207639_11254141 | Ga0207639_112541412 | 103 |
| 608 | 3300026067 | Ga0207678_10017673 | Ga0207678_100176732 | 103 |
| 609 | 3300026067 | Ga0207678_10566695 | Ga0207678_105666952 | 103 |
| 610 | 3300026078 | Ga0207702_10782873 | Ga0207702_107828731 | 103 |
| 611 | 3300026078 | Ga0207702_10850524 | Ga0207702_108505242 | 103 |
| 612 | 3300026088 | Ga0207641_10303989 | Ga0207641_103039892 | 103 |
| 613 | 3300026088 | Ga0207641_11422971 | Ga0207641_114229712 | 103 |
| 614 | 3300026095 | Ga0207676_10618815 | Ga0207676_106188152 | 103 |
| 615 | 3300026095 | Ga0207676_10755135 | Ga0207676_107551352 | 103 |
| 616 | 3300026095 | Ga0207676_11051941 | Ga0207676_110519412 | 103 |
| 617 | 3300026095 | Ga0207676_12216554 | Ga0207676_122165542 | 103 |
| 618 | 3300026118 | Ga0207675_100163902 | Ga0207675_1001639022 | 103 |
| 619 | 3300026121 | Ga0207683_10577610 | Ga0207683_105776102 | 103 |
| 620 | 3300027876 | Ga0209974_10163426 | Ga0209974_101634261 | 103 |
| 621 | 3300028379 | Ga0268266_10043478 | Ga0268266_100434782 | 103 |
| 622 | 3300028379 | Ga0268266_10056203 | Ga0268266_100562032 | 103 |
| 623 | 3300028379 | Ga0268266_10345233 | Ga0268266_103452332 | 103 |
| 624 | 3300028379 | Ga0268266_10522709 | Ga0268266_105227092 | 103 |
| 625 | 3300028380 | Ga0268265_11976313 | Ga0268265_119763132 | 103 |
| 626 | 3300035083 | Ga0373926_0068650 | Ga0373926_0068650_356_667 | 103 |
| 627 | 3300035086 | Ga0373934_0068216 | Ga0373934_0068216_1035_1346 | 103 |
| 628 | 3300035088 | Ga0373940_0286791 | Ga0373940_0286791_214_525 | 103 |
| 629 | 3300035089 | Ga0373944_0059956 | Ga0373944_0059956_274_585 | 103 |
| 630 | 3300035111 | Ga0373923_0181340 | Ga0373923_0181340_561_872 | 103 |
| 631 | 3300035116 | Ga0373945_0032318 | Ga0373945_0032318_214_525 | 103 |
| 632 | 3300035116 | Ga0373945_0264920 | Ga0373945_0264920_314_625 | 103 |
| 633 | 3300035117 | Ga0373953_0018832 | Ga0373953_0018832_820_1131 | 103 |
| 634 | 3300035118 | Ga0373954_0046839 | Ga0373954_0046839_118_429 | 103 |
| 635 | 3300035119 | Ga0373956_0021811 | Ga0373956_0021811_1131_1442 | 103 |
| 636 | 3300035120 | Ga0373957_0027985 | Ga0373957_0027985_847_1158 | 103 |
| 637 | 3300035120 | Ga0373957_0376806 | Ga0373957_0376806_202_513 | 103 |
| 638 | 3300035170 | Ga0373943_0178173 | Ga0373943_0178173_359_670 | 103 |
| 639 | 3300035171 | Ga0373946_0041419 | Ga0373946_0041419_419_730 | 103 |
| 640 | 3300035172 | Ga0373955_0202384 | Ga0373955_0202384_53_364 | 103 |
| 641 | 3300035172 | Ga0373955_0221747 | Ga0373955_0221747_261_572 | 103 |
| 642 | 3300035207 | Ga0373942_0133971 | Ga0373942_0133971_91_402 | 103 |
| 643 | 3300035691 | Ga0373931_0112472 | Ga0373931_0112472_130_441 | 103 |
