F480947

General Info

Members Datasets Scaffolds Average Seq Length
790 309 790 482

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10151317|Ga0105248_101513172
Length 573
Sequence MDAAGGRRQRRRDHQHGDRPCDDISHVCPPGSASVPTSTTEITEKSPHVWLGALSVLGGEGSELRNNSSPPEMPAHVLGIDVGTGGTRAVVVDQGGRIVASATEEHEAFASLQIGWAEQRPEDWWRAAGAAIRRALAHARLRGTDISCVGLTGQMHGAVMLDASGDAVRPAPIWCDVRTSRQCAELTERIGAQRIIQWTCNPALANFTLTKLLWVQQHEPGLWSRVRAVMLPKDYVRFRLTGEKATDVADASGTLMLDVARRRWSEEMLQAAGIDRMVLPSLHESPDVCGTISKAGADASGLAAGTPVVAGAGDQAAGALGLGIVSPXAVSATIGTSGVVFAATDRPAVDPRGRLHTFCHAIPGRWHVMGVTQAAGLSLRWFRDQFARDGDAGGPASYDQLTEEAAAVSPGSEGLLWAPYLMGERTPHLDPDARGALVGLTASHTRAHAVRAVLEGVAFSLKDTLTILSEMDVPMTTIRLGGGGARSPLWRQIQADAYARDVEIVEAEEGAAYGAAILAGVGGGLWPSVDAACASVVRVAAGVRPNERGAAAMTTGYAAYRRVYPAIKSIFRT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
176 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
177 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
211 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
212 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
213 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
245 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
296 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
297 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
300 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
301 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
307 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
308 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.87
Metatranscriptomes 0.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.52
Nodule 0
Rhizoplane 3.54
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2054937 2162886007 Unclassified 2372
2 rootH2_10071456 3300003320 Bacteria 8644
3 Ga0065704_10078208 3300005289 Bacteria 4497
4 Ga0065712_10071722 3300005290 Bacteria 5098
5 Ga0065712_10085738 3300005290 Unclassified 2649
6 Ga0065715_10099289 3300005293 Bacteria 3431
7 Ga0065715_10109053 3300005293 Bacteria 2683
8 Ga0065707_10002876 3300005295 Bacteria 5654
9 Ga0065707_10082532 3300005295 Bacteria 14047
10 Ga0070658_10002614 3300005327 Bacteria 15008
11 Ga0070683_100006910 3300005329 Bacteria 9535
12 Ga0070683_100008769 3300005329 Bacteria 8596
13 Ga0070683_100021572 3300005329 Bacteria 5749
14 Ga0070683_100070557 3300005329 Bacteria 3259
15 Ga0070690_100028588 3300005330 Bacteria 3453
16 Ga0070670_100017726 3300005331 Bacteria 6109
17 Ga0068869_100020910 3300005334 Unclassified 4496
18 Ga0070666_10003842 3300005335 Bacteria 9113
19 Ga0070666_10042742 3300005335 Bacteria 3033
20 Ga0070680_100018455 3300005336 Bacteria 5510
21 Ga0070680_100031524 3300005336 Bacteria 4263
22 Ga0070680_100137248 3300005336 Bacteria 2049
23 Ga0068868_100001960 3300005338 Bacteria 14101
24 Ga0068868_100007353 3300005338 Bacteria 7843
25 Ga0068868_100014059 3300005338 Bacteria 5892
26 Ga0068868_100015308 3300005338 Bacteria 5670
27 Ga0070689_100016063 3300005340 Bacteria 5475
28 Ga0070689_100035853 3300005340 Bacteria 3791
29 Ga0070661_100004719 3300005344 Bacteria 9377
30 Ga0070661_100171148 3300005344 Unclassified 1649
31 Ga0070669_100042973 3300005353 Bacteria 3290
32 Ga0070669_100164441 3300005353 Bacteria 1726
33 Ga0070675_100082844 3300005354 Bacteria 2677
34 Ga0070673_100128151 3300005364 Unclassified 2126
35 Ga0070659_100013438 3300005366 Bacteria 6094
36 Ga0070659_100068315 3300005366 Bacteria 2819
37 Ga0070703_10013902 3300005406 Bacteria 2287
38 Ga0070709_10072226 3300005434 Bacteria 2230
39 Ga0070709_10093478 3300005434 Bacteria 1988
40 Ga0070714_100000065 3300005435 Bacteria 96459
41 Ga0070714_100009692 3300005435 Bacteria 7584
42 Ga0070714_100115807 3300005435 Bacteria 2379
43 Ga0070714_100178423 3300005435 Unclassified 1931
44 Ga0070713_100010317 3300005436 Bacteria 6746
45 Ga0070713_100052784 3300005436 Unclassified 3367
46 Ga0070713_100067191 3300005436 Unclassified 3018
47 Ga0070701_10021017 3300005438 Bacteria 3108
48 Ga0070701_10039158 3300005438 Bacteria 2403
49 Ga0070711_100000441 3300005439 Bacteria 21555
50 Ga0070711_100010131 3300005439 Bacteria 5825
51 Ga0070711_100011410 3300005439 Bacteria 5516
52 Ga0070711_100012830 3300005439 Bacteria 5247
53 Ga0070711_100020844 3300005439 Bacteria 4231
54 Ga0070705_100003449 3300005440 Bacteria 7755
55 Ga0070700_100011097 3300005441 Bacteria 4983
56 Ga0070700_100044426 3300005441 Bacteria 2736
57 Ga0070694_100002059 3300005444 Bacteria 11922
58 Ga0070694_100002458 3300005444 Bacteria 10936
59 Ga0070694_100020215 3300005444 Bacteria 4243
60 Ga0070708_100002019 3300005445 Bacteria 15622
61 Ga0070708_100002323 3300005445 Bacteria 14714
62 Ga0070708_100002603 3300005445 Bacteria 13958
63 Ga0070708_100094548 3300005445 Unclassified 2727
64 Ga0070678_100049829 3300005456 Bacteria 3024
65 Ga0070681_10000055 3300005458 Bacteria 80179
66 Ga0070681_10029576 3300005458 Bacteria 5501
67 Ga0070681_10059518 3300005458 Unclassified 3800
68 Ga0070681_10060176 3300005458 Bacteria 3776
69 Ga0070681_10160339 3300005458 Bacteria 2173
70 Ga0068867_100019588 3300005459 Bacteria 4820
71 Ga0068867_100043396 3300005459 Bacteria 3292
72 Ga0070685_10048476 3300005466 Bacteria 2446
73 Ga0070706_100002696 3300005467 Bacteria 17765
74 Ga0070706_100006514 3300005467 Bacteria 11020
75 Ga0070707_100003997 3300005468 Bacteria 13883
76 Ga0070707_100026349 3300005468 Bacteria 5519
77 Ga0070707_100126963 3300005468 Bacteria 2478
78 Ga0070707_100156409 3300005468 Unclassified 2220
79 Ga0070707_100244129 3300005468 Unclassified 1748
80 Ga0070698_100000200 3300005471 Bacteria 57460
81 Ga0070698_100034000 3300005471 Bacteria 5281
82 Ga0070698_100086646 3300005471 Bacteria 3118
83 Ga0070698_100088872 3300005471 Unclassified 3074
84 Ga0070698_100094262 3300005471 Bacteria 2973
85 Ga0070698_100096294 3300005471 Bacteria 2936
86 Ga0070699_100000156 3300005518 Bacteria 64338
87 Ga0070699_100024708 3300005518 Bacteria 5180
88 Ga0070699_100051478 3300005518 Bacteria 3565
89 Ga0070699_100084372 3300005518 Bacteria 2772
90 Ga0070679_100016382 3300005530 Bacteria 7148
91 Ga0070679_100146930 3300005530 Unclassified 2335
92 Ga0070679_100212057 3300005530 Bacteria 1900
93 Ga0070684_100007024 3300005535 Bacteria 8750
94 Ga0070684_100075978 3300005535 Bacteria 2964
95 Ga0070697_100000235 3300005536 Bacteria 44962
96 Ga0070697_100012862 3300005536 Bacteria 6558
97 Ga0070697_100030767 3300005536 Bacteria 4314
98 Ga0070697_100066894 3300005536 Bacteria 2938
99 Ga0070697_100207316 3300005536 Bacteria 1668
100 Ga0068853_100064113 3300005539 Bacteria 3185
101 Ga0068853_100091158 3300005539 Unclassified 2680
102 Ga0070672_100103052 3300005543 Unclassified 2317
103 Ga0070686_100015781 3300005544 Bacteria 4384
104 Ga0070695_100003121 3300005545 Bacteria 9649
105 Ga0070695_100073059 3300005545 Bacteria 2250
106 Ga0070696_100017071 3300005546 Bacteria 4898
107 Ga0070693_100037881 3300005547 Unclassified 2692
108 Ga0070693_100039810 3300005547 Bacteria 2635
109 Ga0070665_100028955 3300005548 Bacteria 5576
110 Ga0070665_100051409 3300005548 Bacteria 4133
111 Ga0070665_100156110 3300005548 Unclassified 2284
112 Ga0070704_100025720 3300005549 Bacteria 3879
113 Ga0068855_100001077 3300005563 Bacteria 33925
114 Ga0068855_100002871 3300005563 Bacteria 21140
115 Ga0068855_100037082 3300005563 Bacteria 5800
116 Ga0068855_100066292 3300005563 Bacteria 4210
117 Ga0070664_100001803 3300005564 Bacteria 17165
118 Ga0070664_100007698 3300005564 Bacteria 8699
119 Ga0068857_100000041 3300005577 Bacteria 70173
120 Ga0068857_100147381 3300005577 Bacteria 2130
121 Ga0068854_100005254 3300005578 Bacteria 8168
122 Ga0068854_100027125 3300005578 Unclassified 3945
123 Ga0068854_100066423 3300005578 Bacteria 2625
124 Ga0068856_100000355 3300005614 Bacteria 49986
125 Ga0068856_100001245 3300005614 Bacteria 26739
126 Ga0068856_100001397 3300005614 Bacteria 25289
127 Ga0068856_100046450 3300005614 Bacteria 4277
128 Ga0068856_100061884 3300005614 Bacteria 3697
129 Ga0068856_100087222 3300005614 Bacteria 3102
130 Ga0068856_100087961 3300005614 Bacteria 3089
131 Ga0068856_100193573 3300005614 Bacteria 2047
132 Ga0068852_100046839 3300005616 Bacteria 3686
133 Ga0068859_100000959 3300005617 Bacteria 29530
134 Ga0068859_100005424 3300005617 Bacteria 12967
135 Ga0068859_100015114 3300005617 Bacteria 7747
136 Ga0068859_100027605 3300005617 Bacteria 5693
137 Ga0068859_100029316 3300005617 Bacteria 5522
138 Ga0068859_100033126 3300005617 Bacteria 5190
139 Ga0068859_100079723 3300005617 Bacteria 3315
140 Ga0068859_100192529 3300005617 Bacteria 2124
141 Ga0068864_100000940 3300005618 Bacteria 24377
142 Ga0068864_100005434 3300005618 Bacteria 10446
143 Ga0068864_100006890 3300005618 Bacteria 9315
144 Ga0068861_100006960 3300005719 Bacteria 7726
145 Ga0068861_100038189 3300005719 Bacteria 3574
146 Ga0068870_10015992 3300005840 Bacteria 3574
147 Ga0068863_100070331 3300005841 Bacteria 3310
148 Ga0068863_100127068 3300005841 Bacteria 2433
149 Ga0068863_100176469 3300005841 Unclassified 2051
150 Ga0068858_100028183 3300005842 Bacteria 5218
151 Ga0068858_100035131 3300005842 Unclassified 4649
152 Ga0068858_100061145 3300005842 Bacteria 3482
153 Ga0068858_100187227 3300005842 Bacteria 1955
154 Ga0068860_100002847 3300005843 Bacteria 17956
155 Ga0068860_100038275 3300005843 Bacteria 4588
156 Ga0068860_100121345 3300005843 Bacteria 2503
157 Ga0068862_100016749 3300005844 Bacteria 6102
158 Ga0068862_100091064 3300005844 Bacteria 2655
159 Ga0081455_10066861 3300005937 Bacteria 2998
160 Ga0070717_10000558 3300006028 Bacteria 23672
161 Ga0070717_10002266 3300006028 Bacteria 13490
