F481195

General Info

Members Datasets Scaffolds Average Seq Length
796 315 796 103

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_11686937|Ga0207674_116869371
Length 115
Sequence MGLLSRKPDPTSQSKSAKELTIINRLGLHARPSAMFVKTASRFKCEVWVEKDGERVNGKSIMGLMMLAAGQGSKLLVSCEGTDGDKALAEIEEIIRRKFDEDSRQRAFSAHPPHT

Samples

Sample ID Description Type Environment
1 2124908018 Switchgrass rhizosphere microbial communities from Rose Lake, Michigan, USA - BV2.2 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
199 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
200 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
216 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
217 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
227 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
228 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
231 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
232 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
233 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
234 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
235 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
236 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
272 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
301 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
302 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
303 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
310 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
311 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
312 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
313 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.38
Nodule 0
Rhizoplane 7.41
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhBV22_Contig_4286 2124908018 Bacteria 743
2 2214801627 2209111006 Bacteria 706
3 JGI24744J21845_10015577 3300002077 Bacteria 1518
4 JGI24742J22300_10114521 3300002244 Bacteria 529
5 JGI25405J52794_10140164 3300003911 Bacteria 549
6 Ga0065704_10016897 3300005289 Bacteria 1268
7 Ga0065704_10023391 3300005289 Bacteria 1538
8 Ga0065704_10025131 3300005289 Bacteria 1113
9 Ga0065712_10007221 3300005290 Bacteria 3134
10 Ga0065712_10071598 3300005290 Bacteria 5159
11 Ga0065712_10252632 3300005290 Unclassified 956
12 Ga0065715_10001841 3300005293 Bacteria 5511
13 Ga0065715_10009791 3300005293 Unclassified 2796
14 Ga0065715_10010413 3300005293 Bacteria 4159
15 Ga0065715_10200500 3300005293 Bacteria 1356
16 Ga0065715_10262112 3300005293 Unclassified 1119
17 Ga0065715_10529236 3300005293 Unclassified 755
18 Ga0065707_10470852 3300005295 Bacteria 782
19 Ga0070658_10004979 3300005327 Bacteria 10822
20 Ga0070658_11118709 3300005327 Bacteria 685
21 Ga0070676_10015290 3300005328 Bacteria 4233
22 Ga0070676_10020144 3300005328 Bacteria 3719
23 Ga0070676_10427984 3300005328 Unclassified 926
24 Ga0070676_10670652 3300005328 Unclassified 754
25 Ga0070676_10937765 3300005328 Bacteria 647
26 Ga0070683_100119052 3300005329 Bacteria 2494
27 Ga0070683_100167685 3300005329 Bacteria 2084
28 Ga0070683_100279200 3300005329 Bacteria 1589
29 Ga0070683_100296687 3300005329 Unclassified 1537
30 Ga0070690_100122694 3300005330 Unclassified 1746
31 Ga0070690_101152542 3300005330 Unclassified 617
32 Ga0070690_101206321 3300005330 Bacteria 604
33 Ga0070670_100014442 3300005331 Bacteria 6779
34 Ga0070670_100054028 3300005331 Bacteria 3448
35 Ga0070670_100612607 3300005331 Bacteria 975
36 Ga0070677_10122457 3300005333 Bacteria 1176
37 Ga0068869_100249434 3300005334 Bacteria 1417
38 Ga0068869_101400217 3300005334 Bacteria 619
39 Ga0070666_10032117 3300005335 Unclassified 3468
40 Ga0070666_10840130 3300005335 Bacteria 677
41 Ga0070666_11280780 3300005335 Unclassified 547
42 Ga0070680_100159576 3300005336 Bacteria 1894
43 Ga0070682_100128511 3300005337 Bacteria 1712
44 Ga0070682_100269638 3300005337 Bacteria 1236
45 Ga0070682_101319282 3300005337 Unclassified 614
46 Ga0068868_100014966 3300005338 Bacteria 5728
47 Ga0068868_100084610 3300005338 Bacteria 2547
48 Ga0068868_100430792 3300005338 Bacteria 1144
49 Ga0068868_101119140 3300005338 Unclassified 725
50 Ga0070660_100018375 3300005339 Bacteria 5108
51 Ga0070660_100262447 3300005339 Bacteria 1411
52 Ga0070660_100547985 3300005339 Bacteria 965
53 Ga0070660_101680443 3300005339 Unclassified 541
54 Ga0070689_100028937 3300005340 Bacteria 4190
55 Ga0070689_100127380 3300005340 Bacteria 2039
56 Ga0070689_100203517 3300005340 Bacteria 1617
57 Ga0070689_101200323 3300005340 Bacteria 681
58 Ga0070691_10355129 3300005341 Bacteria 815
59 Ga0070687_100414572 3300005343 Unclassified 887
60 Ga0070661_100106886 3300005344 Unclassified 2086
61 Ga0070661_100116256 3300005344 Bacteria 2001
62 Ga0070661_100330819 3300005344 Bacteria 1192
63 Ga0070668_100019359 3300005347 Bacteria 5123
64 Ga0070668_100052697 3300005347 Bacteria 3136
65 Ga0070668_100514564 3300005347 Bacteria 1038
66 Ga0070669_100002855 3300005353 Bacteria 12482
67 Ga0070669_100325477 3300005353 Bacteria 1242
68 Ga0070669_100901555 3300005353 Unclassified 755
69 Ga0070675_100012615 3300005354 Bacteria 6626
70 Ga0070675_100016119 3300005354 Bacteria 5924
71 Ga0070675_100027188 3300005354 Bacteria 4595
72 Ga0070675_100127457 3300005354 Bacteria 2167
73 Ga0070675_100147760 3300005354 Unclassified 2013
74 Ga0070675_100187866 3300005354 Unclassified 1789
75 Ga0070675_100458656 3300005354 Bacteria 1144
76 Ga0070675_101242035 3300005354 Bacteria 686
77 Ga0070675_101437073 3300005354 Unclassified 636
78 Ga0070671_100001422 3300005355 Bacteria 17892
79 Ga0070671_100031408 3300005355 Bacteria 4387
80 Ga0070671_100816365 3300005355 Bacteria 812
81 Ga0070674_100002179 3300005356 Bacteria 10766
82 Ga0070674_100084695 3300005356 Bacteria 2274
83 Ga0070674_101103438 3300005356 Unclassified 701
84 Ga0070674_101577726 3300005356 Bacteria 591
85 Ga0070673_100000434 3300005364 Bacteria 22067
86 Ga0070673_100024350 3300005364 Unclassified 4438
87 Ga0070673_100030668 3300005364 Bacteria 4028
88 Ga0070673_100462143 3300005364 Bacteria 1143
89 Ga0070688_100011701 3300005365 Bacteria 4887
90 Ga0070688_100036100 3300005365 Bacteria 3005
91 Ga0070688_100124857 3300005365 Bacteria 1729
92 Ga0070688_100191855 3300005365 Unclassified 1424
93 Ga0070688_100715429 3300005365 Unclassified 777
94 Ga0070688_101238095 3300005365 Unclassified 601
95 Ga0070659_100001816 3300005366 Bacteria 15366
96 Ga0070659_100151911 3300005366 Bacteria 1889
97 Ga0070659_100878177 3300005366 Unclassified 783
98 Ga0070667_100030098 3300005367 Bacteria 4527
99 Ga0070667_100075007 3300005367 Bacteria 2887
100 Ga0070667_100100279 3300005367 Unclassified 2501
101 Ga0070667_100538488 3300005367 Bacteria 1072
102 Ga0070667_101970243 3300005367 Bacteria 550
103 Ga0070709_11117078 3300005434 Bacteria 631
104 Ga0070709_11795639 3300005434 Bacteria 502
105 Ga0070714_100010616 3300005435 Bacteria 7287
106 Ga0070714_100338086 3300005435 Bacteria 1411
107 Ga0070714_100673824 3300005435 Bacteria 997
108 Ga0070713_100027581 3300005436 Bacteria 4472
109 Ga0070713_100058836 3300005436 Bacteria 3207
110 Ga0070713_100180724 3300005436 Bacteria 1895
111 Ga0070713_100375402 3300005436 Unclassified 1324
112 Ga0070713_101019021 3300005436 Unclassified 799
113 Ga0070710_10160008 3300005437 Bacteria 1395
114 Ga0070711_100290062 3300005439 Bacteria 1297
115 Ga0070711_100600374 3300005439 Bacteria 918
116 Ga0070711_100906780 3300005439 Bacteria 752
117 Ga0070705_100100550 3300005440 Bacteria 1825
118 Ga0070705_100111839 3300005440 Bacteria 1746
119 Ga0070700_100019271 3300005441 Bacteria 3935
120 Ga0070694_100638455 3300005444 Bacteria 861
121 Ga0070708_100050425 3300005445 Bacteria 3685
122 Ga0070708_100057319 3300005445 Bacteria 3468
123 Ga0070708_100259124 3300005445 Bacteria 1635
124 Ga0070708_100738633 3300005445 Unclassified 926
125 Ga0070663_100027393 3300005455 Bacteria 3870
126 Ga0070663_100101409 3300005455 Unclassified 2148
127 Ga0070663_100185891 3300005455 Bacteria 1614
128 Ga0070663_101640344 3300005455 Unclassified 574
129 Ga0070678_100128423 3300005456 Bacteria 2010
130 Ga0070678_100701535 3300005456 Unclassified 912
131 Ga0070662_100064088 3300005457 Bacteria 2690
132 Ga0070662_100434665 3300005457 Bacteria 1087
133 Ga0070662_100737825 3300005457 Bacteria 835
134 Ga0070662_100842338 3300005457 Bacteria 781
135 Ga0070681_10088153 3300005458 Unclassified 3055
136 Ga0068867_100039740 3300005459 Bacteria 3431
137 Ga0068867_100200835 3300005459 Unclassified 1596
138 Ga0070685_10018866 3300005466 Bacteria 3715
139 Ga0070706_100063533 3300005467 Unclassified 3412
140 Ga0070706_100184319 3300005467 Bacteria 1950
141 Ga0070706_100277823 3300005467 Bacteria 1563
142 Ga0070706_100508317 3300005467 Bacteria 1121
143 Ga0070706_100730522 3300005467 Bacteria 918
144 Ga0070706_100902190 3300005467 Unclassified 816
145 Ga0070706_101088350 3300005467 Bacteria 736
146 Ga0070706_101385031 3300005467 Bacteria 644
147 Ga0070707_100001892 3300005468 Bacteria 20056
148 Ga0070707_100026239 3300005468 Bacteria 5530
149 Ga0070707_100096169 3300005468 Bacteria 2868
150 Ga0070707_100167231 3300005468 Unclassified 2143
151 Ga0070707_101099745 3300005468 Bacteria 761
152 Ga0070707_101696307 3300005468 Bacteria 599
153 Ga0070707_101812734 3300005468 Unclassified 577
154 Ga0070698_100000694 3300005471 Bacteria 35925
155 Ga0070698_100001080 3300005471 Bacteria 29961
156 Ga0070698_100047049 3300005471 Unclassified 4410
157 Ga0070698_100065927 3300005471 Bacteria 3646
158 Ga0070698_101603143 3300005471 Bacteria 603
159 Ga0070699_100148455 3300005518 Bacteria 2072
160 Ga0070699_100625174 3300005518 Unclassified 982
161 Ga0070699_101785566 3300005518 Bacteria 563
162 Ga0070679_100402944 3300005530 Bacteria 1314
163 Ga0070684_100001876 3300005535 Bacteria 15383
164 Ga0070684_100002566 3300005535 Bacteria 13413
165 Ga0070684_101042196 3300005535 Bacteria 768
166 Ga0070697_100013199 3300005536 Bacteria 6477
167 Ga0070697_100044378 3300005536 Bacteria 3600
168 Ga0070697_100090545 3300005536 Unclassified 2528
169 Ga0070697_100711788 3300005536 Bacteria 886
170 Ga0070697_101030954 3300005536 Bacteria 732
171 Ga0068853_101657855 3300005539 Unclassified 620
172 Ga0070672_100013002 3300005543 Bacteria 5866
173 Ga0070672_100185002 3300005543 Unclassified 1737
174 Ga0070672_100394302 3300005543 Bacteria 1186
175 Ga0070672_100995905 3300005543 Bacteria 743
176 Ga0070686_100073886 3300005544 Bacteria 2239
177 Ga0070686_101400959 3300005544 Unclassified 587
178 Ga0070695_100116340 3300005545 Bacteria 1823
179 Ga0070695_100302844 3300005545 Bacteria 1182
180 Ga0070696_101588245 3300005546 Bacteria 562
181 Ga0070693_100719642 3300005547 Bacteria 733
182 Ga0070693_100953371 3300005547 Bacteria 646
183 Ga0070665_100004891 3300005548 Bacteria 13902
184 Ga0070665_100029270 3300005548 Bacteria 5544
185 Ga0070665_100216799 3300005548 Bacteria 1914
186 Ga0070665_100293320 3300005548 Unclassified 1629
187 Ga0070665_101982486 3300005548 Unclassified 587
188 Ga0068855_100010853 3300005563 Bacteria 10998
189 Ga0068855_102523784 3300005563 Unclassified 511
190 Ga0070664_100043515 3300005564 Bacteria 3789
191 Ga0070664_100068902 3300005564 Bacteria 3025
192 Ga0070664_100267663 3300005564 Bacteria 1539
193 Ga0070664_100616727 3300005564 Bacteria 1007