| 644 | 3300035692 | Ga0373935_0289431 | Ga0373935_0289431_661_972 | 103 |
| 645 | 3300035692 | Ga0373935_0530550 | Ga0373935_0530550_44_355 | 103 |
| 646 | 3300035692 | Ga0373935_0826476 | Ga0373935_0826476_259_570 | 103 |
| 647 | 3300035692 | Ga0373935_0901645 | Ga0373935_0901645_223_534 | 103 |
| 648 | 3300035695 | Ga0373927_0031919 | Ga0373927_0031919_3015_3326 | 103 |
| 649 | 3300035695 | Ga0373927_0718714 | Ga0373927_0718714_259_570 | 103 |
| 650 | 3300035724 | Ga0373933_0183447 | Ga0373933_0183447_220_531 | 103 |
| 651 | 3300035725 | Ga0373947_0217408 | Ga0373947_0217408_513_824 | 103 |
| 652 | 3300035725 | Ga0373947_0329279 | Ga0373947_0329279_219_530 | 103 |
| 653 | 3300035725 | Ga0373947_0507285 | Ga0373947_0507285_50_361 | 103 |
| 654 | 3300036401 | Ga0373937_0096255 | Ga0373937_0096255_1048_1359 | 103 |
| 655 | 3300036401 | Ga0373937_0184059 | Ga0373937_0184059_1612_1923 | 103 |
| 656 | 3300036401 | Ga0373937_1027433 | Ga0373937_1027433_45_356 | 103 |
| 657 | 3300037068 | Ga0373925_0027645 | Ga0373925_0027645_781_1092 | 103 |
| 658 | 3300037068 | Ga0373925_1251300 | Ga0373925_1251300_175_486 | 103 |
| 659 | 3300037312 | Ga0395899_0759722 | Ga0395899_0759722_253_564 | 103 |
| 660 | 3300037466 | Ga0395898_0019724 | Ga0395898_0019724_6415_6726 | 103 |
| 661 | 3300037466 | Ga0395898_1358703 | Ga0395898_1358703_203_514 | 103 |
| 662 | 3300038443 | Ga0395901_0269800 | Ga0395901_0269800_799_1110 | 103 |
| 663 | 3300038443 | Ga0395901_1892070 | Ga0395901_1892070_192_503 | 103 |
| 664 | 3300041452 | Ga0451793_0357197 | Ga0451793_0357197_421_732 | 103 |
| 665 | 3300041512 | Ga0451853_0874465 | Ga0451853_0874465_301_612 | 103 |
| 666 | 3300042003 | Ga0439443_055059 | Ga0439443_055059_46_357 | 103 |
| 667 | 3300042005 | Ga0439448_0167405 | Ga0439448_0167405_370_681 | 103 |
| 668 | 3300042008 | Ga0439450_038473 | Ga0439450_038473_737_1048 | 103 |
| 669 | 3300042012 | Ga0439455_0036334 | Ga0439455_0036334_23_334 | 103 |
| 670 | 3300042157 | Ga0439458_0029050 | Ga0439458_0029050_368_679 | 103 |
| 671 | 3300042993 | Ga0439440_0070788 | Ga0439440_0070788_532_843 | 103 |
| 672 | 3300044706 | Ga0466964_0058486 | Ga0466964_0058486_1223_1534 | 103 |
| 673 | 3300045976 | Ga0466967_1556467 | Ga0466967_1556467_82_393 | 103 |
| 674 | 3300046454 | Ga0495592_0011225 | Ga0495592_0011225_5154_5465 | 103 |
| 675 | 3300046455 | Ga0495603_0051331 | Ga0495603_0051331_1044_1355 | 103 |
| 676 | 3300046459 | Ga0495629_0208928 | Ga0495629_0208928_910_1221 | 103 |
| 677 | 3300046459 | Ga0495629_0258089 | Ga0495629_0258089_350_661 | 103 |
| 678 | 3300046461 | Ga0495641_0056447 | Ga0495641_0056447_139_450 | 103 |
| 679 | 3300046461 | Ga0495641_0097369 | Ga0495641_0097369_89_400 | 103 |
