F481174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 796 | 309 | 1592 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100576254|Ga0070699_1005762542 |
| Length | 153 |
| Sequence | MLLSRAREMALFDTLQTDLNAARKAQDKARVLVLGTIFSDAKNRKIELRRDLTDDEVVDVLRKGIKRRRESIEMYAGKRDDLAEKERAEVAILETYLPAAVSDDELRAAVRAAIAGGASQIGAVMGKVLPQFKGRAEGSTINAIAREELSKQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 184 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 187 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 188 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 217 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 218 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 223 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 308 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 309 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.74 |
| Metatranscriptomes | 1.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.26 |
| Rhizosphere | 97.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 21.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070699_100576254 | 3300005518 | Bacteria | 1025 |
| 2 | JGI24752J21851_1032930 | 3300001976 | Bacteria | 686 |
| 3 | JGI25406J46586_10032351 | 3300003203 | Bacteria | 1944 |
| 4 | Ga0058863_10125579 | 3300004799 | Bacteria | 813 |
| 5 | Ga0058863_11665452 | 3300004799 | Bacteria | 928 |
| 6 | Ga0058861_10000584 | 3300004800 | Bacteria | 834 |
| 7 | Ga0058861_10046646 | 3300004800 | Bacteria | 1102 |
| 8 | Ga0058861_11593278 | 3300004800 | Bacteria | 570 |
| 9 | Ga0058861_12032014 | 3300004800 | Bacteria | 970 |
| 10 | Ga0065712_10074141 | 3300005290 | Bacteria | 4174 |
| 11 | Ga0065715_10169908 | 3300005293 | Bacteria | 1555 |
| 12 | Ga0065715_10196773 | 3300005293 | Bacteria | 1383 |
| 13 | Ga0070658_10004996 | 3300005327 | Bacteria | 10800 |
| 14 | Ga0070658_10005423 | 3300005327 | Bacteria | 10348 |
| 15 | Ga0070658_10005604 | 3300005327 | Bacteria | 10184 |
| 16 | Ga0070658_10108991 | 3300005327 | Unclassified | 2292 |
| 17 | Ga0070658_10177326 | 3300005327 | Bacteria | 1792 |
| 18 | Ga0070658_10639631 | 3300005327 | Unclassified | 923 |
| 19 | Ga0070676_10057744 | 3300005328 | Unclassified | 2297 |
| 20 | Ga0070676_10078553 | 3300005328 | Bacteria | 1997 |
| 21 | Ga0070683_100000681 | 3300005329 | Bacteria | 24634 |
| 22 | Ga0070683_100012618 | 3300005329 | Bacteria | 7346 |
| 23 | Ga0070683_100025497 | 3300005329 | Bacteria | 5310 |
| 24 | Ga0070683_100028687 | 3300005329 | Bacteria | 5031 |
| 25 | Ga0070683_100146612 | 3300005329 | Bacteria | 2237 |
| 26 | Ga0070683_100207460 | 3300005329 | Bacteria | 1861 |
| 27 | Ga0070683_100227384 | 3300005329 | Unclassified | 1773 |
| 28 | Ga0070690_100025728 | 3300005330 | Bacteria | 3625 |
| 29 | Ga0070670_100008651 | 3300005331 | Bacteria | 8690 |
| 30 | Ga0070670_100200388 | 3300005331 | Unclassified | 1734 |
| 31 | Ga0068869_100000336 | 3300005334 | Bacteria | 25057 |
| 32 | Ga0068869_100718121 | 3300005334 | Unclassified | 853 |
| 33 | Ga0070666_10110846 | 3300005335 | Bacteria | 1898 |
| 34 | Ga0070666_10339171 | 3300005335 | Bacteria | 1074 |
| 35 | Ga0070666_10503018 | 3300005335 | Unclassified | 878 |
| 36 | Ga0070666_10548670 | 3300005335 | Bacteria | 841 |
| 37 | Ga0070680_100000247 | 3300005336 | Bacteria | 35633 |
| 38 | Ga0070680_100005105 | 3300005336 | Bacteria | 9912 |
| 39 | Ga0070680_100006242 | 3300005336 | Bacteria | 9042 |
| 40 | Ga0070680_100049309 | 3300005336 | Bacteria | 3432 |
| 41 | Ga0070680_100352849 | 3300005336 | Bacteria | 1251 |
| 42 | Ga0070680_100615808 | 3300005336 | Bacteria | 932 |
| 43 | Ga0070682_100001941 | 3300005337 | Bacteria | 11536 |
| 44 | Ga0070682_100861849 | 3300005337 | Bacteria | 741 |
| 45 | Ga0068868_100109440 | 3300005338 | Bacteria | 2244 |
| 46 | Ga0068868_100557281 | 3300005338 | Unclassified | 1011 |
| 47 | Ga0068868_100647303 | 3300005338 | Unclassified | 941 |
| 48 | Ga0070660_100008200 | 3300005339 | Bacteria | 7301 |
| 49 | Ga0070660_100131677 | 3300005339 | Unclassified | 2002 |
| 50 | Ga0070660_100311438 | 3300005339 | Bacteria | 1292 |
| 51 | Ga0070689_100020073 | 3300005340 | Bacteria | 4953 |
| 52 | Ga0070689_100194013 | 3300005340 | Bacteria | 1655 |
| 53 | Ga0070689_100650956 | 3300005340 | Bacteria | 916 |
| 54 | Ga0070687_100010494 | 3300005343 | Bacteria | 4008 |
| 55 | Ga0070687_100101337 | 3300005343 | Bacteria | 1613 |
| 56 | Ga0070687_100327884 | 3300005343 | Unclassified | 980 |
| 57 | Ga0070661_100001897 | 3300005344 | Bacteria | 14475 |
| 58 | Ga0070661_100086485 | 3300005344 | Unclassified | 2318 |
| 59 | Ga0070661_100153652 | 3300005344 | Bacteria | 1741 |
| 60 | Ga0070692_10035629 | 3300005345 | Bacteria | 2521 |
| 61 | Ga0070692_10106284 | 3300005345 | Unclassified | 1546 |
| 62 | Ga0070692_10627313 | 3300005345 | Bacteria | 715 |
| 63 | Ga0070668_100055450 | 3300005347 | Bacteria | 3059 |
| 64 | Ga0070668_100134691 | 3300005347 | Bacteria | 1986 |
| 65 | Ga0070669_100002374 | 3300005353 | Bacteria | 13618 |
| 66 | Ga0070669_100178078 | 3300005353 | Bacteria | 1662 |
| 67 | Ga0070669_100257763 | 3300005353 | Bacteria | 1391 |
| 68 | Ga0070675_100000547 | 3300005354 | Bacteria | 25799 |
| 69 | Ga0070675_100002559 | 3300005354 | Bacteria | 13613 |
| 70 | Ga0070675_100099296 | 3300005354 | Unclassified | 2450 |
| 71 | Ga0070675_100285802 | 3300005354 | Bacteria | 1451 |
| 72 | Ga0070675_100645305 | 3300005354 | Bacteria | 962 |
| 73 | Ga0070675_101355819 | 3300005354 | Bacteria | 656 |
| 74 | Ga0070671_100152325 | 3300005355 | Bacteria | 1953 |
| 75 | Ga0070671_100390003 | 3300005355 | Unclassified | 1191 |
| 76 | Ga0070674_100725588 | 3300005356 | Unclassified | 852 |
| 77 | Ga0070673_100013820 | 3300005364 | Bacteria | 5602 |
| 78 | Ga0070673_100029048 | 3300005364 | Bacteria | 4120 |
| 79 | Ga0070673_100094070 | 3300005364 | Bacteria | 2456 |
| 80 | Ga0070673_100901064 | 3300005364 | Unclassified | 820 |
| 81 | Ga0070688_100288949 | 3300005365 | Bacteria | 1181 |
| 82 | Ga0070659_100002963 | 3300005366 | Bacteria | 12102 |
| 83 | Ga0070659_100110987 | 3300005366 | Unclassified | 2214 |
| 84 | Ga0070659_100126935 | 3300005366 | Bacteria | 2070 |
| 85 | Ga0070667_100048207 | 3300005367 | Bacteria | 3585 |
| 86 | Ga0070667_100062062 | 3300005367 | Unclassified | 3165 |
| 87 | Ga0070667_100254836 | 3300005367 | Bacteria | 1570 |
| 88 | Ga0070667_100542343 | 3300005367 | Unclassified | 1069 |
| 89 | Ga0070667_101098064 | 3300005367 | Bacteria | 743 |
| 90 | Ga0070709_10116047 | 3300005434 | Bacteria | 1807 |
| 91 | Ga0070709_11335186 | 3300005434 | Bacteria | 579 |
| 92 | Ga0070714_100033582 | 3300005435 | Bacteria | 4290 |
| 93 | Ga0070714_100347440 | 3300005435 | Bacteria | 1393 |
| 94 | Ga0070714_100567033 | 3300005435 | Unclassified | 1088 |
| 95 | Ga0070714_101777585 | 3300005435 | Bacteria | 602 |
| 96 | Ga0070713_100007753 | 3300005436 | Bacteria | 7560 |
| 97 | Ga0070713_100024185 | 3300005436 | Bacteria | 4728 |
| 98 | Ga0070713_100101428 | 3300005436 | Bacteria | 2493 |
| 99 | Ga0070710_10020846 | 3300005437 | Bacteria | 3407 |
| 100 | Ga0070710_10047944 | 3300005437 | Unclassified | 2385 |
| 101 | Ga0070701_10302394 | 3300005438 | Unclassified | 984 |
| 102 | Ga0070711_100213452 | 3300005439 | Bacteria | 1496 |
| 103 | Ga0070705_100577534 | 3300005440 | Unclassified | 866 |
| 104 | Ga0070694_100218592 | 3300005444 | Bacteria | 1428 |
| 105 | Ga0070663_101179226 | 3300005455 | Unclassified | 672 |
| 106 | Ga0070678_100220838 | 3300005456 | Unclassified | 1575 |
| 107 | Ga0070662_100055229 | 3300005457 | Bacteria | 2880 |
| 108 | Ga0070662_100359235 | 3300005457 | Bacteria | 1195 |
| 109 | Ga0070681_10001887 | 3300005458 | Bacteria | 18911 |
| 110 | Ga0070681_10003332 | 3300005458 | Bacteria | 15018 |
| 111 | Ga0070681_10003955 | 3300005458 | Bacteria | 13970 |
| 112 | Ga0070681_10005293 | 3300005458 | Bacteria | 12458 |
| 113 | Ga0070681_10009589 | 3300005458 | Bacteria | 9518 |
| 114 | Ga0070681_10051410 | 3300005458 | Bacteria | 4110 |
| 115 | Ga0070681_10209015 | 3300005458 | Bacteria | 1868 |
| 116 | Ga0070681_10330945 | 3300005458 | Bacteria | 1433 |
| 117 | Ga0070681_11040701 | 3300005458 | Unclassified | 739 |
| 118 | Ga0068867_100223953 | 3300005459 | Bacteria | 1517 |
| 119 | Ga0068867_100300678 | 3300005459 | Unclassified | 1323 |
| 120 | Ga0070685_10005071 | 3300005466 | Bacteria | 6679 |
| 121 | Ga0070685_10150450 | 3300005466 | Unclassified | 1474 |
| 122 | Ga0070685_10474259 | 3300005466 | Unclassified | 881 |
| 123 | Ga0070707_100645295 | 3300005468 | Unclassified | 1021 |
| 124 | Ga0070707_100683137 | 3300005468 | Bacteria | 989 |
| 125 | Ga0070698_100151552 | 3300005471 | Unclassified | 2266 |
| 126 | Ga0070698_100250214 | 3300005471 | Unclassified | 1705 |
| 127 | Ga0070699_100564996 | 3300005518 | Bacteria | 1036 |
| 128 | Ga0070679_100000919 | 3300005530 | Bacteria | 25597 |
| 129 | Ga0070679_100001804 | 3300005530 | Bacteria | 19304 |
| 130 | Ga0070679_100005710 | 3300005530 | Bacteria | 11536 |
| 131 | Ga0070679_100022028 | 3300005530 | Bacteria | 6225 |
| 132 | Ga0070679_100146039 | 3300005530 | Bacteria | 2343 |
| 133 | Ga0070679_100290355 | 3300005530 | Bacteria | 1587 |
| 134 | Ga0070679_100334780 | 3300005530 | Bacteria | 1462 |
| 135 | Ga0070679_100714740 | 3300005530 | Bacteria | 945 |
| 136 | Ga0070679_101597268 | 3300005530 | Bacteria | 600 |
| 137 | Ga0070684_100005210 | 3300005535 | Bacteria | 9942 |
| 138 | Ga0070684_100013772 | 3300005535 | Bacteria | 6527 |
| 139 | Ga0070684_100034974 | 3300005535 | Bacteria | 4298 |
| 140 | Ga0070684_100044305 | 3300005535 | Bacteria | 3848 |
| 141 | Ga0070684_100227530 | 3300005535 | Bacteria | 1702 |
| 142 | Ga0070684_100525700 | 3300005535 | Bacteria | 1097 |