162 Ga0070717_10003199 3300006028 Bacteria 11700
163 Ga0070717_10004158 3300006028 Bacteria 10434
164 Ga0070717_10012524 3300006028 Bacteria 6469
165 Ga0070717_10031206 3300006028 Bacteria 4285
166 Ga0075364_10063086 3300006051 Bacteria 2432
167 Ga0070715_10000032 3300006163 Bacteria 83594
168 Ga0070716_100002392 3300006173 Bacteria 8635
169 Ga0070716_100050396 3300006173 Unclassified 2363
170 Ga0070716_100060558 3300006173 Unclassified 2187
171 Ga0070712_100000849 3300006175 Bacteria 18182
172 Ga0070712_100001921 3300006175 Bacteria 12720
173 Ga0070712_100005692 3300006175 Bacteria 7705
174 Ga0070712_100023513 3300006175 Unclassified 4072
175 Ga0070712_100039273 3300006175 Bacteria 3239
176 Ga0070712_100049404 3300006175 Bacteria 2921
177 Ga0075367_10049947 3300006178 Bacteria 2467
178 Ga0075366_10000144 3300006195 Bacteria 29999
179 Ga0075366_10010326 3300006195 Bacteria 5241
180 Ga0097621_100000533 3300006237 Bacteria 26715
181 Ga0097621_100000581 3300006237 Bacteria 25739
182 Ga0097621_100002271 3300006237 Bacteria 13157
183 Ga0097621_100003948 3300006237 Bacteria 10274
184 Ga0097621_100061367 3300006237 Bacteria 3083
185 Ga0097621_100119678 3300006237 Unclassified 2232
186 Ga0075370_10045341 3300006353 Bacteria 2487
187 Ga0068871_100000221 3300006358 Bacteria 40089
188 Ga0068871_100000664 3300006358 Bacteria 23618
189 Ga0068871_100004354 3300006358 Bacteria 9840
190 Ga0068871_100009590 3300006358 Bacteria 7026
191 Ga0068871_100025464 3300006358 Bacteria 4604
192 Ga0068871_100056040 3300006358 Unclassified 3203
193 Ga0068871_100058610 3300006358 Bacteria 3136
194 Ga0075428_100087856 3300006844 Bacteria 3391
195 Ga0075428_100139940 3300006844 Unclassified 2631
196 Ga0075431_100007696 3300006847 Bacteria 10728
197 Ga0075431_100008530 3300006847 Bacteria 10261
198 Ga0075433_10000957 3300006852 Bacteria 20408
199 Ga0075433_10002695 3300006852 Bacteria 13559
200 Ga0075433_10030368 3300006852 Bacteria 4610
201 Ga0075434_100000557 3300006871 Bacteria 28585
202 Ga0075434_100017276 3300006871 Bacteria 6948
203 Ga0075434_100034773 3300006871 Bacteria 4979
204 Ga0075434_100131160 3300006871 Unclassified 2525
205 Ga0075434_100230089 3300006871 Bacteria 1873
206 Ga0075429_100057680 3300006880 Bacteria 3381
207 Ga0068865_100015086 3300006881 Bacteria 4923
208 Ga0068865_100016076 3300006881 Unclassified 4779
209 Ga0068865_100029088 3300006881 Bacteria 3662
210 Ga0068865_100077081 3300006881 Bacteria 2381
211 Ga0068865_100113486 3300006881 Bacteria 2003
212 Ga0075436_100001203 3300006914 Bacteria 17612
213 Ga0075436_100006202 3300006914 Bacteria 8198
214 Ga0075436_100010366 3300006914 Bacteria 6385
215 Ga0075436_100015949 3300006914 Bacteria 5142
216 Ga0075436_100031768 3300006914 Bacteria 3637
217 Ga0075436_100063164 3300006914 Bacteria 2560
218 Ga0097620_100000959 3300006931 Bacteria 29530
219 Ga0097620_100005424 3300006931 Bacteria 12967
220 Ga0097620_100015114 3300006931 Bacteria 7747
221 Ga0097620_100027605 3300006931 Bacteria 5693
222 Ga0097620_100029316 3300006931 Bacteria 5522
223 Ga0097620_100033120 3300006931 Bacteria 5190
224 Ga0097620_100079723 3300006931 Bacteria 3315
225 Ga0097620_100192531 3300006931 Bacteria 2124
226 Ga0075435_100000616 3300007076 Bacteria 21880
227 Ga0075435_100005304 3300007076 Bacteria 8979
228 Ga0075435_100007747 3300007076 Bacteria 7675
229 Ga0075435_100018223 3300007076 Bacteria 5332
230 Ga0075435_100027121 3300007076 Bacteria 4477
231 Ga0099794_10000677 3300007265 Bacteria 11399
232 Ga0099794_10005123 3300007265 Bacteria 5227
233 Ga0105240_10000178 3300009093 Bacteria 129018
234 Ga0105240_10034349 3300009093 Bacteria 6541
235 Ga0105240_10043737 3300009093 Bacteria 5695
236 Ga0105240_10057800 3300009093 Bacteria 4844
237 Ga0105240_10097442 3300009093 Bacteria 3583
238 Ga0105240_10099641 3300009093 Bacteria 3537
239 Ga0105240_10181339 3300009093 Bacteria 2485
240 Ga0111539_10001532 3300009094 Bacteria 30761
241 Ga0111539_10005248 3300009094 Bacteria 16787
242 Ga0111539_10014193 3300009094 Bacteria 9949
243 Ga0111539_10014823 3300009094 Bacteria 9723
244 Ga0111539_10017378 3300009094 Bacteria 8903
245 Ga0111539_10122332 3300009094 Unclassified 3050
246 Ga0105245_10001723 3300009098 Bacteria 19950
247 Ga0105245_10004878 3300009098 Bacteria 11802
248 Ga0105245_10042333 3300009098 Bacteria 4063
249 Ga0105245_10055647 3300009098 Bacteria 3554
250 Ga0105247_10043136 3300009101 Bacteria 2763
251 Ga0114129_10008657 3300009147 Bacteria 14506
252 Ga0114129_10011241 3300009147 Bacteria 12763
253 Ga0114129_10022378 3300009147 Bacteria 8974
254 Ga0114129_10033594 3300009147 Bacteria 7248
255 Ga0114129_10084691 3300009147 Bacteria 4401
256 Ga0114129_10119081 3300009147 Bacteria 3637
257 Ga0114129_10124090 3300009147 Bacteria 3552
258 Ga0105241_10011619 3300009174 Bacteria 6457
259 Ga0105241_10020850 3300009174 Bacteria 4844
260 Ga0105241_10026728 3300009174 Bacteria 4295
261 Ga0105241_10043050 3300009174 Bacteria 3419
262 Ga0105242_10001107 3300009176 Bacteria 21243
263 Ga0105242_10071676 3300009176 Bacteria 2876
264 Ga0105242_10089304 3300009176 Bacteria 2590
265 Ga0105242_10197872 3300009176 Bacteria 1783
266 Ga0105248_10001527 3300009177 Bacteria 25763
267 Ga0105248_10012017 3300009177 Bacteria 9548
268 Ga0105248_10013857 3300009177 Bacteria 8870
269 Ga0105248_10030942 3300009177 Bacteria 5979
270 Ga0105248_10034229 3300009177 Bacteria 5680
271 Ga0105248_10075736 3300009177 Bacteria 3782
272 Ga0105248_10151317 3300009177 Bacteria 2618
273 Ga0105237_10011654 3300009545 Bacteria 9302
274 Ga0105237_10015644 3300009545 Bacteria 7886
275 Ga0105237_10194924 3300009545 Bacteria 2025
276 Ga0105238_10000533 3300009551 Bacteria 39822
277 Ga0105238_10006729 3300009551 Bacteria 11474
278 Ga0105249_10006220 3300009553 Bacteria 10365
279 Ga0105239_10025091 3300010375 Bacteria 6567
280 Ga0105239_10031318 3300010375 Bacteria 5850
281 Ga0105239_10270093 3300010375 Bacteria 1913
282 Ga0105246_10050293 3300011119 Bacteria 2858
283 Ga0105246_10100141 3300011119 Unclassified 2108
284 Ga0157373_10001055 3300013100 Bacteria 21221
285 Ga0157373_10069536 3300013100 Bacteria 2489
286 Ga0157371_10021289 3300013102 Bacteria 4762
287 Ga0157370_10017861 3300013104 Bacteria 7148
288 Ga0157369_10000170 3300013105 Bacteria 91583
289 Ga0157369_10009253 3300013105 Bacteria 11271
290 Ga0157369_10021941 3300013105 Bacteria 7138
291 Ga0157369_10034498 3300013105 Bacteria 5553
292 Ga0157369_10048297 3300013105 Bacteria 4618
293 Ga0157369_10050261 3300013105 Bacteria 4516
294 Ga0157369_10071926 3300013105 Unclassified 3712
295 Ga0157369_10112657 3300013105 Bacteria 2890
296 Ga0157374_10000316 3300013296 Bacteria 44946
297 Ga0157374_10000330 3300013296 Bacteria 43615
298 Ga0157374_10000533 3300013296 Bacteria 34093
299 Ga0157374_10004887 3300013296 Bacteria 11247
300 Ga0157374_10007459 3300013296 Bacteria 9327
301 Ga0157374_10022691 3300013296 Bacteria 5602
302 Ga0157374_10138388 3300013296 Bacteria 2362
303 Ga0157374_10233318 3300013296 Bacteria 1808
304 Ga0157378_10000071 3300013297 Bacteria 91313
305 Ga0157378_10000085 3300013297 Bacteria 87651
306 Ga0157378_10000182 3300013297 Bacteria 60024
307 Ga0157378_10013955 3300013297 Bacteria 7028
308 Ga0157378_10079407 3300013297 Bacteria 2963
309 Ga0163162_10000147 3300013306 Bacteria 64948
310 Ga0163162_10002317 3300013306 Bacteria 17858
311 Ga0163162_10010881 3300013306 Bacteria 8856
312 Ga0163162_10013390 3300013306 Bacteria 8009
313 Ga0157372_10000620 3300013307 Bacteria 38778
314 Ga0157372_10001563 3300013307 Bacteria 24933
315 Ga0157372_10001829 3300013307 Bacteria 23049
316 Ga0157372_10002374 3300013307 Bacteria 20377
317 Ga0157372_10020625 3300013307 Bacteria 7112
318 Ga0157372_10023041 3300013307 Bacteria 6748
319 Ga0157372_10026600 3300013307 Bacteria 6296
320 Ga0157372_10028884 3300013307 Bacteria 6052
321 Ga0157372_10035796 3300013307 Bacteria 5467
322 Ga0157372_10184378 3300013307 Bacteria 2417
323 Ga0157372_10236277 3300013307 Bacteria 2120
324 Ga0157372_10322166 3300013307 Bacteria 1799
325 Ga0157375_10023986 3300013308 Bacteria 5638
326 Ga0157375_10128081 3300013308 Bacteria 2656
327 Ga0157375_10180581 3300013308 Bacteria 2261
328 Ga0163163_10002642 3300014325 Bacteria 15164
329 Ga0163163_10058820 3300014325 Bacteria 3800
330 Ga0163163_10073522 3300014325 Bacteria 3410
331 Ga0163163_10076691 3300014325 Unclassified 3338
332 Ga0163163_10201541 3300014325 Bacteria 2038
333 Ga0157380_10000849 3300014326 Bacteria 19156
334 Ga0157380_10012184 3300014326 Bacteria 6229
335 Ga0157380_10058476 3300014326 Bacteria 3073
336 Ga0157380_10184968 3300014326 Bacteria 1834
337 Ga0157377_10028727 3300014745 Bacteria 2996
338 Ga0157379_10004057 3300014968 Bacteria 12492
339 Ga0157379_10023546 3300014968 Bacteria 5465
340 Ga0157376_10000005 3300014969 Bacteria 443695
341 Ga0157376_10000991 3300014969 Bacteria 18517
342 Ga0157376_10059100 3300014969 Bacteria 3214
343 Ga0157376_10060623 3300014969 Unclassified 3178
344 Ga0157376_10069227 3300014969 Bacteria 2991
345 Ga0157376_10127200 3300014969 Unclassified 2268
346 Ga0163161_10018819 3300017792 Bacteria 4840
347 Ga0228598_1000070 3300024227 Bacteria 15225
348 Ga0228598_1000423 3300024227 Bacteria 8603
349 Ga0207653_10004400 3300025885 Bacteria 4417
350 Ga0207692_10046550 3300025898 Unclassified 2175
351 Ga0207642_10050730 3300025899 Bacteria 1873
352 Ga0207688_10060600 3300025901 Bacteria 2132
353 Ga0207680_10002337 3300025903 Bacteria 8821
354 Ga0207647_10003151 3300025904 Bacteria 12371
355 Ga0207647_10022443 3300025904 Bacteria 4192
356 Ga0207685_10000016 3300025905 Bacteria 151990