| 680 | 3300046462 | Ga0495651_0160530 | Ga0495651_0160530_1084_1395 | 103 |
| 681 | 3300046462 | Ga0495651_0463201 | Ga0495651_0463201_105_416 | 103 |
| 682 | 3300046463 | Ga0495653_0313310 | Ga0495653_0313310_161_472 | 103 |
| 683 | 3300046473 | Ga0495582_0185982 | Ga0495582_0185982_722_1033 | 103 |
| 684 | 3300046474 | Ga0495605_0346386 | Ga0495605_0346386_10_321 | 103 |
| 685 | 3300046476 | Ga0495662_0148882 | Ga0495662_0148882_805_1116 | 103 |
| 686 | 3300046477 | Ga0495664_0790960 | Ga0495664_0790960_227_538 | 103 |
| 687 | 3300046491 | Ga0495584_0151135 | Ga0495584_0151135_858_1169 | 103 |
| 688 | 3300046491 | Ga0495584_0257573 | Ga0495584_0257573_248_559 | 103 |
| 689 | 3300046499 | Ga0495594_0066156 | Ga0495594_0066156_498_809 | 103 |
| 690 | 3300046511 | Ga0495608_0219869 | Ga0495608_0219869_535_846 | 103 |
| 691 | 3300046511 | Ga0495608_0267853 | Ga0495608_0267853_586_897 | 103 |
| 692 | 3300046511 | Ga0495608_0862526 | Ga0495608_0862526_75_386 | 103 |
| 693 | 3300046514 | Ga0495618_0134761 | Ga0495618_0134761_566_877 | 103 |
| 694 | 3300046514 | Ga0495618_0875463 | Ga0495618_0875463_168_479 | 103 |
| 695 | 3300046516 | Ga0495628_0030849 | Ga0495628_0030849_608_919 | 103 |
| 696 | 3300046517 | Ga0495630_0050818 | Ga0495630_0050818_161_472 | 103 |
| 697 | 3300046517 | Ga0495630_1176768 | Ga0495630_1176768_97_408 | 103 |
| 698 | 3300046520 | Ga0495637_0313631 | Ga0495637_0313631_101_412 | 103 |
| 699 | 3300046523 | Ga0495644_0152135 | Ga0495644_0152135_366_677 | 103 |
| 700 | 3300046529 | Ga0495652_0177757 | Ga0495652_0177757_702_1013 | 103 |
| 701 | 3300046529 | Ga0495652_0279458 | Ga0495652_0279458_769_1080 | 103 |
| 702 | 3300046531 | Ga0495665_0151866 | Ga0495665_0151866_133_444 | 103 |
| 703 | 3300046531 | Ga0495665_0218404 | Ga0495665_0218404_332_643 | 103 |
| 704 | 3300046533 | Ga0495640_0054657 | Ga0495640_0054657_1955_2266 | 103 |
| 705 | 3300046533 | Ga0495640_0305117 | Ga0495640_0305117_206_517 | 103 |
| 706 | 3300046535 | Ga0495586_0024694 | Ga0495586_0024694_2146_2457 | 103 |
| 707 | 3300046536 | Ga0495587_0013515 | Ga0495587_0013515_1921_2232 | 103 |
| 708 | 3300046543 | Ga0495645_0052406 | Ga0495645_0052406_2034_2345 | 103 |
| 709 | 3300046559 | Ga0495667_0232857 | Ga0495667_0232857_607_918 | 103 |
| 710 | 3300046559 | Ga0495667_0333439 | Ga0495667_0333439_520_831 | 103 |
| 711 | 3300046559 | Ga0495667_0355320 | Ga0495667_0355320_554_865 | 103 |
| 712 | 3300046616 | Ga0495668_0323661 | Ga0495668_0323661_396_707 | 103 |
| 713 | 3300046664 | Ga0495659_0093196 | Ga0495659_0093196_86_397 | 103 |
| 714 | 3300046675 | Ga0495657_0203603 | Ga0495657_0203603_389_700 | 103 |