| 143 | Ga0070684_100808534 | 3300005535 | Bacteria | 876 |
| 144 | Ga0070684_101201704 | 3300005535 | Bacteria | 713 |
| 145 | Ga0068853_100305087 | 3300005539 | Unclassified | 1472 |
| 146 | Ga0070672_100061046 | 3300005543 | Bacteria | 2971 |
| 147 | Ga0070672_100121254 | 3300005543 | Bacteria | 2140 |
| 148 | Ga0070672_100413326 | 3300005543 | Unclassified | 1158 |
| 149 | Ga0070672_100551829 | 3300005543 | Unclassified | 1000 |
| 150 | Ga0070672_100604157 | 3300005543 | Bacteria | 955 |
| 151 | Ga0070686_100464234 | 3300005544 | Unclassified | 976 |
| 152 | Ga0070686_100568989 | 3300005544 | Unclassified | 889 |
| 153 | Ga0070695_100026962 | 3300005545 | Bacteria | 3557 |
| 154 | Ga0070695_100483654 | 3300005545 | Bacteria | 954 |
| 155 | Ga0070695_100496008 | 3300005545 | Bacteria | 944 |
| 156 | Ga0070696_100242089 | 3300005546 | Unclassified | 1361 |
| 157 | Ga0070693_100005997 | 3300005547 | Bacteria | 5876 |
| 158 | Ga0070693_100096480 | 3300005547 | Bacteria | 1792 |
| 159 | Ga0070693_100470776 | 3300005547 | Unclassified | 886 |
| 160 | Ga0070665_101387001 | 3300005548 | Bacteria | 712 |
| 161 | Ga0068855_100115188 | 3300005563 | Bacteria | 3082 |
| 162 | Ga0068855_100125507 | 3300005563 | Bacteria | 2935 |
| 163 | Ga0068855_101023024 | 3300005563 | Bacteria | 867 |
| 164 | Ga0068855_101363176 | 3300005563 | Unclassified | 732 |
| 165 | Ga0068855_101891262 | 3300005563 | Unclassified | 605 |
| 166 | Ga0070664_100091147 | 3300005564 | Bacteria | 2639 |
| 167 | Ga0070664_100137844 | 3300005564 | Bacteria | 2146 |
| 168 | Ga0070664_100186657 | 3300005564 | Bacteria | 1845 |
| 169 | Ga0070664_100215487 | 3300005564 | Bacteria | 1716 |
| 170 | Ga0070664_100268660 | 3300005564 | Bacteria | 1536 |
| 171 | Ga0070664_100704983 | 3300005564 | Unclassified | 941 |
| 172 | Ga0070664_100817538 | 3300005564 | Unclassified | 872 |
| 173 | Ga0068857_100003188 | 3300005577 | Bacteria | 13600 |
| 174 | Ga0068857_100130586 | 3300005577 | Unclassified | 2266 |
| 175 | Ga0068857_100581944 | 3300005577 | Bacteria | 1057 |
| 176 | Ga0068856_100054678 | 3300005614 | Bacteria | 3939 |
| 177 | Ga0068856_100289006 | 3300005614 | Bacteria | 1656 |
| 178 | Ga0068856_100723210 | 3300005614 | Bacteria | 1016 |
| 179 | Ga0068856_101824872 | 3300005614 | Bacteria | 620 |
| 180 | Ga0070702_100018681 | 3300005615 | Bacteria | 3600 |
| 181 | Ga0070702_101115420 | 3300005615 | Bacteria | 631 |
| 182 | Ga0068852_100007975 | 3300005616 | Bacteria | 7765 |
| 183 | Ga0068852_100094918 | 3300005616 | Bacteria | 2677 |
| 184 | Ga0068852_100580647 | 3300005616 | Bacteria | 1124 |
| 185 | Ga0068852_100842906 | 3300005616 | Bacteria | 932 |
| 186 | Ga0068852_101017064 | 3300005616 | Bacteria | 848 |
| 187 | Ga0068859_100001968 | 3300005617 | Bacteria | 20974 |
| 188 | Ga0068859_100036493 | 3300005617 | Bacteria | 4935 |
| 189 | Ga0068859_100109364 | 3300005617 | Unclassified | 2825 |
| 190 | Ga0068859_100354582 | 3300005617 | Bacteria | 1562 |
| 191 | Ga0068859_101972429 | 3300005617 | Bacteria | 645 |
| 192 | Ga0068864_100003498 | 3300005618 | Bacteria | 12984 |
| 193 | Ga0068864_100177643 | 3300005618 | Bacteria | 1944 |
| 194 | Ga0068864_100260336 | 3300005618 | Unclassified | 1613 |
| 195 | Ga0068864_100341672 | 3300005618 | Unclassified | 1411 |
| 196 | Ga0068864_100516741 | 3300005618 | Bacteria | 1151 |
| 197 | Ga0068866_10285061 | 3300005718 | Unclassified | 1025 |
| 198 | Ga0068851_10539052 | 3300005834 | Unclassified | 704 |
| 199 | Ga0068870_10051829 | 3300005840 | Bacteria | 2174 |
| 200 | Ga0068863_100017790 | 3300005841 | Bacteria | 6802 |
| 201 | Ga0068863_100591328 | 3300005841 | Unclassified | 1098 |
| 202 | Ga0068863_100728263 | 3300005841 | Unclassified | 987 |
| 203 | Ga0068858_100023097 | 3300005842 | Bacteria | 5801 |
| 204 | Ga0068858_100090363 | 3300005842 | Bacteria | 2850 |
| 205 | Ga0068858_100096835 | 3300005842 | Bacteria | 2750 |
| 206 | Ga0068858_100664570 | 3300005842 | Bacteria | 1013 |
| 207 | Ga0068858_101401544 | 3300005842 | Bacteria | 688 |
| 208 | Ga0068860_100125158 | 3300005843 | Bacteria | 2463 |
| 209 | Ga0068860_100613813 | 3300005843 | Unclassified | 1094 |
| 210 | Ga0068860_102097355 | 3300005843 | Bacteria | 587 |
| 211 | Ga0068862_100042802 | 3300005844 | Unclassified | 3859 |
| 212 | Ga0068862_100043702 | 3300005844 | Bacteria | 3820 |
| 213 | Ga0068862_100121228 | 3300005844 | Unclassified | 2305 |
| 214 | Ga0081455_10156263 | 3300005937 | Bacteria | 1753 |
| 215 | Ga0081539_10000104 | 3300005985 | Bacteria | 197478 |
| 216 | Ga0070717_10164669 | 3300006028 | Bacteria | 1925 |
| 217 | Ga0070717_10519430 | 3300006028 | Unclassified | 1077 |
| 218 | Ga0070712_100212715 | 3300006175 | Bacteria | 1526 |
| 219 | Ga0070712_100285982 | 3300006175 | Bacteria | 1330 |
| 220 | Ga0070712_100375803 | 3300006175 | Bacteria | 1169 |
| 221 | Ga0070712_100556864 | 3300006175 | Bacteria | 967 |
| 222 | Ga0068871_100026192 | 3300006358 | Bacteria | 4548 |
| 223 | Ga0068871_100111188 | 3300006358 | Unclassified | 2304 |
| 224 | Ga0068871_101535481 | 3300006358 | Unclassified | 630 |
| 225 | Ga0075428_100147487 | 3300006844 | Bacteria | 2557 |
| 226 | Ga0075428_100470903 | 3300006844 | Bacteria | 1345 |
| 227 | Ga0075431_100053464 | 3300006847 | Unclassified | 4164 |
| 228 | Ga0075431_100180951 | 3300006847 | Unclassified | 2163 |
| 229 | Ga0075434_100499738 | 3300006871 | Bacteria | 1237 |
| 230 | Ga0075434_100616558 | 3300006871 | Bacteria | 1104 |
| 231 | Ga0068865_100035690 | 3300006881 | Bacteria | 3347 |
| 232 | Ga0068865_100588840 | 3300006881 | Bacteria | 939 |
| 233 | Ga0075436_100076052 | 3300006914 | Bacteria | 2325 |
| 234 | Ga0075436_100105513 | 3300006914 | Bacteria | 1965 |
| 235 | Ga0075436_100425164 | 3300006914 | Bacteria | 965 |
| 236 | Ga0075436_100485365 | 3300006914 | Bacteria | 903 |
| 237 | Ga0097620_100001968 | 3300006931 | Bacteria | 20974 |
| 238 | Ga0097620_100036492 | 3300006931 | Bacteria | 4935 |
| 239 | Ga0097620_100109362 | 3300006931 | Unclassified | 2825 |
| 240 | Ga0097620_100354613 | 3300006931 | Bacteria | 1562 |
| 241 | Ga0097620_101972420 | 3300006931 | Bacteria | 645 |
| 242 | Ga0075435_100052188 | 3300007076 | Bacteria | 3295 |
| 243 | Ga0075435_100159233 | 3300007076 | Bacteria | 1901 |
| 244 | Ga0075435_100390412 | 3300007076 | Bacteria | 1196 |
| 245 | Ga0075435_100498057 | 3300007076 | Bacteria | 1053 |
| 246 | Ga0105240_10008178 | 3300009093 | Bacteria | 15002 |
| 247 | Ga0105240_10267296 | 3300009093 | Bacteria | 1971 |
| 248 | Ga0105240_10724576 | 3300009093 | Unclassified | 1083 |
| 249 | Ga0111539_11089178 | 3300009094 | Bacteria | 928 |
| 250 | Ga0105245_10033899 | 3300009098 | Bacteria | 4525 |
| 251 | Ga0105245_10103172 | 3300009098 | Bacteria | 2642 |
| 252 | Ga0105247_10777299 | 3300009101 | Unclassified | 728 |
| 253 | Ga0105243_10793108 | 3300009148 | Unclassified | 933 |
| 254 | Ga0105243_11054141 | 3300009148 | Bacteria | 819 |
| 255 | Ga0105241_10073374 | 3300009174 | Bacteria | 2662 |
| 256 | Ga0105241_10661514 | 3300009174 | Bacteria | 950 |
| 257 | Ga0105242_10037749 | 3300009176 | Bacteria | 3882 |
| 258 | Ga0105242_10452151 | 3300009176 | Bacteria | 1211 |
| 259 | Ga0105242_10513244 | 3300009176 | Bacteria | 1142 |
| 260 | Ga0105242_11111080 | 3300009176 | Bacteria | 805 |
| 261 | Ga0105248_10011323 | 3300009177 | Bacteria | 9831 |
| 262 | Ga0105248_10072370 | 3300009177 | Bacteria | 3874 |
| 263 | Ga0105248_10078912 | 3300009177 | Unclassified | 3700 |
| 264 | Ga0105248_10211730 | 3300009177 | Bacteria | 2184 |
| 265 | Ga0105248_10527922 | 3300009177 | Bacteria | 1331 |
| 266 | Ga0105237_11009645 | 3300009545 | Bacteria | 839 |
| 267 | Ga0105238_10731684 | 3300009551 | Bacteria | 1002 |
| 268 | Ga0105249_10000115 | 3300009553 | Bacteria | 108581 |
| 269 | Ga0105249_10450049 | 3300009553 | Unclassified | 1326 |
| 270 | Ga0105249_10512367 | 3300009553 | Bacteria | 1246 |
| 271 | Ga0105249_11750512 | 3300009553 | Bacteria | 694 |
| 272 | Ga0099796_10257769 | 3300010159 | Unclassified | 726 |
| 273 | Ga0105239_10020162 | 3300010375 | Bacteria | 7355 |
| 274 | Ga0105239_11047806 | 3300010375 | Bacteria | 938 |
| 275 | Ga0105246_10000533 | 3300011119 | Bacteria | 20789 |
| 276 | Ga0105246_10285282 | 3300011119 | Unclassified | 1326 |
| 277 | Ga0105246_11029399 | 3300011119 | Unclassified | 747 |
| 278 | Ga0157373_10075899 | 3300013100 | Bacteria | 2372 |
| 279 | Ga0157373_10082017 | 3300013100 | Bacteria | 2273 |
| 280 | Ga0157373_10284407 | 3300013100 | Unclassified | 1172 |
| 281 | Ga0157373_10384254 | 3300013100 | Bacteria | 1005 |
| 282 | Ga0157373_10386513 | 3300013100 | Bacteria | 1001 |
| 283 | Ga0157373_11476864 | 3300013100 | Bacteria | 518 |
| 284 | Ga0157371_10046464 | 3300013102 | Bacteria | 3088 |
| 285 | Ga0157371_10051360 | 3300013102 | Bacteria | 2930 |
| 286 | Ga0157370_10008754 | 3300013104 | Bacteria | 10881 |
| 287 | Ga0157370_10011411 | 3300013104 | Bacteria | 9295 |
| 288 | Ga0157370_10073976 | 3300013104 | Bacteria | 3214 |
| 289 | Ga0157370_10429733 | 3300013104 | Bacteria | 1214 |
| 290 | Ga0157370_10528998 | 3300013104 | Bacteria | 1082 |
| 291 | Ga0157370_10934539 | 3300013104 | Bacteria | 786 |
| 292 | Ga0157370_11148298 | 3300013104 | Bacteria | 701 |
| 293 | Ga0157370_11389723 | 3300013104 | Bacteria | 632 |
| 294 | Ga0157369_10014454 | 3300013105 | Bacteria | 8912 |
| 295 | Ga0157369_10017798 | 3300013105 | Bacteria | 7977 |
| 296 | Ga0157369_10050550 | 3300013105 | Bacteria | 4501 |
| 297 | Ga0157369_10079483 | 3300013105 | Bacteria | 3512 |
| 298 | Ga0157369_10875500 | 3300013105 | Bacteria | 922 |
| 299 | Ga0157369_11322304 | 3300013105 | Bacteria | 734 |
| 300 | Ga0157374_10007525 | 3300013296 | Bacteria | 9292 |
| 301 | Ga0157374_10760190 | 3300013296 | Bacteria | 984 |
| 302 | Ga0157378_11104443 | 3300013297 | Unclassified | 830 |
| 303 | Ga0163162_10228112 | 3300013306 | Bacteria | 1993 |
| 304 | Ga0163162_10353547 | 3300013306 | Bacteria | 1602 |
| 305 | Ga0163162_10728725 | 3300013306 | Unclassified | 1112 |
| 306 | Ga0163162_10919024 | 3300013306 | Unclassified | 987 |
| 307 | Ga0157372_10004359 | 3300013307 | Bacteria | 15110 |
| 308 | Ga0157372_10013032 | 3300013307 | Bacteria | 8868 |
| 309 | Ga0157372_10015537 | 3300013307 | Bacteria | 8158 |
| 310 | Ga0157372_10037374 | 3300013307 | Bacteria | 5356 |
| 311 | Ga0157372_10174728 | 3300013307 | Bacteria | 2486 |
| 312 | Ga0157372_10247758 | 3300013307 | Bacteria | 2068 |
| 313 | Ga0157372_10805643 | 3300013307 | Unclassified | 1091 |
| 314 | Ga0157372_11339263 | 3300013307 | Bacteria | 826 |
| 315 | Ga0157372_11906903 | 3300013307 | Bacteria | 683 |
| 316 | Ga0157372_12009261 | 3300013307 | Bacteria | 664 |
| 317 | Ga0157375_10019946 | 3300013308 | Bacteria | 6113 |
| 318 | Ga0157375_10038310 | 3300013308 | Bacteria | 4603 |
| 319 | Ga0157375_10047714 | 3300013308 | Bacteria | 4184 |
| 320 | Ga0157375_10208812 | 3300013308 | Bacteria | 2110 |
| 321 | Ga0157375_10504614 | 3300013308 | Unclassified | 1374 |
| 322 | Ga0157375_10818331 | 3300013308 | Unclassified | 1079 |
| 323 | Ga0157375_10950110 | 3300013308 | Bacteria | 1001 |
| 324 | Ga0157375_11842827 | 3300013308 | Unclassified | 718 |
| 325 | Ga0163163_10046544 | 3300014325 | Bacteria | 4261 |
| 326 | Ga0163163_10935451 | 3300014325 | Unclassified | 930 |
| 327 | Ga0163163_11736291 | 3300014325 | Bacteria | 685 |
| 328 | Ga0157377_10005155 | 3300014745 | Bacteria | 6110 |
| 329 | Ga0157377_10055970 | 3300014745 | Bacteria | 2238 |
| 330 | Ga0157377_10117135 | 3300014745 | Unclassified | 1609 |
| 331 | Ga0157379_10124556 | 3300014968 | Bacteria | 2319 |
| 332 | Ga0157379_10608980 | 3300014968 | Unclassified | 1020 |
| 333 | Ga0157379_11309624 | 3300014968 | Bacteria | 700 |
| 334 | Ga0157376_10006603 | 3300014969 | Bacteria | 8207 |
| 335 | Ga0157376_10858650 | 3300014969 | Bacteria | 923 |
| 336 | Ga0157376_10948364 | 3300014969 | Bacteria | 881 |
| 337 | Ga0157376_11049617 | 3300014969 | Unclassified | 839 |
| 338 | Ga0182007_10022680 | 3300015262 | Bacteria | 2214 |
| 339 | Ga0182007_10113149 | 3300015262 | Bacteria | 904 |
| 340 | Ga0206356_10424242 | 3300020070 | Bacteria | 697 |
| 341 | Ga0206352_10989846 | 3300020078 | Bacteria | 715 |
| 342 | Ga0206350_11611277 | 3300020080 | Bacteria | 912 |
| 343 | Ga0207697_10116964 | 3300025315 | Bacteria | 1145 |
| 344 | Ga0207697_10184474 | 3300025315 | Unclassified | 915 |
| 345 | Ga0207682_10072927 | 3300025893 | Bacteria | 1457 |
| 346 | Ga0207692_10187488 | 3300025898 | Bacteria | 1209 |
| 347 | Ga0207692_10532303 | 3300025898 | Unclassified | 749 |
| 348 | Ga0207692_10721631 | 3300025898 | Bacteria | 648 |
| 349 | Ga0207692_10977542 | 3300025898 | Unclassified | 558 |
| 350 | Ga0207688_10040101 | 3300025901 | Bacteria | 2602 |
| 351 | Ga0207688_10305008 | 3300025901 | Unclassified | 974 |
| 352 | Ga0207680_10080016 | 3300025903 | Bacteria | 2051 |
| 353 | Ga0207680_10480743 | 3300025903 | Unclassified | 883 |
| 354 | Ga0207647_10311503 | 3300025904 | Bacteria | 895 |
| 355 | Ga0207699_10507717 | 3300025906 | Unclassified | 871 |
| 356 | Ga0207699_10642903 | 3300025906 | Bacteria | 774 |
| 357 | Ga0207645_10003872 | 3300025907 | Bacteria | 11197 |
| 358 | Ga0207645_10063020 | 3300025907 | Unclassified | 2369 |
| 359 | Ga0207643_10061382 | 3300025908 | Bacteria | 2147 |
| 360 | Ga0207643_10378805 | 3300025908 | Bacteria | 892 |
| 361 | Ga0207705_10007107 | 3300025909 | Bacteria | 8254 |
| 362 | Ga0207705_10028191 | 3300025909 | Bacteria | 4003 |
| 363 | Ga0207705_10052172 | 3300025909 | Bacteria | 2944 |
| 364 | Ga0207705_10128599 | 3300025909 | Bacteria | 1884 |
| 365 | Ga0207705_11421881 | 3300025909 | Unclassified | 527 |
| 366 | Ga0207654_10036126 | 3300025911 | Bacteria | 2758 |
| 367 | Ga0207707_10002146 | 3300025912 | Bacteria | 17846 |
| 368 | Ga0207707_10002891 | 3300025912 | Bacteria | 15329 |
| 369 | Ga0207707_10008528 | 3300025912 | Bacteria | 8885 |
| 370 | Ga0207707_10016136 | 3300025912 | Bacteria | 6514 |
| 371 | Ga0207707_10041205 | 3300025912 | Bacteria | 4033 |
| 372 | Ga0207707_10246032 | 3300025912 | Bacteria | 1554 |
| 373 | Ga0207707_10307852 | 3300025912 | Bacteria | 1369 |
| 374 | Ga0207707_10903195 | 3300025912 | Bacteria | 730 |
| 375 | Ga0207695_10022335 | 3300025913 | Bacteria | 7185 |
| 376 | Ga0207695_10031937 | 3300025913 | Bacteria | 5767 |
| 377 | Ga0207693_10160874 | 3300025915 | Bacteria | 1766 |
| 378 | Ga0207693_10202071 | 3300025915 | Bacteria | 1563 |
| 379 | Ga0207693_10399726 | 3300025915 | Bacteria | 1074 |
| 380 | Ga0207693_10888010 | 3300025915 | Bacteria | 684 |
| 381 | Ga0207663_10024888 | 3300025916 | Bacteria | 3453 |
| 382 | Ga0207663_10723126 | 3300025916 | Bacteria | 789 |
| 383 | Ga0207660_10000668 | 3300025917 | Bacteria | 22904 |
| 384 | Ga0207660_10004932 | 3300025917 | Bacteria | 8694 |
| 385 | Ga0207660_10006680 | 3300025917 | Bacteria | 7477 |
| 386 | Ga0207660_10007146 | 3300025917 | Bacteria | 7230 |
| 387 | Ga0207660_10173324 | 3300025917 | Bacteria | 1671 |
| 388 | Ga0207660_10421980 | 3300025917 | Bacteria | 1076 |
| 389 | Ga0207660_10538051 | 3300025917 | Unclassified | 949 |
| 390 | Ga0207662_10004709 | 3300025918 | Bacteria | 7200 |
| 391 | Ga0207662_10070614 | 3300025918 | Unclassified | 2113 |
| 392 | Ga0207657_10051867 | 3300025919 | Bacteria | 3564 |
| 393 | Ga0207657_10069100 | 3300025919 | Bacteria | 2999 |
| 394 | Ga0207657_10187741 | 3300025919 | Bacteria | 1669 |
| 395 | Ga0207657_10227481 | 3300025919 | Unclassified | 1492 |
| 396 | Ga0207657_10291830 | 3300025919 | Bacteria | 1293 |
| 397 | Ga0207649_10001792 | 3300025920 | Bacteria | 12287 |
| 398 | Ga0207649_10039518 | 3300025920 | Bacteria | 2862 |
| 399 | Ga0207649_10085800 | 3300025920 | Bacteria | 2050 |
| 400 | Ga0207649_10102300 | 3300025920 | Unclassified | 1899 |
| 401 | Ga0207652_10003423 | 3300025921 | Bacteria | 13091 |
| 402 | Ga0207652_10042703 | 3300025921 | Bacteria | 3860 |
| 403 | Ga0207652_10158298 | 3300025921 | Bacteria | 2029 |
| 404 | Ga0207652_10280152 | 3300025921 | Bacteria | 1504 |
| 405 | Ga0207652_10425959 | 3300025921 | Unclassified | 1197 |
| 406 | Ga0207652_10700286 | 3300025921 | Bacteria | 904 |
| 407 | Ga0207652_11610009 | 3300025921 | Bacteria | 554 |
| 408 | Ga0207652_11708284 | 3300025921 | Unclassified | 534 |
| 409 | Ga0207681_10100699 | 3300025923 | Unclassified | 2083 |
| 410 | Ga0207681_10342882 | 3300025923 | Bacteria | 1194 |
| 411 | Ga0207681_10731643 | 3300025923 | Bacteria | 824 |
| 412 | Ga0207694_11085868 | 3300025924 | Bacteria | 677 |
| 413 | Ga0207650_10005580 | 3300025925 | Bacteria | 8591 |
| 414 | Ga0207650_10096560 | 3300025925 | Unclassified | 2267 |
| 415 | Ga0207659_10013350 | 3300025926 | Bacteria | 5257 |
| 416 | Ga0207659_10025849 | 3300025926 | Bacteria | 3952 |
| 417 | Ga0207659_10075624 | 3300025926 | Bacteria | 2472 |
| 418 | Ga0207659_11229672 | 3300025926 | Unclassified | 644 |
| 419 | Ga0207687_10118162 | 3300025927 | Unclassified | 1979 |
| 420 | Ga0207700_10088817 | 3300025928 | Bacteria | 2434 |
| 421 | Ga0207700_10108769 | 3300025928 | Unclassified | 2227 |
| 422 | Ga0207700_10275037 | 3300025928 | Bacteria | 1446 |
| 423 | Ga0207700_10594852 | 3300025928 | Bacteria | 984 |
| 424 | Ga0207664_10228072 | 3300025929 | Bacteria | 1618 |
| 425 | Ga0207644_10126985 | 3300025931 | Bacteria | 1948 |
| 426 | Ga0207644_10766818 | 3300025931 | Unclassified | 806 |
| 427 | Ga0207690_10003494 | 3300025932 | Bacteria | 9371 |
| 428 | Ga0207690_10048007 | 3300025932 | Bacteria | 2836 |
| 429 | Ga0207690_10052981 | 3300025932 | Bacteria | 2720 |
| 430 | Ga0207690_10639805 | 3300025932 | Bacteria | 871 |
| 431 | Ga0207706_10015214 | 3300025933 | Bacteria | 6961 |
| 432 | Ga0207706_10101881 | 3300025933 | Bacteria | 2526 |
| 433 | Ga0207706_10495699 | 3300025933 | Unclassified | 1055 |
| 434 | Ga0207686_10013975 | 3300025934 | Bacteria | 4457 |
| 435 | Ga0207686_10021299 | 3300025934 | Unclassified | 3719 |
| 436 | Ga0207686_10724998 | 3300025934 | Unclassified | 792 |
| 437 | Ga0207686_10735967 | 3300025934 | Bacteria | 786 |
| 438 | Ga0207670_10122881 | 3300025936 | Bacteria | 1890 |
| 439 | Ga0207670_10646978 | 3300025936 | Bacteria | 871 |
| 440 | Ga0207670_10693987 | 3300025936 | Unclassified | 842 |
| 441 | Ga0207669_10094194 | 3300025937 | Bacteria | 1959 |
| 442 | Ga0207704_10009122 | 3300025938 | Bacteria | 4772 |
| 443 | Ga0207704_10676377 | 3300025938 | Bacteria | 852 |
| 444 | Ga0207691_10025086 | 3300025940 | Bacteria | 5600 |
| 445 | Ga0207691_10116828 | 3300025940 | Bacteria | 2367 |
| 446 | Ga0207691_10132033 | 3300025940 | Bacteria | 2205 |
| 447 | Ga0207691_10244680 | 3300025940 | Unclassified | 1550 |
| 448 | Ga0207691_10264695 | 3300025940 | Bacteria | 1481 |
| 449 | Ga0207691_10402150 | 3300025940 | Bacteria | 1168 |
| 450 | Ga0207691_10714684 | 3300025940 | Unclassified | 844 |
| 451 | Ga0207711_10016049 | 3300025941 | Bacteria | 6214 |
| 452 | Ga0207711_10077486 | 3300025941 | Unclassified | 2898 |
| 453 | Ga0207711_10232911 | 3300025941 | Bacteria | 1687 |
| 454 | Ga0207711_10254469 | 3300025941 | Bacteria | 1613 |
| 455 | Ga0207711_10402343 | 3300025941 | Bacteria | 1272 |
| 456 | Ga0207689_10000838 | 3300025942 | Bacteria | 29648 |
| 457 | Ga0207689_10393465 | 3300025942 | Unclassified | 1155 |
| 458 | Ga0207661_10002707 | 3300025944 | Bacteria | 12194 |
| 459 | Ga0207661_10028371 | 3300025944 | Bacteria | 4286 |
| 460 | Ga0207661_10032381 | 3300025944 | Bacteria | 4049 |
| 461 | Ga0207661_10062899 | 3300025944 | Bacteria | 3004 |
| 462 | Ga0207661_10065056 | 3300025944 | Bacteria | 2959 |
| 463 | Ga0207661_10077152 | 3300025944 | Bacteria | 2739 |
| 464 | Ga0207661_10387357 | 3300025944 | Bacteria | 1266 |
| 465 | Ga0207661_10476863 | 3300025944 | Bacteria | 1138 |
| 466 | Ga0207679_10004107 | 3300025945 | Bacteria | 9036 |
| 467 | Ga0207679_10031754 | 3300025945 | Bacteria | 3699 |
| 468 | Ga0207679_10242689 | 3300025945 | Bacteria | 1527 |
| 469 | Ga0207679_10401590 | 3300025945 | Bacteria | 1206 |
| 470 | Ga0207679_10804485 | 3300025945 | Unclassified | 857 |
| 471 | Ga0207679_11423032 | 3300025945 | Unclassified | 636 |
| 472 | Ga0207667_10355830 | 3300025949 | Bacteria | 1493 |
| 473 | Ga0207667_10840176 | 3300025949 | Unclassified | 913 |
| 474 | Ga0207667_11051448 | 3300025949 | Bacteria | 799 |
| 475 | Ga0207667_11159274 | 3300025949 | Bacteria | 754 |
| 476 | Ga0207651_10026293 | 3300025960 | Bacteria | 3633 |
| 477 | Ga0207651_10800207 | 3300025960 | Bacteria | 836 |
| 478 | Ga0207651_10800652 | 3300025960 | Unclassified | 835 |
| 479 | Ga0207651_10988933 | 3300025960 | Bacteria | 751 |
| 480 | Ga0207712_10000261 | 3300025961 | Bacteria | 51172 |
| 481 | Ga0207712_10341306 | 3300025961 | Unclassified | 1242 |
| 482 | Ga0207712_10630381 | 3300025961 | Bacteria | 930 |
| 483 | Ga0207640_10317831 | 3300025981 | Bacteria | 1238 |
| 484 | Ga0207640_11169943 | 3300025981 | Bacteria | 683 |
| 485 | Ga0207658_10004283 | 3300025986 | Bacteria | 9944 |
| 486 | Ga0207658_10075418 | 3300025986 | Bacteria | 2566 |
| 487 | Ga0207658_10172563 | 3300025986 | Bacteria | 1783 |
| 488 | Ga0207658_10445610 | 3300025986 | Unclassified | 1145 |
| 489 | Ga0207658_10932462 | 3300025986 | Bacteria | 791 |
| 490 | Ga0207658_11262531 | 3300025986 | Unclassified | 675 |
| 491 | Ga0207677_10051698 | 3300026023 | Bacteria | 2787 |
| 492 | Ga0207677_10327514 | 3300026023 | Unclassified | 1275 |
| 493 | Ga0207703_10018395 | 3300026035 | Bacteria | 5456 |
| 494 | Ga0207703_10188836 | 3300026035 | Bacteria | 1823 |
| 495 | Ga0207639_10225215 | 3300026041 | Unclassified | 1622 |
| 496 | Ga0207639_10249748 | 3300026041 | Bacteria | 1546 |
| 497 | Ga0207639_10663660 | 3300026041 | Bacteria | 965 |
| 498 | Ga0207678_10538115 | 3300026067 | Bacteria | 1021 |
| 499 | Ga0207678_10772993 | 3300026067 | Unclassified | 847 |
| 500 | Ga0207708_10378559 | 3300026075 | Bacteria | 1167 |
| 501 | Ga0207708_10665233 | 3300026075 | Unclassified | 888 |
| 502 | Ga0207702_10054033 | 3300026078 | Bacteria | 3402 |
| 503 | Ga0207702_10284363 | 3300026078 | Unclassified | 1565 |
| 504 | Ga0207702_10374612 | 3300026078 | Bacteria | 1368 |
| 505 | Ga0207641_10010846 | 3300026088 | Bacteria | 7466 |
| 506 | Ga0207648_10020613 | 3300026089 | Bacteria | 5935 |
| 507 | Ga0207648_10315216 | 3300026089 | Bacteria | 1405 |
| 508 | Ga0207648_10510057 | 3300026089 | Unclassified | 1101 |
| 509 | Ga0207676_10038651 | 3300026095 | Bacteria | 3644 |
| 510 | Ga0207676_10176016 | 3300026095 | Bacteria | 1869 |
| 511 | Ga0207676_10219267 | 3300026095 | Bacteria | 1693 |
| 512 | Ga0207676_10412359 | 3300026095 | Unclassified | 1265 |
| 513 | Ga0207674_10001189 | 3300026116 | Bacteria | 33857 |
| 514 | Ga0207674_10002932 | 3300026116 | Bacteria | 21199 |
| 515 | Ga0207674_10147711 | 3300026116 | Unclassified | 2309 |
| 516 | Ga0207674_10288620 | 3300026116 | Bacteria | 1589 |
| 517 | Ga0207674_10324052 | 3300026116 | Unclassified | 1490 |
| 518 | Ga0207675_100088311 | 3300026118 | Bacteria | 2912 |
| 519 | Ga0207675_100433668 | 3300026118 | Unclassified | 1300 |
| 520 | Ga0207675_100757380 | 3300026118 | Unclassified | 983 |
| 521 | Ga0207683_10283311 | 3300026121 | Bacteria | 1514 |
| 522 | Ga0207683_10400206 | 3300026121 | Bacteria | 1263 |
| 523 | Ga0207698_10006278 | 3300026142 | Bacteria | 7397 |
| 524 | Ga0207698_10504270 | 3300026142 | Bacteria | 1178 |
| 525 | Ga0207698_10664933 | 3300026142 | Bacteria | 1033 |
| 526 | Ga0207698_10803319 | 3300026142 | Bacteria | 943 |
| 527 | Ga0207698_12386460 | 3300026142 | Bacteria | 540 |
| 528 | Ga0268266_11334632 | 3300028379 | Bacteria | 693 |
| 529 | Ga0268265_10271482 | 3300028380 | Bacteria | 1513 |
| 530 | Ga0268264_10029590 | 3300028381 | Bacteria | 4487 |
| 531 | Ga0268264_10388169 | 3300028381 | Bacteria | 1339 |
| 532 | Ga0268264_10616745 | 3300028381 | Bacteria | 1070 |
| 533 | Ga0268264_10759724 | 3300028381 | Unclassified | 966 |
| 534 | Ga0265332_10027215 | 3300031238 | Bacteria | 2505 |
| 535 | Ga0265332_10034489 | 3300031238 | Bacteria | 2199 |
| 536 | Ga0265340_10239648 | 3300031247 | Bacteria | 809 |
| 537 | Ga0265331_10071106 | 3300031250 | Unclassified | 1628 |
| 538 | Ga0265327_10017353 | 3300031251 | Bacteria | 4521 |
| 539 | Ga0307408_100006742 | 3300031548 | Bacteria | 7610 |
| 540 | Ga0307408_100235595 | 3300031548 | Unclassified | 1502 |
| 541 | Ga0307408_100524586 | 3300031548 | Bacteria | 1041 |
| 542 | Ga0265314_10005150 | 3300031711 | Bacteria | 11881 |
| 543 | Ga0265314_10101772 | 3300031711 | Unclassified | 1845 |
| 544 | Ga0265342_10131775 | 3300031712 | Bacteria | 1400 |
| 545 | Ga0307405_10000648 | 3300031731 | Bacteria | 13427 |
| 546 | Ga0307405_10651374 | 3300031731 | Unclassified | 866 |
| 547 | Ga0307413_10000361 | 3300031824 | Bacteria | 14528 |
| 548 | Ga0307413_10434584 | 3300031824 | Bacteria | 1037 |
| 549 | Ga0307413_10800301 | 3300031824 | Bacteria | 792 |
| 550 | Ga0307410_10000204 | 3300031852 | Bacteria | 22235 |
| 551 | Ga0307410_10199084 | 3300031852 | Bacteria | 1528 |
| 552 | Ga0307410_10350542 | 3300031852 | Bacteria | 1179 |
| 553 | Ga0307406_10011710 | 3300031901 | Bacteria | 4979 |
| 554 | Ga0307406_10660845 | 3300031901 | Bacteria | 868 |
| 555 | Ga0307406_10809913 | 3300031901 | Bacteria | 791 |
| 556 | Ga0307407_10000173 | 3300031903 | Bacteria | 19580 |
| 557 | Ga0307412_10150855 | 3300031911 | Bacteria | 1715 |
| 558 | Ga0307412_10733183 | 3300031911 | Bacteria | 851 |
| 559 | Ga0307409_100000064 | 3300031995 | Bacteria | 38623 |
| 560 | Ga0307409_100040901 | 3300031995 | Bacteria | 3457 |
| 561 | Ga0307409_101092686 | 3300031995 | Unclassified | 818 |
| 562 | Ga0307416_100174869 | 3300032002 | Bacteria | 2004 |
| 563 | Ga0307416_100254469 | 3300032002 | Bacteria | 1712 |
| 564 | Ga0307416_100541864 | 3300032002 | Unclassified | 1236 |
| 565 | Ga0307416_101914799 | 3300032002 | Unclassified | 696 |
| 566 | Ga0307414_10016841 | 3300032004 | Bacteria | 4458 |
| 567 | Ga0307411_10000371 | 3300032005 | Bacteria | 15251 |
| 568 | Ga0307415_100004545 | 3300032126 | Bacteria | 7226 |
| 569 | Ga0307415_100084953 | 3300032126 | Bacteria | 2272 |
| 570 | Ga0307415_100235040 | 3300032126 | Bacteria | 1479 |
| 571 | Ga0307415_100240421 | 3300032126 | Bacteria | 1464 |
| 572 | Ga0373934_0000634 | 3300035086 | Bacteria | 12395 |
| 573 | Ga0373934_0192254 | 3300035086 | Bacteria | 840 |
| 574 | Ga0373923_0115703 | 3300035111 | Bacteria | 1194 |
| 575 | Ga0373953_0014611 | 3300035117 | Bacteria | 2828 |
| 576 | Ga0373953_0167900 | 3300035117 | Unclassified | 944 |
| 577 | Ga0373954_0037354 | 3300035118 | Bacteria | 2257 |
| 578 | Ga0373956_0001499 | 3300035119 | Bacteria | 9653 |
| 579 | Ga0373956_0032412 | 3300035119 | Bacteria | 2292 |
| 580 | Ga0373957_0012172 | 3300035120 | Bacteria | 2890 |
| 581 | Ga0373957_0076576 | 3300035120 | Bacteria | 1315 |
| 582 | Ga0373943_0215904 | 3300035170 | Bacteria | 1067 |
| 583 | Ga0373943_0391351 | 3300035170 | Unclassified | 801 |
| 584 | Ga0373946_0296483 | 3300035171 | Bacteria | 799 |
| 585 | Ga0373955_0005518 | 3300035172 | Bacteria | 5687 |
| 586 | Ga0373955_0015819 | 3300035172 | Bacteria | 3700 |
| 587 | Ga0373955_0024936 | 3300035172 | Bacteria | 3064 |
| 588 | Ga0373931_0530032 | 3300035691 | Bacteria | 763 |
| 589 | Ga0373935_0049313 | 3300035692 | Unclassified | 2668 |
| 590 | Ga0373927_0162312 | 3300035695 | Bacteria | 1464 |
| 591 | Ga0373927_0177677 | 3300035695 | Bacteria | 1396 |
| 592 | Ga0373933_0008374 | 3300035724 | Bacteria | 5647 |
| 593 | Ga0373933_0049512 | 3300035724 | Unclassified | 2505 |
| 594 | Ga0373937_0002914 | 3300036401 | Bacteria | 14299 |
| 595 | Ga0373937_0018683 | 3300036401 | Bacteria | 6194 |
| 596 | Ga0373937_0033508 | 3300036401 | Bacteria | 4665 |
| 597 | Ga0373937_0055491 | 3300036401 | Bacteria | 3637 |
| 598 | Ga0373925_0073606 | 3300037068 | Bacteria | 2586 |
| 599 | Ga0395899_0003367 | 3300037312 | Bacteria | 12685 |
| 600 | Ga0395900_0068956 | 3300037418 | Bacteria | 3634 |
| 601 | Ga0395905_0024256 | 3300037471 | Bacteria | 5725 |
| 602 | Ga0436364_0474148 | 3300037853 | Bacteria | 992 |
| 603 | Ga0395901_0003407 | 3300038443 | Bacteria | 16018 |
| 604 | Ga0436365_1643073 | 3300039437 | Archaea | 627 |
| 605 | Ga0451802_1558764 | 3300041460 | Bacteria | 928 |
| 606 | Ga0451807_0755438 | 3300041486 | Unclassified | 816 |
| 607 | Ga0439448_0074585 | 3300042005 | Bacteria | 1133 |
| 608 | Ga0450894_029478 | 3300042131 | Unclassified | 762 |
| 609 | Ga0439434_0022152 | 3300042435 | Bacteria | 1910 |
| 610 | Ga0451577_0017882 | 3300042876 | Bacteria | 6541 |
| 611 | Ga0451577_0953976 | 3300042876 | Bacteria | 771 |
| 612 | Ga0439440_0078589 | 3300042993 | Bacteria | 869 |
| 613 | Ga0466966_0752680 | 3300044684 | Bacteria | 587 |
| 614 | Ga0453684_0003703 | 3300044712 | Bacteria | 33868 |
| 615 | Ga0466968_0406693 | 3300044735 | Bacteria | 668 |
| 616 | Ga0466957_0313933 | 3300044842 | Bacteria | 1056 |
| 617 | Ga0466957_0753834 | 3300044842 | Unclassified | 689 |
| 618 | Ga0451576_0025244 | 3300045051 | Bacteria | 6404 |
| 619 | Ga0451576_0392870 | 3300045051 | Bacteria | 1454 |
| 620 | Ga0451576_0637498 | 3300045051 | Bacteria | 1120 |
| 621 | Ga0466958_0024376 | 3300045836 | Unclassified | 3560 |
| 622 | Ga0466958_0736516 | 3300045836 | Bacteria | 642 |