194 Ga0068854_100374280 3300005578 Bacteria 1172
195 Ga0068854_100460791 3300005578 Unclassified 1063
196 Ga0068856_100073290 3300005614 Bacteria 3391
197 Ga0068856_100306780 3300005614 Bacteria 1605
198 Ga0068856_101144563 3300005614 Bacteria 795
199 Ga0068856_101434394 3300005614 Unclassified 704
200 Ga0070702_100419396 3300005615 Bacteria 963
201 Ga0068859_100312430 3300005617 Bacteria 1665
202 Ga0068859_103122426 3300005617 Bacteria 505
203 Ga0068864_100328601 3300005618 Bacteria 1438
204 Ga0068864_100345941 3300005618 Unclassified 1402
205 Ga0068864_100415696 3300005618 Bacteria 1280
206 Ga0068864_101221358 3300005618 Unclassified 751
207 Ga0068864_101653289 3300005618 Unclassified 645
208 Ga0068866_10360263 3300005718 Bacteria 927
209 Ga0068866_10615549 3300005718 Bacteria 735
210 Ga0068870_10777064 3300005840 Bacteria 667
211 Ga0068863_100026675 3300005841 Bacteria 5509
212 Ga0068863_100354495 3300005841 Unclassified 1429
213 Ga0068863_100718501 3300005841 Bacteria 994
214 Ga0068863_101120860 3300005841 Unclassified 792
215 Ga0068858_100045107 3300005842 Unclassified 4085
216 Ga0068858_100134412 3300005842 Bacteria 2320
217 Ga0068858_100322499 3300005842 Bacteria 1477
218 Ga0068858_100824044 3300005842 Unclassified 906
219 Ga0068860_100000202 3300005843 Bacteria 94520
220 Ga0068860_100129957 3300005843 Bacteria 2416
221 Ga0068860_100335721 3300005843 Bacteria 1485
222 Ga0068860_101228452 3300005843 Bacteria 770
223 Ga0068862_100210711 3300005844 Bacteria 1756
224 Ga0068862_102448839 3300005844 Unclassified 534
225 Ga0081455_10002512 3300005937 Bacteria 21774
226 Ga0081455_10021948 3300005937 Bacteria 5979
227 Ga0081455_10023390 3300005937 Bacteria 5750
228 Ga0081455_10034285 3300005937 Bacteria 4550
229 Ga0081455_10078628 3300005937 Bacteria 2710
230 Ga0081455_10127226 3300005937 Bacteria 1997
231 Ga0081455_10138759 3300005937 Unclassified 1891
232 Ga0081455_10449976 3300005937 Bacteria 880
233 Ga0081540_1001119 3300005983 Bacteria 23729
234 Ga0081540_1009553 3300005983 Bacteria 6674
235 Ga0081540_1094483 3300005983 Unclassified 1306
236 Ga0081540_1196661 3300005983 Unclassified 737
237 Ga0081539_10000052 3300005985 Bacteria 268240
238 Ga0081539_10000671 3300005985 Bacteria 68678
239 Ga0081539_10021753 3300005985 Unclassified 4270
240 Ga0081539_10107129 3300005985 Bacteria 1414
241 Ga0081539_10133477 3300005985 Bacteria 1216
242 Ga0070717_10007003 3300006028 Bacteria 8343
243 Ga0070717_10072092 3300006028 Bacteria 2883
244 Ga0070717_10147471 3300006028 Bacteria 2033
245 Ga0070717_10158543 3300006028 Unclassified 1962
246 Ga0070717_11368278 3300006028 Bacteria 643
247 Ga0070717_11577386 3300006028 Bacteria 595
248 Ga0075363_100599836 3300006048 Bacteria 660
249 Ga0070715_10095844 3300006163 Bacteria 1374
250 Ga0070715_10121076 3300006163 Unclassified 1248
251 Ga0070716_100111540 3300006173 Bacteria 1696
252 Ga0070716_100157119 3300006173 Bacteria 1469
253 Ga0070712_100034753 3300006175 Bacteria 3417
254 Ga0070712_100122098 3300006175 Unclassified 1961
255 Ga0070712_100148771 3300006175 Bacteria 1795
256 Ga0070712_100259798 3300006175 Bacteria 1391
257 Ga0070712_100403413 3300006175 Bacteria 1130
258 Ga0075362_10039378 3300006177 Bacteria 2078
259 Ga0075362_10623669 3300006177 Bacteria 558
260 Ga0075366_10094854 3300006195 Bacteria 1789
261 Ga0075366_10167754 3300006195 Bacteria 1332
262 Ga0097621_100008612 3300006237 Bacteria 7355
263 Ga0097621_100018579 3300006237 Bacteria 5315
264 Ga0068871_100025764 3300006358 Bacteria 4580
265 Ga0068871_100051125 3300006358 Bacteria 3345
266 Ga0068871_100223691 3300006358 Unclassified 1631
267 Ga0068871_100443318 3300006358 Bacteria 1163
268 Ga0068871_102028374 3300006358 Unclassified 548
269 Ga0075428_100243578 3300006844 Bacteria 1940
270 Ga0075433_10719387 3300006852 Bacteria 874
271 Ga0075433_11461854 3300006852 Bacteria 591
272 Ga0075434_100875689 3300006871 Bacteria 913
273 Ga0075434_102006986 3300006871 Bacteria 584
274 Ga0068865_100006676 3300006881 Bacteria 7057
275 Ga0068865_100109714 3300006881 Bacteria 2034
276 Ga0068865_100195749 3300006881 Bacteria 1566
277 Ga0068865_100488740 3300006881 Unclassified 1024
278 Ga0075436_100044115 3300006914 Bacteria 3074
279 Ga0097620_100312468 3300006931 Bacteria 1665
280 Ga0097620_103121585 3300006931 Bacteria 505
281 Ga0075435_101512514 3300007076 Bacteria 589
282 Ga0099794_10406574 3300007265 Bacteria 711
283 Ga0099795_10107716 3300007788 Bacteria 1101
284 Ga0105245_10327619 3300009098 Bacteria 1510
285 Ga0105245_10718427 3300009098 Bacteria 1033
286 Ga0105247_10097735 3300009101 Unclassified 1873
287 Ga0114129_10631873 3300009147 Bacteria 1384
288 Ga0114129_10647695 3300009147 Bacteria 1364
289 Ga0114129_10702553 3300009147 Bacteria 1299
290 Ga0105243_10159811 3300009148 Bacteria 1942
291 Ga0105243_10973861 3300009148 Bacteria 849
292 Ga0105241_11041825 3300009174 Bacteria 767
293 Ga0105242_10363679 3300009176 Bacteria 1340
294 Ga0105242_11989553 3300009176 Bacteria 623
295 Ga0105242_12888484 3300009176 Bacteria 531
296 Ga0105248_11110317 3300009177 Bacteria 894
297 Ga0105248_12035804 3300009177 Bacteria 652
298 Ga0105237_10015766 3300009545 Bacteria 7859
299 Ga0105237_11684399 3300009545 Bacteria 641
300 Ga0105237_11997933 3300009545 Unclassified 588
301 Ga0105237_12093754 3300009545 Bacteria 575
302 Ga0105238_11034795 3300009551 Bacteria 842
303 Ga0105249_10186698 3300009553 Bacteria 2020
304 Ga0105249_12064964 3300009553 Bacteria 643
305 Ga0099796_10038160 3300010159 Bacteria 1610
306 Ga0099796_10222535 3300010159 Bacteria 774
307 Ga0105239_10211920 3300010375 Unclassified 2172
308 Ga0105239_10437507 3300010375 Bacteria 1483
309 Ga0105239_11326923 3300010375 Bacteria 830
310 Ga0105239_12048462 3300010375 Bacteria 665
311 Ga0105246_10815966 3300011119 Bacteria 829
312 Ga0105246_10912459 3300011119 Unclassified 789
313 Ga0157373_10549474 3300013100 Bacteria 837
314 Ga0157371_10263893 3300013102 Bacteria 1242
315 Ga0157371_10737881 3300013102 Bacteria 739
316 Ga0157371_11104824 3300013102 Bacteria 608
317 Ga0157370_10368050 3300013104 Bacteria 1324
318 Ga0157374_10009530 3300013296 Bacteria 8338
319 Ga0157374_10030397 3300013296 Bacteria 4904
320 Ga0157374_10117230 3300013296 Bacteria 2566
321 Ga0157374_10175300 3300013296 Unclassified 2093
322 Ga0157374_10236283 3300013296 Bacteria 1796
323 Ga0157374_10302879 3300013296 Unclassified 1581
324 Ga0157374_10571099 3300013296 Bacteria 1139
325 Ga0157374_11154256 3300013296 Unclassified 796
326 Ga0157374_12249492 3300013296 Bacteria 572
327 Ga0157378_10033410 3300013297 Bacteria 4547
328 Ga0157378_10062015 3300013297 Bacteria 3338
329 Ga0157378_10079408 3300013297 Bacteria 2963
330 Ga0157378_10158723 3300013297 Bacteria 2113
331 Ga0157378_11861491 3300013297 Bacteria 650
332 Ga0157378_13082920 3300013297 Unclassified 517
333 Ga0163162_10002841 3300013306 Bacteria 16482
334 Ga0163162_10149344 3300013306 Bacteria 2454
335 Ga0163162_10440967 3300013306 Bacteria 1434
336 Ga0163162_10632206 3300013306 Unclassified 1195
337 Ga0157372_10023674 3300013307 Bacteria 6662
338 Ga0157372_10277298 3300013307 Bacteria 1949
339 Ga0157372_11404020 3300013307 Bacteria 805
340 Ga0157372_11920510 3300013307 Unclassified 680
341 Ga0157375_10004600 3300013308 Bacteria 11990
342 Ga0157375_10005288 3300013308 Bacteria 11210
343 Ga0157375_10019367 3300013308 Bacteria 6189
344 Ga0157375_10028471 3300013308 Bacteria 5236
345 Ga0157375_11399458 3300013308 Bacteria 824
346 Ga0157375_11549503 3300013308 Unclassified 783
347 Ga0157375_12847759 3300013308 Bacteria 578
348 Ga0157375_13319466 3300013308 Unclassified 536
349 Ga0163163_10669810 3300014325 Bacteria 1101
350 Ga0163163_10693307 3300014325 Unclassified 1082
351 Ga0163163_11180473 3300014325 Bacteria 828
352 Ga0163163_11832804 3300014325 Bacteria 667
353 Ga0163163_12952853 3300014325 Bacteria 530
354 Ga0157380_12644569 3300014326 Bacteria 568
355 Ga0157377_10008830 3300014745 Bacteria 4929
356 Ga0157377_11140444 3300014745 Unclassified 600
357 Ga0157379_11017798 3300014968 Bacteria 790
358 Ga0157379_11384942 3300014968 Bacteria 681
359 Ga0157376_10079358 3300014969 Unclassified 2813
360 Ga0157376_10103786 3300014969 Unclassified 2490
361 Ga0157376_10291847 3300014969 Bacteria 1540
362 Ga0157376_10737273 3300014969 Unclassified 993
363 Ga0157376_12594521 3300014969 Bacteria 547
364 Ga0157376_12684503 3300014969 Bacteria 538
365 Ga0182007_10043093 3300015262 Bacteria 1501
366 Ga0182007_10082446 3300015262 Bacteria 1055
367 Ga0163161_10209079 3300017792 Bacteria 1507
368 Ga0163161_10403271 3300017792 Bacteria 1097
369 Ga0197907_10816653 3300020069 Bacteria 642
370 Ga0206355_1274465 3300020076 Bacteria 700
371 Ga0224712_10696313 3300022467 Bacteria 500
372 Ga0207666_1000131 3300025271 Bacteria 11528
373 Ga0207673_1000321 3300025290 Bacteria 4814
374 Ga0207673_1009634 3300025290 Bacteria 1236
375 Ga0207673_1025434 3300025290 Bacteria 810
376 Ga0207697_10000116 3300025315 Bacteria 37551
377 Ga0207697_10002751 3300025315 Bacteria 8971
378 Ga0207697_10008048 3300025315 Bacteria 4651
379 Ga0207697_10061473 3300025315 Bacteria 1563
380 Ga0207697_10140126 3300025315 Bacteria 1049
381 Ga0207697_10153082 3300025315 Unclassified 1004
382 Ga0207697_10428559 3300025315 Bacteria 587
383 Ga0207653_10004352 3300025885 Bacteria 4446
384 Ga0207653_10055425 3300025885 Bacteria 1327
385 Ga0207682_10156735 3300025893 Bacteria 1030
386 Ga0207692_10064534 3300025898 Unclassified 1907
387 Ga0207692_10171367 3300025898 Bacteria 1258
388 Ga0207642_10514700 3300025899 Bacteria 734
389 Ga0207642_10526858 3300025899 Bacteria 727
390 Ga0207710_10073332 3300025900 Unclassified 1574
391 Ga0207688_10003621 3300025901 Bacteria 8433
392 Ga0207688_10046425 3300025901 Bacteria 2425
393 Ga0207688_10283819 3300025901 Bacteria 1009
394 Ga0207680_10046070 3300025903 Bacteria 2576
395 Ga0207680_10399730 3300025903 Bacteria 971
396 Ga0207647_10013194 3300025904 Bacteria 5738
397 Ga0207685_10117831 3300025905 Unclassified 1161
398 Ga0207699_10241843 3300025906 Unclassified 1240
399 Ga0207699_10490193 3300025906 Bacteria 886
400 Ga0207645_10019788 3300025907 Bacteria 4410
401 Ga0207645_10089619 3300025907 Bacteria 1978
402 Ga0207645_10154520 3300025907 Bacteria 1499
403 Ga0207645_10398046 3300025907 Unclassified 926
404 Ga0207705_10001641 3300025909 Bacteria 17746
405 Ga0207705_10205921 3300025909 Bacteria 1491
406 Ga0207705_10624364 3300025909 Bacteria 838
407 Ga0207684_10000268 3300025910 Bacteria 77123
408 Ga0207684_10005555 3300025910 Bacteria 11608
409 Ga0207684_10100398 3300025910 Bacteria 2473
410 Ga0207684_10103404 3300025910 Bacteria 2435
411 Ga0207684_10116444 3300025910 Bacteria 2290
412 Ga0207684_10159436 3300025910 Unclassified 1942
413 Ga0207684_10197833 3300025910 Bacteria 1734
414 Ga0207684_10685246 3300025910 Bacteria 872
415 Ga0207684_10759992 3300025910 Unclassified 821
416 Ga0207654_10160674 3300025911 Unclassified 1451
417 Ga0207654_11007821 3300025911 Bacteria 606
418 Ga0207707_10037297 3300025912 Unclassified 4247
419 Ga0207671_10035366 3300025914 Bacteria 3707
420 Ga0207671_10189393 3300025914 Bacteria 1604
421 Ga0207693_10034854 3300025915 Bacteria 3969
422 Ga0207693_10063500 3300025915 Unclassified 2893
423 Ga0207693_10117541 3300025915 Bacteria 2088
424 Ga0207693_10220603 3300025915 Unclassified 1490