| 715 | 3300046678 | Ga0495599_0043050 | Ga0495599_0043050_2313_2624 | 103 |
| 716 | 3300046679 | Ga0495623_0010814 | Ga0495623_0010814_996_1307 | 103 |
| 717 | 3300046680 | Ga0495646_0005936 | Ga0495646_0005936_461_772 | 103 |
| 718 | 3300046683 | Ga0495658_0048384 | Ga0495658_0048384_766_1077 | 103 |
| 719 | 3300046684 | Ga0495669_0173178 | Ga0495669_0173178_620_931 | 103 |
| 720 | 3300046689 | Ga0495613_0295413 | Ga0495613_0295413_766_1077 | 103 |
| 721 | 3300046689 | Ga0495613_0768051 | Ga0495613_0768051_159_470 | 103 |
| 722 | 3300046691 | Ga0495670_0320155 | Ga0495670_0320155_358_669 | 103 |
| 723 | 3300046809 | Ga0495600_0818914 | Ga0495600_0818914_42_353 | 103 |
| 724 | 3300046809 | Ga0495600_0876490 | Ga0495600_0876490_195_506 | 103 |
| 725 | 3300047317 | Ga0495604_0072297 | Ga0495604_0072297_740_1051 | 103 |
| 726 | 3300047317 | Ga0495604_0391913 | Ga0495604_0391913_45_356 | 103 |
| 727 | 3300047318 | Ga0495636_0355976 | Ga0495636_0355976_327_638 | 103 |
| 728 | 3300047319 | Ga0495674_0245478 | Ga0495674_0245478_743_1054 | 103 |
| 729 | 3300047319 | Ga0495674_0315550 | Ga0495674_0315550_357_668 | 103 |
| 730 | 3300047321 | Ga0495676_0086573 | Ga0495676_0086573_205_516 | 103 |
| 731 | 3300047321 | Ga0495676_0716209 | Ga0495676_0716209_183_494 | 103 |
| 732 | 3300047322 | Ga0495680_0143657 | Ga0495680_0143657_454_765 | 103 |
| 733 | 3300047444 | Ga0495675_0034710 | Ga0495675_0034710_2740_3051 | 103 |
| 734 | 3300047471 | Ga0495684_0116581 | Ga0495684_0116581_639_950 | 103 |
| 735 | 3300047471 | Ga0495684_0396592 | Ga0495684_0396592_466_777 | 103 |
| 736 | 3300047673 | Ga0495593_0084185 | Ga0495593_0084185_1308_1619 | 103 |
| 737 | 3300048088 | Ga0495602_0140797 | Ga0495602_0140797_936_1247 | 103 |
| 738 | 3300048903 | Ga0496100_0248221 | Ga0496100_0248221_871_1182 | 103 |
| 739 | 3300048904 | Ga0496101_0079978 | Ga0496101_0079978_1178_1489 | 103 |
| 740 | 3300048904 | Ga0496101_0125680 | Ga0496101_0125680_709_1020 | 103 |
| 741 | 3300048904 | Ga0496101_0851479 | Ga0496101_0851479_254_565 | 103 |
| 742 | 3300048905 | Ga0496102_0067806 | Ga0496102_0067806_1094_1405 | 103 |
| 743 | 3300048905 | Ga0496102_0114593 | Ga0496102_0114593_359_670 | 103 |
| 744 | 3300048905 | Ga0496102_0235623 | Ga0496102_0235623_467_778 | 103 |
| 745 | 3300048905 | Ga0496102_0328933 | Ga0496102_0328933_153_464 | 103 |
| 746 | 3300048906 | Ga0496103_0220136 | Ga0496103_0220136_241_552 | 103 |
| 747 | 3300048906 | Ga0496103_0351242 | Ga0496103_0351242_265_576 | 103 |
| 748 | 3300048906 | Ga0496103_0745857 | Ga0496103_0745857_34_345 | 103 |
| 749 | 3300048907 | Ga0496104_0036202 | Ga0496104_0036202_2801_3112 | 103 |
| 750 | 3300048907 | Ga0496104_0169875 | Ga0496104_0169875_1130_1441 | 103 |