| 623 | Ga0466967_0677241 | 3300045976 | Bacteria | 1021 |
| 624 | Ga0466967_1266534 | 3300045976 | Bacteria | 734 |
| 625 | Ga0495592_0017200 | 3300046454 | Bacteria | 5491 |
| 626 | Ga0495603_0020192 | 3300046455 | Bacteria | 4038 |
| 627 | Ga0495629_0029745 | 3300046459 | Bacteria | 3873 |
| 628 | Ga0495629_0196473 | 3300046459 | Bacteria | 1395 |
| 629 | Ga0495629_0879691 | 3300046459 | Bacteria | 588 |
| 630 | Ga0495651_0001301 | 3300046462 | Bacteria | 19332 |
| 631 | Ga0495651_0012957 | 3300046462 | Bacteria | 6444 |
| 632 | Ga0495651_0036726 | 3300046462 | Bacteria | 3814 |
| 633 | Ga0495653_0003982 | 3300046463 | Bacteria | 11925 |
| 634 | Ga0495653_0005425 | 3300046463 | Bacteria | 10383 |
| 635 | Ga0495653_0042851 | 3300046463 | Bacteria | 3522 |
| 636 | Ga0495653_0411169 | 3300046463 | Bacteria | 858 |
| 637 | Ga0495580_0001189 | 3300046472 | Bacteria | 22911 |
| 638 | Ga0495580_0678661 | 3300046472 | Bacteria | 676 |
| 639 | Ga0495582_0181429 | 3300046473 | Bacteria | 1199 |
| 640 | Ga0495639_0063015 | 3300046475 | Bacteria | 1702 |
| 641 | Ga0495639_0064663 | 3300046475 | Bacteria | 1682 |
| 642 | Ga0495662_0092708 | 3300046476 | Bacteria | 1474 |
| 643 | Ga0495662_0180659 | 3300046476 | Unclassified | 1040 |
| 644 | Ga0495664_0016717 | 3300046477 | Bacteria | 4185 |
| 645 | Ga0495664_0064249 | 3300046477 | Bacteria | 2188 |
| 646 | Ga0495594_0619531 | 3300046499 | Unclassified | 613 |
| 647 | Ga0495594_0767002 | 3300046499 | Bacteria | 544 |
| 648 | Ga0495608_0024437 | 3300046511 | Bacteria | 4133 |
| 649 | Ga0495608_0024921 | 3300046511 | Bacteria | 4087 |
| 650 | Ga0495608_0065126 | 3300046511 | Bacteria | 2387 |
| 651 | Ga0495608_0119141 | 3300046511 | Bacteria | 1693 |
| 652 | Ga0495618_0030082 | 3300046514 | Bacteria | 3390 |
| 653 | Ga0495618_0300625 | 3300046514 | Bacteria | 997 |
| 654 | Ga0495618_0371045 | 3300046514 | Unclassified | 879 |
| 655 | Ga0495628_0000494 | 3300046516 | Bacteria | 36135 |
| 656 | Ga0495628_0037014 | 3300046516 | Bacteria | 3913 |
| 657 | Ga0495628_0061517 | 3300046516 | Bacteria | 2944 |
| 658 | Ga0495628_0227716 | 3300046516 | Unclassified | 1398 |
| 659 | Ga0495628_0239300 | 3300046516 | Bacteria | 1358 |
| 660 | Ga0495630_0008617 | 3300046517 | Bacteria | 7319 |
| 661 | Ga0495630_0039168 | 3300046517 | Bacteria | 3545 |
| 662 | Ga0495630_0155719 | 3300046517 | Bacteria | 1739 |
| 663 | Ga0495630_0242162 | 3300046517 | Unclassified | 1378 |
| 664 | Ga0495644_0146542 | 3300046523 | Bacteria | 903 |
| 665 | Ga0495663_0143727 | 3300046525 | Unclassified | 811 |
| 666 | Ga0495666_0052197 | 3300046526 | Bacteria | 1963 |
| 667 | Ga0495652_0004937 | 3300046529 | Bacteria | 12645 |
| 668 | Ga0495652_0018334 | 3300046529 | Bacteria | 6242 |
| 669 | Ga0495652_0032147 | 3300046529 | Bacteria | 4590 |
| 670 | Ga0495652_0077805 | 3300046529 | Unclassified | 2748 |
| 671 | Ga0495665_0016052 | 3300046531 | Bacteria | 4035 |
| 672 | Ga0495640_0075659 | 3300046533 | Bacteria | 2248 |
| 673 | Ga0495640_0147339 | 3300046533 | Bacteria | 1514 |
| 674 | Ga0495586_0181927 | 3300046535 | Bacteria | 1189 |
| 675 | Ga0495587_0000269 | 3300046536 | Bacteria | 37262 |
| 676 | Ga0495587_0000334 | 3300046536 | Bacteria | 33589 |
| 677 | Ga0495587_0004284 | 3300046536 | Bacteria | 9422 |
| 678 | Ga0495598_0240935 | 3300046537 | Bacteria | 667 |
| 679 | Ga0495621_0020889 | 3300046539 | Bacteria | 2153 |
| 680 | Ga0495621_0174196 | 3300046539 | Unclassified | 856 |
| 681 | Ga0495645_0000918 | 3300046543 | Bacteria | 20080 |
| 682 | Ga0495645_0001039 | 3300046543 | Bacteria | 18908 |
| 683 | Ga0495645_0005490 | 3300046543 | Bacteria | 8712 |
| 684 | Ga0495645_0247572 | 3300046543 | Bacteria | 1186 |
| 685 | Ga0495645_0606080 | 3300046543 | Bacteria | 673 |
| 686 | Ga0495667_0003294 | 3300046559 | Bacteria | 10826 |
| 687 | Ga0495667_0022638 | 3300046559 | Bacteria | 4234 |
| 688 | Ga0495667_0113936 | 3300046559 | Unclassified | 1747 |
| 689 | Ga0495667_0283353 | 3300046559 | Bacteria | 1052 |
| 690 | Ga0495667_0838538 | 3300046559 | Bacteria | 566 |
| 691 | Ga0495656_0027613 | 3300046615 | Unclassified | 2269 |
| 692 | Ga0495634_0051663 | 3300046642 | Bacteria | 2758 |
| 693 | Ga0495634_0134623 | 3300046642 | Bacteria | 1573 |
| 694 | Ga0495635_0000200 | 3300046663 | Bacteria | 37911 |
| 695 | Ga0495635_0028291 | 3300046663 | Bacteria | 3896 |
| 696 | Ga0495635_0063141 | 3300046663 | Bacteria | 2544 |
| 697 | Ga0495635_0136879 | 3300046663 | Bacteria | 1669 |
| 698 | Ga0495588_0118581 | 3300046674 | Unclassified | 1395 |
| 699 | Ga0495657_0001237 | 3300046675 | Bacteria | 22362 |
| 700 | Ga0495657_0036360 | 3300046675 | Bacteria | 3404 |
| 701 | Ga0495657_0062960 | 3300046675 | Bacteria | 2449 |
| 702 | Ga0495599_0000385 | 3300046678 | Bacteria | 25410 |
| 703 | Ga0495599_0001207 | 3300046678 | Bacteria | 14651 |
| 704 | Ga0495599_0012015 | 3300046678 | Bacteria | 5328 |
| 705 | Ga0495599_0013493 | 3300046678 | Bacteria | 5048 |
| 706 | Ga0495599_0018564 | 3300046678 | Bacteria | 4333 |
| 707 | Ga0495623_0000156 | 3300046679 | Bacteria | 42279 |
| 708 | Ga0495623_0005693 | 3300046679 | Bacteria | 8137 |
| 709 | Ga0495623_0174144 | 3300046679 | Bacteria | 1255 |
| 710 | Ga0495646_0068047 | 3300046680 | Bacteria | 2103 |
| 711 | Ga0495658_0113971 | 3300046683 | Bacteria | 1628 |
| 712 | Ga0495658_0180615 | 3300046683 | Bacteria | 1309 |
| 713 | Ga0495658_0758085 | 3300046683 | Bacteria | 622 |
| 714 | Ga0495613_0091423 | 3300046689 | Bacteria | 2204 |
| 715 | Ga0495613_0189445 | 3300046689 | Bacteria | 1454 |
| 716 | Ga0495613_0240738 | 3300046689 | Bacteria | 1265 |
| 717 | Ga0495600_0001690 | 3300046809 | Bacteria | 12334 |
| 718 | Ga0495600_0057426 | 3300046809 | Unclassified | 2542 |
| 719 | Ga0495581_0031911 | 3300047315 | Bacteria | 3052 |
| 720 | Ga0495581_0160232 | 3300047315 | Bacteria | 1315 |
| 721 | Ga0495581_0200290 | 3300047315 | Bacteria | 1168 |
| 722 | Ga0495581_0250423 | 3300047315 | Bacteria | 1036 |
| 723 | Ga0495604_0008848 | 3300047317 | Bacteria | 7957 |
| 724 | Ga0495604_0095343 | 3300047317 | Unclassified | 2198 |
| 725 | Ga0495604_0121186 | 3300047317 | Bacteria | 1893 |
| 726 | Ga0495604_0195203 | 3300047317 | Unclassified | 1408 |
| 727 | Ga0495604_0334362 | 3300047317 | Unclassified | 1010 |
| 728 | Ga0495604_0647415 | 3300047317 | Bacteria | 674 |
| 729 | Ga0495674_0038246 | 3300047319 | Bacteria | 4308 |
| 730 | Ga0495674_0040546 | 3300047319 | Bacteria | 4165 |
| 731 | Ga0495674_0085270 | 3300047319 | Bacteria | 2706 |
| 732 | Ga0495680_0019597 | 3300047322 | Bacteria | 5707 |
| 733 | Ga0495680_0031505 | 3300047322 | Bacteria | 4315 |
| 734 | Ga0495680_0127885 | 3300047322 | Bacteria | 1869 |
| 735 | Ga0495680_0249145 | 3300047322 | Bacteria | 1259 |
| 736 | Ga0495675_0003343 | 3300047444 | Bacteria | 9656 |
| 737 | Ga0495675_0009279 | 3300047444 | Bacteria | 6120 |
| 738 | Ga0495675_0016554 | 3300047444 | Bacteria | 4664 |
| 739 | Ga0495675_0172950 | 3300047444 | Bacteria | 1326 |
| 740 | Ga0495675_0353589 | 3300047444 | Unclassified | 864 |
| 741 | Ga0495684_0002113 | 3300047471 | Bacteria | 15945 |
| 742 | Ga0495684_0003435 | 3300047471 | Bacteria | 12412 |
| 743 | Ga0495684_0089155 | 3300047471 | Unclassified | 2337 |
| 744 | Ga0495593_0073763 | 3300047673 | Bacteria | 1770 |
| 745 | Ga0495593_0103671 | 3300047673 | Unclassified | 1457 |
| 746 | Ga0495602_0005326 | 3300048088 | Bacteria | 13502 |
| 747 | Ga0495602_0019916 | 3300048088 | Bacteria | 6644 |
| 748 | Ga0495602_0095084 | 3300048088 | Bacteria | 2461 |
| 749 | Ga0496101_0100195 | 3300048904 | Bacteria | 2167 |
| 750 | Ga0496102_0651698 | 3300048905 | Bacteria | 976 |
| 751 | Ga0496104_0035102 | 3300048907 | Bacteria | 4681 |
| 752 | Ga0496105_0055635 | 3300048908 | Bacteria | 3267 |
| 753 | Ga0496105_0599479 | 3300048908 | Bacteria | 855 |
| 754 | Ga0496106_0150431 | 3300048909 | Unclassified | 1836 |
| 755 | Ga0496107_0716961 | 3300048910 | Unclassified | 735 |
| 756 | Ga0496108_0546966 | 3300048911 | Bacteria | 1010 |
| 757 | Ga0496108_0770483 | 3300048911 | Bacteria | 831 |
| 758 | Ga0496109_0241694 | 3300048912 | Bacteria | 1699 |
| 759 | Ga0496109_0289985 | 3300048912 | Unclassified | 1543 |
| 760 | Ga0496111_1019318 | 3300048914 | Unclassified | 593 |
| 761 | Ga0496112_0000196 | 3300048915 | Bacteria | 39516 |
| 762 | Ga0496113_0239880 | 3300048916 | Bacteria | 1446 |
| 763 | Ga0496113_0263046 | 3300048916 | Bacteria | 1378 |
| 764 | Ga0496114_0366781 | 3300048917 | Bacteria | 1274 |
| 765 | Ga0501032_0174633 | 3300049569 | Bacteria | 1408 |
| 766 | Ga0501036_0282575 | 3300049572 | Bacteria | 1389 |
| 767 | Ga0501037_0504815 | 3300049573 | Bacteria | 820 |
| 768 | Ga0501038_0193202 | 3300049574 | Bacteria | 1637 |
| 769 | Ga0501038_0402349 | 3300049574 | Unclassified | 1059 |
| 770 | Ga0501041_1086969 | 3300049577 | Bacteria | 515 |
| 771 | Ga0501043_0767555 | 3300049579 | Unclassified | 700 |
| 772 | Ga0501070_0162054 | 3300049586 | Bacteria | 1843 |
| 773 | Ga0501071_0202127 | 3300049587 | Bacteria | 1493 |
| 774 | Ga0501072_0398973 | 3300049588 | Bacteria | 1091 |
| 775 | Ga0501079_0326140 | 3300049741 | Bacteria | 1202 |
| 776 | Ga0501080_0786957 | 3300049742 | Bacteria | 835 |
| 777 | Ga0501044_1212767 | 3300049823 | Bacteria | 622 |
| 778 | nmdc:mga0qj67_331962_c1 | 3300050509 | Bacteria | 1230 |
| 779 | nmdc:mga06r32_1117684_c1 | 3300050510 | Bacteria | 737 |
| 780 | nmdc:mga06r32_113314_c1 | 3300050510 | Bacteria | 2669 |
| 781 | nmdc:mga0n895_1500556_c1 | 3300050512 | Unclassified | 640 |
| 782 | nmdc:mga0n895_158722_c1 | 3300050512 | Bacteria | 2293 |
| 783 | nmdc:mga0rr50_41952_c1 | 3300050513 | Bacteria | 3338 |
| 784 | nmdc:mga08x19_192485_c1 | 3300050514 | Bacteria | 1396 |
| 785 | nmdc:mga08x19_93792_c1 | 3300050514 | Bacteria | 1984 |
| 786 | Ga0495601_0029750 | 3300053077 | Bacteria | 3390 |
| 787 | Ga0495601_0057136 | 3300053077 | Bacteria | 2472 |
| 788 | Ga0495612_0008751 | 3300053078 | Bacteria | 4106 |
| 789 | Ga0495612_0023851 | 3300053078 | Bacteria | 2456 |
| 790 | Ga0495595_0052096 | 3300053084 | Bacteria | 1898 |
| 791 | Ga0495619_0024498 | 3300053085 | Unclassified | 3871 |
| 792 | Ga0495619_0056264 | 3300053085 | Bacteria | 2607 |
| 793 | Ga0495619_0997781 | 3300053085 | Bacteria | 560 |
| 794 | Ga0590071_046608 | 3300059421 | Bacteria | 1047 |
| 795 | Ga0590074_034929 | 3300059423 | Bacteria | 895 |
| 796 | Ga0587090_087411 | 3300059510 | Bacteria | 634 |
| 797 | Ga0070699_100576254 | |||
| 798 | JGI24752J21851_1032930 | |||
| 799 | JGI25406J46586_10032351 | |||
| 800 | Ga0058863_10125579 | |||
| 801 | Ga0058863_11665452 | |||
| 802 | Ga0058861_10000584 | |||
| 803 | Ga0058861_10046646 | |||
| 804 | Ga0058861_11593278 | |||
| 805 | Ga0058861_12032014 | |||
| 806 | Ga0065712_10074141 | |||
| 807 | Ga0065715_10169908 | |||
| 808 | Ga0065715_10196773 | |||
| 809 | Ga0070658_10004996 | |||
| 810 | Ga0070658_10005423 | |||
| 811 | Ga0070658_10005604 | |||
| 812 | Ga0070658_10108991 | |||
| 813 | Ga0070658_10177326 | |||
| 814 | Ga0070658_10639631 | |||
| 815 | Ga0070676_10057744 | |||
| 816 | Ga0070676_10078553 | |||
| 817 | Ga0070683_100000681 | |||
| 818 | Ga0070683_100012618 | |||
| 819 | Ga0070683_100025497 | |||
| 820 | Ga0070683_100028687 | |||
| 821 | Ga0070683_100146612 | |||
| 822 | Ga0070683_100207460 | |||
| 823 | Ga0070683_100227384 | |||
| 824 | Ga0070690_100025728 | |||
| 825 | Ga0070670_100008651 | |||
| 826 | Ga0070670_100200388 | |||
| 827 | Ga0068869_100000336 | |||
| 828 | Ga0068869_100718121 | |||
| 829 | Ga0070666_10110846 | |||
| 830 | Ga0070666_10339171 | |||
| 831 | Ga0070666_10503018 | |||
| 832 | Ga0070666_10548670 | |||
| 833 | Ga0070680_100000247 | |||
| 834 | Ga0070680_100005105 | |||
| 835 | Ga0070680_100006242 | |||
| 836 | Ga0070680_100049309 | |||
| 837 | Ga0070680_100352849 | |||
| 838 | Ga0070680_100615808 | |||
| 839 | Ga0070682_100001941 | |||
| 840 | Ga0070682_100861849 | |||
| 841 | Ga0068868_100109440 | |||
| 842 | Ga0068868_100557281 | |||
| 843 | Ga0068868_100647303 | |||
| 844 | Ga0070660_100008200 | |||
| 845 | Ga0070660_100131677 | |||
| 846 | Ga0070660_100311438 | |||
| 847 | Ga0070689_100020073 | |||
| 848 | Ga0070689_100194013 | |||
| 849 | Ga0070689_100650956 | |||
| 850 | Ga0070687_100010494 | |||
| 851 | Ga0070687_100101337 | |||
| 852 | Ga0070687_100327884 | |||
| 853 | Ga0070661_100001897 | |||
| 854 | Ga0070661_100086485 | |||
| 855 | Ga0070661_100153652 | |||
| 856 | Ga0070692_10035629 | |||
| 857 | Ga0070692_10106284 | |||
| 858 | Ga0070692_10627313 | |||
| 859 | Ga0070668_100055450 | |||
| 860 | Ga0070668_100134691 | |||
| 861 | Ga0070669_100002374 | |||
| 862 | Ga0070669_100178078 | |||
| 863 | Ga0070669_100257763 | |||
| 864 | Ga0070675_100000547 | |||
| 865 | Ga0070675_100002559 | |||
| 866 | Ga0070675_100099296 | |||
| 867 | Ga0070675_100285802 | |||
| 868 | Ga0070675_100645305 | |||
| 869 | Ga0070675_101355819 | |||
| 870 | Ga0070671_100152325 | |||
| 871 | Ga0070671_100390003 | |||
| 872 | Ga0070674_100725588 | |||
| 873 | Ga0070673_100013820 | |||
| 874 | Ga0070673_100029048 | |||
| 875 | Ga0070673_100094070 | |||
| 876 | Ga0070673_100901064 | |||
| 877 | Ga0070688_100288949 | |||
| 878 | Ga0070659_100002963 | |||
| 879 | Ga0070659_100110987 | |||
| 880 | Ga0070659_100126935 | |||
| 881 | Ga0070667_100048207 | |||
| 882 | Ga0070667_100062062 | |||
| 883 | Ga0070667_100254836 | |||
| 884 | Ga0070667_100542343 | |||
| 885 | Ga0070667_101098064 | |||
| 886 | Ga0070709_10116047 | |||
| 887 | Ga0070709_11335186 | |||
| 888 | Ga0070714_100033582 | |||
| 889 | Ga0070714_100347440 | |||
| 890 | Ga0070714_100567033 | |||
| 891 | Ga0070714_101777585 | |||
| 892 | Ga0070713_100007753 | |||
| 893 | Ga0070713_100024185 | |||
| 894 | Ga0070713_100101428 | |||
| 895 | Ga0070710_10020846 | |||
| 896 | Ga0070710_10047944 | |||
| 897 | Ga0070701_10302394 | |||
| 898 | Ga0070711_100213452 | |||
| 899 | Ga0070705_100577534 | |||
| 900 | Ga0070694_100218592 | |||
| 901 | Ga0070663_101179226 | |||
| 902 | Ga0070678_100220838 | |||
| 903 | Ga0070662_100055229 | |||
| 904 | Ga0070662_100359235 | |||
| 905 | Ga0070681_10001887 | |||
| 906 | Ga0070681_10003332 | |||
| 907 | Ga0070681_10003955 | |||
| 908 | Ga0070681_10005293 | |||
| 909 | Ga0070681_10009589 | |||
| 910 | Ga0070681_10051410 | |||
| 911 | Ga0070681_10209015 | |||
| 912 | Ga0070681_10330945 | |||
| 913 | Ga0070681_11040701 | |||
| 914 | Ga0068867_100223953 | |||
| 915 | Ga0068867_100300678 | |||
| 916 | Ga0070685_10005071 | |||
| 917 | Ga0070685_10150450 | |||
| 918 | Ga0070685_10474259 | |||
| 919 | Ga0070707_100645295 | |||
| 920 | Ga0070707_100683137 | |||
| 921 | Ga0070698_100151552 | |||
| 922 | Ga0070698_100250214 | |||
| 923 | Ga0070699_100564996 | |||
| 924 | Ga0070679_100000919 | |||
| 925 | Ga0070679_100001804 | |||
| 926 | Ga0070679_100005710 | |||
| 927 | Ga0070679_100022028 | |||
| 928 | Ga0070679_100146039 | |||
| 929 | Ga0070679_100290355 | |||
| 930 | Ga0070679_100334780 | |||
| 931 | Ga0070679_100714740 | |||
| 932 | Ga0070679_101597268 | |||
| 933 | Ga0070684_100005210 | |||
| 934 | Ga0070684_100013772 | |||
| 935 | Ga0070684_100034974 | |||
| 936 | Ga0070684_100044305 | |||
| 937 | Ga0070684_100227530 | |||
| 938 | Ga0070684_100525700 | |||
| 939 | Ga0070684_100808534 | |||
| 940 | Ga0070684_101201704 | |||
| 941 | Ga0068853_100305087 | |||
| 942 | Ga0070672_100061046 | |||
| 943 | Ga0070672_100121254 | |||
| 944 | Ga0070672_100413326 | |||
| 945 | Ga0070672_100551829 | |||
| 946 | Ga0070672_100604157 | |||
| 947 | Ga0070686_100464234 | |||
| 948 | Ga0070686_100568989 | |||
| 949 | Ga0070695_100026962 | |||
| 950 | Ga0070695_100483654 | |||
| 951 | Ga0070695_100496008 | |||
| 952 | Ga0070696_100242089 | |||
| 953 | Ga0070693_100005997 | |||
| 954 | Ga0070693_100096480 | |||
| 955 | Ga0070693_100470776 | |||
| 956 | Ga0070665_101387001 | |||
| 957 | Ga0068855_100115188 | |||
| 958 | Ga0068855_100125507 | |||
| 959 | Ga0068855_101023024 | |||
| 960 | Ga0068855_101363176 | |||
| 961 | Ga0068855_101891262 | |||
| 962 | Ga0070664_100091147 | |||
| 963 | Ga0070664_100137844 | |||
| 964 | Ga0070664_100186657 | |||
| 965 | Ga0070664_100215487 | |||
| 966 | Ga0070664_100268660 | |||
| 967 | Ga0070664_100704983 | |||
| 968 | Ga0070664_100817538 | |||
| 969 | Ga0068857_100003188 | |||
| 970 | Ga0068857_100130586 | |||
| 971 | Ga0068857_100581944 | |||
| 972 | Ga0068856_100054678 | |||
| 973 | Ga0068856_100289006 | |||
| 974 | Ga0068856_100723210 | |||
| 975 | Ga0068856_101824872 | |||
| 976 | Ga0070702_100018681 | |||
| 977 | Ga0070702_101115420 | |||
| 978 | Ga0068852_100007975 | |||
| 979 | Ga0068852_100094918 | |||
| 980 | Ga0068852_100580647 | |||
| 981 | Ga0068852_100842906 | |||
| 982 | Ga0068852_101017064 | |||
| 983 | Ga0068859_100001968 | |||
| 984 | Ga0068859_100036493 | |||
| 985 | Ga0068859_100109364 | |||
| 986 | Ga0068859_100354582 | |||
| 987 | Ga0068859_101972429 | |||
| 988 | Ga0068864_100003498 | |||
| 989 | Ga0068864_100177643 | |||
| 990 | Ga0068864_100260336 | |||
| 991 | Ga0068864_100341672 | |||
| 992 | Ga0068864_100516741 | |||
| 993 | Ga0068866_10285061 | |||
| 994 | Ga0068851_10539052 | |||
| 995 | Ga0068870_10051829 | |||
| 996 | Ga0068863_100017790 | |||
| 997 | Ga0068863_100591328 | |||
| 998 | Ga0068863_100728263 | |||
| 999 | Ga0068858_100023097 | |||
| 1000 | Ga0068858_100090363 | |||
| 1001 | Ga0068858_100096835 | |||
| 1002 | Ga0068858_100664570 | |||
| 1003 | Ga0068858_101401544 | |||
| 1004 | Ga0068860_100125158 | |||
| 1005 | Ga0068860_100613813 | |||
| 1006 | Ga0068860_102097355 | |||
| 1007 | Ga0068862_100042802 | |||
| 1008 | Ga0068862_100043702 | |||
| 1009 | Ga0068862_100121228 | |||
| 1010 | Ga0081455_10156263 | |||
| 1011 | Ga0081539_10000104 | |||
| 1012 | Ga0070717_10164669 | |||
| 1013 | Ga0070717_10519430 | |||
| 1014 | Ga0070712_100212715 | |||
| 1015 | Ga0070712_100285982 | |||
| 1016 | Ga0070712_100375803 | |||
| 1017 | Ga0070712_100556864 | |||
| 1018 | Ga0068871_100026192 | |||
| 1019 | Ga0068871_100111188 | |||
| 1020 | Ga0068871_101535481 | |||
| 1021 | Ga0075428_100147487 | |||
| 1022 | Ga0075428_100470903 | |||
| 1023 | Ga0075431_100053464 | |||
| 1024 | Ga0075431_100180951 | |||
| 1025 | Ga0075434_100499738 | |||
| 1026 | Ga0075434_100616558 | |||
| 1027 | Ga0068865_100035690 | |||
| 1028 | Ga0068865_100588840 | |||
| 1029 | Ga0075436_100076052 | |||
| 1030 | Ga0075436_100105513 | |||
| 1031 | Ga0075436_100425164 | |||
| 1032 | Ga0075436_100485365 | |||
| 1033 | Ga0097620_100001968 | |||
| 1034 | Ga0097620_100036492 | |||
| 1035 | Ga0097620_100109362 | |||
| 1036 | Ga0097620_100354613 | |||
| 1037 | Ga0097620_101972420 | |||
| 1038 | Ga0075435_100052188 | |||
| 1039 | Ga0075435_100159233 | |||
| 1040 | Ga0075435_100390412 | |||
| 1041 | Ga0075435_100498057 | |||
| 1042 | Ga0105240_10008178 | |||
| 1043 | Ga0105240_10267296 | |||
| 1044 | Ga0105240_10724576 | |||
| 1045 | Ga0111539_11089178 | |||
| 1046 | Ga0105245_10033899 | |||
| 1047 | Ga0105245_10103172 | |||
| 1048 | Ga0105247_10777299 | |||
| 1049 | Ga0105243_10793108 | |||
| 1050 | Ga0105243_11054141 | |||
| 1051 | Ga0105241_10073374 | |||
| 1052 | Ga0105241_10661514 | |||
| 1053 | Ga0105242_10037749 | |||
| 1054 | Ga0105242_10452151 | |||
| 1055 | Ga0105242_10513244 | |||
| 1056 | Ga0105242_11111080 | |||
| 1057 | Ga0105248_10011323 | |||
| 1058 | Ga0105248_10072370 | |||
| 1059 | Ga0105248_10078912 | |||
| 1060 | Ga0105248_10211730 | |||
| 1061 | Ga0105248_10527922 | |||
| 1062 | Ga0105237_11009645 | |||