357 Ga0207699_10004889 3300025906 Bacteria 6414
358 Ga0207699_10030224 3300025906 Bacteria 3030
359 Ga0207699_10031428 3300025906 Bacteria 2981
360 Ga0207705_10022321 3300025909 Bacteria 4513
361 Ga0207684_10000260 3300025910 Bacteria 78456
362 Ga0207684_10004777 3300025910 Bacteria 12691
363 Ga0207684_10038756 3300025910 Bacteria 4044
364 Ga0207684_10078233 3300025910 Bacteria 2813
365 Ga0207684_10127292 3300025910 Bacteria 2186
366 Ga0207684_10163002 3300025910 Bacteria 1920
367 Ga0207707_10000739 3300025912 Bacteria 32307
368 Ga0207707_10005345 3300025912 Bacteria 11220
369 Ga0207707_10086333 3300025912 Bacteria 2742
370 Ga0207707_10095021 3300025912 Bacteria 2605
371 Ga0207695_10000249 3300025913 Bacteria 140258
372 Ga0207695_10047422 3300025913 Bacteria 4547
373 Ga0207695_10050832 3300025913 Bacteria 4358
374 Ga0207695_10073020 3300025913 Bacteria 3497
375 Ga0207695_10076754 3300025913 Unclassified 3395
376 Ga0207695_10118499 3300025913 Bacteria 2618
377 Ga0207671_10030492 3300025914 Bacteria 4022
378 Ga0207671_10162796 3300025914 Bacteria 1728
379 Ga0207693_10000777 3300025915 Bacteria 28620
380 Ga0207693_10001973 3300025915 Bacteria 17983
381 Ga0207693_10009884 3300025915 Bacteria 7758
382 Ga0207693_10016287 3300025915 Bacteria 5944
383 Ga0207693_10027726 3300025915 Bacteria 4477
384 Ga0207693_10039903 3300025915 Bacteria 3697
385 Ga0207693_10040788 3300025915 Unclassified 3656
386 Ga0207693_10080755 3300025915 Bacteria 2545
387 Ga0207663_10001682 3300025916 Bacteria 10396
388 Ga0207663_10019745 3300025916 Bacteria 3804
389 Ga0207660_10028269 3300025917 Unclassified 3834
390 Ga0207660_10085859 3300025917 Bacteria 2322
391 Ga0207652_10066349 3300025921 Bacteria 3127
392 Ga0207652_10199399 3300025921 Bacteria 1801
393 Ga0207646_10000261 3300025922 Bacteria 71826
394 Ga0207646_10001014 3300025922 Bacteria 35904
395 Ga0207646_10003367 3300025922 Bacteria 18111
396 Ga0207646_10005136 3300025922 Bacteria 13879
397 Ga0207646_10008426 3300025922 Bacteria 10340
398 Ga0207646_10016437 3300025922 Bacteria 6943
399 Ga0207646_10074042 3300025922 Bacteria 3042
400 Ga0207646_10254108 3300025922 Unclassified 1588
401 Ga0207694_10001172 3300025924 Bacteria 22716
402 Ga0207694_10088549 3300025924 Bacteria 2440
403 Ga0207659_10072645 3300025926 Bacteria 2516
404 Ga0207687_10000622 3300025927 Bacteria 23930
405 Ga0207687_10004348 3300025927 Bacteria 9454
406 Ga0207687_10102430 3300025927 Unclassified 2109
407 Ga0207700_10041011 3300025928 Unclassified 3383
408 Ga0207700_10045123 3300025928 Bacteria 3250
409 Ga0207700_10144480 3300025928 Unclassified 1959
410 Ga0207664_10000532 3300025929 Bacteria 27088
411 Ga0207664_10016554 3300025929 Bacteria 5382
412 Ga0207664_10036249 3300025929 Unclassified 3811
413 Ga0207690_10157266 3300025932 Unclassified 1691
414 Ga0207706_10028239 3300025933 Bacteria 5011
415 Ga0207706_10084543 3300025933 Bacteria 2790
416 Ga0207686_10000141 3300025934 Bacteria 56428
417 Ga0207686_10010141 3300025934 Bacteria 5122
418 Ga0207686_10046554 3300025934 Bacteria 2676
419 Ga0207704_10119060 3300025938 Bacteria 1802
420 Ga0207704_10142126 3300025938 Unclassified 1681
421 Ga0207665_10005264 3300025939 Bacteria 8642
422 Ga0207665_10035687 3300025939 Bacteria 3302
423 Ga0207665_10051697 3300025939 Bacteria 2766
424 Ga0207665_10058385 3300025939 Unclassified 2609
425 Ga0207665_10139273 3300025939 Bacteria 1728
426 Ga0207691_10020128 3300025940 Bacteria 6312
427 Ga0207691_10043105 3300025940 Bacteria 4159
428 Ga0207691_10059852 3300025940 Unclassified 3462
429 Ga0207691_10186561 3300025940 Bacteria 1810
430 Ga0207711_10005197 3300025941 Bacteria 11022
431 Ga0207711_10042283 3300025941 Bacteria 3883
432 Ga0207711_10045713 3300025941 Bacteria 3742
433 Ga0207711_10195444 3300025941 Unclassified 1845
434 Ga0207689_10002264 3300025942 Bacteria 18044
435 Ga0207689_10013848 3300025942 Bacteria 6872
436 Ga0207689_10015206 3300025942 Bacteria 6517
437 Ga0207689_10100188 3300025942 Unclassified 2380
438 Ga0207689_10161124 3300025942 Bacteria 1848
439 Ga0207661_10045539 3300025944 Bacteria 3473
440 Ga0207679_10028975 3300025945 Bacteria 3850
441 Ga0207667_10000785 3300025949 Bacteria 41249
442 Ga0207667_10003707 3300025949 Bacteria 18846
443 Ga0207667_10007973 3300025949 Bacteria 12629
444 Ga0207667_10012221 3300025949 Bacteria 9917
445 Ga0207667_10060404 3300025949 Bacteria 3968
446 Ga0207667_10168824 3300025949 Bacteria 2249
447 Ga0207668_10055321 3300025972 Bacteria 2758
448 Ga0207640_10004787 3300025981 Bacteria 7350
449 Ga0207640_10051211 3300025981 Bacteria 2683
450 Ga0207677_10009392 3300026023 Bacteria 5504
451 Ga0207677_10017039 3300026023 Unclassified 4320
452 Ga0207677_10045304 3300026023 Unclassified 2937
453 Ga0207677_10071183 3300026023 Unclassified 2453
454 Ga0207703_10001398 3300026035 Bacteria 21976
455 Ga0207703_10009935 3300026035 Bacteria 7466
456 Ga0207703_10019982 3300026035 Bacteria 5233
457 Ga0207703_10021476 3300026035 Bacteria 5054
458 Ga0207703_10021921 3300026035 Bacteria 5003
459 Ga0207703_10036937 3300026035 Bacteria 3891
460 Ga0207639_10014034 3300026041 Bacteria 5623
461 Ga0207639_10187084 3300026041 Unclassified 1766
462 Ga0207678_10010352 3300026067 Bacteria 8186
463 Ga0207678_10027757 3300026067 Bacteria 4942
464 Ga0207708_10160211 3300026075 Bacteria 1777
465 Ga0207702_10000089 3300026078 Bacteria 105440
466 Ga0207702_10000759 3300026078 Bacteria 34304
467 Ga0207702_10013451 3300026078 Bacteria 6802
468 Ga0207702_10049880 3300026078 Bacteria 3533
469 Ga0207702_10074260 3300026078 Bacteria 2935
470 Ga0207641_10001723 3300026088 Bacteria 21130
471 Ga0207641_10030588 3300026088 Bacteria 4461
472 Ga0207648_10005354 3300026089 Bacteria 12938
473 Ga0207648_10010915 3300026089 Bacteria 8584
474 Ga0207648_10028057 3300026089 Bacteria 4993
475 Ga0207648_10043163 3300026089 Bacteria 3959
476 Ga0207676_10008246 3300026095 Bacteria 7411
477 Ga0207676_10018710 3300026095 Bacteria 5041
478 Ga0207676_10034969 3300026095 Bacteria 3808
479 Ga0207676_10097316 3300026095 Bacteria 2431
480 Ga0207674_10000309 3300026116 Bacteria 62067
481 Ga0207674_10000469 3300026116 Bacteria 52895
482 Ga0207674_10005897 3300026116 Bacteria 14522
483 Ga0207674_10056840 3300026116 Bacteria 3970
484 Ga0207674_10153683 3300026116 Bacteria 2257
485 Ga0207675_100008562 3300026118 Bacteria 9623
486 Ga0207675_100097627 3300026118 Bacteria 2767
487 Ga0207675_100103457 3300026118 Bacteria 2683
488 Ga0207683_10031671 3300026121 Bacteria 4590
489 Ga0209588_1002048 3300027671 Bacteria 5439
490 Ga0209588_1005352 3300027671 Bacteria 3674
491 Ga0207428_10015554 3300027907 Bacteria 6577
492 Ga0207428_10026180 3300027907 Unclassified 4871
493 Ga0207428_10039352 3300027907 Bacteria 3840
494 Ga0268265_10058794 3300028380 Bacteria 2938
495 Ga0268265_10151173 3300028380 Bacteria 1958
496 Ga0268264_10043592 3300028381 Bacteria 3718
497 Ga0265319_1002942 3300028563 Bacteria 9067
498 Ga0265334_10037472 3300028573 Bacteria 1911
499 Ga0265318_10005219 3300028577 Bacteria 6123
500 Ga0265318_10011748 3300028577 Bacteria 3752
501 Ga0265338_10003433 3300028800 Bacteria 22326
502 Ga0265338_10004350 3300028800 Bacteria 19176
503 Ga0265338_10005938 3300028800 Bacteria 15728
504 Ga0265338_10015852 3300028800 Bacteria 8249
505 Ga0265762_1001799 3300030760 Bacteria 3895
506 Ga0265330_10000194 3300031235 Bacteria 47211
507 Ga0265330_10000507 3300031235 Bacteria 26079
508 Ga0265330_10047557 3300031235 Bacteria 1888
509 Ga0265332_10002649 3300031238 Bacteria 8989
510 Ga0265328_10000568 3300031239 Bacteria 17163
511 Ga0265320_10000032 3300031240 Bacteria 141785
512 Ga0265320_10006993 3300031240 Bacteria 7037
513 Ga0265325_10000167 3300031241 Bacteria 46417
514 Ga0265325_10000239 3300031241 Bacteria 39004
515 Ga0265325_10006458 3300031241 Bacteria 7109
516 Ga0265325_10006922 3300031241 Bacteria 6843
517 Ga0265329_10005856 3300031242 Bacteria 4932
518 Ga0265340_10001152 3300031247 Bacteria 15114
519 Ga0265340_10004426 3300031247 Bacteria 7853
520 Ga0265340_10026524 3300031247 Bacteria 2928
521 Ga0265339_10001113 3300031249 Bacteria 20339
522 Ga0265339_10003514 3300031249 Bacteria 10952
523 Ga0265339_10024272 3300031249 Bacteria 3496
524 Ga0265339_10037352 3300031249 Bacteria 2715
525 Ga0265339_10041400 3300031249 Bacteria 2557
526 Ga0265331_10000512 3300031250 Bacteria 36326
527 Ga0265331_10012216 3300031250 Bacteria 4660
528 Ga0265316_10001849 3300031344 Bacteria 22260
529 Ga0265316_10004004 3300031344 Bacteria 14756
530 Ga0265316_10004612 3300031344 Bacteria 13670
531 Ga0265316_10061796 3300031344 Bacteria 2908
532 Ga0307513_10003815 3300031456 Bacteria 20322
533 Ga0265313_10000349 3300031595 Bacteria 50279
534 Ga0265313_10000894 3300031595 Bacteria 29941
535 Ga0265313_10001760 3300031595 Bacteria 19846
536 Ga0316579_10042784 3300031691 Bacteria 2105
537 Ga0265314_10000231 3300031711 Bacteria 83338
538 Ga0265314_10000713 3300031711 Bacteria 40163
539 Ga0265314_10012791 3300031711 Bacteria 6822
540 Ga0265342_10000686 3300031712 Bacteria 35395
541 Ga0265342_10000782 3300031712 Bacteria 32235
542 Ga0265342_10079086 3300031712 Bacteria 1902
543 Ga0316578_10086679 3300031728 Bacteria 1867
544 Ga0307416_100013345 3300032002 Bacteria 5580
545 Ga0373926_0002560 3300035083 Bacteria 5777
546 Ga0373934_0007018 3300035086 Bacteria 4178
547 Ga0373923_0026268 3300035111 Bacteria 2316
548 Ga0373936_0003622 3300035113 Bacteria 5804
549 Ga0373936_0013395 3300035113 Bacteria 3130
550 Ga0373954_0002808 3300035118 Bacteria 7332
551 Ga0373954_0019753 3300035118 Bacteria 3041
552 Ga0373956_0008131 3300035119 Bacteria 4245
553 Ga0373957_0003665 3300035120 Bacteria 4580
554 Ga0373957_0007236 3300035120 Bacteria 3545
555 Ga0373946_0005395 3300035171 Bacteria 4609
556 Ga0373946_0015994 3300035171 Bacteria 2854
557 Ga0373955_0006586 3300035172 Bacteria 5298
558 Ga0373955_0008811 3300035172 Bacteria 4702
559 Ga0373955_0017844 3300035172 Bacteria 3518
560 Ga0373955_0091673 3300035172 Unclassified 1732
561 Ga0373931_0029217 3300035691 Unclassified 2828
562 Ga0373931_0085551 3300035691 Unclassified 1748
563 Ga0373935_0013755 3300035692 Bacteria 4886
564 Ga0373935_0115991 3300035692 Bacteria 1783
565 Ga0373927_0005612 3300035695 Bacteria 8621
566 Ga0373927_0047319 3300035695 Bacteria 2782
567 Ga0373927_0178843 3300035695 Bacteria 1391
568 Ga0373933_0011538 3300035724 Bacteria 4875
569 Ga0373933_0075830 3300035724 Bacteria 2053
570 Ga0373947_0006387 3300035725 Bacteria 6850
571 Ga0373947_0054965 3300035725 Unclassified 2404
572 Ga0373947_0061910 3300035725 Bacteria 2275
573 Ga0373937_0015641 3300036401 Bacteria 6716
574 Ga0373937_0188893 3300036401 Bacteria 1935
575 Ga0316582_0000018 3300036647 Bacteria 39444
576 Ga0373925_0005926 3300037068 Bacteria 9061
577 Ga0373925_0024087 3300037068 Bacteria 4443
578 Ga0395900_0288985 3300037418 Unclassified 1629
579 Ga0395905_0206051 3300037471 Unclassified 1843
580 Ga0436365_0126746 3300039437 Bacteria 2891
581 Ga0436360_0434407 3300039438 Bacteria 2848
582 Ga0436363_0052375 3300039450 Bacteria 3042
583 Ga0436362_0461762 3300039453 Bacteria 5323
584 Ga0450908_004534 3300042184 Bacteria 2675
585 Ga0439464_0006622 3300042439 Bacteria 3023
586 Ga0451577_0020122 3300042876 Bacteria 6128
587 Ga0451577_0026254 3300042876 Bacteria 5276
588 Ga0451577_0128704 3300042876 Bacteria 2270
589 Ga0466972_0002988 3300044658 Bacteria 8374
590 Ga0466961_0179717 3300044693 Bacteria 1314
591 Ga0466963_0011667 3300044694 Bacteria 5354
592 Ga0453684_0020898 3300044712 Bacteria 9823
593 Ga0453684_0052207 3300044712 Bacteria 5349
594 Ga0453684_0131019 3300044712 Bacteria 3008
595 Ga0466960_0007624 3300044901 Bacteria 4405
596 Ga0451576_0113632 3300045051 Bacteria 2819
597 Ga0466958_0017067 3300045836 Bacteria 4191
598 Ga0466967_0023138 3300045976 Bacteria 5088
599 Ga0495638_0022118 3300046460 Bacteria 4176
600 Ga0495580_0002375 3300046472 Bacteria 16435
601 Ga0495580_0004333 3300046472 Bacteria 11913
602 Ga0495580_0011661 3300046472 Bacteria 6795
603 Ga0495582_0000143 3300046473 Bacteria 38449
604 Ga0495582_0046150 3300046473 Bacteria 2400
605 Ga0495664_0002704 3300046477 Bacteria 9539
606 Ga0495584_0045530 3300046491 Bacteria 2213
607 Ga0495608_0004886 3300046511 Bacteria 9592
608 Ga0495630_0016477 3300046517 Bacteria 5402
609 Ga0495666_0040319 3300046526 Unclassified 2265
610 Ga0495652_0080183 3300046529 Bacteria 2697
611 Ga0495665_0001194 3300046531 Bacteria 13831
612 Ga0495587_0001500 3300046536 Bacteria 15512
613 Ga0495645_0014894 3300046543 Bacteria 5525
614 Ga0495667_0053150 3300046559 Bacteria 2668
615 Ga0495635_0059297 3300046663 Bacteria 2632
616 Ga0495657_0113848 3300046675 Bacteria 1710
617 Ga0495613_0019741 3300046689 Bacteria 5023
618 Ga0495624_0032867 3300046690 Bacteria 3362
619 Ga0495600_0034985 3300046809 Bacteria 3262
620 Ga0495581_0029740 3300047315 Bacteria 3166
621 Ga0495604_0010694 3300047317 Bacteria 7283
622 Ga0495674_0008394 3300047319 Bacteria 9844
623 Ga0495674_0184483 3300047319 Bacteria 1736
624 Ga0495684_0089050 3300047471 Bacteria 2339
625 Ga0495684_0099311 3300047471 Bacteria 2201
626 Ga0495593_0074061 3300047673 Bacteria 1766
627 Ga0495602_0002361 3300048088 Bacteria 19105
628 Ga0495602_0091332 3300048088 Bacteria 2526
629 Ga0496100_0071778 3300048903 Unclassified 2313
630 Ga0496102_0000641 3300048905 Bacteria 35434
631 Ga0496102_0058742 3300048905 Bacteria 3515
632 Ga0496102_0260574 3300048905 Unclassified 1635
633 Ga0496103_0000987 3300048906 Bacteria 20071
634 Ga0496104_0013455 3300048907 Bacteria 7372
635 Ga0496104_0030486 3300048907 Bacteria 5012
636 Ga0496104_0061528 3300048907 Bacteria 3560
637 Ga0496105_0117664 3300048908 Bacteria 2192
638 Ga0496106_0075998 3300048909 Bacteria 2574
639 Ga0496106_0241090 3300048909 Bacteria 1445
640 Ga0496107_0207178 3300048910 Bacteria 1458
641 Ga0496108_0000009 3300048911 Bacteria 276390
642 Ga0496108_0065744 3300048911 Bacteria 3057
643 Ga0496109_0019210 3300048912 Bacteria 6020
644 Ga0496110_0045619 3300048913 Bacteria 3832
645 Ga0496112_0053191 3300048915 Bacteria 3976
646 Ga0496112_0083501 3300048915 Bacteria 3159
647 Ga0496112_0089484 3300048915 Unclassified 3047
648 Ga0496112_0101967 3300048915 Unclassified 2840
649 Ga0496112_0151877 3300048915 Bacteria 2283
650 Ga0496112_0295136 3300048915 Bacteria 1567
651 Ga0496113_0100874 3300048916 Bacteria 2237
652 Ga0496114_0001138 3300048917 Bacteria 20094
653 Ga0496114_0022395 3300048917 Bacteria 5149
654 Ga0496115_0010873 3300048918 Bacteria 6813
655 Ga0496115_0044671 3300048918 Bacteria 3536
656 Ga0496115_0063353 3300048918 Bacteria 2983
657 Ga0496126_0000074 3300048929 Bacteria 235643
658 Ga0501031_0001966 3300049568 Bacteria 12970
659 Ga0501031_0103351 3300049568 Bacteria 1859
660 Ga0501032_0003101 3300049569 Bacteria 12813
661 Ga0501032_0012270 3300049569 Bacteria 6131
662 Ga0501032_0045989 3300049569 Bacteria 2950
663 Ga0501033_0001096 3300049570 Bacteria 24540
664 Ga0501033_0005773 3300049570 Bacteria 9743
665 Ga0501033_0006344 3300049570 Bacteria 9268
666 Ga0501033_0009768 3300049570 Bacteria 7370
667 Ga0501034_0010575 3300049571 Bacteria 9602
668 Ga0501034_0018789 3300049571 Bacteria 7083
669 Ga0501034_0072741 3300049571 Bacteria 3446
670 Ga0501034_0085258 3300049571 Bacteria 3160
671 Ga0501036_0001195 3300049572 Bacteria 19790
672 Ga0501036_0005799 3300049572 Bacteria 10008
673 Ga0501036_0048793 3300049572 Bacteria 3584
674 Ga0501036_0065766 3300049572 Bacteria 3068
675 Ga0501037_0002133 3300049573 Bacteria 14321
676 Ga0501037_0005157 3300049573 Bacteria 9505
677 Ga0501037_0008661 3300049573 Bacteria 7460
678 Ga0501038_0001977 3300049574 Bacteria 18932
679 Ga0501038_0024503 3300049574 Bacteria 5382
680 Ga0501038_0054283 3300049574 Bacteria 3446
681 Ga0501039_0027515 3300049575 Bacteria 4372
682 Ga0501039_0042516 3300049575 Bacteria 3510
683 Ga0501040_0024283 3300049576 Bacteria 4067
684 Ga0501040_0077806 3300049576 Unclassified 2295
685 Ga0501043_0003562 3300049579 Bacteria 12779
686 Ga0501043_0008126 3300049579 Bacteria 8280
687 Ga0501043_0009092 3300049579 Bacteria 7814
688 Ga0501046_0003257 3300049580 Bacteria 14902
689 Ga0501046_0006694 3300049580 Bacteria 10175
690 Ga0501046_0010405 3300049580 Bacteria 7992
691 Ga0501046_0014221 3300049580 Bacteria 6720
692 Ga0501047_0003666 3300049581 Bacteria 14477
693 Ga0501047_0003728 3300049581 Bacteria 14349
694 Ga0501047_0014526 3300049581 Bacteria 7489
695 Ga0501047_0025582 3300049581 Bacteria 5674
696 Ga0501047_0034946 3300049581 Bacteria 4853
697 Ga0501048_0001404 3300049582 Bacteria 18280
698 Ga0501048_0001416 3300049582 Bacteria 18138
699 Ga0501048_0002224 3300049582 Bacteria 14778
700 Ga0501067_0003313 3300049583 Bacteria 8859
701 Ga0501067_0009909 3300049583 Bacteria 5277
702 Ga0501067_0053166 3300049583 Bacteria 2244
703 Ga0501068_0008669 3300049584 Bacteria 5669
704 Ga0501070_0012750 3300049586 Bacteria 7085
705 Ga0501070_0015454 3300049586 Bacteria 6422
706 Ga0501070_0144853 3300049586 Bacteria 1961
707 Ga0501071_0041281 3300049587 Bacteria 3304
708 Ga0501071_0043532 3300049587 Bacteria 3219
709 Ga0501072_0054835 3300049588 Bacteria 3142
710 Ga0501072_0092327 3300049588 Bacteria 2404
711 Ga0501073_0009670 3300049589 Bacteria 7108
712 Ga0501074_0000241 3300049590 Bacteria 30651
713 Ga0501074_0001199 3300049590 Bacteria 17037
714 Ga0501074_0039329 3300049590 Bacteria 3426
715 Ga0501075_0087112 3300049591 Unclassified 2367
716 Ga0501075_0113100 3300049591 Bacteria 2064
717 Ga0501076_0033736 3300049592 Bacteria 3997
718 Ga0501079_0001813 3300049741 Bacteria 15266
719 Ga0501079_0003433 3300049741 Bacteria 11635
720 Ga0501079_0020680 3300049741 Bacteria 5031
721 Ga0501080_0014267 3300049742 Bacteria 7317
722 Ga0501080_0016012 3300049742 Bacteria 6919
723 Ga0501080_0048020 3300049742 Bacteria 3974
724 Ga0501080_0057345 3300049742 Bacteria 3626
725 Ga0501080_0080690 3300049742 Bacteria 3023
726 Ga0501080_0089718 3300049742 Bacteria 2856
727 Ga0501081_0017759 3300049743 Bacteria 4715
728 Ga0501081_0018651 3300049743 Bacteria 4611
729 Ga0501083_0007965 3300049744 Bacteria 7502
730 Ga0501083_0008460 3300049744 Bacteria 7270
731 Ga0501083_0083237 3300049744 Bacteria 2119
732 Ga0501035_0002125 3300049822 Bacteria 19716
733 Ga0501035_0007030 3300049822 Bacteria 10516
734 Ga0501044_0025473 3300049823 Bacteria 6269
735 Ga0501044_0056260 3300049823 Bacteria 4038
736 Ga0501045_0014147 3300049824 Bacteria 5651
737 Ga0501045_0025895 3300049824 Bacteria 4217
738 Ga0501045_0150248 3300049824 Bacteria 1733
739 nmdc:mga00v17_131664_c1 3300050491 Bacteria 1599
740 nmdc:mga0yw44_96256_c1 3300050492 Bacteria 1879
741 nmdc:mga0k408_10800_c1 3300050493 Bacteria 4951
742 nmdc:mga0k408_3793_c1 3300050493 Bacteria 8010
743 nmdc:mga06z11_37534_c1 3300050494 Bacteria 2400
744 nmdc:mga07m45_37453_c1 3300050496 Bacteria 2705
745 nmdc:mga05p37_115958_c1 3300050507 Bacteria 3292
746 nmdc:mga05p37_16678_c1 3300050507 Bacteria 5080
747 nmdc:mga05p37_35213_c1 3300050507 Bacteria 6137
748 nmdc:mga05p37_3603_c1 3300050507 Bacteria 18091
749 nmdc:mga05p37_7639_c1 3300050507 Bacteria 12758
750 nmdc:mga09592_8755_c1 3300050508 Bacteria 8234
751 nmdc:mga06r32_8085_c1 3300050510 Bacteria 9462