| 751 | 3300048907 | Ga0496104_1314076 | Ga0496104_1314076_171_482 | 103 |
| 752 | 3300048908 | Ga0496105_0088006 | Ga0496105_0088006_422_733 | 103 |
| 753 | 3300048908 | Ga0496105_0309640 | Ga0496105_0309640_843_1154 | 103 |
| 754 | 3300048908 | Ga0496105_0331260 | Ga0496105_0331260_336_647 | 103 |
| 755 | 3300048908 | Ga0496105_1384553 | Ga0496105_1384553_61_372 | 103 |
| 756 | 3300048909 | Ga0496106_0367509 | Ga0496106_0367509_499_810 | 103 |
| 757 | 3300048909 | Ga0496106_0540201 | Ga0496106_0540201_283_594 | 103 |
| 758 | 3300048911 | Ga0496108_0020745 | Ga0496108_0020745_585_896 | 103 |
| 759 | 3300048911 | Ga0496108_0432284 | Ga0496108_0432284_738_1049 | 103 |
| 760 | 3300048911 | Ga0496108_0838520 | Ga0496108_0838520_11_322 | 103 |
| 761 | 3300048911 | Ga0496108_1109584 | Ga0496108_1109584_34_345 | 103 |
| 762 | 3300048912 | Ga0496109_0022499 | Ga0496109_0022499_2364_2675 | 103 |
| 763 | 3300048912 | Ga0496109_0278260 | Ga0496109_0278260_499_810 | 103 |
| 764 | 3300048912 | Ga0496109_1479981 | Ga0496109_1479981_135_446 | 103 |
| 765 | 3300048913 | Ga0496110_0589995 | Ga0496110_0589995_295_606 | 103 |
| 766 | 3300048913 | Ga0496110_0908138 | Ga0496110_0908138_123_434 | 103 |
| 767 | 3300048913 | Ga0496110_1049399 | Ga0496110_1049399_167_478 | 103 |
| 768 | 3300048914 | Ga0496111_0341814 | Ga0496111_0341814_373_684 | 103 |
| 769 | 3300048914 | Ga0496111_0925256 | Ga0496111_0925256_34_345 | 103 |
| 770 | 3300048915 | Ga0496112_0092375 | Ga0496112_0092375_262_573 | 103 |
| 771 | 3300048915 | Ga0496112_0326535 | Ga0496112_0326535_1092_1403 | 103 |
| 772 | 3300048915 | Ga0496112_0604247 | Ga0496112_0604247_648_959 | 103 |
| 773 | 3300048916 | Ga0496113_0288167 | Ga0496113_0288167_313_624 | 103 |
| 774 | 3300048917 | Ga0496114_0002874 | Ga0496114_0002874_10360_10671 | 103 |
| 775 | 3300048917 | Ga0496114_0134745 | Ga0496114_0134745_1387_1698 | 103 |
| 776 | 3300048917 | Ga0496114_0282762 | Ga0496114_0282762_243_554 | 103 |
| 777 | 3300048918 | Ga0496115_0001553 | Ga0496115_0001553_4183_4494 | 103 |
| 778 | 3300048918 | Ga0496115_0172757 | Ga0496115_0172757_1267_1578 | 103 |
| 779 | 3300048918 | Ga0496115_0948939 | Ga0496115_0948939_252_563 | 103 |
| 780 | 3300050493 | nmdc:mga0k408_877908_c1 | nmdc:mga0k408_877908_c1_122_433 | 103 |
| 781 | 3300050507 | nmdc:mga05p37_2002467_c1 | nmdc:mga05p37_2002467_c1_128_439 | 103 |
| 782 | 3300050507 | nmdc:mga05p37_242495_c1 | nmdc:mga05p37_242495_c1_748_1059 | 103 |
| 783 | 3300050507 | nmdc:mga05p37_376324_c1 | nmdc:mga05p37_376324_c1_887_1198 | 103 |
| 784 | 3300050512 | nmdc:mga0n895_1639780_c1 | nmdc:mga0n895_1639780_c1_268_579 | 103 |