| 1063 | Ga0105238_10731684 | |||
| 1064 | Ga0105249_10000115 | |||
| 1065 | Ga0105249_10450049 | |||
| 1066 | Ga0105249_10512367 | |||
| 1067 | Ga0105249_11750512 | |||
| 1068 | Ga0099796_10257769 | |||
| 1069 | Ga0105239_10020162 | |||
| 1070 | Ga0105239_11047806 | |||
| 1071 | Ga0105246_10000533 | |||
| 1072 | Ga0105246_10285282 | |||
| 1073 | Ga0105246_11029399 | |||
| 1074 | Ga0157373_10075899 | |||
| 1075 | Ga0157373_10082017 | |||
| 1076 | Ga0157373_10284407 | |||
| 1077 | Ga0157373_10384254 | |||
| 1078 | Ga0157373_10386513 | |||
| 1079 | Ga0157373_11476864 | |||
| 1080 | Ga0157371_10046464 | |||
| 1081 | Ga0157371_10051360 | |||
| 1082 | Ga0157370_10008754 | |||
| 1083 | Ga0157370_10011411 | |||
| 1084 | Ga0157370_10073976 | |||
| 1085 | Ga0157370_10429733 | |||
| 1086 | Ga0157370_10528998 | |||
| 1087 | Ga0157370_10934539 | |||
| 1088 | Ga0157370_11148298 | |||
| 1089 | Ga0157370_11389723 | |||
| 1090 | Ga0157369_10014454 | |||
| 1091 | Ga0157369_10017798 | |||
| 1092 | Ga0157369_10050550 | |||
| 1093 | Ga0157369_10079483 | |||
| 1094 | Ga0157369_10875500 | |||
| 1095 | Ga0157369_11322304 | |||
| 1096 | Ga0157374_10007525 | |||
| 1097 | Ga0157374_10760190 | |||
| 1098 | Ga0157378_11104443 | |||
| 1099 | Ga0163162_10228112 | |||
| 1100 | Ga0163162_10353547 | |||
| 1101 | Ga0163162_10728725 | |||
| 1102 | Ga0163162_10919024 | |||
| 1103 | Ga0157372_10004359 | |||
| 1104 | Ga0157372_10013032 | |||
| 1105 | Ga0157372_10015537 | |||
| 1106 | Ga0157372_10037374 | |||
| 1107 | Ga0157372_10174728 | |||
| 1108 | Ga0157372_10247758 | |||
| 1109 | Ga0157372_10805643 | |||
| 1110 | Ga0157372_11339263 | |||
| 1111 | Ga0157372_11906903 | |||
| 1112 | Ga0157372_12009261 | |||
| 1113 | Ga0157375_10019946 | |||
| 1114 | Ga0157375_10038310 | |||
| 1115 | Ga0157375_10047714 | |||
| 1116 | Ga0157375_10208812 | |||
| 1117 | Ga0157375_10504614 | |||
| 1118 | Ga0157375_10818331 | |||
| 1119 | Ga0157375_10950110 | |||
| 1120 | Ga0157375_11842827 | |||
| 1121 | Ga0163163_10046544 | |||
| 1122 | Ga0163163_10935451 | |||
| 1123 | Ga0163163_11736291 | |||
| 1124 | Ga0157377_10005155 | |||
| 1125 | Ga0157377_10055970 | |||
| 1126 | Ga0157377_10117135 | |||
| 1127 | Ga0157379_10124556 | |||
| 1128 | Ga0157379_10608980 | |||
| 1129 | Ga0157379_11309624 | |||
| 1130 | Ga0157376_10006603 | |||
| 1131 | Ga0157376_10858650 | |||
| 1132 | Ga0157376_10948364 | |||
| 1133 | Ga0157376_11049617 | |||
| 1134 | Ga0182007_10022680 | |||
| 1135 | Ga0182007_10113149 | |||
| 1136 | Ga0206356_10424242 | |||
| 1137 | Ga0206352_10989846 | |||
| 1138 | Ga0206350_11611277 | |||
| 1139 | Ga0207697_10116964 | |||
| 1140 | Ga0207697_10184474 | |||
| 1141 | Ga0207682_10072927 | |||
| 1142 | Ga0207692_10187488 | |||
| 1143 | Ga0207692_10532303 | |||
| 1144 | Ga0207692_10721631 | |||
| 1145 | Ga0207692_10977542 | |||
| 1146 | Ga0207688_10040101 | |||
| 1147 | Ga0207688_10305008 | |||
| 1148 | Ga0207680_10080016 | |||
| 1149 | Ga0207680_10480743 | |||
| 1150 | Ga0207647_10311503 | |||
| 1151 | Ga0207699_10507717 | |||
| 1152 | Ga0207699_10642903 | |||
| 1153 | Ga0207645_10003872 | |||
| 1154 | Ga0207645_10063020 | |||
| 1155 | Ga0207643_10061382 | |||
| 1156 | Ga0207643_10378805 | |||
| 1157 | Ga0207705_10007107 | |||
| 1158 | Ga0207705_10028191 | |||
| 1159 | Ga0207705_10052172 | |||
| 1160 | Ga0207705_10128599 | |||
| 1161 | Ga0207705_11421881 | |||
| 1162 | Ga0207654_10036126 | |||
| 1163 | Ga0207707_10002146 | |||
| 1164 | Ga0207707_10002891 | |||
| 1165 | Ga0207707_10008528 | |||
| 1166 | Ga0207707_10016136 | |||
| 1167 | Ga0207707_10041205 | |||
| 1168 | Ga0207707_10246032 | |||
| 1169 | Ga0207707_10307852 | |||
| 1170 | Ga0207707_10903195 | |||
| 1171 | Ga0207695_10022335 | |||
| 1172 | Ga0207695_10031937 | |||
| 1173 | Ga0207693_10160874 | |||
| 1174 | Ga0207693_10202071 | |||
| 1175 | Ga0207693_10399726 | |||
| 1176 | Ga0207693_10888010 | |||
| 1177 | Ga0207663_10024888 | |||
| 1178 | Ga0207663_10723126 | |||
| 1179 | Ga0207660_10000668 | |||
| 1180 | Ga0207660_10004932 | |||
| 1181 | Ga0207660_10006680 | |||
| 1182 | Ga0207660_10007146 | |||
| 1183 | Ga0207660_10173324 | |||
| 1184 | Ga0207660_10421980 | |||
| 1185 | Ga0207660_10538051 | |||
| 1186 | Ga0207662_10004709 | |||
| 1187 | Ga0207662_10070614 | |||
| 1188 | Ga0207657_10051867 | |||
| 1189 | Ga0207657_10069100 | |||
| 1190 | Ga0207657_10187741 | |||
| 1191 | Ga0207657_10227481 | |||
| 1192 | Ga0207657_10291830 | |||
| 1193 | Ga0207649_10001792 | |||
| 1194 | Ga0207649_10039518 | |||
| 1195 | Ga0207649_10085800 | |||
| 1196 | Ga0207649_10102300 | |||
| 1197 | Ga0207652_10003423 | |||
| 1198 | Ga0207652_10042703 | |||
| 1199 | Ga0207652_10158298 | |||
| 1200 | Ga0207652_10280152 | |||
| 1201 | Ga0207652_10425959 | |||
| 1202 | Ga0207652_10700286 | |||
| 1203 | Ga0207652_11610009 | |||
| 1204 | Ga0207652_11708284 | |||
| 1205 | Ga0207681_10100699 | |||
| 1206 | Ga0207681_10342882 | |||
| 1207 | Ga0207681_10731643 | |||
| 1208 | Ga0207694_11085868 | |||
| 1209 | Ga0207650_10005580 | |||
| 1210 | Ga0207650_10096560 | |||
| 1211 | Ga0207659_10013350 | |||
| 1212 | Ga0207659_10025849 | |||
| 1213 | Ga0207659_10075624 | |||
| 1214 | Ga0207659_11229672 | |||
| 1215 | Ga0207687_10118162 | |||
| 1216 | Ga0207700_10088817 | |||
| 1217 | Ga0207700_10108769 | |||
| 1218 | Ga0207700_10275037 | |||
| 1219 | Ga0207700_10594852 | |||
| 1220 | Ga0207664_10228072 | |||
| 1221 | Ga0207644_10126985 | |||
| 1222 | Ga0207644_10766818 | |||
| 1223 | Ga0207690_10003494 | |||
| 1224 | Ga0207690_10048007 | |||
| 1225 | Ga0207690_10052981 | |||
| 1226 | Ga0207690_10639805 | |||
| 1227 | Ga0207706_10015214 | |||
| 1228 | Ga0207706_10101881 | |||
| 1229 | Ga0207706_10495699 | |||
| 1230 | Ga0207686_10013975 | |||
| 1231 | Ga0207686_10021299 | |||
| 1232 | Ga0207686_10724998 | |||
| 1233 | Ga0207686_10735967 | |||
| 1234 | Ga0207670_10122881 | |||
| 1235 | Ga0207670_10646978 | |||
| 1236 | Ga0207670_10693987 | |||
| 1237 | Ga0207669_10094194 | |||
| 1238 | Ga0207704_10009122 | |||
| 1239 | Ga0207704_10676377 | |||
| 1240 | Ga0207691_10025086 | |||
| 1241 | Ga0207691_10116828 | |||
| 1242 | Ga0207691_10132033 | |||
| 1243 | Ga0207691_10244680 | |||
| 1244 | Ga0207691_10264695 | |||
| 1245 | Ga0207691_10402150 | |||
| 1246 | Ga0207691_10714684 | |||
| 1247 | Ga0207711_10016049 | |||
| 1248 | Ga0207711_10077486 | |||
| 1249 | Ga0207711_10232911 | |||
| 1250 | Ga0207711_10254469 | |||
| 1251 | Ga0207711_10402343 | |||
| 1252 | Ga0207689_10000838 | |||
| 1253 | Ga0207689_10393465 | |||
| 1254 | Ga0207661_10002707 | |||
| 1255 | Ga0207661_10028371 | |||
| 1256 | Ga0207661_10032381 | |||
| 1257 | Ga0207661_10062899 | |||
| 1258 | Ga0207661_10065056 | |||
| 1259 | Ga0207661_10077152 | |||
| 1260 | Ga0207661_10387357 | |||
| 1261 | Ga0207661_10476863 | |||
| 1262 | Ga0207679_10004107 | |||
| 1263 | Ga0207679_10031754 | |||
| 1264 | Ga0207679_10242689 | |||
| 1265 | Ga0207679_10401590 | |||
| 1266 | Ga0207679_10804485 | |||
| 1267 | Ga0207679_11423032 | |||
| 1268 | Ga0207667_10355830 | |||
| 1269 | Ga0207667_10840176 | |||
| 1270 | Ga0207667_11051448 | |||
| 1271 | Ga0207667_11159274 | |||
| 1272 | Ga0207651_10026293 | |||
| 1273 | Ga0207651_10800207 | |||
| 1274 | Ga0207651_10800652 | |||
| 1275 | Ga0207651_10988933 | |||
| 1276 | Ga0207712_10000261 | |||
| 1277 | Ga0207712_10341306 | |||
| 1278 | Ga0207712_10630381 | |||
| 1279 | Ga0207640_10317831 | |||
| 1280 | Ga0207640_11169943 | |||
| 1281 | Ga0207658_10004283 | |||
| 1282 | Ga0207658_10075418 | |||
| 1283 | Ga0207658_10172563 | |||
| 1284 | Ga0207658_10445610 | |||
| 1285 | Ga0207658_10932462 | |||
| 1286 | Ga0207658_11262531 | |||
| 1287 | Ga0207677_10051698 | |||
| 1288 | Ga0207677_10327514 | |||
| 1289 | Ga0207703_10018395 | |||
| 1290 | Ga0207703_10188836 | |||
| 1291 | Ga0207639_10225215 | |||
| 1292 | Ga0207639_10249748 | |||
| 1293 | Ga0207639_10663660 | |||
| 1294 | Ga0207678_10538115 | |||
| 1295 | Ga0207678_10772993 | |||
| 1296 | Ga0207708_10378559 | |||
| 1297 | Ga0207708_10665233 | |||
| 1298 | Ga0207702_10054033 | |||
| 1299 | Ga0207702_10284363 | |||
| 1300 | Ga0207702_10374612 | |||
| 1301 | Ga0207641_10010846 | |||
| 1302 | Ga0207648_10020613 | |||
| 1303 | Ga0207648_10315216 | |||
| 1304 | Ga0207648_10510057 | |||
| 1305 | Ga0207676_10038651 | |||
| 1306 | Ga0207676_10176016 | |||
| 1307 | Ga0207676_10219267 | |||
| 1308 | Ga0207676_10412359 | |||
| 1309 | Ga0207674_10001189 | |||
| 1310 | Ga0207674_10002932 | |||
| 1311 | Ga0207674_10147711 | |||
| 1312 | Ga0207674_10288620 | |||
| 1313 | Ga0207674_10324052 | |||
| 1314 | Ga0207675_100088311 | |||
| 1315 | Ga0207675_100433668 | |||
| 1316 | Ga0207675_100757380 | |||
| 1317 | Ga0207683_10283311 | |||
| 1318 | Ga0207683_10400206 | |||
| 1319 | Ga0207698_10006278 | |||
| 1320 | Ga0207698_10504270 | |||
| 1321 | Ga0207698_10664933 | |||
| 1322 | Ga0207698_10803319 | |||
| 1323 | Ga0207698_12386460 | |||
| 1324 | Ga0268266_11334632 | |||
| 1325 | Ga0268265_10271482 | |||
| 1326 | Ga0268264_10029590 | |||
| 1327 | Ga0268264_10388169 | |||
| 1328 | Ga0268264_10616745 | |||
| 1329 | Ga0268264_10759724 | |||
| 1330 | Ga0265332_10027215 | |||
| 1331 | Ga0265332_10034489 | |||
| 1332 | Ga0265340_10239648 | |||
| 1333 | Ga0265331_10071106 | |||
| 1334 | Ga0265327_10017353 | |||
| 1335 | Ga0307408_100006742 | |||
| 1336 | Ga0307408_100235595 | |||
| 1337 | Ga0307408_100524586 | |||
| 1338 | Ga0265314_10005150 | |||
| 1339 | Ga0265314_10101772 | |||
| 1340 | Ga0265342_10131775 | |||
| 1341 | Ga0307405_10000648 | |||
| 1342 | Ga0307405_10651374 | |||
| 1343 | Ga0307413_10000361 | |||
| 1344 | Ga0307413_10434584 | |||
| 1345 | Ga0307413_10800301 | |||
| 1346 | Ga0307410_10000204 | |||
| 1347 | Ga0307410_10199084 | |||
| 1348 | Ga0307410_10350542 | |||