752 nmdc:mga08y16_12239_c1 3300050511 Bacteria 9016
753 nmdc:mga08y16_34764_c1 3300050511 Bacteria 5295
754 nmdc:mga08y16_36774_c1 3300050511 Bacteria 5141
755 nmdc:mga08y16_70051_c1 3300050511 Bacteria 3656
756 nmdc:mga0n895_112789_c1 3300050512 Unclassified 2736
757 nmdc:mga0n895_21342_c1 3300050512 Bacteria 6053
758 nmdc:mga0n895_28812_c1 3300050512 Bacteria 5287
759 nmdc:mga0n895_34219_c1 3300050512 Bacteria 4889
760 nmdc:mga0n895_62898_c1 3300050512 Bacteria 3669
761 nmdc:mga0rr50_108201_c1 3300050513 Unclassified 2196
762 nmdc:mga0rr50_1304_c1 3300050513 Bacteria 13612
763 nmdc:mga0rr50_15163_c1 3300050513 Bacteria 5080
764 nmdc:mga0rr50_3575_c1 3300050513 Bacteria 8979
765 nmdc:mga0rr50_5571_c1 3300050513 Bacteria 7531
766 nmdc:mga08x19_10097_c1 3300050514 Bacteria 5663
767 nmdc:mga08x19_3993_c1 3300050514 Bacteria 8778
768 nmdc:mga08x19_5216_c1 3300050514 Bacteria 7687
769 nmdc:mga08x19_82009_c1 3300050514 Bacteria 2119
770 nmdc:mga08x19_9583_c2 3300050514 Bacteria 4833
771 nmdc:mga0a205_115835_c1 3300050515 Bacteria 2578
772 nmdc:mga0a205_3661_c1 3300050515 Bacteria 13766
773 nmdc:mga0a205_58221_c1 3300050515 Bacteria 3732
774 nmdc:mga0a205_5839_c1 3300050515 Bacteria 11089
775 nmdc:mga0a205_649_c2 3300050515 Bacteria 19623
776 Ga0495601_0062613 3300053077 Bacteria 2363
777 Ga0495612_0015322 3300053078 Bacteria 3074
778 Ga0495619_0008599 3300053085 Bacteria 6459
779 Ga0500568_0010180 3300053139 Bacteria 4419
780 Ga0501084_0002244 3300054114 Bacteria 15503
781 Ga0501084_0014669 3300054114 Bacteria 6498
782 Ga0501084_0203873 3300054114 Bacteria 1669
783 Ga0501084_0228900 3300054114 Bacteria 1569
784 Ga0501082_0001883 3300060353 Bacteria 18464
785 Ga0501082_0004549 3300060353 Bacteria 12105
786 Ga0501082_0027217 3300060353 Bacteria 4924
787 Ga0501082_0038130 3300060353 Bacteria 4145
788 Ga0501082_0074498 3300060353 Bacteria 2924
789 Ga0501082_0078520 3300060353 Bacteria 2847
790 Ga0530510_0089031 3300061734 Unclassified 2251

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0054965 Ga0373947_0054965_34_1299 386
2 3300050513 nmdc:mga0rr50_108201_c1 nmdc:mga0rr50_108201_c1_17_1279 387
3 3300027671 Ga0209588_1002048 Ga0209588_10020485 388
4 3300035083 Ga0373926_0002560 Ga0373926_0002560_1263_2516 394
5 3300035113 Ga0373936_0003622 Ga0373936_0003622_2194_3447 394
6 3300035171 Ga0373946_0015994 Ga0373946_0015994_1453_2706 394
7 3300035692 Ga0373935_0115991 Ga0373935_0115991_262_1515 394
8 3300035695 Ga0373927_0047319 Ga0373927_0047319_442_1695 394
9 3300035695 Ga0373927_0178843 Ga0373927_0178843_29_1282 394
10 3300035725 Ga0373947_0006387 Ga0373947_0006387_265_1518 394
11 3300037068 Ga0373925_0024087 Ga0373925_0024087_41_1294 394
12 3300046472 Ga0495580_0002375 Ga0495580_0002375_3265_4518 394
13 3300046473 Ga0495582_0000143 Ga0495582_0000143_20491_21744 394
14 3300046526 Ga0495666_0040319 Ga0495666_0040319_641_1894 394
15 3300046531 Ga0495665_0001194 Ga0495665_0001194_1473_2726 394
16 3300047315 Ga0495581_0029740 Ga0495581_0029740_1626_2879 394
17 3300047319 Ga0495674_0184483 Ga0495674_0184483_114_1367 394
18 3300047673 Ga0495593_0074061 Ga0495593_0074061_187_1440 394
19 3300048915 Ga0496112_0295136 Ga0496112_0295136_265_1518 394
20 3300050513 nmdc:mga0rr50_1304_c1 nmdc:mga0rr50_1304_c1_2894_4147 394
21 3300050514 nmdc:mga08x19_5216_c1 nmdc:mga08x19_5216_c1_3055_4308 394
22 3300050507 nmdc:mga05p37_16678_c1 nmdc:mga05p37_16678_c1_55_1326 395
23 3300048915 Ga0496112_0053191 Ga0496112_0053191_235_1482 398
24 3300044693 Ga0466961_0179717 Ga0466961_0179717_48_1295 403
25 3300048910 Ga0496107_0207178 Ga0496107_0207178_193_1440 408
26 3300045051 Ga0451576_0113632 Ga0451576_0113632_1424_2677 410
27 3300005439 Ga0070711_100012830 Ga0070711_1000128304 411
28 3300006175 Ga0070712_100005692 Ga0070712_1000056926 411
29 3300025915 Ga0207693_10009884 Ga0207693_100098842 411
30 3300005617 Ga0068859_100005424 Ga0068859_1000054247 412
31 3300006931 Ga0097620_100005424 Ga0097620_1000054247 412
32 3300025927 Ga0207687_10004348 Ga0207687_100043483 412
33 3300025941 Ga0207711_10005197 Ga0207711_100051975 412
34 3300005547 Ga0070693_100039810 Ga0070693_1000398102 413
35 3300007265 Ga0099794_10005123 Ga0099794_100051232 413
36 3300048909 Ga0496106_0241090 Ga0496106_0241090_153_1406 413
37 3300048915 Ga0496112_0089484 Ga0496112_0089484_55_1308 413
38 3300050492 nmdc:mga0yw44_96256_c1 nmdc:mga0yw44_96256_c1_24_1319 415
39 3300005340 Ga0070689_100016063 Ga0070689_1000160632 421
40 3300025901 Ga0207688_10060600 Ga0207688_100606002 430
41 3300026118 Ga0207675_100103457 Ga0207675_1001034571 430
42 3300037471 Ga0395905_0206051 Ga0395905_0206051_130_1452 433
43 3300037418 Ga0395900_0288985 Ga0395900_0288985_257_1588 436
44 3300046491 Ga0495584_0045530 Ga0495584_0045530_257_1633 441
45 3300028800 Ga0265338_10015852 Ga0265338_100158527 443
46 3300031711 Ga0265314_10000231 Ga0265314_1000023151 443
47 3300031712 Ga0265342_10079086 Ga0265342_100790861 445
48 3300028577 Ga0265318_10011748 Ga0265318_100117482 447
49 3300028800 Ga0265338_10003433 Ga0265338_1000343317 447
50 3300031235 Ga0265330_10000194 Ga0265330_1000019412 447
51 3300031238 Ga0265332_10002649 Ga0265332_100026493 447
52 3300031239 Ga0265328_10000568 Ga0265328_100005683 447
53 3300031240 Ga0265320_10006993 Ga0265320_100069935 447
54 3300031241 Ga0265325_10006458 Ga0265325_100064585 447
55 3300031242 Ga0265329_10005856 Ga0265329_100058562 447
56 3300031247 Ga0265340_10001152 Ga0265340_1000115211 447
57 3300031249 Ga0265339_10001113 Ga0265339_1000111314 447
58 3300031344 Ga0265316_10004612 Ga0265316_100046129 447
59 3300031595 Ga0265313_10001760 Ga0265313_1000176013 447
60 3300031712 Ga0265342_10000782 Ga0265342_1000078212 447
61 3300006358 Ga0068871_100004354 Ga0068871_1000043545 448
62 3300014968 Ga0157379_10023546 Ga0157379_100235465 448
63 3300014969 Ga0157376_10000005 Ga0157376_10000005128 448
64 3300035725 Ga0373947_0061910 Ga0373947_0061910_509_2038 448
65 3300048917 Ga0496114_0001138 Ga0496114_0001138_15482_16930 448
66 3300048918 Ga0496115_0010873 Ga0496115_0010873_2654_4102 448
67 3300006175 Ga0070712_100039273 Ga0070712_1000392733 449
68 3300006871 Ga0075434_100034773 Ga0075434_1000347734 449
69 3300006871 Ga0075434_100230089 Ga0075434_1002300891 449
70 3300006880 Ga0075429_100057680 Ga0075429_1000576802 449
71 3300007076 Ga0075435_100027121 Ga0075435_1000271212 449
72 3300025915 Ga0207693_10039903 Ga0207693_100399032 449
73 3300025922 Ga0207646_10003367 Ga0207646_1000336713 449
74 3300025939 Ga0207665_10035687 Ga0207665_100356873 449
75 3300050512 nmdc:mga0n895_28812_c1 nmdc:mga0n895_28812_c1_71_1522 449
76 3300025927 Ga0207687_10000622 Ga0207687_100006227 450
77 3300046675 Ga0495657_0113848 Ga0495657_0113848_257_1636 451
78 3300006028 Ga0070717_10000558 Ga0070717_100005588 452
79 3300014326 Ga0157380_10184968 Ga0157380_101849682 452
80 3300026035 Ga0207703_10009935 Ga0207703_100099354 452
81 3300048911 Ga0496108_0000009 Ga0496108_0000009_54151_55671 452
82 3300005617 Ga0068859_100015114 Ga0068859_1000151142 453
83 3300006931 Ga0097620_100015114 Ga0097620_1000151142 453
84 3300053078 Ga0495612_0015322 Ga0495612_0015322_1503_3008 453
85 3300005354 Ga0070675_100082844 Ga0070675_1000828442 456
86 3300006852 Ga0075433_10000957 Ga0075433_1000095717 456
87 3300006871 Ga0075434_100000557 Ga0075434_1000005573 456
88 3300006914 Ga0075436_100015949 Ga0075436_1000159494 456
89 3300007076 Ga0075435_100000616 Ga0075435_1000006164 456
90 3300025926 Ga0207659_10072645 Ga0207659_100726452 456
91 3300050512 nmdc:mga0n895_112789_c1 nmdc:mga0n895_112789_c1_1156_2661 456
92 3300050514 nmdc:mga08x19_10097_c1 nmdc:mga08x19_10097_c1_1404_2909 456
93 3300050515 nmdc:mga0a205_649_c2 nmdc:mga0a205_649_c2_17666_19171 456
94 3300014326 Ga0157380_10000849 Ga0157380_100008499 458
95 3300050512 nmdc:mga0n895_62898_c1 nmdc:mga0n895_62898_c1_1937_3433 458
96 3300039438 Ga0436360_0434407 Ga0436360_0434407_309_1766 459
97 3300005545 Ga0070695_100003121 Ga0070695_1000031213 460
98 3300006914 Ga0075436_100006202 Ga0075436_1000062027 460
99 3300013307 Ga0157372_10020625 Ga0157372_100206258 460
100 3300050514 nmdc:mga08x19_3993_c1 nmdc:mga08x19_3993_c1_2071_3597 460
101 3300005545 Ga0070695_100073059 Ga0070695_1000730592 461
102 3300009094 Ga0111539_10122332 Ga0111539_101223321 461
103 3300048912 Ga0496109_0019210 Ga0496109_0019210_159_1724 461
104 3300005327 Ga0070658_10002614 Ga0070658_100026149 462
105 3300013105 Ga0157369_10034498 Ga0157369_100344984 462
106 3300013307 Ga0157372_10184378 Ga0157372_101843781 462
107 3300025909 Ga0207705_10022321 Ga0207705_100223213 462
108 3300031456 Ga0307513_10003815 Ga0307513_100038153 462
109 3300005614 Ga0068856_100193573 Ga0068856_1001935732 463
110 3300009147 Ga0114129_10124090 Ga0114129_101240902 463
111 3300048907 Ga0496104_0061528 Ga0496104_0061528_185_1681 463
112 3300006163 Ga0070715_10000032 Ga0070715_1000003216 464
113 3300006871 Ga0075434_100131160 Ga0075434_1001311602 464
114 3300025905 Ga0207685_10000016 Ga0207685_1000001646 464
115 3300025942 Ga0207689_10100188 Ga0207689_101001882 464
116 3300005329 Ga0070683_100006910 Ga0070683_1000069105 465
117 3300005353 Ga0070669_100042973 Ga0070669_1000429731 465
118 3300005439 Ga0070711_100011410 Ga0070711_1000114101 465
119 3300005459 Ga0068867_100019588 Ga0068867_1000195881 465
120 3300005518 Ga0070699_100024708 Ga0070699_1000247083 465
121 3300005546 Ga0070696_100017071 Ga0070696_1000170715 465
122 3300005844 Ga0068862_100016749 Ga0068862_1000167492 465
123 3300006175 Ga0070712_100049404 Ga0070712_1000494042 465
124 3300006358 Ga0068871_100058610 Ga0068871_1000586102 465
125 3300006881 Ga0068865_100015086 Ga0068865_1000150862 465
126 3300006881 Ga0068865_100077081 Ga0068865_1000770812 465
127 3300009094 Ga0111539_10014193 Ga0111539_100141935 465
128 3300009098 Ga0105245_10001723 Ga0105245_100017237 465
129 3300009098 Ga0105245_10042333 Ga0105245_100423332 465
130 3300009545 Ga0105237_10011654 Ga0105237_100116543 465
131 3300009553 Ga0105249_10006220 Ga0105249_100062205 465
132 3300010375 Ga0105239_10031318 Ga0105239_100313183 465
133 3300013105 Ga0157369_10071926 Ga0157369_100719263 465
134 3300013296 Ga0157374_10138388 Ga0157374_101383881 465
135 3300013307 Ga0157372_10035796 Ga0157372_100357964 465
136 3300025915 Ga0207693_10016287 Ga0207693_100162874 465
137 3300025915 Ga0207693_10080755 Ga0207693_100807552 465
138 3300025933 Ga0207706_10084543 Ga0207706_100845432 465
139 3300025934 Ga0207686_10010141 Ga0207686_100101413 465
140 3300026089 Ga0207648_10028057 Ga0207648_100280572 465
141 3300026089 Ga0207648_10043163 Ga0207648_100431632 465
142 3300035086 Ga0373934_0007018 Ga0373934_0007018_2119_3624 465
143 3300035111 Ga0373923_0026268 Ga0373923_0026268_166_1671 465
144 3300035118 Ga0373954_0002808 Ga0373954_0002808_3527_5032 465
145 3300035118 Ga0373954_0019753 Ga0373954_0019753_504_2009 465
146 3300035120 Ga0373957_0003665 Ga0373957_0003665_2792_4297 465
147 3300035172 Ga0373955_0006586 Ga0373955_0006586_1925_3430 465
148 3300035172 Ga0373955_0008811 Ga0373955_0008811_155_1660 465
149 3300035724 Ga0373933_0011538 Ga0373933_0011538_909_2414 465
150 3300036401 Ga0373937_0015641 Ga0373937_0015641_2866_4371 465
151 3300045976 Ga0466967_0023138 Ga0466967_0023138_3126_4601 465
152 3300046472 Ga0495580_0011661 Ga0495580_0011661_2094_3599 465
153 3300046511 Ga0495608_0004886 Ga0495608_0004886_5204_6709 465
154 3300046529 Ga0495652_0080183 Ga0495652_0080183_118_1623 465
155 3300046536 Ga0495587_0001500 Ga0495587_0001500_207_1712 465
156 3300046559 Ga0495667_0053150 Ga0495667_0053150_973_2478 465
157 3300046689 Ga0495613_0019741 Ga0495613_0019741_2489_3994 465
158 3300047317 Ga0495604_0010694 Ga0495604_0010694_2229_3734 465
159 3300048088 Ga0495602_0002361 Ga0495602_0002361_2792_4297 465
160 3300050511 nmdc:mga08y16_36774_c1 nmdc:mga08y16_36774_c1_354_1787 465
161 3300050515 nmdc:mga0a205_58221_c1 nmdc:mga0a205_58221_c1_46_1542 465
162 3300003320 rootH2_10071456 rootH2_100714567 466
163 3300005336 Ga0070680_100018455 Ga0070680_1000184554 466
164 3300005434 Ga0070709_10072226 Ga0070709_100722262 466
165 3300005439 Ga0070711_100020844 Ga0070711_1000208443 466
166 3300005468 Ga0070707_100156409 Ga0070707_1001564091 466
167 3300005471 Ga0070698_100088872 Ga0070698_1000888722 466
168 3300005530 Ga0070679_100016382 Ga0070679_1000163822 466
169 3300005543 Ga0070672_100103052 Ga0070672_1001030522 466
170 3300005548 Ga0070665_100051409 Ga0070665_1000514093 466
171 3300005614 Ga0068856_100087222 Ga0068856_1000872222 466
172 3300005617 Ga0068859_100033126 Ga0068859_1000331262 466
173 3300006028 Ga0070717_10002266 Ga0070717_100022667 466
174 3300006175 Ga0070712_100000849 Ga0070712_1000008495 466
175 3300006931 Ga0097620_100033120 Ga0097620_1000331202 466
176 3300009093 Ga0105240_10057800 Ga0105240_100578002 466
177 3300013105 Ga0157369_10050261 Ga0157369_100502614 466
178 3300013296 Ga0157374_10022691 Ga0157374_100226914 466
179 3300025910 Ga0207684_10038756 Ga0207684_100387562 466
180 3300025912 Ga0207707_10086333 Ga0207707_100863333 466
181 3300025913 Ga0207695_10118499 Ga0207695_101184992 466
182 3300025915 Ga0207693_10001973 Ga0207693_100019735 466
183 3300025916 Ga0207663_10019745 Ga0207663_100197452 466
184 3300025917 Ga0207660_10028269 Ga0207660_100282692 466
185 3300025921 Ga0207652_10066349 Ga0207652_100663491 466
186 3300025924 Ga0207694_10088549 Ga0207694_100885493 466
187 3300025933 Ga0207706_10028239 Ga0207706_100282392 466
188 3300025940 Ga0207691_10059852 Ga0207691_100598522 466
189 3300025949 Ga0207667_10012221 Ga0207667_100122212 466
190 3300026078 Ga0207702_10074260 Ga0207702_100742602 466
191 3300026116 Ga0207674_10056840 Ga0207674_100568403 466
192 3300046472 Ga0495580_0004333 Ga0495580_0004333_3473_4963 466
193 3300013308 Ga0157375_10180581 Ga0157375_101805812 467
194 3300025922 Ga0207646_10074042 Ga0207646_100740421 467
195 3300005445 Ga0070708_100002019 Ga0070708_10000201911 468
196 3300005539 Ga0068853_100091158 Ga0068853_1000911581 468
197 3300005617 Ga0068859_100079723 Ga0068859_1000797232 468
198 3300006028 Ga0070717_10012524 Ga0070717_100125243 468
199 3300006173 Ga0070716_100060558 Ga0070716_1000605581 468
200 3300006881 Ga0068865_100016076 Ga0068865_1000160762 468
201 3300006931 Ga0097620_100079723 Ga0097620_1000797232 468
202 3300010375 Ga0105239_10025091 Ga0105239_100250915 468
203 3300011119 Ga0105246_10100141 Ga0105246_101001412 468
204 3300013306 Ga0163162_10013390 Ga0163162_100133902 468
205 3300013308 Ga0157375_10023986 Ga0157375_100239863 468
206 3300014325 Ga0163163_10002642 Ga0163163_100026425 468
207 3300025904 Ga0207647_10003151 Ga0207647_100031513 468
208 3300025904 Ga0207647_10022443 Ga0207647_100224431 468
209 3300025927 Ga0207687_10102430 Ga0207687_101024302 468
210 3300025939 Ga0207665_10058385 Ga0207665_100583852 468
211 3300025942 Ga0207689_10002264 Ga0207689_1000226411 468
212 3300026023 Ga0207677_10071183 Ga0207677_100711831 468
213 3300026035 Ga0207703_10036937 Ga0207703_100369372 468
214 3300026041 Ga0207639_10187084 Ga0207639_101870841 468
215 3300028800 Ga0265338_10004350 Ga0265338_1000435011 468
216 3300048907 Ga0496104_0030486 Ga0496104_0030486_3154_4680 468
217 3300048915 Ga0496112_0083501 Ga0496112_0083501_368_1864 468
218 3300005436 Ga0070713_100010317 Ga0070713_1000103174 470
219 3300005439 Ga0070711_100000441 Ga0070711_10000044110 470
220 3300005439 Ga0070711_100010131 Ga0070711_1000101314 470
221 3300006028 Ga0070717_10004158 Ga0070717_100041584 470
222 3300006175 Ga0070712_100001921 Ga0070712_1000019213 470
223 3300009174 Ga0105241_10026728 Ga0105241_100267282 470
224 3300013306 Ga0163162_10000147 Ga0163162_1000014751 470
225 3300013306 Ga0163162_10010881 Ga0163162_100108814 470
226 3300025915 Ga0207693_10000777 Ga0207693_1000077718 470
227 3300025916 Ga0207663_10001682 Ga0207663_100016823 470
228 3300025928 Ga0207700_10144480 Ga0207700_101444802 470
229 3300025929 Ga0207664_10036249 Ga0207664_100362492 470
230 3300048917 Ga0496114_0022395 Ga0496114_0022395_3472_5001 470
231 3300005336 Ga0070680_100137248 Ga0070680_1001372481 471
232 3300005344 Ga0070661_100004719 Ga0070661_1000047191 471
233 3300005435 Ga0070714_100178423 Ga0070714_1001784231 471
234 3300005445 Ga0070708_100094548 Ga0070708_1000945483 471
235 3300005616 Ga0068852_100046839 Ga0068852_1000468392 471
236 3300006173 Ga0070716_100002392 Ga0070716_1000023925 471
237 3300006175 Ga0070712_100023513 Ga0070712_1000235132 471
238 3300006914 Ga0075436_100010366 Ga0075436_1000103663 471
239 3300007076 Ga0075435_100007747 Ga0075435_1000077475 471
240 3300025898 Ga0207692_10046550 Ga0207692_100465502 471
241 3300025906 Ga0207699_10004889 Ga0207699_100048894 471
242 3300025915 Ga0207693_10040788 Ga0207693_100407882 471
243 3300025928 Ga0207700_10041011 Ga0207700_100410111 471
244 3300025939 Ga0207665_10005264 Ga0207665_100052644 471
245 3300025942 Ga0207689_10161124 Ga0207689_101611241 471
246 3300039450 Ga0436363_0052375 Ga0436363_0052375_1512_2999 471
247 3300048929 Ga0496126_0000074 Ga0496126_0000074_52162_53787 471
248 3300005366 Ga0070659_100068315 Ga0070659_1000683151 472
249 3300005436 Ga0070713_100067191 Ga0070713_1000671913 472
250 3300005563 Ga0068855_100037082 Ga0068855_1000370822 472
251 3300005563 Ga0068855_100066292 Ga0068855_1000662922 472
252 3300005614 Ga0068856_100046450 Ga0068856_1000464501 472
253 3300006028 Ga0070717_10003199 Ga0070717_100031997 472
254 3300009093 Ga0105240_10000178 Ga0105240_1000017839 472
255 3300013307 Ga0157372_10026600 Ga0157372_100266007 472
256 3300013307 Ga0157372_10236277 Ga0157372_102362771 472
257 3300025913 Ga0207695_10000249 Ga0207695_1000024990 472
258 3300025949 Ga0207667_10007973 Ga0207667_100079736 472
259 3300035113 Ga0373936_0013395 Ga0373936_0013395_923_2434 472
260 3300039453 Ga0436362_0461762 Ga0436362_0461762_3172_4698 472
261 3300047471 Ga0495684_0099311 Ga0495684_0099311_623_2098 472
262 3300005444 Ga0070694_100020215 Ga0070694_1000202151 473
263 3300005471 Ga0070698_100096294 Ga0070698_1000962943 473
264 3300005536 Ga0070697_100207316 Ga0070697_1002073162 473
265 3300009147 Ga0114129_10022378 Ga0114129_100223783 473
266 3300014969 Ga0157376_10127200 Ga0157376_101272002 473
267 3300050507 nmdc:mga05p37_3603_c1 nmdc:mga05p37_3603_c1_14434_15867 473
268 3300005338 Ga0068868_100015308 Ga0068868_1000153085 474
269 3300005406 Ga0070703_10013902 Ga0070703_100139022 474
270 3300005518 Ga0070699_100051478 Ga0070699_1000514782 474
271 3300005536 Ga0070697_100030767 Ga0070697_1000307673 474
272 3300005548 Ga0070665_100156110 Ga0070665_1001561102 474
273 3300005614 Ga0068856_100061884 Ga0068856_1000618842 474
274 3300006358 Ga0068871_100056040 Ga0068871_1000560402 474
275 3300006871 Ga0075434_100017276 Ga0075434_1000172764 474
276 3300006914 Ga0075436_100063164 Ga0075436_1000631643 474
277 3300007076 Ga0075435_100005304 Ga0075435_1000053043 474
278 3300009094 Ga0111539_10014823 Ga0111539_100148234 474
279 3300009098 Ga0105245_10004878 Ga0105245_100048788 474
280 3300009147 Ga0114129_10011241 Ga0114129_100112418 474
281 3300009174 Ga0105241_10011619 Ga0105241_100116194 474
282 3300009174 Ga0105241_10043050 Ga0105241_100430503 474
283 3300009177 Ga0105248_10001527 Ga0105248_100015278 474
284 3300011119 Ga0105246_10050293 Ga0105246_100502932 474
285 3300013100 Ga0157373_10001055 Ga0157373_1000105512 474
286 3300013307 Ga0157372_10028884 Ga0157372_100288845 474
287 3300014969 Ga0157376_10000991 Ga0157376_100009918 474
288 3300025885 Ga0207653_10004400 Ga0207653_100044002 474
289 3300026078 Ga0207702_10013451 Ga0207702_100134515 474
290 3300031691 Ga0316579_10042784 Ga0316579_100427842 474
291 3300042876 Ga0451577_0128704 Ga0451577_0128704_131_1621 474
292 3300048918 Ga0496115_0044671 Ga0496115_0044671_930_2438 474
293 3300049570 Ga0501033_0005773 Ga0501033_0005773_4160_5662 474
294 3300049581 Ga0501047_0003666 Ga0501047_0003666_5630_7132 474
295 3300049744 Ga0501083_0008460 Ga0501083_0008460_4550_6052 474
296 3300049744 Ga0501083_0083237 Ga0501083_0083237_555_2057 474
297 3300049824 Ga0501045_0150248 Ga0501045_0150248_37_1539 474
298 3300050507 nmdc:mga05p37_115958_c1 nmdc:mga05p37_115958_c1_988_2436 474
299 3300050512 nmdc:mga0n895_34219_c1 nmdc:mga0n895_34219_c1_2025_3533 474
300 3300050513 nmdc:mga0rr50_3575_c1 nmdc:mga0rr50_3575_c1_1018_2526 474
301 3300050514 nmdc:mga08x19_9583_c2 nmdc:mga08x19_9583_c2_1000_2508 474
302 3300050515 nmdc:mga0a205_115835_c1 nmdc:mga0a205_115835_c1_902_2413 474
303 3300006237 Ga0097621_100003948 Ga0097621_1000039486 475
304 3300009147 Ga0114129_10119081 Ga0114129_101190812 475
305 3300009545 Ga0105237_10015644 Ga0105237_100156445 475
306 3300025914 Ga0207671_10030492 Ga0207671_100304923 475
307 3300044712 Ga0453684_0020898 Ga0453684_0020898_6057_7547 475
308 3300048915 Ga0496112_0101967 Ga0496112_0101967_1016_2515 475
309 3300049569 Ga0501032_0045989 Ga0501032_0045989_1373_2875 475
310 3300049571 Ga0501034_0010575 Ga0501034_0010575_7682_9184 475
311 3300049574 Ga0501038_0054283 Ga0501038_0054283_1501_3003 475
312 3300049575 Ga0501039_0042516 Ga0501039_0042516_1349_2851 475
313 3300049580 Ga0501046_0014221 Ga0501046_0014221_4942_6444 475
314 3300049581 Ga0501047_0003728 Ga0501047_0003728_11534_13036 475
315 3300049583 Ga0501067_0053166 Ga0501067_0053166_649_2151 475
316 3300049742 Ga0501080_0014267 Ga0501080_0014267_5102_6604 475
317 3300049823 Ga0501044_0056260 Ga0501044_0056260_2314_3816 475
318 3300060353 Ga0501082_0078520 Ga0501082_0078520_699_2201 475
319 3300005335 Ga0070666_10003842 Ga0070666_100038423 476
320 3300006237 Ga0097621_100002271 Ga0097621_1000022719 476
321 3300025903 Ga0207680_10002337 Ga0207680_100023373 476
322 3300025939 Ga0207665_10139273 Ga0207665_101392731 476
323 3300026035 Ga0207703_10001398 Ga0207703_1000139816 476
324 3300028573 Ga0265334_10037472 Ga0265334_100374721 476
325 3300031240 Ga0265320_10000032 Ga0265320_1000003230 476
326 3300042439 Ga0439464_0006622 Ga0439464_0006622_148_1677 476
327 3300046473 Ga0495582_0046150 Ga0495582_0046150_503_2008 476
328 3300005295 Ga0065707_10002876 Ga0065707_100028762 477
329 3300005467 Ga0070706_100002696 Ga0070706_1000026969 477
330 3300005468 Ga0070707_100003997 Ga0070707_1000039972 477
331 3300005471 Ga0070698_100034000 Ga0070698_1000340003 477
332 3300006847 Ga0075431_100008530 Ga0075431_1000085303 477
333 3300009147 Ga0114129_10033594 Ga0114129_100335942 477
334 3300009174 Ga0105241_10020850 Ga0105241_100208502 477
335 3300010375 Ga0105239_10270093 Ga0105239_102700931 477
336 3300014326 Ga0157380_10012184 Ga0157380_100121843 477
337 3300014968 Ga0157379_10004057 Ga0157379_100040574 477
338 3300025910 Ga0207684_10004777 Ga0207684_100047777 477
339 3300025922 Ga0207646_10005136 Ga0207646_1000513613 477
340 3300025922 Ga0207646_10016437 Ga0207646_100164372 477
341 3300028577 Ga0265318_10005219 Ga0265318_100052192 477
342 3300031235 Ga0265330_10047557 Ga0265330_100475572 477
343 3300031250 Ga0265331_10012216 Ga0265331_100122161 477
344 3300035691 Ga0373931_0029217 Ga0373931_0029217_326_1819 477
345 3300044712 Ga0453684_0052207 Ga0453684_0052207_921_2429 477
346 3300048905 Ga0496102_0000641 Ga0496102_0000641_26765_28258 477
347 3300048907 Ga0496104_0013455 Ga0496104_0013455_3126_4619 477
348 3300048908 Ga0496105_0117664 Ga0496105_0117664_222_1715 477
349 3300050507 nmdc:mga05p37_35213_c1 nmdc:mga05p37_35213_c1_1290_2810 477
350 3300005436 Ga0070713_100052784 Ga0070713_1000527842 478
351 3300005518 Ga0070699_100084372 Ga0070699_1000843722 478
352 3300005937 Ga0081455_10066861 Ga0081455_100668613 478
353 3300024227 Ga0228598_1000423 Ga0228598_10004233 478
354 3300025910 Ga0207684_10127292 Ga0207684_101272922 478
355 3300028563 Ga0265319_1002942 Ga0265319_10029427 478
356 3300042876 Ga0451577_0026254 Ga0451577_0026254_2261_3757 478
357 3300046543 Ga0495645_0014894 Ga0495645_0014894_3783_5291 478
358 3300049568 Ga0501031_0103351 Ga0501031_0103351_95_1600 478
359 3300049569 Ga0501032_0012270 Ga0501032_0012270_2432_3937 478
360 3300049570 Ga0501033_0006344 Ga0501033_0006344_5127_6632 478
361 3300049571 Ga0501034_0018789 Ga0501034_0018789_1909_3414 478
362 3300049573 Ga0501037_0008661 Ga0501037_0008661_1184_2689 478
363 3300049574 Ga0501038_0024503 Ga0501038_0024503_734_2239 478
364 3300049579 Ga0501043_0003562 Ga0501043_0003562_5550_7055 478
365 3300049580 Ga0501046_0010405 Ga0501046_0010405_4390_5895 478
366 3300049581 Ga0501047_0025582 Ga0501047_0025582_2998_4503 478
367 3300049582 Ga0501048_0001404 Ga0501048_0001404_14138_15643 478
368 3300049583 Ga0501067_0009909 Ga0501067_0009909_495_2000 478
369 3300049586 Ga0501070_0012750 Ga0501070_0012750_5329_6834 478
370 3300049741 Ga0501079_0020680 Ga0501079_0020680_2090_3595 478
371 3300049742 Ga0501080_0016012 Ga0501080_0016012_5255_6760 478
372 3300053077 Ga0495601_0062613 Ga0495601_0062613_167_1675 478
373 3300009101 Ga0105247_10043136 Ga0105247_100431363 479
374 3300031235 Ga0265330_10000507 Ga0265330_100005078 479
375 3300031241 Ga0265325_10000167 Ga0265325_100001676 479
376 3300031241 Ga0265325_10000239 Ga0265325_1000023929 479
377 3300031249 Ga0265339_10003514 Ga0265339_100035143 479
378 3300031249 Ga0265339_10041400 Ga0265339_100414002 479
379 3300031250 Ga0265331_10000512 Ga0265331_100005122 479
380 3300031344 Ga0265316_10001849 Ga0265316_100018497 479
381 3300031595 Ga0265313_10000349 Ga0265313_1000034910 479
382 3300031595 Ga0265313_10000894 Ga0265313_100008948 479
383 3300031711 Ga0265314_10000713 Ga0265314_1000071326 479
384 3300031712 Ga0265342_10000686 Ga0265342_100006864 479
385 3300031728 Ga0316578_10086679 Ga0316578_100866791 479
386 3300005329 Ga0070683_100021572 Ga0070683_1000215726 480
387 3300025912 Ga0207707_10095021 Ga0207707_100950212 480
388 3300025940 Ga0207691_10186561 Ga0207691_101865612 480
389 3300005842 Ga0068858_100035131 Ga0068858_1000351314 481
390 3300006844 Ga0075428_100139940 Ga0075428_1001399401 481
391 3300009094 Ga0111539_10005248 Ga0111539_100052483 481
392 3300013296 Ga0157374_10004887 Ga0157374_100048878 481
393 3300005441 Ga0070700_100044426 Ga0070700_1000444262 482
394 3300005459 Ga0068867_100043396 Ga0068867_1000433962 482
395 3300005842 Ga0068858_100187227 Ga0068858_1001872272 482
396 3300009147 Ga0114129_10084691 Ga0114129_100846912 482
397 3300009176 Ga0105242_10089304 Ga0105242_100893042 482
398 3300026075 Ga0207708_10160211 Ga0207708_101602111 482
399 3300031241 Ga0265325_10006922 Ga0265325_100069226 482
400 3300031247 Ga0265340_10004426 Ga0265340_100044264 482
401 3300031247 Ga0265340_10026524 Ga0265340_100265244 482
402 3300031249 Ga0265339_10037352 Ga0265339_100373522 482
403 3300031344 Ga0265316_10061796 Ga0265316_100617963 482
404 3300035172 Ga0373955_0091673 Ga0373955_0091673_153_1649 482
405 3300046663 Ga0495635_0059297 Ga0495635_0059297_1036_2532 482
406 3300005340 Ga0070689_100035853 Ga0070689_1000358533 483
407 3300005440 Ga0070705_100003449 Ga0070705_1000034497 483
408 3300005544 Ga0070686_100015781 Ga0070686_1000157812 483
409 3300005578 Ga0068854_100066423 Ga0068854_1000664232 483
410 3300006852 Ga0075433_10002695 Ga0075433_100026957 483
411 3300014745 Ga0157377_10028727 Ga0157377_100287272 483
412 3300025981 Ga0207640_10051211 Ga0207640_100512111 483
413 3300026067 Ga0207678_10010352 Ga0207678_100103524 483
414 3300026089 Ga0207648_10010915 Ga0207648_100109152 483
415 3300031344 Ga0265316_10004004 Ga0265316_100040049 483
416 3300039437 Ga0436365_0126746 Ga0436365_0126746_531_2039 483
417 3300049569 Ga0501032_0003101 Ga0501032_0003101_290_1795 483
418 3300049570 Ga0501033_0001096 Ga0501033_0001096_5198_6703 483
419 3300049571 Ga0501034_0072741 Ga0501034_0072741_1599_3104 483
420 3300049572 Ga0501036_0001195 Ga0501036_0001195_4111_5616 483
421 3300049573 Ga0501037_0002133 Ga0501037_0002133_12692_14197 483
422 3300049579 Ga0501043_0008126 Ga0501043_0008126_6217_7722 483
423 3300049580 Ga0501046_0003257 Ga0501046_0003257_2915_4420 483
424 3300049581 Ga0501047_0034946 Ga0501047_0034946_3071_4576 483
425 3300049582 Ga0501048_0001416 Ga0501048_0001416_2533_4038 483
426 3300049586 Ga0501070_0015454 Ga0501070_0015454_1374_2879 483
427 3300049589 Ga0501073_0009670 Ga0501073_0009670_3071_4576 483
428 3300049590 Ga0501074_0001199 Ga0501074_0001199_2534_4039 483
429 3300049741 Ga0501079_0001813 Ga0501079_0001813_13687_15192 483
430 3300049742 Ga0501080_0048020 Ga0501080_0048020_238_1743 483
431 3300049744 Ga0501083_0007965 Ga0501083_0007965_1599_3104 483
432 3300049822 Ga0501035_0002125 Ga0501035_0002125_2532_4037 483
433 3300049823 Ga0501044_0025473 Ga0501044_0025473_2533_4038 483
434 3300050515 nmdc:mga0a205_3661_c1 nmdc:mga0a205_3661_c1_926_2446 483
435 3300054114 Ga0501084_0002244 Ga0501084_0002244_9051_10556 483
436 3300060353 Ga0501082_0001883 Ga0501082_0001883_12445_13950 483