| 785 | 3300050512 | nmdc:mga0n895_1678316_c1 | nmdc:mga0n895_1678316_c1_70_381 | 103 |
| 786 | 3300050512 | nmdc:mga0n895_642633_c1 | nmdc:mga0n895_642633_c1_358_669 | 103 |
| 787 | 3300050513 | nmdc:mga0rr50_1321276_c1 | nmdc:mga0rr50_1321276_c1_23_334 | 103 |
| 788 | 3300050513 | nmdc:mga0rr50_369509_c1 | nmdc:mga0rr50_369509_c1_150_461 | 103 |
| 789 | 3300050515 | nmdc:mga0a205_230878_c1 | nmdc:mga0a205_230878_c1_551_862 | 103 |
| 790 | 3300053077 | Ga0495601_0062152 | Ga0495601_0062152_624_935 | 103 |
| 791 | 3300053078 | Ga0495612_0035773 | Ga0495612_0035773_93_404 | 103 |
| 792 | 3300053078 | Ga0495612_0200838 | Ga0495612_0200838_169_480 | 103 |
| 793 | 3300053083 | Ga0495655_0146308 | Ga0495655_0146308_144_455 | 103 |
| 794 | 3300053084 | Ga0495595_0048848 | Ga0495595_0048848_883_1194 | 103 |
| 795 | 3300053085 | Ga0495619_0211239 | Ga0495619_0211239_889_1200 | 103 |
| 796 | 3300053085 | Ga0495619_1009061 | Ga0495619_1009061_214_525 | 103 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3le5-assembly2.cif.gz_B-3 | crystal structure of hpr dimer from thermoanaerobacter tengcongensis | 0.9443 | 29 | 102 |
| 3ihs-assembly2.cif.gz_B | crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames | 0.941 | 16 | 96 |
| 2hpr-assembly1.cif.gz_A | histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c) | 0.9336 | 17 | 98 |
| 3ccd-assembly1.cif.gz_A | 1.0 a structure of post-succinimide his15asp hpr | 0.9317 | 17 | 97 |
| 3lfg-assembly2.cif.gz_B | crystal structure of hpr-c-his from thermoanaerobacter tengcongensis | 0.9309 | 17 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69811_287_371_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9367 | 19 | 99 | 3.30.1340.10 |
| 3ccdB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9315 | 17 | 98 | 3.30.1340.10 |
| 3ihsB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9238 | 17 | 96 | 3.30.1340.10 |
| af_P37349_156_242_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.923 | 17 | 103 | 3.30.1340.10 |
| af_P37349_156_242_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.913 | 17 | 103 | 3.30.1340.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2SKU9-F1-model_v4 | HPr family phosphocarrier protein | 0.9663 | 14 | 100 |
GO:0005737
GO:0009401 |
| AF-A0A2V7KXM1-F1-model_v4 | HPr family phosphocarrier protein | 0.9655 | 15 | 100 |
|
| AF-A0A496PVT4-F1-model_v4 | HPr family phosphocarrier protein | 0.9655 | 17 | 100 |
GO:0005737
GO:0009401 |
| AF-A0A1Y5EDL0-F1-model_v4 | HPr domain-containing protein | 0.9623 | 16 | 100 |
GO:0005737
GO:0009401 |
| AF-A0A3N9MMD1-F1-model_v4 | HPr family phosphocarrier protein | 0.9617 | 17 | 100 |
GO:0005737
GO:0009401 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar