F481174

General Info

Members Datasets Scaffolds Average Seq Length
796 309 1592 146

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100576254|Ga0070699_1005762542
Length 153
Sequence MLLSRAREMALFDTLQTDLNAARKAQDKARVLVLGTIFSDAKNRKIELRRDLTDDEVVDVLRKGIKRRRESIEMYAGKRDDLAEKERAEVAILETYLPAAVSDDELRAAVRAAIAGGASQIGAVMGKVLPQFKGRAEGSTINAIAREELSKQG

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
217 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
220 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
221 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
222 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
296 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.26
Rhizosphere 97.49
Stem 0
Stem Tuber 0
Unclassified 21.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100576254 3300005518 Bacteria 1025
2 JGI24752J21851_1032930 3300001976 Bacteria 686
3 JGI25406J46586_10032351 3300003203 Bacteria 1944
4 Ga0058863_10125579 3300004799 Bacteria 813
5 Ga0058863_11665452 3300004799 Bacteria 928
6 Ga0058861_10000584 3300004800 Bacteria 834
7 Ga0058861_10046646 3300004800 Bacteria 1102
8 Ga0058861_11593278 3300004800 Bacteria 570
9 Ga0058861_12032014 3300004800 Bacteria 970
10 Ga0065712_10074141 3300005290 Bacteria 4174
11 Ga0065715_10169908 3300005293 Bacteria 1555
12 Ga0065715_10196773 3300005293 Bacteria 1383
13 Ga0070658_10004996 3300005327 Bacteria 10800
14 Ga0070658_10005423 3300005327 Bacteria 10348
15 Ga0070658_10005604 3300005327 Bacteria 10184
16 Ga0070658_10108991 3300005327 Unclassified 2292
17 Ga0070658_10177326 3300005327 Bacteria 1792
18 Ga0070658_10639631 3300005327 Unclassified 923
19 Ga0070676_10057744 3300005328 Unclassified 2297
20 Ga0070676_10078553 3300005328 Bacteria 1997
21 Ga0070683_100000681 3300005329 Bacteria 24634
22 Ga0070683_100012618 3300005329 Bacteria 7346
23 Ga0070683_100025497 3300005329 Bacteria 5310
24 Ga0070683_100028687 3300005329 Bacteria 5031
25 Ga0070683_100146612 3300005329 Bacteria 2237
26 Ga0070683_100207460 3300005329 Bacteria 1861
27 Ga0070683_100227384 3300005329 Unclassified 1773
28 Ga0070690_100025728 3300005330 Bacteria 3625
29 Ga0070670_100008651 3300005331 Bacteria 8690
30 Ga0070670_100200388 3300005331 Unclassified 1734
31 Ga0068869_100000336 3300005334 Bacteria 25057
32 Ga0068869_100718121 3300005334 Unclassified 853
33 Ga0070666_10110846 3300005335 Bacteria 1898
34 Ga0070666_10339171 3300005335 Bacteria 1074
35 Ga0070666_10503018 3300005335 Unclassified 878
36 Ga0070666_10548670 3300005335 Bacteria 841
37 Ga0070680_100000247 3300005336 Bacteria 35633
38 Ga0070680_100005105 3300005336 Bacteria 9912
39 Ga0070680_100006242 3300005336 Bacteria 9042
40 Ga0070680_100049309 3300005336 Bacteria 3432
41 Ga0070680_100352849 3300005336 Bacteria 1251
42 Ga0070680_100615808 3300005336 Bacteria 932
43 Ga0070682_100001941 3300005337 Bacteria 11536
44 Ga0070682_100861849 3300005337 Bacteria 741
45 Ga0068868_100109440 3300005338 Bacteria 2244
46 Ga0068868_100557281 3300005338 Unclassified 1011
47 Ga0068868_100647303 3300005338 Unclassified 941
48 Ga0070660_100008200 3300005339 Bacteria 7301
49 Ga0070660_100131677 3300005339 Unclassified 2002
50 Ga0070660_100311438 3300005339 Bacteria 1292
51 Ga0070689_100020073 3300005340 Bacteria 4953
52 Ga0070689_100194013 3300005340 Bacteria 1655
53 Ga0070689_100650956 3300005340 Bacteria 916
54 Ga0070687_100010494 3300005343 Bacteria 4008
55 Ga0070687_100101337 3300005343 Bacteria 1613
56 Ga0070687_100327884 3300005343 Unclassified 980
57 Ga0070661_100001897 3300005344 Bacteria 14475
58 Ga0070661_100086485 3300005344 Unclassified 2318
59 Ga0070661_100153652 3300005344 Bacteria 1741
60 Ga0070692_10035629 3300005345 Bacteria 2521
61 Ga0070692_10106284 3300005345 Unclassified 1546
62 Ga0070692_10627313 3300005345 Bacteria 715
63 Ga0070668_100055450 3300005347 Bacteria 3059
64 Ga0070668_100134691 3300005347 Bacteria 1986
65 Ga0070669_100002374 3300005353 Bacteria 13618
66 Ga0070669_100178078 3300005353 Bacteria 1662
67 Ga0070669_100257763 3300005353 Bacteria 1391
68 Ga0070675_100000547 3300005354 Bacteria 25799
69 Ga0070675_100002559 3300005354 Bacteria 13613
70 Ga0070675_100099296 3300005354 Unclassified 2450
71 Ga0070675_100285802 3300005354 Bacteria 1451
72 Ga0070675_100645305 3300005354 Bacteria 962
73 Ga0070675_101355819 3300005354 Bacteria 656
74 Ga0070671_100152325 3300005355 Bacteria 1953
75 Ga0070671_100390003 3300005355 Unclassified 1191
76 Ga0070674_100725588 3300005356 Unclassified 852
77 Ga0070673_100013820 3300005364 Bacteria 5602
78 Ga0070673_100029048 3300005364 Bacteria 4120
79 Ga0070673_100094070 3300005364 Bacteria 2456
80 Ga0070673_100901064 3300005364 Unclassified 820
81 Ga0070688_100288949 3300005365 Bacteria 1181
82 Ga0070659_100002963 3300005366 Bacteria 12102
83 Ga0070659_100110987 3300005366 Unclassified 2214
84 Ga0070659_100126935 3300005366 Bacteria 2070
85 Ga0070667_100048207 3300005367 Bacteria 3585
86 Ga0070667_100062062 3300005367 Unclassified 3165
87 Ga0070667_100254836 3300005367 Bacteria 1570
88 Ga0070667_100542343 3300005367 Unclassified 1069
89 Ga0070667_101098064 3300005367 Bacteria 743
90 Ga0070709_10116047 3300005434 Bacteria 1807
91 Ga0070709_11335186 3300005434 Bacteria 579
92 Ga0070714_100033582 3300005435 Bacteria 4290
93 Ga0070714_100347440 3300005435 Bacteria 1393
94 Ga0070714_100567033 3300005435 Unclassified 1088
95 Ga0070714_101777585 3300005435 Bacteria 602
96 Ga0070713_100007753 3300005436 Bacteria 7560
97 Ga0070713_100024185 3300005436 Bacteria 4728
98 Ga0070713_100101428 3300005436 Bacteria 2493
99 Ga0070710_10020846 3300005437 Bacteria 3407
100 Ga0070710_10047944 3300005437 Unclassified 2385
101 Ga0070701_10302394 3300005438 Unclassified 984
102 Ga0070711_100213452 3300005439 Bacteria 1496
103 Ga0070705_100577534 3300005440 Unclassified 866
104 Ga0070694_100218592 3300005444 Bacteria 1428
105 Ga0070663_101179226 3300005455 Unclassified 672
106 Ga0070678_100220838 3300005456 Unclassified 1575
107 Ga0070662_100055229 3300005457 Bacteria 2880
108 Ga0070662_100359235 3300005457 Bacteria 1195
109 Ga0070681_10001887 3300005458 Bacteria 18911
110 Ga0070681_10003332 3300005458 Bacteria 15018
111 Ga0070681_10003955 3300005458 Bacteria 13970
112 Ga0070681_10005293 3300005458 Bacteria 12458
113 Ga0070681_10009589 3300005458 Bacteria 9518
114 Ga0070681_10051410 3300005458 Bacteria 4110
115 Ga0070681_10209015 3300005458 Bacteria 1868
116 Ga0070681_10330945 3300005458 Bacteria 1433
117 Ga0070681_11040701 3300005458 Unclassified 739
118 Ga0068867_100223953 3300005459 Bacteria 1517
119 Ga0068867_100300678 3300005459 Unclassified 1323
120 Ga0070685_10005071 3300005466 Bacteria 6679
121 Ga0070685_10150450 3300005466 Unclassified 1474
122 Ga0070685_10474259 3300005466 Unclassified 881
123 Ga0070707_100645295 3300005468 Unclassified 1021
124 Ga0070707_100683137 3300005468 Bacteria 989
125 Ga0070698_100151552 3300005471 Unclassified 2266
126 Ga0070698_100250214 3300005471 Unclassified 1705
127 Ga0070699_100564996 3300005518 Bacteria 1036
128 Ga0070679_100000919 3300005530 Bacteria 25597
129 Ga0070679_100001804 3300005530 Bacteria 19304
130 Ga0070679_100005710 3300005530 Bacteria 11536
131 Ga0070679_100022028 3300005530 Bacteria 6225
132 Ga0070679_100146039 3300005530 Bacteria 2343
133 Ga0070679_100290355 3300005530 Bacteria 1587
134 Ga0070679_100334780 3300005530 Bacteria 1462
135 Ga0070679_100714740 3300005530 Bacteria 945
136 Ga0070679_101597268 3300005530 Bacteria 600
137 Ga0070684_100005210 3300005535 Bacteria 9942
138 Ga0070684_100013772 3300005535 Bacteria 6527