425 Ga0207693_10493657 3300025915 Bacteria 956
426 Ga0207693_10655984 3300025915 Bacteria 815
427 Ga0207693_10704491 3300025915 Bacteria 782
428 Ga0207663_10436995 3300025916 Unclassified 1007
429 Ga0207663_10662429 3300025916 Bacteria 824
430 Ga0207660_10201542 3300025917 Bacteria 1554
431 Ga0207660_10676125 3300025917 Bacteria 842
432 Ga0207662_10075776 3300025918 Bacteria 2044
433 Ga0207657_10018574 3300025919 Bacteria 6628
434 Ga0207657_10183335 3300025919 Bacteria 1691
435 Ga0207657_10190220 3300025919 Bacteria 1656
436 Ga0207657_10232458 3300025919 Bacteria 1474
437 Ga0207649_10178294 3300025920 Unclassified 1485
438 Ga0207649_10372478 3300025920 Unclassified 1062
439 Ga0207652_11113739 3300025921 Bacteria 690
440 Ga0207646_10007983 3300025922 Bacteria 10673
441 Ga0207646_10052919 3300025922 Unclassified 3632
442 Ga0207646_10066543 3300025922 Bacteria 3218
443 Ga0207646_10234015 3300025922 Bacteria 1660
444 Ga0207646_10348789 3300025922 Unclassified 1338
445 Ga0207646_10631726 3300025922 Bacteria 960
446 Ga0207646_11292189 3300025922 Unclassified 637
447 Ga0207681_10020375 3300025923 Bacteria 4201
448 Ga0207681_10058229 3300025923 Bacteria 2645
449 Ga0207681_10889715 3300025923 Unclassified 745
450 Ga0207694_10888246 3300025924 Bacteria 753
451 Ga0207650_10025433 3300025925 Bacteria 4217
452 Ga0207650_10051417 3300025925 Bacteria 3049
453 Ga0207659_10026322 3300025926 Bacteria 3923
454 Ga0207659_10058831 3300025926 Bacteria 2760
455 Ga0207659_10062176 3300025926 Bacteria 2694
456 Ga0207659_10203878 3300025926 Bacteria 1581
457 Ga0207659_10357383 3300025926 Bacteria 1213
458 Ga0207659_10396809 3300025926 Bacteria 1153
459 Ga0207659_10448956 3300025926 Unclassified 1086
460 Ga0207687_10133580 3300025927 Bacteria 1874
461 Ga0207687_10207559 3300025927 Bacteria 1535
462 Ga0207700_10002998 3300025928 Bacteria 9735
463 Ga0207700_10324518 3300025928 Bacteria 1335
464 Ga0207700_10950405 3300025928 Bacteria 769
465 Ga0207664_10071032 3300025929 Bacteria 2803
466 Ga0207664_10279125 3300025929 Unclassified 1466
467 Ga0207664_10452858 3300025929 Bacteria 1146
468 Ga0207644_10069184 3300025931 Bacteria 2577
469 Ga0207644_10116283 3300025931 Unclassified 2029
470 Ga0207644_10194564 3300025931 Bacteria 1596
471 Ga0207644_10531213 3300025931 Unclassified 972
472 Ga0207690_10006971 3300025932 Bacteria 6698
473 Ga0207690_10058662 3300025932 Bacteria 2604
474 Ga0207690_10280027 3300025932 Bacteria 1299
475 Ga0207706_10035568 3300025933 Bacteria 4427
476 Ga0207706_10476560 3300025933 Bacteria 1078
477 Ga0207706_10989284 3300025933 Bacteria 707
478 Ga0207706_10995024 3300025933 Bacteria 705
479 Ga0207686_10457804 3300025934 Bacteria 983
480 Ga0207709_10201833 3300025935 Bacteria 1421
481 Ga0207709_10777429 3300025935 Bacteria 771
482 Ga0207670_10129317 3300025936 Bacteria 1847
483 Ga0207670_10461746 3300025936 Bacteria 1025
484 Ga0207670_10666650 3300025936 Unclassified 859
485 Ga0207670_10686502 3300025936 Unclassified 847
486 Ga0207669_10004922 3300025937 Bacteria 5939
487 Ga0207669_10437739 3300025937 Bacteria 1033
488 Ga0207704_10027297 3300025938 Bacteria 3148
489 Ga0207704_10069471 3300025938 Bacteria 2226
490 Ga0207704_10372992 3300025938 Unclassified 1118
491 Ga0207665_10092552 3300025939 Unclassified 2098
492 Ga0207665_10098473 3300025939 Bacteria 2037
493 Ga0207665_11028182 3300025939 Bacteria 656
494 Ga0207691_10001082 3300025940 Bacteria 27131
495 Ga0207691_10119459 3300025940 Bacteria 2337
496 Ga0207691_10276583 3300025940 Unclassified 1445
497 Ga0207689_10110145 3300025942 Bacteria 2263
498 Ga0207689_10797334 3300025942 Bacteria 797
499 Ga0207661_10044464 3300025944 Bacteria 3510
500 Ga0207661_10084479 3300025944 Unclassified 2629
501 Ga0207661_10087176 3300025944 Bacteria 2592
502 Ga0207661_10138610 3300025944 Bacteria 2091
503 Ga0207661_10245701 3300025944 Bacteria 1589
504 Ga0207679_10266427 3300025945 Bacteria 1463
505 Ga0207667_10010863 3300025949 Bacteria 10618
506 Ga0207651_10008503 3300025960 Bacteria 5548
507 Ga0207651_10234408 3300025960 Unclassified 1492
508 Ga0207712_10217965 3300025961 Bacteria 1524
509 Ga0207712_11337169 3300025961 Bacteria 641
510 Ga0207668_10034403 3300025972 Bacteria 3365
511 Ga0207668_10107755 3300025972 Bacteria 2084
512 Ga0207668_10652044 3300025972 Bacteria 921
513 Ga0207668_11031982 3300025972 Bacteria 736
514 Ga0207640_10106266 3300025981 Bacteria 1980
515 Ga0207658_10068856 3300025986 Bacteria 2672
516 Ga0207658_10149497 3300025986 Bacteria 1901
517 Ga0207658_10689711 3300025986 Bacteria 922
518 Ga0207677_10059389 3300026023 Bacteria 2637
519 Ga0207677_10175799 3300026023 Bacteria 1679
520 Ga0207677_10176510 3300026023 Unclassified 1676
521 Ga0207677_10883069 3300026023 Unclassified 805
522 Ga0207703_10017603 3300026035 Bacteria 5579
523 Ga0207703_10467315 3300026035 Bacteria 1180
524 Ga0207703_10981204 3300026035 Unclassified 810
525 Ga0207703_11006802 3300026035 Bacteria 799
526 Ga0207703_12046658 3300026035 Unclassified 549
527 Ga0207639_10872408 3300026041 Unclassified 840
528 Ga0207639_11254141 3300026041 Unclassified 696
529 Ga0207639_12268985 3300026041 Bacteria 504
530 Ga0207678_10017673 3300026067 Bacteria 6261
531 Ga0207678_10566695 3300026067 Bacteria 994
532 Ga0207702_10389092 3300026078 Bacteria 1342
533 Ga0207702_10782873 3300026078 Bacteria 942
534 Ga0207702_10850524 3300026078 Bacteria 903
535 Ga0207641_10303989 3300026088 Bacteria 1507
536 Ga0207641_11422971 3300026088 Bacteria 694
537 Ga0207648_10110122 3300026089 Bacteria 2418
538 Ga0207648_10133635 3300026089 Bacteria 2184
539 Ga0207676_10618815 3300026095 Bacteria 1042
540 Ga0207676_10755135 3300026095 Unclassified 946
541 Ga0207676_11051941 3300026095 Bacteria 803
542 Ga0207676_12216554 3300026095 Unclassified 547
543 Ga0207674_10761200 3300026116 Bacteria 935
544 Ga0207674_11686937 3300026116 Bacteria 602
545 Ga0207675_100163902 3300026118 Unclassified 2122
546 Ga0207683_10001621 3300026121 Bacteria 20182
547 Ga0207683_10110618 3300026121 Bacteria 2460
548 Ga0207683_10577610 3300026121 Unclassified 1040
549 Ga0207698_10884199 3300026142 Bacteria 900
550 Ga0207698_11451033 3300026142 Unclassified 701
551 Ga0207698_12394483 3300026142 Bacteria 539
552 Ga0209974_10163426 3300027876 Bacteria 809
553 Ga0268266_10043478 3300028379 Bacteria 3839
554 Ga0268266_10056203 3300028379 Unclassified 3385
555 Ga0268266_10276884 3300028379 Unclassified 1559
556 Ga0268266_10319523 3300028379 Bacteria 1453
557 Ga0268266_10345233 3300028379 Bacteria 1398
558 Ga0268266_10522709 3300028379 Bacteria 1135
559 Ga0268265_10152829 3300028380 Bacteria 1949
560 Ga0268265_10883192 3300028380 Bacteria 877
561 Ga0268265_11976313 3300028380 Unclassified 590
562 Ga0268264_10000241 3300028381 Bacteria 103608
563 Ga0268264_10122825 3300028381 Unclassified 2291
564 Ga0268264_10541536 3300028381 Bacteria 1141
565 Ga0268264_11142164 3300028381 Bacteria 788
566 Ga0373926_0068650 3300035083 Bacteria 1300
567 Ga0373934_0068216 3300035086 Bacteria 1421
568 Ga0373934_0273956 3300035086 Unclassified 699
569 Ga0373940_0286791 3300035088 Bacteria 564
570 Ga0373944_0059956 3300035089 Bacteria 1219
571 Ga0373923_0181340 3300035111 Bacteria 968
572 Ga0373923_0546833 3300035111 Unclassified 567
573 Ga0373945_0032318 3300035116 Bacteria 1854
574 Ga0373945_0264920 3300035116 Bacteria 729
575 Ga0373953_0018832 3300035117 Bacteria 2560
576 Ga0373953_0168054 3300035117 Unclassified 944
577 Ga0373954_0046839 3300035118 Bacteria 2022
578 Ga0373956_0021811 3300035119 Bacteria 2734
579 Ga0373957_0027985 3300035120 Bacteria 2051
580 Ga0373957_0376806 3300035120 Unclassified 608
581 Ga0373943_0178173 3300035170 Bacteria 1167
582 Ga0373943_0283706 3300035170 Bacteria 937
583 Ga0373946_0041419 3300035171 Bacteria 1889
584 Ga0373955_0190430 3300035172 Bacteria 1219
585 Ga0373955_0202384 3300035172 Unclassified 1182
586 Ga0373955_0221747 3300035172 Bacteria 1129
587 Ga0373942_0133971 3300035207 Bacteria 784
588 Ga0373924_0048152 3300035410 Unclassified 1760
589 Ga0373931_0112472 3300035691 Bacteria 1547
590 Ga0373935_0289431 3300035692 Bacteria 1155
591 Ga0373935_0310795 3300035692 Bacteria 1116
592 Ga0373935_0530550 3300035692 Bacteria 857
593 Ga0373935_0826476 3300035692 Bacteria 685
594 Ga0373935_0901645 3300035692 Bacteria 655
595 Ga0373927_0031919 3300035695 Bacteria 3431
596 Ga0373927_0718714 3300035695 Bacteria 660
597 Ga0373933_0183447 3300035724 Bacteria 1335
598 Ga0373947_0217408 3300035725 Bacteria 1255
599 Ga0373947_0329279 3300035725 Bacteria 1022
600 Ga0373947_0507285 3300035725 Bacteria 820
601 Ga0373937_0013425 3300036401 Bacteria 7215
602 Ga0373937_0035953 3300036401 Bacteria 4512
603 Ga0373937_0096255 3300036401 Bacteria 2745
604 Ga0373937_0167954 3300036401 Bacteria 2058
605 Ga0373937_0184059 3300036401 Bacteria 1962
606 Ga0373937_1027433 3300036401 Unclassified 773
607 Ga0373925_0027645 3300037068 Bacteria 4152
608 Ga0373925_0628637 3300037068 Bacteria 885
609 Ga0373925_1251300 3300037068 Bacteria 609
610 Ga0395899_0759722 3300037312 Bacteria 603
611 Ga0395898_0019724 3300037466 Bacteria 6857
612 Ga0395898_1358703 3300037466 Bacteria 639
613 Ga0395901_0269800 3300038443 Bacteria 1770
614 Ga0395901_1892070 3300038443 Bacteria 544
615 Ga0436365_0479463 3300039437 Bacteria 19101
616 Ga0436365_1750414 3300039437 Bacteria 1627
617 Ga0436363_1476289 3300039450 Unclassified 1073
618 Ga0451793_0357197 3300041452 Bacteria 982
619 Ga0451798_1121114 3300041458 Bacteria 636
620 Ga0451807_0058604 3300041486 Unclassified 818
621 Ga0451807_0777531 3300041486 Bacteria 562
622 Ga0451837_1814547 3300041494 Bacteria 577
623 Ga0451853_0874465 3300041512 Bacteria 680
624 Ga0451853_3976838 3300041512 Bacteria 551
625 Ga0439443_055059 3300042003 Bacteria 703
626 Ga0439448_0167405 3300042005 Bacteria 766
627 Ga0439450_038473 3300042008 Bacteria 1103
628 Ga0439455_0036334 3300042012 Bacteria 1247
629 Ga0439458_0029050 3300042157 Bacteria 1310
630 Ga0439440_0070788 3300042993 Bacteria 907
631 Ga0466964_0058486 3300044706 Unclassified 1598
632 Ga0466967_1556467 3300045976 Bacteria 658
633 Ga0495592_0011225 3300046454 Bacteria 6771
634 Ga0495592_0055436 3300046454 Unclassified 2933
635 Ga0495603_0051331 3300046455 Bacteria 2451
636 Ga0495629_0208928 3300046459 Bacteria 1348
637 Ga0495629_0258089 3300046459 Bacteria 1198
638 Ga0495641_0056447 3300046461 Bacteria 1780
639 Ga0495641_0097369 3300046461 Bacteria 1313
640 Ga0495651_0051690 3300046462 Unclassified 3167
641 Ga0495651_0160530 3300046462 Bacteria 1611
642 Ga0495651_0463201 3300046462 Bacteria 817
643 Ga0495653_0313310 3300046463 Unclassified 1019
644 Ga0495653_0620513 3300046463 Unclassified 663
645 Ga0495582_0185982 3300046473 Bacteria 1184
646 Ga0495605_0346386 3300046474 Bacteria 624
647 Ga0495662_0148882 3300046476 Bacteria 1153
648 Ga0495664_0790960 3300046477 Bacteria 558
649 Ga0495584_0151135 3300046491 Bacteria 1180
650 Ga0495584_0257573 3300046491 Bacteria 887
651 Ga0495594_0066156 3300046499 Bacteria 2005
652 Ga0495608_0219869 3300046511 Bacteria 1192
653 Ga0495608_0267853 3300046511 Unclassified 1062
654 Ga0495608_0435782 3300046511 Bacteria 799
655 Ga0495608_0862526 3300046511 Bacteria 532
656 Ga0495618_0134761 3300046514 Bacteria 1580
657 Ga0495618_0875463 3300046514 Bacteria 520
658 Ga0495628_0030849 3300046516 Bacteria 4338
659 Ga0495628_0258470 3300046516 Bacteria 1298
660 Ga0495630_0050818 3300046517 Bacteria 3102
661 Ga0495630_0210793 3300046517 Unclassified 1483
662 Ga0495630_1176768 3300046517 Bacteria 580
663 Ga0495637_0313631 3300046520 Bacteria 555
664 Ga0495644_0152135 3300046523 Bacteria 886
665 Ga0495652_0177757 3300046529 Bacteria 1636
666 Ga0495652_0279458 3300046529 Bacteria 1223
667 Ga0495665_0151866 3300046531 Bacteria 1209
668 Ga0495665_0218404 3300046531 Bacteria 986
669 Ga0495640_0054657 3300046533 Bacteria 2734
670 Ga0495640_0232856 3300046533 Bacteria 1158
671 Ga0495640_0305117 3300046533 Bacteria 988
672 Ga0495586_0024694 3300046535 Bacteria 3214
673 Ga0495587_0013515 3300046536 Bacteria 5129
674 Ga0495645_0052406 3300046543 Bacteria 2968
675 Ga0495645_0371841 3300046543 Bacteria 916
676 Ga0495667_0232857 3300046559 Bacteria 1174
677 Ga0495667_0333439 3300046559 Bacteria 959
678 Ga0495667_0355320 3300046559 Unclassified 925
679 Ga0495668_0323661 3300046616 Bacteria 846
680 Ga0495611_0369835 3300046648 Unclassified 657
681 Ga0495659_0093196 3300046664 Bacteria 1159
682 Ga0495657_0203603 3300046675 Unclassified 1205
683 Ga0495599_0043050 3300046678 Bacteria 2833
684 Ga0495623_0010814 3300046679 Bacteria 5907
685 Ga0495623_0697878 3300046679 Bacteria 520
686 Ga0495646_0005936 3300046680 Bacteria 7742
687 Ga0495658_0003395 3300046683 Bacteria 7893
688 Ga0495658_0048384 3300046683 Bacteria 2397
689 Ga0495669_0173178 3300046684 Unclassified 1027
690 Ga0495669_0276398 3300046684 Bacteria 808
691 Ga0495613_0295413 3300046689 Bacteria 1122
692 Ga0495613_0768051 3300046689 Unclassified 631
693 Ga0495613_0779941 3300046689 Bacteria 625
694 Ga0495670_0320155 3300046691 Bacteria 833
695 Ga0495600_0818914 3300046809 Bacteria 554
696 Ga0495600_0876490 3300046809 Bacteria 531
697 Ga0495604_0072297 3300047317 Bacteria 2607
698 Ga0495604_0391913 3300047317 Bacteria 916
699 Ga0495636_0355976 3300047318 Bacteria 692
700 Ga0495674_0245478 3300047319 Bacteria 1474
701 Ga0495674_0315550 3300047319 Bacteria 1274
702 Ga0495676_0086573 3300047321 Bacteria 2357
703 Ga0495676_0716209 3300047321 Bacteria 647
704 Ga0495680_0143657 3300047322 Bacteria 1744
705 Ga0495675_0034710 3300047444 Bacteria 3220
706 Ga0495684_0116581 3300047471 Bacteria 2013
707 Ga0495684_0285629 3300047471 Unclassified 1189
708 Ga0495684_0396592 3300047471 Bacteria 970
709 Ga0495593_0084185 3300047673 Unclassified 1642
710 Ga0495602_0140797 3300048088 Bacteria 1909
711 Ga0496100_0028956 3300048903 Bacteria 3421
712 Ga0496100_0248221 3300048903 Bacteria 1316
713 Ga0496101_0022753 3300048904 Bacteria 4319
714 Ga0496101_0079978 3300048904 Bacteria 2414
715 Ga0496101_0125680 3300048904 Bacteria 1943
716 Ga0496101_0851479 3300048904 Unclassified 718
717 Ga0496102_0067806 3300048905 Bacteria 3273
718 Ga0496102_0114593 3300048905 Bacteria 2515
719 Ga0496102_0235623 3300048905 Bacteria 1726
720 Ga0496102_0328933 3300048905 Bacteria 1439
721 Ga0496103_0220136 3300048906 Bacteria 1221
722 Ga0496103_0351242 3300048906 Unclassified 948
723 Ga0496103_0745857 3300048906 Bacteria 619
724 Ga0496104_0036202 3300048907 Bacteria 4613
725 Ga0496104_0126841 3300048907 Bacteria 2451
726 Ga0496104_0133466 3300048907 Bacteria 2385
727 Ga0496104_0169875 3300048907 Unclassified 2091
728 Ga0496104_1314076 3300048907 Bacteria 626
729 Ga0496105_0088006 3300048908 Bacteria 2566
730 Ga0496105_0309640 3300048908 Unclassified 1268
731 Ga0496105_0331260 3300048908 Bacteria 1218
732 Ga0496105_0439212 3300048908 Bacteria 1031
733 Ga0496105_1384553 3300048908 Unclassified 510
734 Ga0496106_0110402 3300048909 Bacteria 2141
735 Ga0496106_0367509 3300048909 Unclassified 1156
736 Ga0496106_0540201 3300048909 Bacteria 935
737 Ga0496108_0020745 3300048911 Bacteria 5401
738 Ga0496108_0208330 3300048911 Bacteria 1697
739 Ga0496108_0432284 3300048911 Unclassified 1150
740 Ga0496108_0838520 3300048911 Unclassified 792
741 Ga0496108_1109584 3300048911 Bacteria 672
742 Ga0496108_1251783 3300048911 Unclassified 626
743 Ga0496108_1627972 3300048911 Bacteria 533
744 Ga0496109_0022499 3300048912 Bacteria 5584
745 Ga0496109_0278260 3300048912 Bacteria 1577
746 Ga0496109_1479981 3300048912 Bacteria 614
747 Ga0496110_0589995 3300048913 Unclassified 1008
748 Ga0496110_0908138 3300048913 Unclassified 787
749 Ga0496110_1049399 3300048913 Bacteria 723
750 Ga0496110_1191644 3300048913 Unclassified 670
751 Ga0496111_0341814 3300048914 Bacteria 1108
752 Ga0496111_0925256 3300048914 Bacteria 627
753 Ga0496112_0023027 3300048915 Bacteria 5944
754 Ga0496112_0092375 3300048915 Bacteria 2996
755 Ga0496112_0326535 3300048915 Unclassified 1478
756 Ga0496112_0554406 3300048915 Bacteria 1083
757 Ga0496112_0604247 3300048915 Bacteria 1029
758 Ga0496113_0288167 3300048916 Unclassified 1313
759 Ga0496114_0002874 3300048917 Bacteria 13206
760 Ga0496114_0134745 3300048917 Unclassified 2135
761 Ga0496114_0282762 3300048917 Bacteria 1463
762 Ga0496115_0001553 3300048918 Bacteria 16496
763 Ga0496115_0008087 3300048918 Bacteria 7769
764 Ga0496115_0172757 3300048918 Bacteria 1787
765 Ga0496115_0948939 3300048918 Unclassified 660
766 Ga0501034_0156221 3300049571 Bacteria 2255
767 Ga0501080_0016700 3300049742 Bacteria 6777
768 Ga0501080_0858046 3300049742 Bacteria 793
769 nmdc:mga03683_176160_c1 3300050489 Bacteria 974
770 nmdc:mga03683_583488_c1 3300050489 Bacteria 546
771 nmdc:mga0k408_311671_c1 3300050493 Bacteria 939
772 nmdc:mga0k408_877908_c1 3300050493 Bacteria 521
773 nmdc:mga05p37_2002467_c1 3300050507 Bacteria 548
774 nmdc:mga05p37_242495_c1 3300050507 Unclassified 2166
775 nmdc:mga05p37_376324_c1 3300050507 Bacteria 1665
776 nmdc:mga0n895_1639780_c1 3300050512 Bacteria 607
777 nmdc:mga0n895_1678316_c1 3300050512 Bacteria 598
778 nmdc:mga0n895_642633_c1 3300050512 Unclassified 1060
779 nmdc:mga0n895_791451_c1 3300050512 Bacteria 939
780 nmdc:mga0n895_947940_c1 3300050512 Unclassified 844
781 nmdc:mga0rr50_1321276_c1 3300050513 Unclassified 611
782 nmdc:mga0rr50_369509_c1 3300050513 Bacteria 1208
783 nmdc:mga08x19_148337_c1 3300050514 Bacteria 1587
784 nmdc:mga0a205_230878_c1 3300050515 Bacteria 1733
785 Ga0495601_0062152 3300053077 Bacteria 2371
786 Ga0495601_0080488 3300053077 Bacteria 2090
787 Ga0495612_0035773 3300053078 Bacteria 2013
788 Ga0495612_0200838 3300053078 Bacteria 880
789 Ga0500610_0143566 3300053079 Bacteria 1203
790 Ga0495655_0146308 3300053083 Unclassified 740
791 Ga0495595_0048848 3300053084 Bacteria 1955
792 Ga0495619_0211239 3300053085 Unclassified 1344
793 Ga0495619_0295705 3300053085 Unclassified 1122
794 Ga0495619_1009061 3300053085 Bacteria 556
795 Ga0500616_0007249 3300053153 Bacteria 7080
796 Ga0587083_0221528 3300059505 Bacteria 550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049742 Ga0501080_0016700 Ga0501080_0016700_3207_3485 88
2 3300009176 Ga0105242_12888484 Ga0105242_128884841 90
3 3300005467 Ga0070706_100277823 Ga0070706_1002778231 93
4 3300005985 Ga0081539_10107129 Ga0081539_101071292 98
5 3300005435 Ga0070714_100673824 Ga0070714_1006738242 99
6 3300005436 Ga0070713_100375402 Ga0070713_1003754022 99
7 3300005467 Ga0070706_100063533 Ga0070706_1000635332 99
8 3300005467 Ga0070706_100730522 Ga0070706_1007305221 99
9 3300005468 Ga0070707_100167231 Ga0070707_1001672311 99
10 3300005468 Ga0070707_101812734 Ga0070707_1018127341 99
11 3300005471 Ga0070698_100000694 Ga0070698_10000069416 99
12 3300005518 Ga0070699_100625174 Ga0070699_1006251742 99
13 3300005536 Ga0070697_100013199 Ga0070697_1000131993 99
14 3300005536 Ga0070697_100090545 Ga0070697_1000905453 99
15 3300006028 Ga0070717_10072092 Ga0070717_100720922 99
16 3300006173 Ga0070716_100111540 Ga0070716_1001115402 99
17 3300007788 Ga0099795_10107716 Ga0099795_101077162 99
18 3300010159 Ga0099796_10222535 Ga0099796_102225352 99
19 3300025910 Ga0207684_10159436 Ga0207684_101594362 99
20 3300025922 Ga0207646_10052919 Ga0207646_100529192 99
21 3300025922 Ga0207646_11292189 Ga0207646_112921892 99
22 3300025924 Ga0207694_10888246 Ga0207694_108882461 99
23 3300025929 Ga0207664_10279125 Ga0207664_102791252 99
24 3300025939 Ga0207665_10092552 Ga0207665_100925522 99
25 3300039437 Ga0436365_1750414 Ga0436365_1750414_1276_1575 99
26 3300039450 Ga0436363_1476289 Ga0436363_1476289_210_509 99
27 3300039437 Ga0436365_0479463 Ga0436365_0479463_10354_10680 100
28 3300041486 Ga0451807_0058604 Ga0451807_0058604_76_378 100
29 3300041512 Ga0451853_3976838 Ga0451853_3976838_172_474 100
30 2209111006 2214801627 2213831403 101
31 3300006881 Ga0068865_100195749 Ga0068865_1001957492 101
32 3300013297 Ga0157378_11861491 Ga0157378_118614912 101
33 3300025939 Ga0207665_11028182 Ga0207665_110281822 101
34 3300041494 Ga0451837_1814547 Ga0451837_1814547_78_383 101
35 3300002077 JGI24744J21845_10015577 JGI24744J21845_100155772 102
36 3300002244 JGI24742J22300_10114521 JGI24742J22300_101145212 102
37 3300005327 Ga0070658_10004979 Ga0070658_100049792 102
38 3300005327 Ga0070658_11118709 Ga0070658_111187091 102
39 3300005328 Ga0070676_10015290 Ga0070676_100152904 102
40 3300005328 Ga0070676_10020144 Ga0070676_100201443 102
41 3300005328 Ga0070676_10427984 Ga0070676_104279842 102
42 3300005329 Ga0070683_100119052 Ga0070683_1001190522 102
43 3300005330 Ga0070690_100122694 Ga0070690_1001226942 102
44 3300005331 Ga0070670_100014442 Ga0070670_1000144424 102
45 3300005331 Ga0070670_100054028 Ga0070670_1000540282 102
46 3300005333 Ga0070677_10122457 Ga0070677_101224572 102
47 3300005334 Ga0068869_100249434 Ga0068869_1002494342 102
48 3300005335 Ga0070666_10032117 Ga0070666_100321173 102
49 3300005335 Ga0070666_10840130 Ga0070666_108401301 102
50 3300005338 Ga0068868_100014966 Ga0068868_1000149663 102
51 3300005338 Ga0068868_101119140 Ga0068868_1011191401 102
52 3300005339 Ga0070660_100547985 Ga0070660_1005479852 102
53 3300005340 Ga0070689_100028937 Ga0070689_1000289372 102
54 3300005340 Ga0070689_101200323 Ga0070689_1012003232 102
55 3300005341 Ga0070691_10355129 Ga0070691_103551292 102
56 3300005347 Ga0070668_100019359 Ga0070668_1000193594 102
57 3300005347 Ga0070668_100052697 Ga0070668_1000526973 102
58 3300005353 Ga0070669_100002855 Ga0070669_1000028554 102
59 3300005353 Ga0070669_100325477 Ga0070669_1003254772 102
60 3300005353 Ga0070669_100901555 Ga0070669_1009015552 102
61 3300005354 Ga0070675_100016119 Ga0070675_1000161194 102
62 3300005354 Ga0070675_100187866 Ga0070675_1001878662 102
63 3300005354 Ga0070675_101242035 Ga0070675_1012420352 102
64 3300005355 Ga0070671_100001422 Ga0070671_10000142210 102
65 3300005355 Ga0070671_100031408 Ga0070671_1000314084 102
66 3300005356 Ga0070674_100002179 Ga0070674_1000021794 102
67 3300005356 Ga0070674_101577726 Ga0070674_1015777261 102
68 3300005364 Ga0070673_100000434 Ga0070673_1000004346 102
69 3300005364 Ga0070673_100024350 Ga0070673_1000243502 102
70 3300005364 Ga0070673_100462143 Ga0070673_1004621432 102
71 3300005365 Ga0070688_100036100 Ga0070688_1000361003 102
72 3300005365 Ga0070688_100191855 Ga0070688_1001918552 102
73 3300005367 Ga0070667_100030098 Ga0070667_1000300984 102
74 3300005367 Ga0070667_100100279 Ga0070667_1001002793 102
75 3300005367 Ga0070667_101970243 Ga0070667_1019702432 102
76 3300005434 Ga0070709_11117078 Ga0070709_111170782 102
77 3300005436 Ga0070713_100180724 Ga0070713_1001807242 102
78 3300005439 Ga0070711_100600374 Ga0070711_1006003742 102
79 3300005455 Ga0070663_100101409 Ga0070663_1001014092 102
80 3300005456 Ga0070678_100128423 Ga0070678_1001284232 102
81 3300005457 Ga0070662_100064088 Ga0070662_1000640882 102
82 3300005459 Ga0068867_100039740 Ga0068867_1000397405 102
83 3300005459 Ga0068867_100200835 Ga0068867_1002008352 102
84 3300005543 Ga0070672_100013002 Ga0070672_1000130023 102
85 3300005543 Ga0070672_100185002 Ga0070672_1001850022 102
86 3300005545 Ga0070695_100116340 Ga0070695_1001163403 102
87 3300005545 Ga0070695_100302844 Ga0070695_1003028442 102
88 3300005547 Ga0070693_100953371 Ga0070693_1009533712 102
89 3300005548 Ga0070665_100029270 Ga0070665_1000292704 102
90 3300005548 Ga0070665_100293320 Ga0070665_1002933202 102
91 3300005563 Ga0068855_100010853 Ga0068855_1000108535 102
92 3300005564 Ga0070664_100043515 Ga0070664_1000435152 102
93 3300005578 Ga0068854_100374280 Ga0068854_1003742802 102
94 3300005614 Ga0068856_100306780 Ga0068856_1003067802 102
95 3300005614 Ga0068856_101144563 Ga0068856_1011445632 102
96 3300005617 Ga0068859_100312430 Ga0068859_1003124302 102
97 3300005618 Ga0068864_100328601 Ga0068864_1003286012 102
98 3300005618 Ga0068864_101221358 Ga0068864_1012213582 102
99 3300005718 Ga0068866_10615549 Ga0068866_106155491 102
100 3300005840 Ga0068870_10777064 Ga0068870_107770642 102
101 3300005841 Ga0068863_100354495 Ga0068863_1003544952 102
102 3300005842 Ga0068858_100045107 Ga0068858_1000451072 102
103 3300005842 Ga0068858_100134412 Ga0068858_1001344122 102
104 3300005843 Ga0068860_100000202 Ga0068860_10000020262 102
105 3300005843 Ga0068860_100335721 Ga0068860_1003357212 102
106 3300005843 Ga0068860_101228452 Ga0068860_1012284522 102
107 3300005844 Ga0068862_100210711 Ga0068862_1002107113 102
108 3300006048 Ga0075363_100599836 Ga0075363_1005998362 102
109 3300006175 Ga0070712_100034753 Ga0070712_1000347533 102
110 3300006177 Ga0075362_10039378 Ga0075362_100393782 102
111 3300006177 Ga0075362_10623669 Ga0075362_106236691 102
112 3300006195 Ga0075366_10094854 Ga0075366_100948542 102
113 3300006195 Ga0075366_10167754 Ga0075366_101677542 102
114 3300006237 Ga0097621_100008612 Ga0097621_1000086128 102
115 3300006237 Ga0097621_100018579 Ga0097621_1000185795 102
116 3300006358 Ga0068871_100025764 Ga0068871_1000257644 102
117 3300006358 Ga0068871_100051125 Ga0068871_1000511252 102
118 3300006358 Ga0068871_100223691 Ga0068871_1002236912 102
119 3300006852 Ga0075433_10719387 Ga0075433_107193872 102
120 3300006871 Ga0075434_100875689 Ga0075434_1008756892 102
121 3300006881 Ga0068865_100006676 Ga0068865_1000066765 102
122 3300006881 Ga0068865_100488740 Ga0068865_1004887402 102
123 3300006914 Ga0075436_100044115 Ga0075436_1000441152 102
124 3300006931 Ga0097620_100312468 Ga0097620_1003124682 102
125 3300009176 Ga0105242_10363679 Ga0105242_103636792 102
126 3300009176 Ga0105242_11989553 Ga0105242_119895532 102
127 3300009545 Ga0105237_10015766 Ga0105237_100157667 102
128 3300009545 Ga0105237_11684399 Ga0105237_116843992 102
129 3300009553 Ga0105249_12064964 Ga0105249_120649642 102
130 3300010375 Ga0105239_10211920 Ga0105239_102119202 102
131 3300010375 Ga0105239_12048462 Ga0105239_120484622 102
132 3300013102 Ga0157371_10737881 Ga0157371_107378812 102
133 3300013296 Ga0157374_10009530 Ga0157374_100095308 102
134 3300013296 Ga0157374_10030397 Ga0157374_100303973 102
135 3300013296 Ga0157374_10236283 Ga0157374_102362832 102
136 3300013297 Ga0157378_10062015 Ga0157378_100620152 102
137 3300013297 Ga0157378_10079408 Ga0157378_100794083 102
138 3300013297 Ga0157378_10158723 Ga0157378_101587232 102
139 3300013297 Ga0157378_13082920 Ga0157378_130829202 102
140 3300013306 Ga0163162_10002841 Ga0163162_1000284114 102
141 3300013306 Ga0163162_10632206 Ga0163162_106322062 102
142 3300013307 Ga0157372_10023674 Ga0157372_100236744 102
143 3300013307 Ga0157372_10277298 Ga0157372_102772982 102
144 3300013308 Ga0157375_10005288 Ga0157375_100052887 102
145 3300013308 Ga0157375_10028471 Ga0157375_100284714 102
146 3300013308 Ga0157375_11399458 Ga0157375_113994582 102
147 3300014325 Ga0163163_10669810 Ga0163163_106698102 102
148 3300014969 Ga0157376_10103786 Ga0157376_101037864 102
149 3300014969 Ga0157376_10291847 Ga0157376_102918472 102
150 3300014969 Ga0157376_12684503 Ga0157376_126845032 102
151 3300015262 Ga0182007_10082446 Ga0182007_100824462 102
152 3300017792 Ga0163161_10403271 Ga0163161_104032712 102
153 3300020069 Ga0197907_10816653 Ga0197907_108166532 102
154 3300020076 Ga0206355_1274465 Ga0206355_12744652 102
155 3300022467 Ga0224712_10696313 Ga0224712_106963131 102
156 3300025290 Ga0207673_1025434 Ga0207673_10254342 102
157 3300025315 Ga0207697_10000116 Ga0207697_1000011619 102
158 3300025315 Ga0207697_10428559 Ga0207697_104285591 102
159 3300025893 Ga0207682_10156735 Ga0207682_101567352 102
160 3300025899 Ga0207642_10514700 Ga0207642_105147001 102
161 3300025901 Ga0207688_10003621 Ga0207688_100036218 102
162 3300025903 Ga0207680_10046070 Ga0207680_100460702 102
163 3300025903 Ga0207680_10399730 Ga0207680_103997302 102
164 3300025907 Ga0207645_10019788 Ga0207645_100197882 102
165 3300025907 Ga0207645_10089619 Ga0207645_100896192 102
166 3300025907 Ga0207645_10398046 Ga0207645_103980462 102
167 3300025909 Ga0207705_10001641 Ga0207705_100016416 102
168 3300025909 Ga0207705_10624364 Ga0207705_106243641 102
169 3300025914 Ga0207671_10035366 Ga0207671_100353662 102
170 3300025915 Ga0207693_10117541 Ga0207693_101175412 102
171 3300025916 Ga0207663_10662429 Ga0207663_106624292 102
172 3300025923 Ga0207681_10020375 Ga0207681_100203753 102
173 3300025923 Ga0207681_10058229 Ga0207681_100582294 102
174 3300025923 Ga0207681_10889715 Ga0207681_108897152 102
175 3300025925 Ga0207650_10025433 Ga0207650_100254333 102
176 3300025925 Ga0207650_10051417 Ga0207650_100514171 102
177 3300025926 Ga0207659_10058831 Ga0207659_100588312 102
178 3300025926 Ga0207659_10448956 Ga0207659_104489562 102
179 3300025928 Ga0207700_10324518 Ga0207700_103245182 102
180 3300025931 Ga0207644_10116283 Ga0207644_101162832 102
181 3300025932 Ga0207690_10280027 Ga0207690_102800271 102
182 3300025933 Ga0207706_10035568 Ga0207706_100355685 102
183 3300025936 Ga0207670_10666650 Ga0207670_106666502 102
184 3300025937 Ga0207669_10004922 Ga0207669_100049225 102
185 3300025938 Ga0207704_10027297 Ga0207704_100272972 102
186 3300025938 Ga0207704_10372992 Ga0207704_103729923 102
187 3300025940 Ga0207691_10001082 Ga0207691_1000108217 102
188 3300025940 Ga0207691_10276583 Ga0207691_102765832 102
189 3300025942 Ga0207689_10797334 Ga0207689_107973342 102
190 3300025944 Ga0207661_10087176 Ga0207661_100871763 102
191 3300025949 Ga0207667_10010863 Ga0207667_100108638 102
192 3300025960 Ga0207651_10008503 Ga0207651_100085034 102
193 3300025960 Ga0207651_10234408 Ga0207651_102344082 102
194 3300025972 Ga0207668_10034403 Ga0207668_100344032 102
195 3300025972 Ga0207668_10107755 Ga0207668_101077552 102
196 3300025986 Ga0207658_10068856 Ga0207658_100688562 102
197 3300026023 Ga0207677_10059389 Ga0207677_100593892 102
198 3300026023 Ga0207677_10883069 Ga0207677_108830692 102
199 3300026035 Ga0207703_10017603 Ga0207703_100176034 102
200 3300026035 Ga0207703_12046658 Ga0207703_120466582 102
201 3300026041 Ga0207639_12268985 Ga0207639_122689852 102
202 3300026078 Ga0207702_10389092 Ga0207702_103890922 102
203 3300026089 Ga0207648_10110122 Ga0207648_101101222 102
204 3300026089 Ga0207648_10133635 Ga0207648_101336352 102
205 3300026116 Ga0207674_10761200 Ga0207674_107612002 102
206 3300026116 Ga0207674_11686937 Ga0207674_116869371 102
207 3300026121 Ga0207683_10001621 Ga0207683_100016217 102
208 3300026121 Ga0207683_10110618 Ga0207683_101106182 102
209 3300026142 Ga0207698_10884199 Ga0207698_108841992 102
210 3300026142 Ga0207698_11451033 Ga0207698_114510332 102
211 3300026142 Ga0207698_12394483 Ga0207698_123944832 102
212 3300028379 Ga0268266_10276884 Ga0268266_102768842 102
213 3300028379 Ga0268266_10319523 Ga0268266_103195232 102
214 3300028380 Ga0268265_10152829 Ga0268265_101528292 102
215 3300028380 Ga0268265_10883192 Ga0268265_108831922 102
216 3300028381 Ga0268264_10000241 Ga0268264_1000024175 102
217 3300028381 Ga0268264_10122825 Ga0268264_101228252 102
218 3300028381 Ga0268264_10541536 Ga0268264_105415362 102
219 3300028381 Ga0268264_11142164 Ga0268264_111421642 102
220 3300035086 Ga0373934_0273956 Ga0373934_0273956_378_686 102
221 3300035111 Ga0373923_0546833 Ga0373923_0546833_242_550 102
222 3300035117 Ga0373953_0168054 Ga0373953_0168054_147_455 102
223 3300035170 Ga0373943_0283706 Ga0373943_0283706_73_381 102
224 3300035172 Ga0373955_0190430 Ga0373955_0190430_128_436 102
225 3300035410 Ga0373924_0048152 Ga0373924_0048152_463_771 102
226 3300035692 Ga0373935_0310795 Ga0373935_0310795_648_956 102
227 3300036401 Ga0373937_0013425 Ga0373937_0013425_220_528 102
228 3300036401 Ga0373937_0035953 Ga0373937_0035953_2183_2491 102
229 3300036401 Ga0373937_0167954 Ga0373937_0167954_363_671 102
230 3300037068 Ga0373925_0628637 Ga0373925_0628637_456_764 102
231 3300041458 Ga0451798_1121114 Ga0451798_1121114_59_367 102
232 3300041486 Ga0451807_0777531 Ga0451807_0777531_93_401 102
233 3300046454 Ga0495592_0055436 Ga0495592_0055436_2536_2844 102
234 3300046462 Ga0495651_0051690 Ga0495651_0051690_2802_3110 102
235 3300046463 Ga0495653_0620513 Ga0495653_0620513_105_413 102
236 3300046511 Ga0495608_0435782 Ga0495608_0435782_184_492 102
237 3300046516 Ga0495628_0258470 Ga0495628_0258470_55_363 102
238 3300046517 Ga0495630_0210793 Ga0495630_0210793_351_659 102
239 3300046533 Ga0495640_0232856 Ga0495640_0232856_155_463 102
240 3300046543 Ga0495645_0371841 Ga0495645_0371841_70_378 102
241 3300046648 Ga0495611_0369835 Ga0495611_0369835_285_593 102
242 3300046679 Ga0495623_0697878 Ga0495623_0697878_103_411 102
243 3300046683 Ga0495658_0003395 Ga0495658_0003395_4139_4447 102
244 3300046684 Ga0495669_0276398 Ga0495669_0276398_447_755 102
245 3300046689 Ga0495613_0779941 Ga0495613_0779941_147_455 102
246 3300047471 Ga0495684_0285629 Ga0495684_0285629_413_721 102
247 3300048903 Ga0496100_0028956 Ga0496100_0028956_656_964 102
248 3300048904 Ga0496101_0022753 Ga0496101_0022753_3177_3485 102
249 3300048907 Ga0496104_0126841 Ga0496104_0126841_456_764 102
250 3300048907 Ga0496104_0133466 Ga0496104_0133466_1396_1704 102
251 3300048908 Ga0496105_0439212 Ga0496105_0439212_574_882 102
252 3300048909 Ga0496106_0110402 Ga0496106_0110402_963_1271 102
253 3300048911 Ga0496108_0208330 Ga0496108_0208330_1016_1324 102
254 3300048911 Ga0496108_1251783 Ga0496108_1251783_172_480 102
255 3300048911 Ga0496108_1627972 Ga0496108_1627972_155_463 102
256 3300048913 Ga0496110_1191644 Ga0496110_1191644_148_456 102
257 3300048915 Ga0496112_0023027 Ga0496112_0023027_1660_1968 102
258 3300048915 Ga0496112_0554406 Ga0496112_0554406_588_896 102
259 3300048918 Ga0496115_0008087 Ga0496115_0008087_726_1034 102
260 3300049571 Ga0501034_0156221 Ga0501034_0156221_441_749 102
261 3300049742 Ga0501080_0858046 Ga0501080_0858046_32_340 102
262 3300050489 nmdc:mga03683_176160_c1 nmdc:mga03683_176160_c1_255_563 102
263 3300050489 nmdc:mga03683_583488_c1 nmdc:mga03683_583488_c1_74_382 102
264 3300050493 nmdc:mga0k408_311671_c1 nmdc:mga0k408_311671_c1_322_630 102
265 3300050512 nmdc:mga0n895_791451_c1 nmdc:mga0n895_791451_c1_135_443 102
266 3300050512 nmdc:mga0n895_947940_c1 nmdc:mga0n895_947940_c1_524_832 102
267 3300050514 nmdc:mga08x19_148337_c1 nmdc:mga08x19_148337_c1_349_657 102
268 3300053077 Ga0495601_0080488 Ga0495601_0080488_1718_2026 102
269 3300053079 Ga0500610_0143566 Ga0500610_0143566_532_840 102
270 3300053085 Ga0495619_0295705 Ga0495619_0295705_354_662 102
271 3300053153 Ga0500616_0007249 Ga0500616_0007249_1422_1730 102
272 3300059505 Ga0587083_0221528 Ga0587083_0221528_166_474 102
273 2124908018 SwRhBV22_Contig_4286 SwRhBV22_00037310 103
274 3300003911 JGI25405J52794_10140164 JGI25405J52794_101401642 103
275 3300005289 Ga0065704_10016897 Ga0065704_100168972 103
276 3300005289 Ga0065704_10023391 Ga0065704_100233912 103
277 3300005289 Ga0065704_10025131 Ga0065704_100251312 103
278 3300005290 Ga0065712_10007221 Ga0065712_100072211 103
279 3300005290 Ga0065712_10071598 Ga0065712_100715985 103
280 3300005290 Ga0065712_10252632 Ga0065712_102526322 103
281 3300005293 Ga0065715_10001841 Ga0065715_100018412 103
282 3300005293 Ga0065715_10009791 Ga0065715_100097912 103
283 3300005293 Ga0065715_10010413 Ga0065715_100104132 103
284 3300005293 Ga0065715_10200500 Ga0065715_102005002 103
285 3300005293 Ga0065715_10262112 Ga0065715_102621122 103
286 3300005293 Ga0065715_10529236 Ga0065715_105292361 103
287 3300005295 Ga0065707_10470852 Ga0065707_104708522 103
288 3300005328 Ga0070676_10670652 Ga0070676_106706521 103
289 3300005328 Ga0070676_10937765 Ga0070676_109377652 103
290 3300005329 Ga0070683_100167685 Ga0070683_1001676852 103
291 3300005329 Ga0070683_100279200 Ga0070683_1002792002 103
292 3300005329 Ga0070683_100296687 Ga0070683_1002966872 103
293 3300005330 Ga0070690_101152542 Ga0070690_1011525421 103
294 3300005330 Ga0070690_101206321 Ga0070690_1012063212 103
295 3300005331 Ga0070670_100612607 Ga0070670_1006126072 103
296 3300005334 Ga0068869_101400217 Ga0068869_1014002172 103
297 3300005335 Ga0070666_11280780 Ga0070666_112807801 103
298 3300005336 Ga0070680_100159576 Ga0070680_1001595761 103
299 3300005337 Ga0070682_100128511 Ga0070682_1001285112 103
300 3300005337 Ga0070682_100269638 Ga0070682_1002696382 103
301 3300005337 Ga0070682_101319282 Ga0070682_1013192821 103
302 3300005338 Ga0068868_100084610 Ga0068868_1000846102 103
303 3300005338 Ga0068868_100430792 Ga0068868_1004307921 103
304 3300005339 Ga0070660_100018375 Ga0070660_1000183752 103
305 3300005339 Ga0070660_100262447 Ga0070660_1002624472 103
306 3300005339 Ga0070660_101680443 Ga0070660_1016804431 103
307 3300005340 Ga0070689_100127380 Ga0070689_1001273802 103
308 3300005340 Ga0070689_100203517 Ga0070689_1002035172 103
309 3300005343 Ga0070687_100414572 Ga0070687_1004145722 103
310 3300005344 Ga0070661_100106886 Ga0070661_1001068862 103
311 3300005344 Ga0070661_100116256 Ga0070661_1001162562 103
312 3300005344 Ga0070661_100330819 Ga0070661_1003308192 103
313 3300005347 Ga0070668_100514564 Ga0070668_1005145641 103
314 3300005354 Ga0070675_100012615 Ga0070675_1000126159 103
315 3300005354 Ga0070675_100027188 Ga0070675_1000271887 103
316 3300005354 Ga0070675_100127457 Ga0070675_1001274572 103
317 3300005354 Ga0070675_100147760 Ga0070675_1001477602 103
318 3300005354 Ga0070675_100458656 Ga0070675_1004586562 103
319 3300005354 Ga0070675_101437073 Ga0070675_1014370732 103
320 3300005355 Ga0070671_100816365 Ga0070671_1008163652 103
321 3300005356 Ga0070674_100084695 Ga0070674_1000846952 103
322 3300005356 Ga0070674_101103438 Ga0070674_1011034382 103
323 3300005364 Ga0070673_100030668 Ga0070673_1000306682 103
324 3300005365 Ga0070688_100011701 Ga0070688_1000117011 103
325 3300005365 Ga0070688_100124857 Ga0070688_1001248572 103
326 3300005365 Ga0070688_100715429 Ga0070688_1007154291 103
327 3300005365 Ga0070688_101238095 Ga0070688_1012380952 103
328 3300005366 Ga0070659_100001816 Ga0070659_1000018164 103
329 3300005366 Ga0070659_100151911 Ga0070659_1001519112 103
330 3300005366 Ga0070659_100878177 Ga0070659_1008781771 103
331 3300005367 Ga0070667_100075007 Ga0070667_1000750075 103
332 3300005367 Ga0070667_100538488 Ga0070667_1005384882 103
333 3300005434 Ga0070709_11795639 Ga0070709_117956391 103
334 3300005435 Ga0070714_100010616 Ga0070714_1000106163 103
335 3300005435 Ga0070714_100338086 Ga0070714_1003380862 103
336 3300005436 Ga0070713_100027581 Ga0070713_1000275814 103
337 3300005436 Ga0070713_100058836 Ga0070713_1000588362 103
338 3300005436 Ga0070713_101019021 Ga0070713_1010190212 103
339 3300005437 Ga0070710_10160008 Ga0070710_101600082 103
340 3300005439 Ga0070711_100290062 Ga0070711_1002900622 103
341 3300005439 Ga0070711_100906780 Ga0070711_1009067802 103
342 3300005440 Ga0070705_100100550 Ga0070705_1001005502 103
343 3300005440 Ga0070705_100111839 Ga0070705_1001118392 103
344 3300005441 Ga0070700_100019271 Ga0070700_1000192714 103
345 3300005444 Ga0070694_100638455 Ga0070694_1006384552 103
346 3300005445 Ga0070708_100050425 Ga0070708_1000504252 103
347 3300005445 Ga0070708_100057319 Ga0070708_1000573195 103
348 3300005445 Ga0070708_100259124 Ga0070708_1002591242 103
349 3300005445 Ga0070708_100738633 Ga0070708_1007386331 103
350 3300005455 Ga0070663_100027393 Ga0070663_1000273932 103
351 3300005455 Ga0070663_100185891 Ga0070663_1001858912 103
352 3300005455 Ga0070663_101640344 Ga0070663_1016403442 103
353 3300005456 Ga0070678_100701535 Ga0070678_1007015352 103
354 3300005457 Ga0070662_100434665 Ga0070662_1004346652 103
355 3300005457 Ga0070662_100737825 Ga0070662_1007378251 103
356 3300005457 Ga0070662_100842338 Ga0070662_1008423381 103
357 3300005458 Ga0070681_10088153 Ga0070681_100881535 103
358 3300005466 Ga0070685_10018866 Ga0070685_100188664 103
359 3300005467 Ga0070706_100184319 Ga0070706_1001843192 103
360 3300005467 Ga0070706_100508317 Ga0070706_1005083172 103
361 3300005467 Ga0070706_100902190 Ga0070706_1009021902 103
362 3300005467 Ga0070706_101088350 Ga0070706_1010883501 103
363 3300005467 Ga0070706_101385031 Ga0070706_1013850311 103
364 3300005468 Ga0070707_100001892 Ga0070707_1000018925 103
365 3300005468 Ga0070707_100026239 Ga0070707_1000262396 103
366 3300005468 Ga0070707_100096169 Ga0070707_1000961693 103
367 3300005468 Ga0070707_101099745 Ga0070707_1010997452 103
368 3300005468 Ga0070707_101696307 Ga0070707_1016963072 103
369 3300005471 Ga0070698_100001080 Ga0070698_10000108030 103
370 3300005471 Ga0070698_100047049 Ga0070698_1000470499 103
371 3300005471 Ga0070698_100065927 Ga0070698_1000659273 103
372 3300005471 Ga0070698_101603143 Ga0070698_1016031431 103
373 3300005518 Ga0070699_100148455 Ga0070699_1001484552 103
374 3300005518 Ga0070699_101785566 Ga0070699_1017855661 103
375 3300005530 Ga0070679_100402944 Ga0070679_1004029441 103
376 3300005535 Ga0070684_100001876 Ga0070684_10000187610 103
377 3300005535 Ga0070684_100002566 Ga0070684_10000256612 103
378 3300005535 Ga0070684_101042196 Ga0070684_1010421961 103
379 3300005536 Ga0070697_100044378 Ga0070697_1000443782 103
380 3300005536 Ga0070697_100711788 Ga0070697_1007117882 103
381 3300005536 Ga0070697_101030954 Ga0070697_1010309542 103
382 3300005539 Ga0068853_101657855 Ga0068853_1016578551 103
383 3300005543 Ga0070672_100394302 Ga0070672_1003943022 103
384 3300005543 Ga0070672_100995905 Ga0070672_1009959052 103
385 3300005544 Ga0070686_100073886 Ga0070686_1000738862 103
386 3300005544 Ga0070686_101400959 Ga0070686_1014009591 103
387 3300005546 Ga0070696_101588245 Ga0070696_1015882451 103
388 3300005547 Ga0070693_100719642 Ga0070693_1007196422 103
389 3300005548 Ga0070665_100004891 Ga0070665_1000048916 103
390 3300005548 Ga0070665_100216799 Ga0070665_1002167992 103
391 3300005548 Ga0070665_101982486 Ga0070665_1019824862 103
392 3300005563 Ga0068855_102523784 Ga0068855_1025237841 103
393 3300005564 Ga0070664_100068902 Ga0070664_1000689023 103
394 3300005564 Ga0070664_100267663 Ga0070664_1002676632 103
395 3300005564 Ga0070664_100616727 Ga0070664_1006167272 103
396 3300005578 Ga0068854_100460791 Ga0068854_1004607911 103
397 3300005614 Ga0068856_100073290 Ga0068856_1000732902 103
398 3300005614 Ga0068856_101434394 Ga0068856_1014343941 103
399 3300005615 Ga0070702_100419396 Ga0070702_1004193961 103
400 3300005617 Ga0068859_103122426 Ga0068859_1031224261 103
401 3300005618 Ga0068864_100345941 Ga0068864_1003459412 103
402 3300005618 Ga0068864_100415696 Ga0068864_1004156962 103
403 3300005618 Ga0068864_101653289 Ga0068864_1016532892 103
404 3300005718 Ga0068866_10360263 Ga0068866_103602632 103
405 3300005841 Ga0068863_100026675 Ga0068863_1000266758 103
406 3300005841 Ga0068863_100718501 Ga0068863_1007185011 103
407 3300005841 Ga0068863_101120860 Ga0068863_1011208602 103
408 3300005842 Ga0068858_100322499 Ga0068858_1003224992 103
409 3300005842 Ga0068858_100824044 Ga0068858_1008240442 103
410 3300005843 Ga0068860_100129957 Ga0068860_1001299572 103
411 3300005844 Ga0068862_102448839 Ga0068862_1024488391 103
412 3300005937 Ga0081455_10002512 Ga0081455_100025129 103
413 3300005937 Ga0081455_10021948 Ga0081455_100219482 103
414 3300005937 Ga0081455_10023390 Ga0081455_100233903 103
415 3300005937 Ga0081455_10034285 Ga0081455_100342855 103
416 3300005937 Ga0081455_10078628 Ga0081455_100786285 103
417 3300005937 Ga0081455_10127226 Ga0081455_101272262 103
418 3300005937 Ga0081455_10138759 Ga0081455_101387591 103
419 3300005937 Ga0081455_10449976 Ga0081455_104499761 103
420 3300005983 Ga0081540_1001119 Ga0081540_10011196 103
421 3300005983 Ga0081540_1009553 Ga0081540_10095532 103
422 3300005983 Ga0081540_1094483 Ga0081540_10944832 103
423 3300005983 Ga0081540_1196661 Ga0081540_11966612 103
424 3300005985 Ga0081539_10000052 Ga0081539_1000005276 103
425 3300005985 Ga0081539_10000671 Ga0081539_100006717 103
426 3300005985 Ga0081539_10021753 Ga0081539_100217533 103
427 3300005985 Ga0081539_10133477 Ga0081539_101334772 103
428 3300006028 Ga0070717_10007003 Ga0070717_100070032 103
429 3300006028 Ga0070717_10147471 Ga0070717_101474712 103
430 3300006028 Ga0070717_10158543 Ga0070717_101585432 103
431 3300006028 Ga0070717_11368278 Ga0070717_113682781 103
432 3300006028 Ga0070717_11577386 Ga0070717_115773861 103
433 3300006163 Ga0070715_10095844 Ga0070715_100958442 103
434 3300006163 Ga0070715_10121076 Ga0070715_101210762 103
435 3300006173 Ga0070716_100157119 Ga0070716_1001571192 103
436 3300006175 Ga0070712_100122098 Ga0070712_1001220982 103
437 3300006175 Ga0070712_100148771 Ga0070712_1001487711 103
438 3300006175 Ga0070712_100259798 Ga0070712_1002597982 103
439 3300006175 Ga0070712_100403413 Ga0070712_1004034132 103
440 3300006358 Ga0068871_100443318 Ga0068871_1004433181 103
441 3300006358 Ga0068871_102028374 Ga0068871_1020283742 103
442 3300006844 Ga0075428_100243578 Ga0075428_1002435782 103
443 3300006852 Ga0075433_11461854 Ga0075433_114618541 103
444 3300006871 Ga0075434_102006986 Ga0075434_1020069861 103
445 3300006881 Ga0068865_100109714 Ga0068865_1001097142 103
446 3300006931 Ga0097620_103121585 Ga0097620_1031215851 103
447 3300007076 Ga0075435_101512514 Ga0075435_1015125142 103
448 3300007265 Ga0099794_10406574 Ga0099794_104065741 103
449 3300009098 Ga0105245_10327619 Ga0105245_103276192 103
450 3300009098 Ga0105245_10718427 Ga0105245_107184272 103
451 3300009101 Ga0105247_10097735 Ga0105247_100977352 103
452 3300009147 Ga0114129_10631873 Ga0114129_106318731 103
453 3300009147 Ga0114129_10647695 Ga0114129_106476951 103
454 3300009147 Ga0114129_10702553 Ga0114129_107025532 103
455 3300009148 Ga0105243_10159811 Ga0105243_101598112 103
456 3300009148 Ga0105243_10973861 Ga0105243_109738612 103
457 3300009174 Ga0105241_11041825 Ga0105241_110418252 103
458 3300009177 Ga0105248_11110317 Ga0105248_111103172 103
459 3300009177 Ga0105248_12035804 Ga0105248_120358041 103
460 3300009545 Ga0105237_11997933 Ga0105237_119979332 103
461 3300009545 Ga0105237_12093754 Ga0105237_120937541 103
462 3300009551 Ga0105238_11034795 Ga0105238_110347951 103
463 3300009553 Ga0105249_10186698 Ga0105249_101866982 103
464 3300010159 Ga0099796_10038160 Ga0099796_100381602 103
465 3300010375 Ga0105239_10437507 Ga0105239_104375072 103
466 3300010375 Ga0105239_11326923 Ga0105239_113269231 103
467 3300011119 Ga0105246_10815966 Ga0105246_108159662 103
468 3300011119 Ga0105246_10912459 Ga0105246_109124591 103
469 3300013100 Ga0157373_10549474 Ga0157373_105494742 103
470 3300013102 Ga0157371_10263893 Ga0157371_102638932 103
471 3300013102 Ga0157371_11104824 Ga0157371_111048241 103
472 3300013104 Ga0157370_10368050 Ga0157370_103680502 103
473 3300013296 Ga0157374_10117230 Ga0157374_101172303 103
474 3300013296 Ga0157374_10175300 Ga0157374_101753001 103
475 3300013296 Ga0157374_10302879 Ga0157374_103028792 103
476 3300013296 Ga0157374_10571099 Ga0157374_105710992 103
477 3300013296 Ga0157374_11154256 Ga0157374_111542562 103
478 3300013296 Ga0157374_12249492 Ga0157374_122494921 103
479 3300013297 Ga0157378_10033410 Ga0157378_100334102 103
480 3300013306 Ga0163162_10149344 Ga0163162_101493442 103
481 3300013306 Ga0163162_10440967 Ga0163162_104409672 103
482 3300013307 Ga0157372_11404020 Ga0157372_114040201 103
483 3300013307 Ga0157372_11920510 Ga0157372_119205102 103
484 3300013308 Ga0157375_10004600 Ga0157375_1000460017 103
485 3300013308 Ga0157375_10019367 Ga0157375_100193672 103
486 3300013308 Ga0157375_11549503 Ga0157375_115495031 103
487 3300013308 Ga0157375_12847759 Ga0157375_128477592 103
488 3300013308 Ga0157375_13319466 Ga0157375_133194662 103
489 3300014325 Ga0163163_10693307 Ga0163163_106933072 103
490 3300014325 Ga0163163_11180473 Ga0163163_111804732 103
491 3300014325 Ga0163163_11832804 Ga0163163_118328041 103
492 3300014325 Ga0163163_12952853 Ga0163163_129528532 103
493 3300014326 Ga0157380_12644569 Ga0157380_126445692 103
494 3300014745 Ga0157377_10008830 Ga0157377_100088302 103
495 3300014745 Ga0157377_11140444 Ga0157377_111404441 103
496 3300014968 Ga0157379_11017798 Ga0157379_110177981 103
497 3300014968 Ga0157379_11384942 Ga0157379_113849421 103
498 3300014969 Ga0157376_10079358 Ga0157376_100793582 103
499 3300014969 Ga0157376_10737273 Ga0157376_107372732 103
500 3300014969 Ga0157376_12594521 Ga0157376_125945212 103
501 3300015262 Ga0182007_10043093 Ga0182007_100430932 103
502 3300017792 Ga0163161_10209079 Ga0163161_102090792 103
503 3300025271 Ga0207666_1000131 Ga0207666_10001316 103
504 3300025290 Ga0207673_1000321 Ga0207673_10003214 103
505 3300025290 Ga0207673_1009634 Ga0207673_10096341 103
506 3300025315 Ga0207697_10002751 Ga0207697_100027515 103
507 3300025315 Ga0207697_10008048 Ga0207697_100080483 103
508 3300025315 Ga0207697_10061473 Ga0207697_100614732 103
509 3300025315 Ga0207697_10140126 Ga0207697_101401262 103
510 3300025315 Ga0207697_10153082 Ga0207697_101530822 103
511 3300025885 Ga0207653_10004352 Ga0207653_100043525 103
512 3300025885 Ga0207653_10055425 Ga0207653_100554252 103
513 3300025898 Ga0207692_10064534 Ga0207692_100645342 103
514 3300025898 Ga0207692_10171367 Ga0207692_101713672 103
515 3300025899 Ga0207642_10526858 Ga0207642_105268581 103
516 3300025900 Ga0207710_10073332 Ga0207710_100733322 103
517 3300025901 Ga0207688_10046425 Ga0207688_100464252 103
518 3300025901 Ga0207688_10283819 Ga0207688_102838192 103
519 3300025904 Ga0207647_10013194 Ga0207647_100131942 103
520 3300025905 Ga0207685_10117831 Ga0207685_101178312 103
521 3300025906 Ga0207699_10241843 Ga0207699_102418432 103
522 3300025906 Ga0207699_10490193 Ga0207699_104901932 103
523 3300025907 Ga0207645_10154520 Ga0207645_101545202 103
524 3300025909 Ga0207705_10205921 Ga0207705_102059212 103
525 3300025910 Ga0207684_10000268 Ga0207684_1000026859 103
526 3300025910 Ga0207684_10005555 Ga0207684_100055557 103
527 3300025910 Ga0207684_10100398 Ga0207684_101003982 103
528 3300025910 Ga0207684_10103404 Ga0207684_101034042 103
529 3300025910 Ga0207684_10116444 Ga0207684_101164442 103
530 3300025910 Ga0207684_10197833 Ga0207684_101978332 103
531 3300025910 Ga0207684_10685246 Ga0207684_106852461 103
532 3300025910 Ga0207684_10759992 Ga0207684_107599921 103
533 3300025911 Ga0207654_10160674 Ga0207654_101606742 103
534 3300025911 Ga0207654_11007821 Ga0207654_110078212 103
535 3300025912 Ga0207707_10037297 Ga0207707_100372973 103
536 3300025914 Ga0207671_10189393 Ga0207671_101893932 103
537 3300025915 Ga0207693_10034854 Ga0207693_100348542 103
538 3300025915 Ga0207693_10063500 Ga0207693_100635003 103
539 3300025915 Ga0207693_10220603 Ga0207693_102206032 103
540 3300025915 Ga0207693_10493657 Ga0207693_104936572 103
541 3300025915 Ga0207693_10655984 Ga0207693_106559842 103
542 3300025915 Ga0207693_10704491 Ga0207693_107044912 103
543 3300025916 Ga0207663_10436995 Ga0207663_104369952 103
544 3300025917 Ga0207660_10201542 Ga0207660_102015422 103
545 3300025917 Ga0207660_10676125 Ga0207660_106761252 103
546 3300025918 Ga0207662_10075776 Ga0207662_100757762 103
547 3300025919 Ga0207657_10018574 Ga0207657_100185744 103
548 3300025919 Ga0207657_10183335 Ga0207657_101833352 103
549 3300025919 Ga0207657_10190220 Ga0207657_101902202 103
550 3300025919 Ga0207657_10232458 Ga0207657_102324582 103
551 3300025920 Ga0207649_10178294 Ga0207649_101782942 103
552 3300025920 Ga0207649_10372478 Ga0207649_103724782 103
553 3300025921 Ga0207652_11113739 Ga0207652_111137391 103
554 3300025922 Ga0207646_10007983 Ga0207646_100079834 103
555 3300025922 Ga0207646_10066543 Ga0207646_100665432 103
556 3300025922 Ga0207646_10234015 Ga0207646_102340152 103
557 3300025922 Ga0207646_10348789 Ga0207646_103487892 103
558 3300025922 Ga0207646_10631726 Ga0207646_106317262 103
559 3300025926 Ga0207659_10026322 Ga0207659_100263226 103
560 3300025926 Ga0207659_10062176 Ga0207659_100621762 103
561 3300025926 Ga0207659_10203878 Ga0207659_102038782 103
562 3300025926 Ga0207659_10357383 Ga0207659_103573831 103
563 3300025926 Ga0207659_10396809 Ga0207659_103968092 103
564 3300025927 Ga0207687_10133580 Ga0207687_101335802 103
565 3300025927 Ga0207687_10207559 Ga0207687_102075592 103
566 3300025928 Ga0207700_10002998 Ga0207700_100029986 103
567 3300025928 Ga0207700_10950405 Ga0207700_109504051 103
568 3300025929 Ga0207664_10071032 Ga0207664_100710323 103
569 3300025929 Ga0207664_10452858 Ga0207664_104528582 103
570 3300025931 Ga0207644_10069184 Ga0207644_100691842 103
571 3300025931 Ga0207644_10194564 Ga0207644_101945642 103
572 3300025931 Ga0207644_10531213 Ga0207644_105312132 103
573 3300025932 Ga0207690_10006971 Ga0207690_100069719 103
574 3300025932 Ga0207690_10058662 Ga0207690_100586622 103
575 3300025933 Ga0207706_10476560 Ga0207706_104765602 103
576 3300025933 Ga0207706_10989284 Ga0207706_109892842 103
577 3300025933 Ga0207706_10995024 Ga0207706_109950242 103
578 3300025934 Ga0207686_10457804 Ga0207686_104578042 103
579 3300025935 Ga0207709_10201833 Ga0207709_102018332 103
580 3300025935 Ga0207709_10777429 Ga0207709_107774291 103
581 3300025936 Ga0207670_10129317 Ga0207670_101293173 103
582 3300025936 Ga0207670_10461746 Ga0207670_104617462 103
583 3300025936 Ga0207670_10686502 Ga0207670_106865022 103
584 3300025937 Ga0207669_10437739 Ga0207669_104377392 103
585 3300025938 Ga0207704_10069471 Ga0207704_100694712 103
586 3300025939 Ga0207665_10098473 Ga0207665_100984733 103
587 3300025940 Ga0207691_10119459 Ga0207691_101194592 103
588 3300025942 Ga0207689_10110145 Ga0207689_101101452 103
589 3300025944 Ga0207661_10044464 Ga0207661_100444642 103
590 3300025944 Ga0207661_10084479 Ga0207661_100844792 103
591 3300025944 Ga0207661_10138610 Ga0207661_101386102 103
592 3300025944 Ga0207661_10245701 Ga0207661_102457012 103
593 3300025945 Ga0207679_10266427 Ga0207679_102664272 103
594 3300025961 Ga0207712_10217965 Ga0207712_102179652 103
595 3300025961 Ga0207712_11337169 Ga0207712_113371692 103
596 3300025972 Ga0207668_10652044 Ga0207668_106520442 103
597 3300025972 Ga0207668_11031982 Ga0207668_110319822 103
598 3300025981 Ga0207640_10106266 Ga0207640_101062662 103
599 3300025986 Ga0207658_10149497 Ga0207658_101494973 103
600 3300025986 Ga0207658_10689711 Ga0207658_106897112 103
601 3300026023 Ga0207677_10175799 Ga0207677_101757992 103
602 3300026023 Ga0207677_10176510 Ga0207677_101765102 103
603 3300026035 Ga0207703_10467315 Ga0207703_104673151 103
604 3300026035 Ga0207703_10981204 Ga0207703_109812041 103
605 3300026035 Ga0207703_11006802 Ga0207703_110068021 103
606 3300026041 Ga0207639_10872408 Ga0207639_108724082 103
607 3300026041 Ga0207639_11254141 Ga0207639_112541412 103
608 3300026067 Ga0207678_10017673 Ga0207678_100176732 103
609 3300026067 Ga0207678_10566695 Ga0207678_105666952 103
610 3300026078 Ga0207702_10782873 Ga0207702_107828731 103
611 3300026078 Ga0207702_10850524 Ga0207702_108505242 103
612 3300026088 Ga0207641_10303989 Ga0207641_103039892 103
613 3300026088 Ga0207641_11422971 Ga0207641_114229712 103
614 3300026095 Ga0207676_10618815 Ga0207676_106188152 103
615 3300026095 Ga0207676_10755135 Ga0207676_107551352 103
616 3300026095 Ga0207676_11051941 Ga0207676_110519412 103
617 3300026095 Ga0207676_12216554 Ga0207676_122165542 103
618 3300026118 Ga0207675_100163902 Ga0207675_1001639022 103
619 3300026121 Ga0207683_10577610 Ga0207683_105776102 103
620 3300027876 Ga0209974_10163426 Ga0209974_101634261 103
621 3300028379 Ga0268266_10043478 Ga0268266_100434782 103
622 3300028379 Ga0268266_10056203 Ga0268266_100562032 103
623 3300028379 Ga0268266_10345233 Ga0268266_103452332 103
624 3300028379 Ga0268266_10522709 Ga0268266_105227092 103
625 3300028380 Ga0268265_11976313 Ga0268265_119763132 103
626 3300035083 Ga0373926_0068650 Ga0373926_0068650_356_667 103
627 3300035086 Ga0373934_0068216 Ga0373934_0068216_1035_1346 103
628 3300035088 Ga0373940_0286791 Ga0373940_0286791_214_525 103
629 3300035089 Ga0373944_0059956 Ga0373944_0059956_274_585 103
630 3300035111 Ga0373923_0181340 Ga0373923_0181340_561_872 103
631 3300035116 Ga0373945_0032318 Ga0373945_0032318_214_525 103
632 3300035116 Ga0373945_0264920 Ga0373945_0264920_314_625 103
633 3300035117 Ga0373953_0018832 Ga0373953_0018832_820_1131 103
634 3300035118 Ga0373954_0046839 Ga0373954_0046839_118_429 103
635 3300035119 Ga0373956_0021811 Ga0373956_0021811_1131_1442 103
636 3300035120 Ga0373957_0027985 Ga0373957_0027985_847_1158 103
637 3300035120 Ga0373957_0376806 Ga0373957_0376806_202_513 103
638 3300035170 Ga0373943_0178173 Ga0373943_0178173_359_670 103
639 3300035171 Ga0373946_0041419 Ga0373946_0041419_419_730 103
640 3300035172 Ga0373955_0202384 Ga0373955_0202384_53_364 103
641 3300035172 Ga0373955_0221747 Ga0373955_0221747_261_572 103
642 3300035207 Ga0373942_0133971 Ga0373942_0133971_91_402 103
643 3300035691 Ga0373931_0112472 Ga0373931_0112472_130_441 103
644 3300035692 Ga0373935_0289431 Ga0373935_0289431_661_972 103
645 3300035692 Ga0373935_0530550 Ga0373935_0530550_44_355 103
646 3300035692 Ga0373935_0826476 Ga0373935_0826476_259_570 103
647 3300035692 Ga0373935_0901645 Ga0373935_0901645_223_534 103
648 3300035695 Ga0373927_0031919 Ga0373927_0031919_3015_3326 103
649 3300035695 Ga0373927_0718714 Ga0373927_0718714_259_570 103
650 3300035724 Ga0373933_0183447 Ga0373933_0183447_220_531 103
651 3300035725 Ga0373947_0217408 Ga0373947_0217408_513_824 103
652 3300035725 Ga0373947_0329279 Ga0373947_0329279_219_530 103
653 3300035725 Ga0373947_0507285 Ga0373947_0507285_50_361 103
654 3300036401 Ga0373937_0096255 Ga0373937_0096255_1048_1359 103
655 3300036401 Ga0373937_0184059 Ga0373937_0184059_1612_1923 103
656 3300036401 Ga0373937_1027433 Ga0373937_1027433_45_356 103
657 3300037068 Ga0373925_0027645 Ga0373925_0027645_781_1092 103
658 3300037068 Ga0373925_1251300 Ga0373925_1251300_175_486 103
659 3300037312 Ga0395899_0759722 Ga0395899_0759722_253_564 103
660 3300037466 Ga0395898_0019724 Ga0395898_0019724_6415_6726 103
661 3300037466 Ga0395898_1358703 Ga0395898_1358703_203_514 103
662 3300038443 Ga0395901_0269800 Ga0395901_0269800_799_1110 103
663 3300038443 Ga0395901_1892070 Ga0395901_1892070_192_503 103
664 3300041452 Ga0451793_0357197 Ga0451793_0357197_421_732 103
665 3300041512 Ga0451853_0874465 Ga0451853_0874465_301_612 103
666 3300042003 Ga0439443_055059 Ga0439443_055059_46_357 103
667 3300042005 Ga0439448_0167405 Ga0439448_0167405_370_681 103
668 3300042008 Ga0439450_038473 Ga0439450_038473_737_1048 103
669 3300042012 Ga0439455_0036334 Ga0439455_0036334_23_334 103
670 3300042157 Ga0439458_0029050 Ga0439458_0029050_368_679 103
671 3300042993 Ga0439440_0070788 Ga0439440_0070788_532_843 103
672 3300044706 Ga0466964_0058486 Ga0466964_0058486_1223_1534 103
673 3300045976 Ga0466967_1556467 Ga0466967_1556467_82_393 103
674 3300046454 Ga0495592_0011225 Ga0495592_0011225_5154_5465 103
675 3300046455 Ga0495603_0051331 Ga0495603_0051331_1044_1355 103
676 3300046459 Ga0495629_0208928 Ga0495629_0208928_910_1221 103
677 3300046459 Ga0495629_0258089 Ga0495629_0258089_350_661 103
678 3300046461 Ga0495641_0056447 Ga0495641_0056447_139_450 103
679 3300046461 Ga0495641_0097369 Ga0495641_0097369_89_400 103
680 3300046462 Ga0495651_0160530 Ga0495651_0160530_1084_1395 103
681 3300046462 Ga0495651_0463201 Ga0495651_0463201_105_416 103
682 3300046463 Ga0495653_0313310 Ga0495653_0313310_161_472 103
683 3300046473 Ga0495582_0185982 Ga0495582_0185982_722_1033 103
684 3300046474 Ga0495605_0346386 Ga0495605_0346386_10_321 103
685 3300046476 Ga0495662_0148882 Ga0495662_0148882_805_1116 103
686 3300046477 Ga0495664_0790960 Ga0495664_0790960_227_538 103
687 3300046491 Ga0495584_0151135 Ga0495584_0151135_858_1169 103
688 3300046491 Ga0495584_0257573 Ga0495584_0257573_248_559 103
689 3300046499 Ga0495594_0066156 Ga0495594_0066156_498_809 103
690 3300046511 Ga0495608_0219869 Ga0495608_0219869_535_846 103
691 3300046511 Ga0495608_0267853 Ga0495608_0267853_586_897 103
692 3300046511 Ga0495608_0862526 Ga0495608_0862526_75_386 103
693 3300046514 Ga0495618_0134761 Ga0495618_0134761_566_877 103
694 3300046514 Ga0495618_0875463 Ga0495618_0875463_168_479 103
695 3300046516 Ga0495628_0030849 Ga0495628_0030849_608_919 103
696 3300046517 Ga0495630_0050818 Ga0495630_0050818_161_472 103
697 3300046517 Ga0495630_1176768 Ga0495630_1176768_97_408 103
698 3300046520 Ga0495637_0313631 Ga0495637_0313631_101_412 103
699 3300046523 Ga0495644_0152135 Ga0495644_0152135_366_677 103
700 3300046529 Ga0495652_0177757 Ga0495652_0177757_702_1013 103
701 3300046529 Ga0495652_0279458 Ga0495652_0279458_769_1080 103
702 3300046531 Ga0495665_0151866 Ga0495665_0151866_133_444 103
703 3300046531 Ga0495665_0218404 Ga0495665_0218404_332_643 103
704 3300046533 Ga0495640_0054657 Ga0495640_0054657_1955_2266 103
705 3300046533 Ga0495640_0305117 Ga0495640_0305117_206_517 103
706 3300046535 Ga0495586_0024694 Ga0495586_0024694_2146_2457 103
707 3300046536 Ga0495587_0013515 Ga0495587_0013515_1921_2232 103
708 3300046543 Ga0495645_0052406 Ga0495645_0052406_2034_2345 103
709 3300046559 Ga0495667_0232857 Ga0495667_0232857_607_918 103
710 3300046559 Ga0495667_0333439 Ga0495667_0333439_520_831 103
711 3300046559 Ga0495667_0355320 Ga0495667_0355320_554_865 103
712 3300046616 Ga0495668_0323661 Ga0495668_0323661_396_707 103
713 3300046664 Ga0495659_0093196 Ga0495659_0093196_86_397 103
714 3300046675 Ga0495657_0203603 Ga0495657_0203603_389_700 103
715 3300046678 Ga0495599_0043050 Ga0495599_0043050_2313_2624 103
716 3300046679 Ga0495623_0010814 Ga0495623_0010814_996_1307 103
717 3300046680 Ga0495646_0005936 Ga0495646_0005936_461_772 103
718 3300046683 Ga0495658_0048384 Ga0495658_0048384_766_1077 103
719 3300046684 Ga0495669_0173178 Ga0495669_0173178_620_931 103
720 3300046689 Ga0495613_0295413 Ga0495613_0295413_766_1077 103
721 3300046689 Ga0495613_0768051 Ga0495613_0768051_159_470 103
722 3300046691 Ga0495670_0320155 Ga0495670_0320155_358_669 103
723 3300046809 Ga0495600_0818914 Ga0495600_0818914_42_353 103
724 3300046809 Ga0495600_0876490 Ga0495600_0876490_195_506 103
725 3300047317 Ga0495604_0072297 Ga0495604_0072297_740_1051 103
726 3300047317 Ga0495604_0391913 Ga0495604_0391913_45_356 103
727 3300047318 Ga0495636_0355976 Ga0495636_0355976_327_638 103
728 3300047319 Ga0495674_0245478 Ga0495674_0245478_743_1054 103
729 3300047319 Ga0495674_0315550 Ga0495674_0315550_357_668 103
730 3300047321 Ga0495676_0086573 Ga0495676_0086573_205_516 103
731 3300047321 Ga0495676_0716209 Ga0495676_0716209_183_494 103
732 3300047322 Ga0495680_0143657 Ga0495680_0143657_454_765 103
733 3300047444 Ga0495675_0034710 Ga0495675_0034710_2740_3051 103
734 3300047471 Ga0495684_0116581 Ga0495684_0116581_639_950 103
735 3300047471 Ga0495684_0396592 Ga0495684_0396592_466_777 103
736 3300047673 Ga0495593_0084185 Ga0495593_0084185_1308_1619 103
737 3300048088 Ga0495602_0140797 Ga0495602_0140797_936_1247 103
738 3300048903 Ga0496100_0248221 Ga0496100_0248221_871_1182 103
739 3300048904 Ga0496101_0079978 Ga0496101_0079978_1178_1489 103
740 3300048904 Ga0496101_0125680 Ga0496101_0125680_709_1020 103
741 3300048904 Ga0496101_0851479 Ga0496101_0851479_254_565 103
742 3300048905 Ga0496102_0067806 Ga0496102_0067806_1094_1405 103
743 3300048905 Ga0496102_0114593 Ga0496102_0114593_359_670 103
744 3300048905 Ga0496102_0235623 Ga0496102_0235623_467_778 103
745 3300048905 Ga0496102_0328933 Ga0496102_0328933_153_464 103
746 3300048906 Ga0496103_0220136 Ga0496103_0220136_241_552 103
747 3300048906 Ga0496103_0351242 Ga0496103_0351242_265_576 103
748 3300048906 Ga0496103_0745857 Ga0496103_0745857_34_345 103
749 3300048907 Ga0496104_0036202 Ga0496104_0036202_2801_3112 103
750 3300048907 Ga0496104_0169875 Ga0496104_0169875_1130_1441 103
751 3300048907 Ga0496104_1314076 Ga0496104_1314076_171_482 103
752 3300048908 Ga0496105_0088006 Ga0496105_0088006_422_733 103
753 3300048908 Ga0496105_0309640 Ga0496105_0309640_843_1154 103
754 3300048908 Ga0496105_0331260 Ga0496105_0331260_336_647 103
755 3300048908 Ga0496105_1384553 Ga0496105_1384553_61_372 103
756 3300048909 Ga0496106_0367509 Ga0496106_0367509_499_810 103
757 3300048909 Ga0496106_0540201 Ga0496106_0540201_283_594 103
758 3300048911 Ga0496108_0020745 Ga0496108_0020745_585_896 103
759 3300048911 Ga0496108_0432284 Ga0496108_0432284_738_1049 103
760 3300048911 Ga0496108_0838520 Ga0496108_0838520_11_322 103
761 3300048911 Ga0496108_1109584 Ga0496108_1109584_34_345 103
762 3300048912 Ga0496109_0022499 Ga0496109_0022499_2364_2675 103
763 3300048912 Ga0496109_0278260 Ga0496109_0278260_499_810 103
764 3300048912 Ga0496109_1479981 Ga0496109_1479981_135_446 103
765 3300048913 Ga0496110_0589995 Ga0496110_0589995_295_606 103
766 3300048913 Ga0496110_0908138 Ga0496110_0908138_123_434 103
767 3300048913 Ga0496110_1049399 Ga0496110_1049399_167_478 103
768 3300048914 Ga0496111_0341814 Ga0496111_0341814_373_684 103
769 3300048914 Ga0496111_0925256 Ga0496111_0925256_34_345 103
770 3300048915 Ga0496112_0092375 Ga0496112_0092375_262_573 103
771 3300048915 Ga0496112_0326535 Ga0496112_0326535_1092_1403 103
772 3300048915 Ga0496112_0604247 Ga0496112_0604247_648_959 103
773 3300048916 Ga0496113_0288167 Ga0496113_0288167_313_624 103
774 3300048917 Ga0496114_0002874 Ga0496114_0002874_10360_10671 103
775 3300048917 Ga0496114_0134745 Ga0496114_0134745_1387_1698 103
776 3300048917 Ga0496114_0282762 Ga0496114_0282762_243_554 103
777 3300048918 Ga0496115_0001553 Ga0496115_0001553_4183_4494 103
778 3300048918 Ga0496115_0172757 Ga0496115_0172757_1267_1578 103
779 3300048918 Ga0496115_0948939 Ga0496115_0948939_252_563 103
780 3300050493 nmdc:mga0k408_877908_c1 nmdc:mga0k408_877908_c1_122_433 103
781 3300050507 nmdc:mga05p37_2002467_c1 nmdc:mga05p37_2002467_c1_128_439 103
782 3300050507 nmdc:mga05p37_242495_c1 nmdc:mga05p37_242495_c1_748_1059 103
783 3300050507 nmdc:mga05p37_376324_c1 nmdc:mga05p37_376324_c1_887_1198 103
784 3300050512 nmdc:mga0n895_1639780_c1 nmdc:mga0n895_1639780_c1_268_579 103
785 3300050512 nmdc:mga0n895_1678316_c1 nmdc:mga0n895_1678316_c1_70_381 103
786 3300050512 nmdc:mga0n895_642633_c1 nmdc:mga0n895_642633_c1_358_669 103
787 3300050513 nmdc:mga0rr50_1321276_c1 nmdc:mga0rr50_1321276_c1_23_334 103
788 3300050513 nmdc:mga0rr50_369509_c1 nmdc:mga0rr50_369509_c1_150_461 103
789 3300050515 nmdc:mga0a205_230878_c1 nmdc:mga0a205_230878_c1_551_862 103
790 3300053077 Ga0495601_0062152 Ga0495601_0062152_624_935 103
791 3300053078 Ga0495612_0035773 Ga0495612_0035773_93_404 103
792 3300053078 Ga0495612_0200838 Ga0495612_0200838_169_480 103
793 3300053083 Ga0495655_0146308 Ga0495655_0146308_144_455 103
794 3300053084 Ga0495595_0048848 Ga0495595_0048848_883_1194 103
795 3300053085 Ga0495619_0211239 Ga0495619_0211239_889_1200 103
796 3300053085 Ga0495619_1009061 Ga0495619_1009061_214_525 103

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

16

97

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3le5-assembly2.cif.gz_B-3 crystal structure of hpr dimer from thermoanaerobacter tengcongensis 0.9443 29 102
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.941 16 96
2hpr-assembly1.cif.gz_A histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c) 0.9336 17 98
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9317 17 97
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.9309 17 103
ID Description Score Start End Superfamily
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9367 19 99 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9315 17 98 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9238 17 96 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.923 17 103 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.913 17 103 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A7C2SKU9-F1-model_v4 HPr family phosphocarrier protein 0.9663 14 100 GO:0005737
GO:0009401
AF-A0A2V7KXM1-F1-model_v4 HPr family phosphocarrier protein 0.9655 15 100
AF-A0A496PVT4-F1-model_v4 HPr family phosphocarrier protein 0.9655 17 100 GO:0005737
GO:0009401
AF-A0A1Y5EDL0-F1-model_v4 HPr domain-containing protein 0.9623 16 100 GO:0005737
GO:0009401
AF-A0A3N9MMD1-F1-model_v4 HPr family phosphocarrier protein 0.9617 17 100 GO:0005737
GO:0009401

Feature Viewer

pLDDT pTM Quality
85.38 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map