| 1349 | Ga0307406_10011710 | |||
| 1350 | Ga0307406_10660845 | |||
| 1351 | Ga0307406_10809913 | |||
| 1352 | Ga0307407_10000173 | |||
| 1353 | Ga0307412_10150855 | |||
| 1354 | Ga0307412_10733183 | |||
| 1355 | Ga0307409_100000064 | |||
| 1356 | Ga0307409_100040901 | |||
| 1357 | Ga0307409_101092686 | |||
| 1358 | Ga0307416_100174869 | |||
| 1359 | Ga0307416_100254469 | |||
| 1360 | Ga0307416_100541864 | |||
| 1361 | Ga0307416_101914799 | |||
| 1362 | Ga0307414_10016841 | |||
| 1363 | Ga0307411_10000371 | |||
| 1364 | Ga0307415_100004545 | |||
| 1365 | Ga0307415_100084953 | |||
| 1366 | Ga0307415_100235040 | |||
| 1367 | Ga0307415_100240421 | |||
| 1368 | Ga0373934_0000634 | |||
| 1369 | Ga0373934_0192254 | |||
| 1370 | Ga0373923_0115703 | |||
| 1371 | Ga0373953_0014611 | |||
| 1372 | Ga0373953_0167900 | |||
| 1373 | Ga0373954_0037354 | |||
| 1374 | Ga0373956_0001499 | |||
| 1375 | Ga0373956_0032412 | |||
| 1376 | Ga0373957_0012172 | |||
| 1377 | Ga0373957_0076576 | |||
| 1378 | Ga0373943_0215904 | |||
| 1379 | Ga0373943_0391351 | |||
| 1380 | Ga0373946_0296483 | |||
| 1381 | Ga0373955_0005518 | |||
| 1382 | Ga0373955_0015819 | |||
| 1383 | Ga0373955_0024936 | |||
| 1384 | Ga0373931_0530032 | |||
| 1385 | Ga0373935_0049313 | |||
| 1386 | Ga0373927_0162312 | |||
| 1387 | Ga0373927_0177677 | |||
| 1388 | Ga0373933_0008374 | |||
| 1389 | Ga0373933_0049512 | |||
| 1390 | Ga0373937_0002914 | |||
| 1391 | Ga0373937_0018683 | |||
| 1392 | Ga0373937_0033508 | |||
| 1393 | Ga0373937_0055491 | |||
| 1394 | Ga0373925_0073606 | |||
| 1395 | Ga0395899_0003367 | |||
| 1396 | Ga0395900_0068956 | |||
| 1397 | Ga0395905_0024256 | |||
| 1398 | Ga0436364_0474148 | |||
| 1399 | Ga0395901_0003407 | |||
| 1400 | Ga0436365_1643073 | |||
| 1401 | Ga0451802_1558764 | |||
| 1402 | Ga0451807_0755438 | |||
| 1403 | Ga0439448_0074585 | |||
| 1404 | Ga0450894_029478 | |||
| 1405 | Ga0439434_0022152 | |||
| 1406 | Ga0451577_0017882 | |||
| 1407 | Ga0451577_0953976 | |||
| 1408 | Ga0439440_0078589 | |||
| 1409 | Ga0466966_0752680 | |||
| 1410 | Ga0453684_0003703 | |||
| 1411 | Ga0466968_0406693 | |||
| 1412 | Ga0466957_0313933 | |||
| 1413 | Ga0466957_0753834 | |||
| 1414 | Ga0451576_0025244 | |||
| 1415 | Ga0451576_0392870 | |||
| 1416 | Ga0451576_0637498 | |||
| 1417 | Ga0466958_0024376 | |||
| 1418 | Ga0466958_0736516 | |||
| 1419 | Ga0466967_0677241 | |||
| 1420 | Ga0466967_1266534 | |||
| 1421 | Ga0495592_0017200 | |||
| 1422 | Ga0495603_0020192 | |||
| 1423 | Ga0495629_0029745 | |||
| 1424 | Ga0495629_0196473 | |||
| 1425 | Ga0495629_0879691 | |||
| 1426 | Ga0495651_0001301 | |||
| 1427 | Ga0495651_0012957 | |||
| 1428 | Ga0495651_0036726 | |||
| 1429 | Ga0495653_0003982 | |||
| 1430 | Ga0495653_0005425 | |||
| 1431 | Ga0495653_0042851 | |||
| 1432 | Ga0495653_0411169 | |||
| 1433 | Ga0495580_0001189 | |||
| 1434 | Ga0495580_0678661 | |||
| 1435 | Ga0495582_0181429 | |||
| 1436 | Ga0495639_0063015 | |||
| 1437 | Ga0495639_0064663 | |||
| 1438 | Ga0495662_0092708 | |||
| 1439 | Ga0495662_0180659 | |||
| 1440 | Ga0495664_0016717 | |||
| 1441 | Ga0495664_0064249 | |||
| 1442 | Ga0495594_0619531 | |||
| 1443 | Ga0495594_0767002 | |||
| 1444 | Ga0495608_0024437 | |||
| 1445 | Ga0495608_0024921 | |||
| 1446 | Ga0495608_0065126 | |||
| 1447 | Ga0495608_0119141 | |||
| 1448 | Ga0495618_0030082 | |||
| 1449 | Ga0495618_0300625 | |||
| 1450 | Ga0495618_0371045 | |||
| 1451 | Ga0495628_0000494 | |||
| 1452 | Ga0495628_0037014 | |||
| 1453 | Ga0495628_0061517 | |||
| 1454 | Ga0495628_0227716 | |||
| 1455 | Ga0495628_0239300 | |||
| 1456 | Ga0495630_0008617 | |||
| 1457 | Ga0495630_0039168 | |||
| 1458 | Ga0495630_0155719 | |||
| 1459 | Ga0495630_0242162 | |||
| 1460 | Ga0495644_0146542 | |||
| 1461 | Ga0495663_0143727 | |||
| 1462 | Ga0495666_0052197 | |||
| 1463 | Ga0495652_0004937 | |||
| 1464 | Ga0495652_0018334 | |||
| 1465 | Ga0495652_0032147 | |||
| 1466 | Ga0495652_0077805 | |||
| 1467 | Ga0495665_0016052 | |||
| 1468 | Ga0495640_0075659 | |||
| 1469 | Ga0495640_0147339 | |||
| 1470 | Ga0495586_0181927 | |||
| 1471 | Ga0495587_0000269 | |||
| 1472 | Ga0495587_0000334 | |||
| 1473 | Ga0495587_0004284 | |||
| 1474 | Ga0495598_0240935 | |||
| 1475 | Ga0495621_0020889 | |||
| 1476 | Ga0495621_0174196 | |||
| 1477 | Ga0495645_0000918 | |||
| 1478 | Ga0495645_0001039 | |||
| 1479 | Ga0495645_0005490 | |||
| 1480 | Ga0495645_0247572 | |||
| 1481 | Ga0495645_0606080 | |||
| 1482 | Ga0495667_0003294 | |||
| 1483 | Ga0495667_0022638 | |||
| 1484 | Ga0495667_0113936 | |||
| 1485 | Ga0495667_0283353 | |||
| 1486 | Ga0495667_0838538 | |||
| 1487 | Ga0495656_0027613 | |||
| 1488 | Ga0495634_0051663 | |||
| 1489 | Ga0495634_0134623 | |||
| 1490 | Ga0495635_0000200 | |||
| 1491 | Ga0495635_0028291 | |||
| 1492 | Ga0495635_0063141 | |||
| 1493 | Ga0495635_0136879 | |||
| 1494 | Ga0495588_0118581 | |||
| 1495 | Ga0495657_0001237 | |||
| 1496 | Ga0495657_0036360 | |||
| 1497 | Ga0495657_0062960 | |||
| 1498 | Ga0495599_0000385 | |||
| 1499 | Ga0495599_0001207 | |||
| 1500 | Ga0495599_0012015 | |||
| 1501 | Ga0495599_0013493 | |||
| 1502 | Ga0495599_0018564 | |||
| 1503 | Ga0495623_0000156 | |||
| 1504 | Ga0495623_0005693 | |||
| 1505 | Ga0495623_0174144 | |||
| 1506 | Ga0495646_0068047 | |||
| 1507 | Ga0495658_0113971 | |||
| 1508 | Ga0495658_0180615 | |||
| 1509 | Ga0495658_0758085 | |||
| 1510 | Ga0495613_0091423 | |||
| 1511 | Ga0495613_0189445 | |||
| 1512 | Ga0495613_0240738 | |||
| 1513 | Ga0495600_0001690 | |||
| 1514 | Ga0495600_0057426 | |||
| 1515 | Ga0495581_0031911 | |||
| 1516 | Ga0495581_0160232 | |||
| 1517 | Ga0495581_0200290 | |||
| 1518 | Ga0495581_0250423 | |||
| 1519 | Ga0495604_0008848 | |||
| 1520 | Ga0495604_0095343 | |||
| 1521 | Ga0495604_0121186 | |||
| 1522 | Ga0495604_0195203 | |||
| 1523 | Ga0495604_0334362 | |||
| 1524 | Ga0495604_0647415 | |||
| 1525 | Ga0495674_0038246 | |||
| 1526 | Ga0495674_0040546 | |||
| 1527 | Ga0495674_0085270 | |||
| 1528 | Ga0495680_0019597 | |||
| 1529 | Ga0495680_0031505 | |||
| 1530 | Ga0495680_0127885 | |||
| 1531 | Ga0495680_0249145 | |||
| 1532 | Ga0495675_0003343 | |||
| 1533 | Ga0495675_0009279 | |||
| 1534 | Ga0495675_0016554 | |||
| 1535 | Ga0495675_0172950 | |||
| 1536 | Ga0495675_0353589 | |||
| 1537 | Ga0495684_0002113 | |||
| 1538 | Ga0495684_0003435 | |||
| 1539 | Ga0495684_0089155 | |||
| 1540 | Ga0495593_0073763 | |||
| 1541 | Ga0495593_0103671 | |||
| 1542 | Ga0495602_0005326 | |||
| 1543 | Ga0495602_0019916 | |||
| 1544 | Ga0495602_0095084 | |||
| 1545 | Ga0496101_0100195 | |||
| 1546 | Ga0496102_0651698 | |||
| 1547 | Ga0496104_0035102 | |||
| 1548 | Ga0496105_0055635 | |||
| 1549 | Ga0496105_0599479 | |||
| 1550 | Ga0496106_0150431 | |||
| 1551 | Ga0496107_0716961 | |||
| 1552 | Ga0496108_0546966 | |||
| 1553 | Ga0496108_0770483 | |||
| 1554 | Ga0496109_0241694 | |||
| 1555 | Ga0496109_0289985 | |||
| 1556 | Ga0496111_1019318 | |||
| 1557 | Ga0496112_0000196 | |||
| 1558 | Ga0496113_0239880 | |||
| 1559 | Ga0496113_0263046 | |||
| 1560 | Ga0496114_0366781 | |||
| 1561 | Ga0501032_0174633 | |||
| 1562 | Ga0501036_0282575 | |||
| 1563 | Ga0501037_0504815 | |||
| 1564 | Ga0501038_0193202 | |||
| 1565 | Ga0501038_0402349 | |||
| 1566 | Ga0501041_1086969 | |||
| 1567 | Ga0501043_0767555 | |||
| 1568 | Ga0501070_0162054 | |||
| 1569 | Ga0501071_0202127 | |||
| 1570 | Ga0501072_0398973 | |||
| 1571 | Ga0501079_0326140 | |||
| 1572 | Ga0501080_0786957 | |||
| 1573 | Ga0501044_1212767 | |||
| 1574 | nmdc:mga0qj67_331962_c1 | |||
| 1575 | nmdc:mga06r32_1117684_c1 | |||
| 1576 | nmdc:mga06r32_113314_c1 | |||
| 1577 | nmdc:mga0n895_1500556_c1 | |||
| 1578 | nmdc:mga0n895_158722_c1 | |||
| 1579 | nmdc:mga0rr50_41952_c1 | |||
| 1580 | nmdc:mga08x19_192485_c1 | |||
| 1581 | nmdc:mga08x19_93792_c1 | |||
| 1582 | Ga0495601_0029750 | |||
| 1583 | Ga0495601_0057136 | |||
| 1584 | Ga0495612_0008751 | |||
| 1585 | Ga0495612_0023851 | |||
| 1586 | Ga0495595_0052096 | |||
| 1587 | Ga0495619_0024498 | |||
| 1588 | Ga0495619_0056264 | |||
| 1589 | Ga0495619_0997781 | |||
| 1590 | Ga0590071_046608 | |||
| 1591 | Ga0590074_034929 | |||
| 1592 | Ga0587090_087411 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.8324 | 1 | 143 |
| 1ng6-assembly1.cif.gz_A | structure of cytosolic protein of unknown function yqey from bacillus subtilis | 0.8074 | 1 | 143 |
| 3l9f-assembly2.cif.gz_C | the crystal structure of smu.1604c from streptococcus mutans ua159 | 0.6581 | 37 | 89 |
| 2p06-assembly1.cif.gz_A-2 | crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 | 0.5712 | 26 | 90 |
| 4eve-assembly1.cif.gz_A | crystal structure hp-nap from strain ys29 in apo form | 0.561 | 11 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3v1fA00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9671 | 54 | 89 | 4.10.860.20 |
| af_I6X831_2_93_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9617 | 2 | 91 | 1.10.1510.10 |
| 3v1fB00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9565 | 54 | 89 | 4.10.860.20 |
| 3v1bA00 | Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain | 0.9468 | 54 | 89 | 4.10.860.20 |
| af_C6Y4B8_28_116_1.10.1510.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain | 0.9364 | 4 | 91 | 1.10.1510.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A136KR09-F1-model_v4 | Yqey-like protein | 0.9899 | 4 | 93 |
GO:0016884
|
| AF-A0A800JZ68-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9873 | 4 | 92 |
GO:0016884
|
| AF-A0A837IIU3-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9763 | 5 | 92 |
GO:0016884
|
| AF-A0A1J5B5E0-F1-model_v4 | Glutamyl-tRNA amidotransferase | 0.9761 | 4 | 92 |
GO:0016884
|
| AF-A0A7C5D377-F1-model_v4 | GatB/YqeY domain-containing protein | 0.9699 | 1 | 90 |
GO:0016884
|