139 Ga0070684_100034974 3300005535 Bacteria 4298
140 Ga0070684_100044305 3300005535 Bacteria 3848
141 Ga0070684_100227530 3300005535 Bacteria 1702
142 Ga0070684_100525700 3300005535 Bacteria 1097
143 Ga0070684_100808534 3300005535 Bacteria 876
144 Ga0070684_101201704 3300005535 Bacteria 713
145 Ga0068853_100305087 3300005539 Unclassified 1472
146 Ga0070672_100061046 3300005543 Bacteria 2971
147 Ga0070672_100121254 3300005543 Bacteria 2140
148 Ga0070672_100413326 3300005543 Unclassified 1158
149 Ga0070672_100551829 3300005543 Unclassified 1000
150 Ga0070672_100604157 3300005543 Bacteria 955
151 Ga0070686_100464234 3300005544 Unclassified 976
152 Ga0070686_100568989 3300005544 Unclassified 889
153 Ga0070695_100026962 3300005545 Bacteria 3557
154 Ga0070695_100483654 3300005545 Bacteria 954
155 Ga0070695_100496008 3300005545 Bacteria 944
156 Ga0070696_100242089 3300005546 Unclassified 1361
157 Ga0070693_100005997 3300005547 Bacteria 5876
158 Ga0070693_100096480 3300005547 Bacteria 1792
159 Ga0070693_100470776 3300005547 Unclassified 886
160 Ga0070665_101387001 3300005548 Bacteria 712
161 Ga0068855_100115188 3300005563 Bacteria 3082
162 Ga0068855_100125507 3300005563 Bacteria 2935
163 Ga0068855_101023024 3300005563 Bacteria 867
164 Ga0068855_101363176 3300005563 Unclassified 732
165 Ga0068855_101891262 3300005563 Unclassified 605
166 Ga0070664_100091147 3300005564 Bacteria 2639
167 Ga0070664_100137844 3300005564 Bacteria 2146
168 Ga0070664_100186657 3300005564 Bacteria 1845
169 Ga0070664_100215487 3300005564 Bacteria 1716
170 Ga0070664_100268660 3300005564 Bacteria 1536
171 Ga0070664_100704983 3300005564 Unclassified 941
172 Ga0070664_100817538 3300005564 Unclassified 872
173 Ga0068857_100003188 3300005577 Bacteria 13600
174 Ga0068857_100130586 3300005577 Unclassified 2266
175 Ga0068857_100581944 3300005577 Bacteria 1057
176 Ga0068856_100054678 3300005614 Bacteria 3939
177 Ga0068856_100289006 3300005614 Bacteria 1656
178 Ga0068856_100723210 3300005614 Bacteria 1016
179 Ga0068856_101824872 3300005614 Bacteria 620
180 Ga0070702_100018681 3300005615 Bacteria 3600
181 Ga0070702_101115420 3300005615 Bacteria 631
182 Ga0068852_100007975 3300005616 Bacteria 7765
183 Ga0068852_100094918 3300005616 Bacteria 2677
184 Ga0068852_100580647 3300005616 Bacteria 1124
185 Ga0068852_100842906 3300005616 Bacteria 932
186 Ga0068852_101017064 3300005616 Bacteria 848
187 Ga0068859_100001968 3300005617 Bacteria 20974
188 Ga0068859_100036493 3300005617 Bacteria 4935
189 Ga0068859_100109364 3300005617 Unclassified 2825
190 Ga0068859_100354582 3300005617 Bacteria 1562
191 Ga0068859_101972429 3300005617 Bacteria 645
192 Ga0068864_100003498 3300005618 Bacteria 12984
193 Ga0068864_100177643 3300005618 Bacteria 1944
194 Ga0068864_100260336 3300005618 Unclassified 1613
195 Ga0068864_100341672 3300005618 Unclassified 1411
196 Ga0068864_100516741 3300005618 Bacteria 1151
197 Ga0068866_10285061 3300005718 Unclassified 1025
198 Ga0068851_10539052 3300005834 Unclassified 704
199 Ga0068870_10051829 3300005840 Bacteria 2174
200 Ga0068863_100017790 3300005841 Bacteria 6802
201 Ga0068863_100591328 3300005841 Unclassified 1098
202 Ga0068863_100728263 3300005841 Unclassified 987
203 Ga0068858_100023097 3300005842 Bacteria 5801
204 Ga0068858_100090363 3300005842 Bacteria 2850
205 Ga0068858_100096835 3300005842 Bacteria 2750
206 Ga0068858_100664570 3300005842 Bacteria 1013
207 Ga0068858_101401544 3300005842 Bacteria 688
208 Ga0068860_100125158 3300005843 Bacteria 2463
209 Ga0068860_100613813 3300005843 Unclassified 1094
210 Ga0068860_102097355 3300005843 Bacteria 587
211 Ga0068862_100042802 3300005844 Unclassified 3859
212 Ga0068862_100043702 3300005844 Bacteria 3820
213 Ga0068862_100121228 3300005844 Unclassified 2305
214 Ga0081455_10156263 3300005937 Bacteria 1753
215 Ga0081539_10000104 3300005985 Bacteria 197478
216 Ga0070717_10164669 3300006028 Bacteria 1925
217 Ga0070717_10519430 3300006028 Unclassified 1077
218 Ga0070712_100212715 3300006175 Bacteria 1526
219 Ga0070712_100285982 3300006175 Bacteria 1330
220 Ga0070712_100375803 3300006175 Bacteria 1169
221 Ga0070712_100556864 3300006175 Bacteria 967
222 Ga0068871_100026192 3300006358 Bacteria 4548
223 Ga0068871_100111188 3300006358 Unclassified 2304
224 Ga0068871_101535481 3300006358 Unclassified 630
225 Ga0075428_100147487 3300006844 Bacteria 2557
226 Ga0075428_100470903 3300006844 Bacteria 1345
227 Ga0075431_100053464 3300006847 Unclassified 4164
228 Ga0075431_100180951 3300006847 Unclassified 2163
229 Ga0075434_100499738 3300006871 Bacteria 1237
230 Ga0075434_100616558 3300006871 Bacteria 1104
231 Ga0068865_100035690 3300006881 Bacteria 3347
232 Ga0068865_100588840 3300006881 Bacteria 939
233 Ga0075436_100076052 3300006914 Bacteria 2325
234 Ga0075436_100105513 3300006914 Bacteria 1965
235 Ga0075436_100425164 3300006914 Bacteria 965
236 Ga0075436_100485365 3300006914 Bacteria 903
237 Ga0097620_100001968 3300006931 Bacteria 20974
238 Ga0097620_100036492 3300006931 Bacteria 4935
239 Ga0097620_100109362 3300006931 Unclassified 2825
240 Ga0097620_100354613 3300006931 Bacteria 1562
241 Ga0097620_101972420 3300006931 Bacteria 645
242 Ga0075435_100052188 3300007076 Bacteria 3295
243 Ga0075435_100159233 3300007076 Bacteria 1901
244 Ga0075435_100390412 3300007076 Bacteria 1196
245 Ga0075435_100498057 3300007076 Bacteria 1053
246 Ga0105240_10008178 3300009093 Bacteria 15002
247 Ga0105240_10267296 3300009093 Bacteria 1971
248 Ga0105240_10724576 3300009093 Unclassified 1083
249 Ga0111539_11089178 3300009094 Bacteria 928
250 Ga0105245_10033899 3300009098 Bacteria 4525
251 Ga0105245_10103172 3300009098 Bacteria 2642
252 Ga0105247_10777299 3300009101 Unclassified 728
253 Ga0105243_10793108 3300009148 Unclassified 933
254 Ga0105243_11054141 3300009148 Bacteria 819
255 Ga0105241_10073374 3300009174 Bacteria 2662
256 Ga0105241_10661514 3300009174 Bacteria 950
257 Ga0105242_10037749 3300009176 Bacteria 3882
258 Ga0105242_10452151 3300009176 Bacteria 1211
259 Ga0105242_10513244 3300009176 Bacteria 1142
260 Ga0105242_11111080 3300009176 Bacteria 805
261 Ga0105248_10011323 3300009177 Bacteria 9831
262 Ga0105248_10072370 3300009177 Bacteria 3874
263 Ga0105248_10078912 3300009177 Unclassified 3700
264 Ga0105248_10211730 3300009177 Bacteria 2184
265 Ga0105248_10527922 3300009177 Bacteria 1331
266 Ga0105237_11009645 3300009545 Bacteria 839
267 Ga0105238_10731684 3300009551 Bacteria 1002
268 Ga0105249_10000115 3300009553 Bacteria 108581
269 Ga0105249_10450049 3300009553 Unclassified 1326
270 Ga0105249_10512367 3300009553 Bacteria 1246
271 Ga0105249_11750512 3300009553 Bacteria 694
272 Ga0099796_10257769 3300010159 Unclassified 726
273 Ga0105239_10020162 3300010375 Bacteria 7355
274 Ga0105239_11047806 3300010375 Bacteria 938
275 Ga0105246_10000533 3300011119 Bacteria 20789
276 Ga0105246_10285282 3300011119 Unclassified 1326
277 Ga0105246_11029399 3300011119 Unclassified 747
278 Ga0157373_10075899 3300013100 Bacteria 2372
279 Ga0157373_10082017 3300013100 Bacteria 2273
280 Ga0157373_10284407 3300013100 Unclassified 1172
281 Ga0157373_10384254 3300013100 Bacteria 1005
282 Ga0157373_10386513 3300013100 Bacteria 1001
283 Ga0157373_11476864 3300013100 Bacteria 518
284 Ga0157371_10046464 3300013102 Bacteria 3088
285 Ga0157371_10051360 3300013102 Bacteria 2930
286 Ga0157370_10008754 3300013104 Bacteria 10881
287 Ga0157370_10011411 3300013104 Bacteria 9295
288 Ga0157370_10073976 3300013104 Bacteria 3214
289 Ga0157370_10429733 3300013104 Bacteria 1214
290 Ga0157370_10528998 3300013104 Bacteria 1082
291 Ga0157370_10934539 3300013104 Bacteria 786
292 Ga0157370_11148298 3300013104 Bacteria 701
293 Ga0157370_11389723 3300013104 Bacteria 632
294 Ga0157369_10014454 3300013105 Bacteria 8912
295 Ga0157369_10017798 3300013105 Bacteria 7977
296 Ga0157369_10050550 3300013105 Bacteria 4501
297 Ga0157369_10079483 3300013105 Bacteria 3512
298 Ga0157369_10875500 3300013105 Bacteria 922
299 Ga0157369_11322304 3300013105 Bacteria 734
300 Ga0157374_10007525 3300013296 Bacteria 9292
301 Ga0157374_10760190 3300013296 Bacteria 984
302 Ga0157378_11104443 3300013297 Unclassified 830
303 Ga0163162_10228112 3300013306 Bacteria 1993
304 Ga0163162_10353547 3300013306 Bacteria 1602
305 Ga0163162_10728725 3300013306 Unclassified 1112
306 Ga0163162_10919024 3300013306 Unclassified 987
307 Ga0157372_10004359 3300013307 Bacteria 15110
308 Ga0157372_10013032 3300013307 Bacteria 8868
309 Ga0157372_10015537 3300013307 Bacteria 8158
310 Ga0157372_10037374 3300013307 Bacteria 5356
311 Ga0157372_10174728 3300013307 Bacteria 2486
312 Ga0157372_10247758 3300013307 Bacteria 2068
313 Ga0157372_10805643 3300013307 Unclassified 1091
314 Ga0157372_11339263 3300013307 Bacteria 826
315 Ga0157372_11906903 3300013307 Bacteria 683
316 Ga0157372_12009261 3300013307 Bacteria 664
317 Ga0157375_10019946 3300013308 Bacteria 6113
318 Ga0157375_10038310 3300013308 Bacteria 4603
319 Ga0157375_10047714 3300013308 Bacteria 4184
320 Ga0157375_10208812 3300013308 Bacteria 2110
321 Ga0157375_10504614 3300013308 Unclassified 1374
322 Ga0157375_10818331 3300013308 Unclassified 1079
323 Ga0157375_10950110 3300013308 Bacteria 1001
324 Ga0157375_11842827 3300013308 Unclassified 718
325 Ga0163163_10046544 3300014325 Bacteria 4261
326 Ga0163163_10935451 3300014325 Unclassified 930
327 Ga0163163_11736291 3300014325 Bacteria 685
328 Ga0157377_10005155 3300014745 Bacteria 6110
329 Ga0157377_10055970 3300014745 Bacteria 2238
330 Ga0157377_10117135 3300014745 Unclassified 1609
331 Ga0157379_10124556 3300014968 Bacteria 2319
332 Ga0157379_10608980 3300014968 Unclassified 1020
333 Ga0157379_11309624 3300014968 Bacteria 700
334 Ga0157376_10006603 3300014969 Bacteria 8207
335 Ga0157376_10858650 3300014969 Bacteria 923
336 Ga0157376_10948364 3300014969 Bacteria 881
337 Ga0157376_11049617 3300014969 Unclassified 839
338 Ga0182007_10022680 3300015262 Bacteria 2214
339 Ga0182007_10113149 3300015262 Bacteria 904
340 Ga0206356_10424242 3300020070 Bacteria 697
341 Ga0206352_10989846 3300020078 Bacteria 715
342 Ga0206350_11611277 3300020080 Bacteria 912
343 Ga0207697_10116964 3300025315 Bacteria 1145
344 Ga0207697_10184474 3300025315 Unclassified 915
345 Ga0207682_10072927 3300025893 Bacteria 1457
346 Ga0207692_10187488 3300025898 Bacteria 1209
347 Ga0207692_10532303 3300025898 Unclassified 749
348 Ga0207692_10721631 3300025898 Bacteria 648
349 Ga0207692_10977542 3300025898 Unclassified 558
350 Ga0207688_10040101 3300025901 Bacteria 2602
351 Ga0207688_10305008 3300025901 Unclassified 974
352 Ga0207680_10080016 3300025903 Bacteria 2051
353 Ga0207680_10480743 3300025903 Unclassified 883
354 Ga0207647_10311503 3300025904 Bacteria 895
355 Ga0207699_10507717 3300025906 Unclassified 871
356 Ga0207699_10642903 3300025906 Bacteria 774
357 Ga0207645_10003872 3300025907 Bacteria 11197
358 Ga0207645_10063020 3300025907 Unclassified 2369
359 Ga0207643_10061382 3300025908 Bacteria 2147
360 Ga0207643_10378805 3300025908 Bacteria 892
361 Ga0207705_10007107 3300025909 Bacteria 8254
362 Ga0207705_10028191 3300025909 Bacteria 4003
363 Ga0207705_10052172 3300025909 Bacteria 2944
364 Ga0207705_10128599 3300025909 Bacteria 1884
365 Ga0207705_11421881 3300025909 Unclassified 527
366 Ga0207654_10036126 3300025911 Bacteria 2758
367 Ga0207707_10002146 3300025912 Bacteria 17846
368 Ga0207707_10002891 3300025912 Bacteria 15329
369 Ga0207707_10008528 3300025912 Bacteria 8885
370 Ga0207707_10016136 3300025912 Bacteria 6514
371 Ga0207707_10041205 3300025912 Bacteria 4033
372 Ga0207707_10246032 3300025912 Bacteria 1554
373 Ga0207707_10307852 3300025912 Bacteria 1369
374 Ga0207707_10903195 3300025912 Bacteria 730
375 Ga0207695_10022335 3300025913 Bacteria 7185
376 Ga0207695_10031937 3300025913 Bacteria 5767
377 Ga0207693_10160874 3300025915 Bacteria 1766
378 Ga0207693_10202071 3300025915 Bacteria 1563
379 Ga0207693_10399726 3300025915 Bacteria 1074
380 Ga0207693_10888010 3300025915 Bacteria 684
381 Ga0207663_10024888 3300025916 Bacteria 3453
382 Ga0207663_10723126 3300025916 Bacteria 789
383 Ga0207660_10000668 3300025917 Bacteria 22904
384 Ga0207660_10004932 3300025917 Bacteria 8694
385 Ga0207660_10006680 3300025917 Bacteria 7477
386 Ga0207660_10007146 3300025917 Bacteria 7230
387 Ga0207660_10173324 3300025917 Bacteria 1671
388 Ga0207660_10421980 3300025917 Bacteria 1076
389 Ga0207660_10538051 3300025917 Unclassified 949
390 Ga0207662_10004709 3300025918 Bacteria 7200
391 Ga0207662_10070614 3300025918 Unclassified 2113
392 Ga0207657_10051867 3300025919 Bacteria 3564
393 Ga0207657_10069100 3300025919 Bacteria 2999
394 Ga0207657_10187741 3300025919 Bacteria 1669
395 Ga0207657_10227481 3300025919 Unclassified 1492
396 Ga0207657_10291830 3300025919 Bacteria 1293
397 Ga0207649_10001792 3300025920 Bacteria 12287
398 Ga0207649_10039518 3300025920 Bacteria 2862
399 Ga0207649_10085800 3300025920 Bacteria 2050
400 Ga0207649_10102300 3300025920 Unclassified 1899
401 Ga0207652_10003423 3300025921 Bacteria 13091
402 Ga0207652_10042703 3300025921 Bacteria 3860
403 Ga0207652_10158298 3300025921 Bacteria 2029
404 Ga0207652_10280152 3300025921 Bacteria 1504
405 Ga0207652_10425959 3300025921 Unclassified 1197
406 Ga0207652_10700286 3300025921 Bacteria 904
407 Ga0207652_11610009 3300025921 Bacteria 554
408 Ga0207652_11708284 3300025921 Unclassified 534
409 Ga0207681_10100699 3300025923 Unclassified 2083
410 Ga0207681_10342882 3300025923 Bacteria 1194
411 Ga0207681_10731643 3300025923 Bacteria 824
412 Ga0207694_11085868 3300025924 Bacteria 677
413 Ga0207650_10005580 3300025925 Bacteria 8591
414 Ga0207650_10096560 3300025925 Unclassified 2267
415 Ga0207659_10013350 3300025926 Bacteria 5257
416 Ga0207659_10025849 3300025926 Bacteria 3952
417 Ga0207659_10075624 3300025926 Bacteria 2472
418 Ga0207659_11229672 3300025926 Unclassified 644
419 Ga0207687_10118162 3300025927 Unclassified 1979
420 Ga0207700_10088817 3300025928 Bacteria 2434
421 Ga0207700_10108769 3300025928 Unclassified 2227
422 Ga0207700_10275037 3300025928 Bacteria 1446
423 Ga0207700_10594852 3300025928 Bacteria 984
424 Ga0207664_10228072 3300025929 Bacteria 1618
425 Ga0207644_10126985 3300025931 Bacteria 1948
426 Ga0207644_10766818 3300025931 Unclassified 806
427 Ga0207690_10003494 3300025932 Bacteria 9371
428 Ga0207690_10048007 3300025932 Bacteria 2836
429 Ga0207690_10052981 3300025932 Bacteria 2720
430 Ga0207690_10639805 3300025932 Bacteria 871
431 Ga0207706_10015214 3300025933 Bacteria 6961
432 Ga0207706_10101881 3300025933 Bacteria 2526
433 Ga0207706_10495699 3300025933 Unclassified 1055
434 Ga0207686_10013975 3300025934 Bacteria 4457
435 Ga0207686_10021299 3300025934 Unclassified 3719
436 Ga0207686_10724998 3300025934 Unclassified 792
437 Ga0207686_10735967 3300025934 Bacteria 786
438 Ga0207670_10122881 3300025936 Bacteria 1890
439 Ga0207670_10646978 3300025936 Bacteria 871
440 Ga0207670_10693987 3300025936 Unclassified 842
441 Ga0207669_10094194 3300025937 Bacteria 1959
442 Ga0207704_10009122 3300025938 Bacteria 4772
443 Ga0207704_10676377 3300025938 Bacteria 852
444 Ga0207691_10025086 3300025940 Bacteria 5600
445 Ga0207691_10116828 3300025940 Bacteria 2367
446 Ga0207691_10132033 3300025940 Bacteria 2205
447 Ga0207691_10244680 3300025940 Unclassified 1550
448 Ga0207691_10264695 3300025940 Bacteria 1481
449 Ga0207691_10402150 3300025940 Bacteria 1168
450 Ga0207691_10714684 3300025940 Unclassified 844
451 Ga0207711_10016049 3300025941 Bacteria 6214
452 Ga0207711_10077486 3300025941 Unclassified 2898
453 Ga0207711_10232911 3300025941 Bacteria 1687
454 Ga0207711_10254469 3300025941 Bacteria 1613
455 Ga0207711_10402343 3300025941 Bacteria 1272
456 Ga0207689_10000838 3300025942 Bacteria 29648
457 Ga0207689_10393465 3300025942 Unclassified 1155
458 Ga0207661_10002707 3300025944 Bacteria 12194
459 Ga0207661_10028371 3300025944 Bacteria 4286
460 Ga0207661_10032381 3300025944 Bacteria 4049
461 Ga0207661_10062899 3300025944 Bacteria 3004
462 Ga0207661_10065056 3300025944 Bacteria 2959
463 Ga0207661_10077152 3300025944 Bacteria 2739
464 Ga0207661_10387357 3300025944 Bacteria 1266
465 Ga0207661_10476863 3300025944 Bacteria 1138
466 Ga0207679_10004107 3300025945 Bacteria 9036
467 Ga0207679_10031754 3300025945 Bacteria 3699
468 Ga0207679_10242689 3300025945 Bacteria 1527
469 Ga0207679_10401590 3300025945 Bacteria 1206
470 Ga0207679_10804485 3300025945 Unclassified 857
471 Ga0207679_11423032 3300025945 Unclassified 636
472 Ga0207667_10355830 3300025949 Bacteria 1493
473 Ga0207667_10840176 3300025949 Unclassified 913
474 Ga0207667_11051448 3300025949 Bacteria 799
475 Ga0207667_11159274 3300025949 Bacteria 754
476 Ga0207651_10026293 3300025960 Bacteria 3633
477 Ga0207651_10800207 3300025960 Bacteria 836
478 Ga0207651_10800652 3300025960 Unclassified 835
479 Ga0207651_10988933 3300025960 Bacteria 751
480 Ga0207712_10000261 3300025961 Bacteria 51172
481 Ga0207712_10341306 3300025961 Unclassified 1242
482 Ga0207712_10630381 3300025961 Bacteria 930
483 Ga0207640_10317831 3300025981 Bacteria 1238
484 Ga0207640_11169943 3300025981 Bacteria 683
485 Ga0207658_10004283 3300025986 Bacteria 9944
486 Ga0207658_10075418 3300025986 Bacteria 2566
487 Ga0207658_10172563 3300025986 Bacteria 1783
488 Ga0207658_10445610 3300025986 Unclassified 1145
489 Ga0207658_10932462 3300025986 Bacteria 791
490 Ga0207658_11262531 3300025986 Unclassified 675
491 Ga0207677_10051698 3300026023 Bacteria 2787
492 Ga0207677_10327514 3300026023 Unclassified 1275
493 Ga0207703_10018395 3300026035 Bacteria 5456
494 Ga0207703_10188836 3300026035 Bacteria 1823
495 Ga0207639_10225215 3300026041 Unclassified 1622
496 Ga0207639_10249748 3300026041 Bacteria 1546
497 Ga0207639_10663660 3300026041 Bacteria 965
498 Ga0207678_10538115 3300026067 Bacteria 1021
499 Ga0207678_10772993 3300026067 Unclassified 847
500 Ga0207708_10378559 3300026075 Bacteria 1167
501 Ga0207708_10665233 3300026075 Unclassified 888
502 Ga0207702_10054033 3300026078 Bacteria 3402
503 Ga0207702_10284363 3300026078 Unclassified 1565
504 Ga0207702_10374612 3300026078 Bacteria 1368
505 Ga0207641_10010846 3300026088 Bacteria 7466
506 Ga0207648_10020613 3300026089 Bacteria 5935
507 Ga0207648_10315216 3300026089 Bacteria 1405
508 Ga0207648_10510057 3300026089 Unclassified 1101
509 Ga0207676_10038651 3300026095 Bacteria 3644
510 Ga0207676_10176016 3300026095 Bacteria 1869
511 Ga0207676_10219267 3300026095 Bacteria 1693
512 Ga0207676_10412359 3300026095 Unclassified 1265
513 Ga0207674_10001189 3300026116 Bacteria 33857
514 Ga0207674_10002932 3300026116 Bacteria 21199
515 Ga0207674_10147711 3300026116 Unclassified 2309
516 Ga0207674_10288620 3300026116 Bacteria 1589
517 Ga0207674_10324052 3300026116 Unclassified 1490
518 Ga0207675_100088311 3300026118 Bacteria 2912
519 Ga0207675_100433668 3300026118 Unclassified 1300
520 Ga0207675_100757380 3300026118 Unclassified 983
521 Ga0207683_10283311 3300026121 Bacteria 1514
522 Ga0207683_10400206 3300026121 Bacteria 1263
523 Ga0207698_10006278 3300026142 Bacteria 7397
524 Ga0207698_10504270 3300026142 Bacteria 1178
525 Ga0207698_10664933 3300026142 Bacteria 1033
526 Ga0207698_10803319 3300026142 Bacteria 943
527 Ga0207698_12386460 3300026142 Bacteria 540
528 Ga0268266_11334632 3300028379 Bacteria 693
529 Ga0268265_10271482 3300028380 Bacteria 1513
530 Ga0268264_10029590 3300028381 Bacteria 4487
531 Ga0268264_10388169 3300028381 Bacteria 1339
532 Ga0268264_10616745 3300028381 Bacteria 1070
533 Ga0268264_10759724 3300028381 Unclassified 966
534 Ga0265332_10027215 3300031238 Bacteria 2505
535 Ga0265332_10034489 3300031238 Bacteria 2199
536 Ga0265340_10239648 3300031247 Bacteria 809
537 Ga0265331_10071106 3300031250 Unclassified 1628
538 Ga0265327_10017353 3300031251 Bacteria 4521
539 Ga0307408_100006742 3300031548 Bacteria 7610
540 Ga0307408_100235595 3300031548 Unclassified 1502
541 Ga0307408_100524586 3300031548 Bacteria 1041
542 Ga0265314_10005150 3300031711 Bacteria 11881
543 Ga0265314_10101772 3300031711 Unclassified 1845
544 Ga0265342_10131775 3300031712 Bacteria 1400
545 Ga0307405_10000648 3300031731 Bacteria 13427
546 Ga0307405_10651374 3300031731 Unclassified 866
547 Ga0307413_10000361 3300031824 Bacteria 14528
548 Ga0307413_10434584 3300031824 Bacteria 1037
549 Ga0307413_10800301 3300031824 Bacteria 792
550 Ga0307410_10000204 3300031852 Bacteria 22235
551 Ga0307410_10199084 3300031852 Bacteria 1528
552 Ga0307410_10350542 3300031852 Bacteria 1179
553 Ga0307406_10011710 3300031901 Bacteria 4979
554 Ga0307406_10660845 3300031901 Bacteria 868
555 Ga0307406_10809913 3300031901 Bacteria 791
556 Ga0307407_10000173 3300031903 Bacteria 19580
557 Ga0307412_10150855 3300031911 Bacteria 1715
558 Ga0307412_10733183 3300031911 Bacteria 851
559 Ga0307409_100000064 3300031995 Bacteria 38623
560 Ga0307409_100040901 3300031995 Bacteria 3457
561 Ga0307409_101092686 3300031995 Unclassified 818
562 Ga0307416_100174869 3300032002 Bacteria 2004
563 Ga0307416_100254469 3300032002 Bacteria 1712
564 Ga0307416_100541864 3300032002 Unclassified 1236
565 Ga0307416_101914799 3300032002 Unclassified 696
566 Ga0307414_10016841 3300032004 Bacteria 4458
567 Ga0307411_10000371 3300032005 Bacteria 15251
568 Ga0307415_100004545 3300032126 Bacteria 7226
569 Ga0307415_100084953 3300032126 Bacteria 2272
570 Ga0307415_100235040 3300032126 Bacteria 1479
571 Ga0307415_100240421 3300032126 Bacteria 1464
572 Ga0373934_0000634 3300035086 Bacteria 12395
573 Ga0373934_0192254 3300035086 Bacteria 840
574 Ga0373923_0115703 3300035111 Bacteria 1194
575 Ga0373953_0014611 3300035117 Bacteria 2828
576 Ga0373953_0167900 3300035117 Unclassified 944
577 Ga0373954_0037354 3300035118 Bacteria 2257
578 Ga0373956_0001499 3300035119 Bacteria 9653
579 Ga0373956_0032412 3300035119 Bacteria 2292
580 Ga0373957_0012172 3300035120 Bacteria 2890
581 Ga0373957_0076576 3300035120 Bacteria 1315
582 Ga0373943_0215904 3300035170 Bacteria 1067
583 Ga0373943_0391351 3300035170 Unclassified 801
584 Ga0373946_0296483 3300035171 Bacteria 799
585 Ga0373955_0005518 3300035172 Bacteria 5687
586 Ga0373955_0015819 3300035172 Bacteria 3700
587 Ga0373955_0024936 3300035172 Bacteria 3064
588 Ga0373931_0530032 3300035691 Bacteria 763
589 Ga0373935_0049313 3300035692 Unclassified 2668
590 Ga0373927_0162312 3300035695 Bacteria 1464
591 Ga0373927_0177677 3300035695 Bacteria 1396
592 Ga0373933_0008374 3300035724 Bacteria 5647
593 Ga0373933_0049512 3300035724 Unclassified 2505
594 Ga0373937_0002914 3300036401 Bacteria 14299
595 Ga0373937_0018683 3300036401 Bacteria 6194
596 Ga0373937_0033508 3300036401 Bacteria 4665
597 Ga0373937_0055491 3300036401 Bacteria 3637
598 Ga0373925_0073606 3300037068 Bacteria 2586
599 Ga0395899_0003367 3300037312 Bacteria 12685
600 Ga0395900_0068956 3300037418 Bacteria 3634
601 Ga0395905_0024256 3300037471 Bacteria 5725
602 Ga0436364_0474148 3300037853 Bacteria 992
603 Ga0395901_0003407 3300038443 Bacteria 16018
604 Ga0436365_1643073 3300039437 Archaea 627
605 Ga0451802_1558764 3300041460 Bacteria 928
606 Ga0451807_0755438 3300041486 Unclassified 816
607 Ga0439448_0074585 3300042005 Bacteria 1133
608 Ga0450894_029478 3300042131 Unclassified 762
609 Ga0439434_0022152 3300042435 Bacteria 1910
610 Ga0451577_0017882 3300042876 Bacteria 6541
611 Ga0451577_0953976 3300042876 Bacteria 771
612 Ga0439440_0078589 3300042993 Bacteria 869
613 Ga0466966_0752680 3300044684 Bacteria 587
614 Ga0453684_0003703 3300044712 Bacteria 33868
615 Ga0466968_0406693 3300044735 Bacteria 668
616 Ga0466957_0313933 3300044842 Bacteria 1056
617 Ga0466957_0753834 3300044842 Unclassified 689
618 Ga0451576_0025244 3300045051 Bacteria 6404
619 Ga0451576_0392870 3300045051 Bacteria 1454
620 Ga0451576_0637498 3300045051 Bacteria 1120
621 Ga0466958_0024376 3300045836 Unclassified 3560
622 Ga0466958_0736516 3300045836 Bacteria 642
623 Ga0466967_0677241 3300045976 Bacteria 1021
624 Ga0466967_1266534 3300045976 Bacteria 734
625 Ga0495592_0017200 3300046454 Bacteria 5491
626 Ga0495603_0020192 3300046455 Bacteria 4038
627 Ga0495629_0029745 3300046459 Bacteria 3873
628 Ga0495629_0196473 3300046459 Bacteria 1395
629 Ga0495629_0879691 3300046459 Bacteria 588
630 Ga0495651_0001301 3300046462 Bacteria 19332
631 Ga0495651_0012957 3300046462 Bacteria 6444
632 Ga0495651_0036726 3300046462 Bacteria 3814
633 Ga0495653_0003982 3300046463 Bacteria 11925
634 Ga0495653_0005425 3300046463 Bacteria 10383
635 Ga0495653_0042851 3300046463 Bacteria 3522
636 Ga0495653_0411169 3300046463 Bacteria 858
637 Ga0495580_0001189 3300046472 Bacteria 22911
638 Ga0495580_0678661 3300046472 Bacteria 676
639 Ga0495582_0181429 3300046473 Bacteria 1199
640 Ga0495639_0063015 3300046475 Bacteria 1702
641 Ga0495639_0064663 3300046475 Bacteria 1682
642 Ga0495662_0092708 3300046476 Bacteria 1474
643 Ga0495662_0180659 3300046476 Unclassified 1040
644 Ga0495664_0016717 3300046477 Bacteria 4185
645 Ga0495664_0064249 3300046477 Bacteria 2188
646 Ga0495594_0619531 3300046499 Unclassified 613
647 Ga0495594_0767002 3300046499 Bacteria 544
648 Ga0495608_0024437 3300046511 Bacteria 4133
649 Ga0495608_0024921 3300046511 Bacteria 4087
650 Ga0495608_0065126 3300046511 Bacteria 2387
651 Ga0495608_0119141 3300046511 Bacteria 1693
652 Ga0495618_0030082 3300046514 Bacteria 3390
653 Ga0495618_0300625 3300046514 Bacteria 997
654 Ga0495618_0371045 3300046514 Unclassified 879
655 Ga0495628_0000494 3300046516 Bacteria 36135
656 Ga0495628_0037014 3300046516 Bacteria 3913
657 Ga0495628_0061517 3300046516 Bacteria 2944
658 Ga0495628_0227716 3300046516 Unclassified 1398
659 Ga0495628_0239300 3300046516 Bacteria 1358
660 Ga0495630_0008617 3300046517 Bacteria 7319
661 Ga0495630_0039168 3300046517 Bacteria 3545
662 Ga0495630_0155719 3300046517 Bacteria 1739
663 Ga0495630_0242162 3300046517 Unclassified 1378
664 Ga0495644_0146542 3300046523 Bacteria 903
665 Ga0495663_0143727 3300046525 Unclassified 811
666 Ga0495666_0052197 3300046526 Bacteria 1963
667 Ga0495652_0004937 3300046529 Bacteria 12645
668 Ga0495652_0018334 3300046529 Bacteria 6242
669 Ga0495652_0032147 3300046529 Bacteria 4590
670 Ga0495652_0077805 3300046529 Unclassified 2748
671 Ga0495665_0016052 3300046531 Bacteria 4035
672 Ga0495640_0075659 3300046533 Bacteria 2248
673 Ga0495640_0147339 3300046533 Bacteria 1514
674 Ga0495586_0181927 3300046535 Bacteria 1189
675 Ga0495587_0000269 3300046536 Bacteria 37262
676 Ga0495587_0000334 3300046536 Bacteria 33589
677 Ga0495587_0004284 3300046536 Bacteria 9422
678 Ga0495598_0240935 3300046537 Bacteria 667
679 Ga0495621_0020889 3300046539 Bacteria 2153
680 Ga0495621_0174196 3300046539 Unclassified 856
681 Ga0495645_0000918 3300046543 Bacteria 20080
682 Ga0495645_0001039 3300046543 Bacteria 18908
683 Ga0495645_0005490 3300046543 Bacteria 8712
684 Ga0495645_0247572 3300046543 Bacteria 1186
685 Ga0495645_0606080 3300046543 Bacteria 673
686 Ga0495667_0003294 3300046559 Bacteria 10826
687 Ga0495667_0022638 3300046559 Bacteria 4234
688 Ga0495667_0113936 3300046559 Unclassified 1747
689 Ga0495667_0283353 3300046559 Bacteria 1052
690 Ga0495667_0838538 3300046559 Bacteria 566
691 Ga0495656_0027613 3300046615 Unclassified 2269
692 Ga0495634_0051663 3300046642 Bacteria 2758
693 Ga0495634_0134623 3300046642 Bacteria 1573
694 Ga0495635_0000200 3300046663 Bacteria 37911
695 Ga0495635_0028291 3300046663 Bacteria 3896
696 Ga0495635_0063141 3300046663 Bacteria 2544
697 Ga0495635_0136879 3300046663 Bacteria 1669
698 Ga0495588_0118581 3300046674 Unclassified 1395
699 Ga0495657_0001237 3300046675 Bacteria 22362
700 Ga0495657_0036360 3300046675 Bacteria 3404
701 Ga0495657_0062960 3300046675 Bacteria 2449
702 Ga0495599_0000385 3300046678 Bacteria 25410
703 Ga0495599_0001207 3300046678 Bacteria 14651
704 Ga0495599_0012015 3300046678 Bacteria 5328
705 Ga0495599_0013493 3300046678 Bacteria 5048
706 Ga0495599_0018564 3300046678 Bacteria 4333
707 Ga0495623_0000156 3300046679 Bacteria 42279
708 Ga0495623_0005693 3300046679 Bacteria 8137
709 Ga0495623_0174144 3300046679 Bacteria 1255
710 Ga0495646_0068047 3300046680 Bacteria 2103
711 Ga0495658_0113971 3300046683 Bacteria 1628
712 Ga0495658_0180615 3300046683 Bacteria 1309
713 Ga0495658_0758085 3300046683 Bacteria 622
714 Ga0495613_0091423 3300046689 Bacteria 2204
715 Ga0495613_0189445 3300046689 Bacteria 1454
716 Ga0495613_0240738 3300046689 Bacteria 1265
717 Ga0495600_0001690 3300046809 Bacteria 12334
718 Ga0495600_0057426 3300046809 Unclassified 2542
719 Ga0495581_0031911 3300047315 Bacteria 3052
720 Ga0495581_0160232 3300047315 Bacteria 1315
721 Ga0495581_0200290 3300047315 Bacteria 1168
722 Ga0495581_0250423 3300047315 Bacteria 1036
723 Ga0495604_0008848 3300047317 Bacteria 7957
724 Ga0495604_0095343 3300047317 Unclassified 2198
725 Ga0495604_0121186 3300047317 Bacteria 1893
726 Ga0495604_0195203 3300047317 Unclassified 1408
727 Ga0495604_0334362 3300047317 Unclassified 1010
728 Ga0495604_0647415 3300047317 Bacteria 674
729 Ga0495674_0038246 3300047319 Bacteria 4308
730 Ga0495674_0040546 3300047319 Bacteria 4165
731 Ga0495674_0085270 3300047319 Bacteria 2706
732 Ga0495680_0019597 3300047322 Bacteria 5707
733 Ga0495680_0031505 3300047322 Bacteria 4315
734 Ga0495680_0127885 3300047322 Bacteria 1869
735 Ga0495680_0249145 3300047322 Bacteria 1259
736 Ga0495675_0003343 3300047444 Bacteria 9656
737 Ga0495675_0009279 3300047444 Bacteria 6120
738 Ga0495675_0016554 3300047444 Bacteria 4664
739 Ga0495675_0172950 3300047444 Bacteria 1326
740 Ga0495675_0353589 3300047444 Unclassified 864
741 Ga0495684_0002113 3300047471 Bacteria 15945
742 Ga0495684_0003435 3300047471 Bacteria 12412
743 Ga0495684_0089155 3300047471 Unclassified 2337
744 Ga0495593_0073763 3300047673 Bacteria 1770
745 Ga0495593_0103671 3300047673 Unclassified 1457
746 Ga0495602_0005326 3300048088 Bacteria 13502
747 Ga0495602_0019916 3300048088 Bacteria 6644
748 Ga0495602_0095084 3300048088 Bacteria 2461
749 Ga0496101_0100195 3300048904 Bacteria 2167
750 Ga0496102_0651698 3300048905 Bacteria 976
751 Ga0496104_0035102 3300048907 Bacteria 4681
752 Ga0496105_0055635 3300048908 Bacteria 3267
753 Ga0496105_0599479 3300048908 Bacteria 855
754 Ga0496106_0150431 3300048909 Unclassified 1836
755 Ga0496107_0716961 3300048910 Unclassified 735
756 Ga0496108_0546966 3300048911 Bacteria 1010
757 Ga0496108_0770483 3300048911 Bacteria 831
758 Ga0496109_0241694 3300048912 Bacteria 1699
759 Ga0496109_0289985 3300048912 Unclassified 1543
760 Ga0496111_1019318 3300048914 Unclassified 593
761 Ga0496112_0000196 3300048915 Bacteria 39516
762 Ga0496113_0239880 3300048916 Bacteria 1446
763 Ga0496113_0263046 3300048916 Bacteria 1378
764 Ga0496114_0366781 3300048917 Bacteria 1274
765 Ga0501032_0174633 3300049569 Bacteria 1408
766 Ga0501036_0282575 3300049572 Bacteria 1389
767 Ga0501037_0504815 3300049573 Bacteria 820
768 Ga0501038_0193202 3300049574 Bacteria 1637
769 Ga0501038_0402349 3300049574 Unclassified 1059
770 Ga0501041_1086969 3300049577 Bacteria 515
771 Ga0501043_0767555 3300049579 Unclassified 700
772 Ga0501070_0162054 3300049586 Bacteria 1843
773 Ga0501071_0202127 3300049587 Bacteria 1493
774 Ga0501072_0398973 3300049588 Bacteria 1091
775 Ga0501079_0326140 3300049741 Bacteria 1202
776 Ga0501080_0786957 3300049742 Bacteria 835
777 Ga0501044_1212767 3300049823 Bacteria 622
778 nmdc:mga0qj67_331962_c1 3300050509 Bacteria 1230
779 nmdc:mga06r32_1117684_c1 3300050510 Bacteria 737
780 nmdc:mga06r32_113314_c1 3300050510 Bacteria 2669
781 nmdc:mga0n895_1500556_c1 3300050512 Unclassified 640
782 nmdc:mga0n895_158722_c1 3300050512 Bacteria 2293
783 nmdc:mga0rr50_41952_c1 3300050513 Bacteria 3338
784 nmdc:mga08x19_192485_c1 3300050514 Bacteria 1396
785 nmdc:mga08x19_93792_c1 3300050514 Bacteria 1984
786 Ga0495601_0029750 3300053077 Bacteria 3390
787 Ga0495601_0057136 3300053077 Bacteria 2472
788 Ga0495612_0008751 3300053078 Bacteria 4106
789 Ga0495612_0023851 3300053078 Bacteria 2456
790 Ga0495595_0052096 3300053084 Bacteria 1898
791 Ga0495619_0024498 3300053085 Unclassified 3871
792 Ga0495619_0056264 3300053085 Bacteria 2607
793 Ga0495619_0997781 3300053085 Bacteria 560
794 Ga0590071_046608 3300059421 Bacteria 1047
795 Ga0590074_034929 3300059423 Bacteria 895
796 Ga0587090_087411 3300059510 Bacteria 634
797 Ga0070699_100576254
798 JGI24752J21851_1032930
799 JGI25406J46586_10032351
800 Ga0058863_10125579
801 Ga0058863_11665452
802 Ga0058861_10000584
803 Ga0058861_10046646
804 Ga0058861_11593278
805 Ga0058861_12032014
806 Ga0065712_10074141
807 Ga0065715_10169908
808 Ga0065715_10196773
809 Ga0070658_10004996
810 Ga0070658_10005423
811 Ga0070658_10005604
812 Ga0070658_10108991
813 Ga0070658_10177326
814 Ga0070658_10639631
815 Ga0070676_10057744
816 Ga0070676_10078553
817 Ga0070683_100000681
818 Ga0070683_100012618
819 Ga0070683_100025497
820 Ga0070683_100028687
821 Ga0070683_100146612
822 Ga0070683_100207460
823 Ga0070683_100227384
824 Ga0070690_100025728
825 Ga0070670_100008651
826 Ga0070670_100200388
827 Ga0068869_100000336
828 Ga0068869_100718121
829 Ga0070666_10110846
830 Ga0070666_10339171
831 Ga0070666_10503018
832 Ga0070666_10548670
833 Ga0070680_100000247
834 Ga0070680_100005105
835 Ga0070680_100006242
836 Ga0070680_100049309
837 Ga0070680_100352849
838 Ga0070680_100615808
839 Ga0070682_100001941
840 Ga0070682_100861849
841 Ga0068868_100109440
842 Ga0068868_100557281
843 Ga0068868_100647303
844 Ga0070660_100008200
845 Ga0070660_100131677
846 Ga0070660_100311438
847 Ga0070689_100020073
848 Ga0070689_100194013
849 Ga0070689_100650956
850 Ga0070687_100010494
851 Ga0070687_100101337
852 Ga0070687_100327884
853 Ga0070661_100001897
854 Ga0070661_100086485
855 Ga0070661_100153652
856 Ga0070692_10035629
857 Ga0070692_10106284
858 Ga0070692_10627313
859 Ga0070668_100055450
860 Ga0070668_100134691
861 Ga0070669_100002374
862 Ga0070669_100178078
863 Ga0070669_100257763
864 Ga0070675_100000547
865 Ga0070675_100002559
866 Ga0070675_100099296
867 Ga0070675_100285802
868 Ga0070675_100645305
869 Ga0070675_101355819
870 Ga0070671_100152325
871 Ga0070671_100390003
872 Ga0070674_100725588
873 Ga0070673_100013820
874 Ga0070673_100029048
875 Ga0070673_100094070
876 Ga0070673_100901064
877 Ga0070688_100288949
878 Ga0070659_100002963
879 Ga0070659_100110987
880 Ga0070659_100126935
881 Ga0070667_100048207
882 Ga0070667_100062062
883 Ga0070667_100254836
884 Ga0070667_100542343
885 Ga0070667_101098064
886 Ga0070709_10116047
887 Ga0070709_11335186
888 Ga0070714_100033582
889 Ga0070714_100347440
890 Ga0070714_100567033
891 Ga0070714_101777585
892 Ga0070713_100007753
893 Ga0070713_100024185
894 Ga0070713_100101428
895 Ga0070710_10020846
896 Ga0070710_10047944
897 Ga0070701_10302394
898 Ga0070711_100213452
899 Ga0070705_100577534
900 Ga0070694_100218592
901 Ga0070663_101179226
902 Ga0070678_100220838
903 Ga0070662_100055229
904 Ga0070662_100359235
905 Ga0070681_10001887
906 Ga0070681_10003332
907 Ga0070681_10003955
908 Ga0070681_10005293
909 Ga0070681_10009589
910 Ga0070681_10051410
911 Ga0070681_10209015
912 Ga0070681_10330945
913 Ga0070681_11040701
914 Ga0068867_100223953
915 Ga0068867_100300678
916 Ga0070685_10005071
917 Ga0070685_10150450
918 Ga0070685_10474259
919 Ga0070707_100645295
920 Ga0070707_100683137
921 Ga0070698_100151552
922 Ga0070698_100250214
923 Ga0070699_100564996
924 Ga0070679_100000919
925 Ga0070679_100001804
926 Ga0070679_100005710
927 Ga0070679_100022028
928 Ga0070679_100146039
929 Ga0070679_100290355
930 Ga0070679_100334780
931 Ga0070679_100714740
932 Ga0070679_101597268
933 Ga0070684_100005210
934 Ga0070684_100013772
935 Ga0070684_100034974
936 Ga0070684_100044305
937 Ga0070684_100227530
938 Ga0070684_100525700
939 Ga0070684_100808534
940 Ga0070684_101201704
941 Ga0068853_100305087
942 Ga0070672_100061046
943 Ga0070672_100121254
944 Ga0070672_100413326
945 Ga0070672_100551829
946 Ga0070672_100604157
947 Ga0070686_100464234
948 Ga0070686_100568989
949 Ga0070695_100026962
950 Ga0070695_100483654
951 Ga0070695_100496008
952 Ga0070696_100242089
953 Ga0070693_100005997
954 Ga0070693_100096480
955 Ga0070693_100470776
956 Ga0070665_101387001
957 Ga0068855_100115188
958 Ga0068855_100125507
959 Ga0068855_101023024
960 Ga0068855_101363176
961 Ga0068855_101891262
962 Ga0070664_100091147
963 Ga0070664_100137844
964 Ga0070664_100186657
965 Ga0070664_100215487
966 Ga0070664_100268660
967 Ga0070664_100704983
968 Ga0070664_100817538
969 Ga0068857_100003188
970 Ga0068857_100130586
971 Ga0068857_100581944
972 Ga0068856_100054678
973 Ga0068856_100289006
974 Ga0068856_100723210
975 Ga0068856_101824872
976 Ga0070702_100018681
977 Ga0070702_101115420
978 Ga0068852_100007975
979 Ga0068852_100094918
980 Ga0068852_100580647
981 Ga0068852_100842906
982 Ga0068852_101017064
983 Ga0068859_100001968
984 Ga0068859_100036493
985 Ga0068859_100109364
986 Ga0068859_100354582
987 Ga0068859_101972429
988 Ga0068864_100003498
989 Ga0068864_100177643
990 Ga0068864_100260336
991 Ga0068864_100341672
992 Ga0068864_100516741
993 Ga0068866_10285061
994 Ga0068851_10539052
995 Ga0068870_10051829
996 Ga0068863_100017790
997 Ga0068863_100591328
998 Ga0068863_100728263
999 Ga0068858_100023097
1000 Ga0068858_100090363
1001 Ga0068858_100096835
1002 Ga0068858_100664570
1003 Ga0068858_101401544
1004 Ga0068860_100125158
1005 Ga0068860_100613813
1006 Ga0068860_102097355
1007 Ga0068862_100042802
1008 Ga0068862_100043702
1009 Ga0068862_100121228
1010 Ga0081455_10156263
1011 Ga0081539_10000104
1012 Ga0070717_10164669
1013 Ga0070717_10519430
1014 Ga0070712_100212715
1015 Ga0070712_100285982
1016 Ga0070712_100375803
1017 Ga0070712_100556864
1018 Ga0068871_100026192
1019 Ga0068871_100111188
1020 Ga0068871_101535481
1021 Ga0075428_100147487
1022 Ga0075428_100470903
1023 Ga0075431_100053464
1024 Ga0075431_100180951
1025 Ga0075434_100499738
1026 Ga0075434_100616558
1027 Ga0068865_100035690
1028 Ga0068865_100588840
1029 Ga0075436_100076052
1030 Ga0075436_100105513
1031 Ga0075436_100425164
1032 Ga0075436_100485365
1033 Ga0097620_100001968
1034 Ga0097620_100036492
1035 Ga0097620_100109362
1036 Ga0097620_100354613
1037 Ga0097620_101972420
1038 Ga0075435_100052188
1039 Ga0075435_100159233
1040 Ga0075435_100390412
1041 Ga0075435_100498057
1042 Ga0105240_10008178
1043 Ga0105240_10267296
1044 Ga0105240_10724576
1045 Ga0111539_11089178
1046 Ga0105245_10033899
1047 Ga0105245_10103172
1048 Ga0105247_10777299
1049 Ga0105243_10793108
1050 Ga0105243_11054141
1051 Ga0105241_10073374
1052 Ga0105241_10661514
1053 Ga0105242_10037749
1054 Ga0105242_10452151
1055 Ga0105242_10513244
1056 Ga0105242_11111080
1057 Ga0105248_10011323
1058 Ga0105248_10072370
1059 Ga0105248_10078912
1060 Ga0105248_10211730
1061 Ga0105248_10527922
1062 Ga0105237_11009645
1063 Ga0105238_10731684
1064 Ga0105249_10000115
1065 Ga0105249_10450049
1066 Ga0105249_10512367
1067 Ga0105249_11750512
1068 Ga0099796_10257769
1069 Ga0105239_10020162
1070 Ga0105239_11047806
1071 Ga0105246_10000533
1072 Ga0105246_10285282
1073 Ga0105246_11029399
1074 Ga0157373_10075899
1075 Ga0157373_10082017
1076 Ga0157373_10284407
1077 Ga0157373_10384254
1078 Ga0157373_10386513
1079 Ga0157373_11476864
1080 Ga0157371_10046464
1081 Ga0157371_10051360
1082 Ga0157370_10008754
1083 Ga0157370_10011411
1084 Ga0157370_10073976
1085 Ga0157370_10429733
1086 Ga0157370_10528998
1087 Ga0157370_10934539
1088 Ga0157370_11148298
1089 Ga0157370_11389723
1090 Ga0157369_10014454
1091 Ga0157369_10017798
1092 Ga0157369_10050550
1093 Ga0157369_10079483
1094 Ga0157369_10875500
1095 Ga0157369_11322304
1096 Ga0157374_10007525
1097 Ga0157374_10760190
1098 Ga0157378_11104443
1099 Ga0163162_10228112
1100 Ga0163162_10353547
1101 Ga0163162_10728725
1102 Ga0163162_10919024
1103 Ga0157372_10004359
1104 Ga0157372_10013032
1105 Ga0157372_10015537
1106 Ga0157372_10037374
1107 Ga0157372_10174728
1108 Ga0157372_10247758
1109 Ga0157372_10805643
1110 Ga0157372_11339263
1111 Ga0157372_11906903
1112 Ga0157372_12009261
1113 Ga0157375_10019946
1114 Ga0157375_10038310
1115 Ga0157375_10047714
1116 Ga0157375_10208812
1117 Ga0157375_10504614
1118 Ga0157375_10818331
1119 Ga0157375_10950110
1120 Ga0157375_11842827
1121 Ga0163163_10046544
1122 Ga0163163_10935451
1123 Ga0163163_11736291
1124 Ga0157377_10005155
1125 Ga0157377_10055970
1126 Ga0157377_10117135
1127 Ga0157379_10124556
1128 Ga0157379_10608980
1129 Ga0157379_11309624
1130 Ga0157376_10006603
1131 Ga0157376_10858650
1132 Ga0157376_10948364
1133 Ga0157376_11049617
1134 Ga0182007_10022680
1135 Ga0182007_10113149
1136 Ga0206356_10424242
1137 Ga0206352_10989846
1138 Ga0206350_11611277
1139 Ga0207697_10116964
1140 Ga0207697_10184474
1141 Ga0207682_10072927
1142 Ga0207692_10187488
1143 Ga0207692_10532303
1144 Ga0207692_10721631
1145 Ga0207692_10977542
1146 Ga0207688_10040101
1147 Ga0207688_10305008
1148 Ga0207680_10080016
1149 Ga0207680_10480743
1150 Ga0207647_10311503
1151 Ga0207699_10507717
1152 Ga0207699_10642903
1153 Ga0207645_10003872
1154 Ga0207645_10063020
1155 Ga0207643_10061382
1156 Ga0207643_10378805
1157 Ga0207705_10007107
1158 Ga0207705_10028191
1159 Ga0207705_10052172
1160 Ga0207705_10128599
1161 Ga0207705_11421881
1162 Ga0207654_10036126
1163 Ga0207707_10002146
1164 Ga0207707_10002891
1165 Ga0207707_10008528
1166 Ga0207707_10016136
1167 Ga0207707_10041205
1168 Ga0207707_10246032
1169 Ga0207707_10307852
1170 Ga0207707_10903195
1171 Ga0207695_10022335
1172 Ga0207695_10031937
1173 Ga0207693_10160874
1174 Ga0207693_10202071
1175 Ga0207693_10399726
1176 Ga0207693_10888010
1177 Ga0207663_10024888
1178 Ga0207663_10723126
1179 Ga0207660_10000668
1180 Ga0207660_10004932
1181 Ga0207660_10006680
1182 Ga0207660_10007146
1183 Ga0207660_10173324
1184 Ga0207660_10421980
1185 Ga0207660_10538051
1186 Ga0207662_10004709
1187 Ga0207662_10070614
1188 Ga0207657_10051867
1189 Ga0207657_10069100
1190 Ga0207657_10187741
1191 Ga0207657_10227481
1192 Ga0207657_10291830
1193 Ga0207649_10001792
1194 Ga0207649_10039518
1195 Ga0207649_10085800
1196 Ga0207649_10102300
1197 Ga0207652_10003423
1198 Ga0207652_10042703
1199 Ga0207652_10158298
1200 Ga0207652_10280152
1201 Ga0207652_10425959
1202 Ga0207652_10700286
1203 Ga0207652_11610009
1204 Ga0207652_11708284
1205 Ga0207681_10100699
1206 Ga0207681_10342882
1207 Ga0207681_10731643
1208 Ga0207694_11085868
1209 Ga0207650_10005580
1210 Ga0207650_10096560
1211 Ga0207659_10013350
1212 Ga0207659_10025849
1213 Ga0207659_10075624
1214 Ga0207659_11229672
1215 Ga0207687_10118162
1216 Ga0207700_10088817
1217 Ga0207700_10108769
1218 Ga0207700_10275037
1219 Ga0207700_10594852
1220 Ga0207664_10228072
1221 Ga0207644_10126985
1222 Ga0207644_10766818
1223 Ga0207690_10003494
1224 Ga0207690_10048007
1225 Ga0207690_10052981
1226 Ga0207690_10639805
1227 Ga0207706_10015214
1228 Ga0207706_10101881
1229 Ga0207706_10495699
1230 Ga0207686_10013975
1231 Ga0207686_10021299
1232 Ga0207686_10724998
1233 Ga0207686_10735967
1234 Ga0207670_10122881
1235 Ga0207670_10646978
1236 Ga0207670_10693987
1237 Ga0207669_10094194
1238 Ga0207704_10009122
1239 Ga0207704_10676377
1240 Ga0207691_10025086
1241 Ga0207691_10116828
1242 Ga0207691_10132033
1243 Ga0207691_10244680
1244 Ga0207691_10264695
1245 Ga0207691_10402150
1246 Ga0207691_10714684
1247 Ga0207711_10016049
1248 Ga0207711_10077486
1249 Ga0207711_10232911
1250 Ga0207711_10254469
1251 Ga0207711_10402343
1252 Ga0207689_10000838
1253 Ga0207689_10393465
1254 Ga0207661_10002707
1255 Ga0207661_10028371
1256 Ga0207661_10032381
1257 Ga0207661_10062899
1258 Ga0207661_10065056
1259 Ga0207661_10077152
1260 Ga0207661_10387357
1261 Ga0207661_10476863
1262 Ga0207679_10004107
1263 Ga0207679_10031754
1264 Ga0207679_10242689
1265 Ga0207679_10401590
1266 Ga0207679_10804485
1267 Ga0207679_11423032
1268 Ga0207667_10355830
1269 Ga0207667_10840176
1270 Ga0207667_11051448
1271 Ga0207667_11159274
1272 Ga0207651_10026293
1273 Ga0207651_10800207
1274 Ga0207651_10800652
1275 Ga0207651_10988933
1276 Ga0207712_10000261
1277 Ga0207712_10341306
1278 Ga0207712_10630381
1279 Ga0207640_10317831
1280 Ga0207640_11169943
1281 Ga0207658_10004283
1282 Ga0207658_10075418
1283 Ga0207658_10172563
1284 Ga0207658_10445610
1285 Ga0207658_10932462
1286 Ga0207658_11262531
1287 Ga0207677_10051698
1288 Ga0207677_10327514
1289 Ga0207703_10018395
1290 Ga0207703_10188836
1291 Ga0207639_10225215
1292 Ga0207639_10249748
1293 Ga0207639_10663660
1294 Ga0207678_10538115
1295 Ga0207678_10772993
1296 Ga0207708_10378559
1297 Ga0207708_10665233
1298 Ga0207702_10054033
1299 Ga0207702_10284363
1300 Ga0207702_10374612
1301 Ga0207641_10010846
1302 Ga0207648_10020613
1303 Ga0207648_10315216
1304 Ga0207648_10510057
1305 Ga0207676_10038651
1306 Ga0207676_10176016
1307 Ga0207676_10219267
1308 Ga0207676_10412359
1309 Ga0207674_10001189
1310 Ga0207674_10002932
1311 Ga0207674_10147711
1312 Ga0207674_10288620
1313 Ga0207674_10324052
1314 Ga0207675_100088311
1315 Ga0207675_100433668
1316 Ga0207675_100757380
1317 Ga0207683_10283311
1318 Ga0207683_10400206
1319 Ga0207698_10006278
1320 Ga0207698_10504270
1321 Ga0207698_10664933
1322 Ga0207698_10803319
1323 Ga0207698_12386460
1324 Ga0268266_11334632
1325 Ga0268265_10271482
1326 Ga0268264_10029590
1327 Ga0268264_10388169
1328 Ga0268264_10616745
1329 Ga0268264_10759724
1330 Ga0265332_10027215
1331 Ga0265332_10034489
1332 Ga0265340_10239648
1333 Ga0265331_10071106
1334 Ga0265327_10017353
1335 Ga0307408_100006742
1336 Ga0307408_100235595
1337 Ga0307408_100524586
1338 Ga0265314_10005150
1339 Ga0265314_10101772
1340 Ga0265342_10131775
1341 Ga0307405_10000648
1342 Ga0307405_10651374
1343 Ga0307413_10000361
1344 Ga0307413_10434584
1345 Ga0307413_10800301
1346 Ga0307410_10000204
1347 Ga0307410_10199084
1348 Ga0307410_10350542
1349 Ga0307406_10011710
1350 Ga0307406_10660845
1351 Ga0307406_10809913
1352 Ga0307407_10000173
1353 Ga0307412_10150855
1354 Ga0307412_10733183
1355 Ga0307409_100000064
1356 Ga0307409_100040901
1357 Ga0307409_101092686
1358 Ga0307416_100174869
1359 Ga0307416_100254469
1360 Ga0307416_100541864
1361 Ga0307416_101914799
1362 Ga0307414_10016841
1363 Ga0307411_10000371
1364 Ga0307415_100004545
1365 Ga0307415_100084953
1366 Ga0307415_100235040
1367 Ga0307415_100240421
1368 Ga0373934_0000634
1369 Ga0373934_0192254
1370 Ga0373923_0115703
1371 Ga0373953_0014611
1372 Ga0373953_0167900
1373 Ga0373954_0037354
1374 Ga0373956_0001499
1375 Ga0373956_0032412
1376 Ga0373957_0012172
1377 Ga0373957_0076576
1378 Ga0373943_0215904
1379 Ga0373943_0391351
1380 Ga0373946_0296483
1381 Ga0373955_0005518
1382 Ga0373955_0015819
1383 Ga0373955_0024936
1384 Ga0373931_0530032
1385 Ga0373935_0049313
1386 Ga0373927_0162312
1387 Ga0373927_0177677
1388 Ga0373933_0008374
1389 Ga0373933_0049512
1390 Ga0373937_0002914
1391 Ga0373937_0018683
1392 Ga0373937_0033508
1393 Ga0373937_0055491
1394 Ga0373925_0073606
1395 Ga0395899_0003367
1396 Ga0395900_0068956
1397 Ga0395905_0024256
1398 Ga0436364_0474148
1399 Ga0395901_0003407
1400 Ga0436365_1643073
1401 Ga0451802_1558764
1402 Ga0451807_0755438
1403 Ga0439448_0074585
1404 Ga0450894_029478
1405 Ga0439434_0022152
1406 Ga0451577_0017882
1407 Ga0451577_0953976
1408 Ga0439440_0078589
1409 Ga0466966_0752680
1410 Ga0453684_0003703
1411 Ga0466968_0406693
1412 Ga0466957_0313933
1413 Ga0466957_0753834
1414 Ga0451576_0025244
1415 Ga0451576_0392870
1416 Ga0451576_0637498
1417 Ga0466958_0024376
1418 Ga0466958_0736516
1419 Ga0466967_0677241
1420 Ga0466967_1266534
1421 Ga0495592_0017200
1422 Ga0495603_0020192
1423 Ga0495629_0029745
1424 Ga0495629_0196473
1425 Ga0495629_0879691
1426 Ga0495651_0001301
1427 Ga0495651_0012957
1428 Ga0495651_0036726
1429 Ga0495653_0003982
1430 Ga0495653_0005425
1431 Ga0495653_0042851
1432 Ga0495653_0411169
1433 Ga0495580_0001189
1434 Ga0495580_0678661
1435 Ga0495582_0181429
1436 Ga0495639_0063015
1437 Ga0495639_0064663
1438 Ga0495662_0092708
1439 Ga0495662_0180659
1440 Ga0495664_0016717
1441 Ga0495664_0064249
1442 Ga0495594_0619531
1443 Ga0495594_0767002
1444 Ga0495608_0024437
1445 Ga0495608_0024921
1446 Ga0495608_0065126
1447 Ga0495608_0119141
1448 Ga0495618_0030082
1449 Ga0495618_0300625
1450 Ga0495618_0371045
1451 Ga0495628_0000494
1452 Ga0495628_0037014
1453 Ga0495628_0061517
1454 Ga0495628_0227716
1455 Ga0495628_0239300
1456 Ga0495630_0008617
1457 Ga0495630_0039168
1458 Ga0495630_0155719
1459 Ga0495630_0242162
1460 Ga0495644_0146542
1461 Ga0495663_0143727
1462 Ga0495666_0052197
1463 Ga0495652_0004937
1464 Ga0495652_0018334
1465 Ga0495652_0032147
1466 Ga0495652_0077805
1467 Ga0495665_0016052
1468 Ga0495640_0075659
1469 Ga0495640_0147339
1470 Ga0495586_0181927
1471 Ga0495587_0000269
1472 Ga0495587_0000334
1473 Ga0495587_0004284
1474 Ga0495598_0240935
1475 Ga0495621_0020889
1476 Ga0495621_0174196
1477 Ga0495645_0000918
1478 Ga0495645_0001039
1479 Ga0495645_0005490
1480 Ga0495645_0247572
1481 Ga0495645_0606080
1482 Ga0495667_0003294
1483 Ga0495667_0022638
1484 Ga0495667_0113936
1485 Ga0495667_0283353
1486 Ga0495667_0838538
1487 Ga0495656_0027613
1488 Ga0495634_0051663
1489 Ga0495634_0134623
1490 Ga0495635_0000200
1491 Ga0495635_0028291
1492 Ga0495635_0063141
1493 Ga0495635_0136879
1494 Ga0495588_0118581
1495 Ga0495657_0001237
1496 Ga0495657_0036360
1497 Ga0495657_0062960
1498 Ga0495599_0000385
1499 Ga0495599_0001207
1500 Ga0495599_0012015
1501 Ga0495599_0013493
1502 Ga0495599_0018564
1503 Ga0495623_0000156
1504 Ga0495623_0005693
1505 Ga0495623_0174144
1506 Ga0495646_0068047
1507 Ga0495658_0113971
1508 Ga0495658_0180615
1509 Ga0495658_0758085
1510 Ga0495613_0091423
1511 Ga0495613_0189445
1512 Ga0495613_0240738
1513 Ga0495600_0001690
1514 Ga0495600_0057426
1515 Ga0495581_0031911
1516 Ga0495581_0160232
1517 Ga0495581_0200290
1518 Ga0495581_0250423
1519 Ga0495604_0008848
1520 Ga0495604_0095343
1521 Ga0495604_0121186
1522 Ga0495604_0195203
1523 Ga0495604_0334362
1524 Ga0495604_0647415
1525 Ga0495674_0038246
1526 Ga0495674_0040546
1527 Ga0495674_0085270
1528 Ga0495680_0019597
1529 Ga0495680_0031505
1530 Ga0495680_0127885
1531 Ga0495680_0249145
1532 Ga0495675_0003343
1533 Ga0495675_0009279
1534 Ga0495675_0016554
1535 Ga0495675_0172950
1536 Ga0495675_0353589
1537 Ga0495684_0002113
1538 Ga0495684_0003435
1539 Ga0495684_0089155
1540 Ga0495593_0073763
1541 Ga0495593_0103671
1542 Ga0495602_0005326
1543 Ga0495602_0019916
1544 Ga0495602_0095084
1545 Ga0496101_0100195
1546 Ga0496102_0651698
1547 Ga0496104_0035102
1548 Ga0496105_0055635
1549 Ga0496105_0599479
1550 Ga0496106_0150431
1551 Ga0496107_0716961
1552 Ga0496108_0546966
1553 Ga0496108_0770483
1554 Ga0496109_0241694
1555 Ga0496109_0289985
1556 Ga0496111_1019318
1557 Ga0496112_0000196
1558 Ga0496113_0239880
1559 Ga0496113_0263046
1560 Ga0496114_0366781
1561 Ga0501032_0174633
1562 Ga0501036_0282575
1563 Ga0501037_0504815
1564 Ga0501038_0193202
1565 Ga0501038_0402349
1566 Ga0501041_1086969
1567 Ga0501043_0767555
1568 Ga0501070_0162054
1569 Ga0501071_0202127
1570 Ga0501072_0398973
1571 Ga0501079_0326140
1572 Ga0501080_0786957
1573 Ga0501044_1212767
1574 nmdc:mga0qj67_331962_c1
1575 nmdc:mga06r32_1117684_c1
1576 nmdc:mga06r32_113314_c1
1577 nmdc:mga0n895_1500556_c1
1578 nmdc:mga0n895_158722_c1
1579 nmdc:mga0rr50_41952_c1
1580 nmdc:mga08x19_192485_c1
1581 nmdc:mga08x19_93792_c1
1582 Ga0495601_0029750
1583 Ga0495601_0057136
1584 Ga0495612_0008751
1585 Ga0495612_0023851
1586 Ga0495595_0052096
1587 Ga0495619_0024498
1588 Ga0495619_0056264
1589 Ga0495619_0997781
1590 Ga0590071_046608
1591 Ga0590074_034929
1592 Ga0587090_087411

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09424

YqeY

Yqey-like protein

12

149

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8324 1 143
1ng6-assembly1.cif.gz_A structure of cytosolic protein of unknown function yqey from bacillus subtilis 0.8074 1 143
3l9f-assembly2.cif.gz_C the crystal structure of smu.1604c from streptococcus mutans ua159 0.6581 37 89
2p06-assembly1.cif.gz_A-2 crystal structure of a predicted coding region af_0060 from archaeoglobus fulgidus dsm 4304 0.5712 26 90
4eve-assembly1.cif.gz_A crystal structure hp-nap from strain ys29 in apo form 0.561 11 90
ID Description Score Start End Superfamily
3v1fA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9671 54 89 4.10.860.20
af_I6X831_2_93_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9617 2 91 1.10.1510.10
3v1fB00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9565 54 89 4.10.860.20
3v1bA00 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9468 54 89 4.10.860.20
af_C6Y4B8_28_116_1.10.1510.10 Mainly Alpha;Orthogonal Bundle;Hypothetical Protein Yqey; Chain: A; domain1;Uncharacterised protein YqeY/AIM41, N-terminal domain 0.9364 4 91 1.10.1510.10
ID Description Score Start End GO Terms
AF-A0A136KR09-F1-model_v4 Yqey-like protein 0.9899 4 93 GO:0016884
AF-A0A800JZ68-F1-model_v4 GatB/YqeY domain-containing protein 0.9873 4 92 GO:0016884
AF-A0A837IIU3-F1-model_v4 GatB/YqeY domain-containing protein 0.9763 5 92 GO:0016884
AF-A0A1J5B5E0-F1-model_v4 Glutamyl-tRNA amidotransferase 0.9761 4 92 GO:0016884
AF-A0A7C5D377-F1-model_v4 GatB/YqeY domain-containing protein 0.9699 1 90 GO:0016884

Map