437 3300006178 Ga0075367_10049947 Ga0075367_100499473 484
438 3300006195 Ga0075366_10010326 Ga0075366_100103262 484
439 3300006353 Ga0075370_10045341 Ga0075370_100453412 484
440 3300028800 Ga0265338_10005938 Ga0265338_1000593813 484
441 3300031249 Ga0265339_10024272 Ga0265339_100242722 484
442 3300031711 Ga0265314_10012791 Ga0265314_100127915 484
443 3300042184 Ga0450908_004534 Ga0450908_004534_358_1857 484
444 3300049568 Ga0501031_0001966 Ga0501031_0001966_5075_6577 484
445 3300049570 Ga0501033_0009768 Ga0501033_0009768_611_2113 484
446 3300049572 Ga0501036_0005799 Ga0501036_0005799_5065_6567 484
447 3300049573 Ga0501037_0005157 Ga0501037_0005157_1925_3427 484
448 3300049575 Ga0501039_0027515 Ga0501039_0027515_744_2246 484
449 3300049579 Ga0501043_0009092 Ga0501043_0009092_2743_4245 484
450 3300049580 Ga0501046_0006694 Ga0501046_0006694_31_1533 484
451 3300049582 Ga0501048_0002224 Ga0501048_0002224_4245_5747 484
452 3300049583 Ga0501067_0003313 Ga0501067_0003313_905_2407 484
453 3300049584 Ga0501068_0008669 Ga0501068_0008669_1345_2847 484
454 3300049587 Ga0501071_0043532 Ga0501071_0043532_1235_2737 484
455 3300049588 Ga0501072_0054835 Ga0501072_0054835_525_2027 484
456 3300049590 Ga0501074_0000241 Ga0501074_0000241_21979_23481 484
457 3300049741 Ga0501079_0003433 Ga0501079_0003433_8361_9863 484
458 3300049822 Ga0501035_0007030 Ga0501035_0007030_2285_3787 484
459 3300049824 Ga0501045_0014147 Ga0501045_0014147_3507_5009 484
460 3300050494 nmdc:mga06z11_37534_c1 nmdc:mga06z11_37534_c1_139_1638 484
461 3300050496 nmdc:mga07m45_37453_c1 nmdc:mga07m45_37453_c1_821_2320 484
462 3300054114 Ga0501084_0014669 Ga0501084_0014669_2533_4035 484
463 3300060353 Ga0501082_0004549 Ga0501082_0004549_4146_5648 484
464 3300005456 Ga0070678_100049829 Ga0070678_1000498292 485
465 3300005536 Ga0070697_100066894 Ga0070697_1000668942 485
466 3300005549 Ga0070704_100025720 Ga0070704_1000257204 485
467 3300005841 Ga0068863_100127068 Ga0068863_1001270682 485
468 3300006028 Ga0070717_10031206 Ga0070717_100312063 485
469 3300006881 Ga0068865_100113486 Ga0068865_1001134862 485
470 3300014325 Ga0163163_10058820 Ga0163163_100588203 485
471 3300025940 Ga0207691_10020128 Ga0207691_100201284 485
472 3300025972 Ga0207668_10055321 Ga0207668_100553212 485
473 3300026067 Ga0207678_10027757 Ga0207678_100277573 485
474 3300026088 Ga0207641_10030588 Ga0207641_100305883 485
475 3300026095 Ga0207676_10097316 Ga0207676_100973162 485
476 3300044658 Ga0466972_0002988 Ga0466972_0002988_1473_2987 485
477 3300044901 Ga0466960_0007624 Ga0466960_0007624_65_1579 485
478 3300005438 Ga0070701_10021017 Ga0070701_100210173 486
479 3300005843 Ga0068860_100121345 Ga0068860_1001213452 486
480 3300005844 Ga0068862_100091064 Ga0068862_1000910642 486
481 3300006195 Ga0075366_10000144 Ga0075366_100001449 486
482 3300009094 Ga0111539_10017378 Ga0111539_100173782 486
483 3300009147 Ga0114129_10008657 Ga0114129_1000865711 486
484 3300009177 Ga0105248_10012017 Ga0105248_100120174 486
485 3300013308 Ga0157375_10128081 Ga0157375_101280811 486
486 3300014326 Ga0157380_10058476 Ga0157380_100584763 486
487 3300025940 Ga0207691_10043105 Ga0207691_100431054 486
488 3300025942 Ga0207689_10013848 Ga0207689_100138484 486
489 3300027907 Ga0207428_10015554 Ga0207428_100155542 486
490 3300027907 Ga0207428_10039352 Ga0207428_100393522 486
491 3300028380 Ga0268265_10151173 Ga0268265_101511732 486
492 3300028381 Ga0268264_10043592 Ga0268264_100435923 486
493 3300049576 Ga0501040_0024283 Ga0501040_0024283_1663_3204 486
494 3300049590 Ga0501074_0039329 Ga0501074_0039329_1011_2552 486
495 3300049743 Ga0501081_0017759 Ga0501081_0017759_665_2206 486
496 3300049824 Ga0501045_0025895 Ga0501045_0025895_521_2062 486
497 3300050493 nmdc:mga0k408_10800_c1 nmdc:mga0k408_10800_c1_270_1781 486
498 3300050507 nmdc:mga05p37_7639_c1 nmdc:mga05p37_7639_c1_2469_3962 486
499 3300050508 nmdc:mga09592_8755_c1 nmdc:mga09592_8755_c1_6625_8136 486
500 3300050511 nmdc:mga08y16_12239_c1 nmdc:mga08y16_12239_c1_383_1894 486
501 3300050511 nmdc:mga08y16_70051_c1 nmdc:mga08y16_70051_c1_1429_2925 486
502 3300060353 Ga0501082_0027217 Ga0501082_0027217_646_2187 486
503 3300005290 Ga0065712_10071722 Ga0065712_100717222 487
504 3300005293 Ga0065715_10109053 Ga0065715_101090532 487
505 3300005334 Ga0068869_100020910 Ga0068869_1000209102 487
506 3300005353 Ga0070669_100164441 Ga0070669_1001644411 487
507 3300005438 Ga0070701_10039158 Ga0070701_100391582 487
508 3300005466 Ga0070685_10048476 Ga0070685_100484762 487
509 3300005468 Ga0070707_100126963 Ga0070707_1001269631 487
510 3300005471 Ga0070698_100094262 Ga0070698_1000942622 487
511 3300005536 Ga0070697_100012862 Ga0070697_1000128622 487
512 3300005719 Ga0068861_100038189 Ga0068861_1000381892 487
513 3300005841 Ga0068863_100070331 Ga0068863_1000703312 487
514 3300006237 Ga0097621_100061367 Ga0097621_1000613672 487
515 3300006358 Ga0068871_100009590 Ga0068871_1000095904 487
516 3300009176 Ga0105242_10071676 Ga0105242_100716762 487
517 3300009176 Ga0105242_10197872 Ga0105242_101978722 487
518 3300009177 Ga0105248_10075736 Ga0105248_100757363 487
519 3300013296 Ga0157374_10007459 Ga0157374_100074597 487
520 3300014969 Ga0157376_10069227 Ga0157376_100692272 487
521 3300017792 Ga0163161_10018819 Ga0163161_100188192 487
522 3300025899 Ga0207642_10050730 Ga0207642_100507302 487
523 3300025910 Ga0207684_10078233 Ga0207684_100782331 487
524 3300025910 Ga0207684_10163002 Ga0207684_101630021 487
525 3300025922 Ga0207646_10001014 Ga0207646_1000101425 487
526 3300025922 Ga0207646_10008426 Ga0207646_100084264 487
527 3300025934 Ga0207686_10046554 Ga0207686_100465542 487
528 3300025938 Ga0207704_10119060 Ga0207704_101190602 487
529 3300025942 Ga0207689_10015206 Ga0207689_100152062 487
530 3300026118 Ga0207675_100097627 Ga0207675_1000976272 487
531 3300026121 Ga0207683_10031671 Ga0207683_100316713 487
532 3300028380 Ga0268265_10058794 Ga0268265_100587942 487
533 3300030760 Ga0265762_1001799 Ga0265762_10017991 487
534 3300035172 Ga0373955_0017844 Ga0373955_0017844_1377_2867 487
535 3300036647 Ga0316582_0000018 Ga0316582_0000018_8639_10123 487
536 3300046809 Ga0495600_0034985 Ga0495600_0034985_1484_2974 487
537 3300048911 Ga0496108_0065744 Ga0496108_0065744_538_2028 487
538 3300048913 Ga0496110_0045619 Ga0496110_0045619_1317_2807 487
539 3300048916 Ga0496113_0100874 Ga0496113_0100874_124_1614 487
540 3300050515 nmdc:mga0a205_5839_c1 nmdc:mga0a205_5839_c1_8231_9742 487
541 3300053085 Ga0495619_0008599 Ga0495619_0008599_4153_5643 487
542 3300005290 Ga0065712_10085738 Ga0065712_100857382 488
543 3300005293 Ga0065715_10099289 Ga0065715_100992893 488
544 3300005335 Ga0070666_10042742 Ga0070666_100427421 488
545 3300005338 Ga0068868_100014059 Ga0068868_1000140592 488
546 3300005364 Ga0070673_100128151 Ga0070673_1001281511 488
547 3300005468 Ga0070707_100026349 Ga0070707_1000263491 488
548 3300005548 Ga0070665_100028955 Ga0070665_1000289554 488
549 3300005617 Ga0068859_100027605 Ga0068859_1000276053 488
550 3300005617 Ga0068859_100192529 Ga0068859_1001925292 488
551 3300005618 Ga0068864_100000940 Ga0068864_10000094014 488
552 3300005841 Ga0068863_100176469 Ga0068863_1001764692 488
553 3300005842 Ga0068858_100061145 Ga0068858_1000611452 488
554 3300006051 Ga0075364_10063086 Ga0075364_100630862 488
555 3300006358 Ga0068871_100025464 Ga0068871_1000254642 488
556 3300006931 Ga0097620_100027605 Ga0097620_1000276053 488
557 3300006931 Ga0097620_100192531 Ga0097620_1001925312 488
558 3300009177 Ga0105248_10030942 Ga0105248_100309422 488
559 3300013105 Ga0157369_10021941 Ga0157369_100219414 488
560 3300013297 Ga0157378_10013955 Ga0157378_100139555 488
561 3300013306 Ga0163162_10002317 Ga0163162_100023177 488
562 3300014969 Ga0157376_10059100 Ga0157376_100591002 488
563 3300025934 Ga0207686_10000141 Ga0207686_1000014121 488
564 3300025938 Ga0207704_10142126 Ga0207704_101421261 488
565 3300025941 Ga0207711_10045713 Ga0207711_100457133 488
566 3300025941 Ga0207711_10195444 Ga0207711_101954441 488
567 3300026023 Ga0207677_10017039 Ga0207677_100170393 488
568 3300026035 Ga0207703_10021476 Ga0207703_100214762 488
569 3300026088 Ga0207641_10001723 Ga0207641_100017239 488
570 3300026095 Ga0207676_10018710 Ga0207676_100187102 488
571 3300037068 Ga0373925_0005926 Ga0373925_0005926_605_2089 488
572 3300050491 nmdc:mga00v17_131664_c1 nmdc:mga00v17_131664_c1_31_1530 488
573 3300050493 nmdc:mga0k408_3793_c1 nmdc:mga0k408_3793_c1_842_2341 488
574 3300050512 nmdc:mga0n895_21342_c1 nmdc:mga0n895_21342_c1_3264_4784 488
575 3300005434 Ga0070709_10093478 Ga0070709_100934781 489
576 3300005435 Ga0070714_100000065 Ga0070714_10000006518 489
577 3300005435 Ga0070714_100115807 Ga0070714_1001158072 489
578 3300005441 Ga0070700_100011097 Ga0070700_1000110974 489
579 3300005444 Ga0070694_100002458 Ga0070694_1000024583 489
580 3300005458 Ga0070681_10160339 Ga0070681_101603391 489
581 3300005468 Ga0070707_100244129 Ga0070707_1002441292 489
582 3300005471 Ga0070698_100086646 Ga0070698_1000866462 489
583 3300005530 Ga0070679_100212057 Ga0070679_1002120571 489
584 3300006914 Ga0075436_100001203 Ga0075436_10000120312 489
585 3300006914 Ga0075436_100031768 Ga0075436_1000317682 489
586 3300007076 Ga0075435_100018223 Ga0075435_1000182233 489
587 3300007265 Ga0099794_10000677 Ga0099794_100006774 489
588 3300009093 Ga0105240_10099641 Ga0105240_100996413 489
589 3300009545 Ga0105237_10194924 Ga0105237_101949242 489
590 3300014325 Ga0163163_10201541 Ga0163163_102015411 489
591 3300025906 Ga0207699_10031428 Ga0207699_100314282 489
592 3300025914 Ga0207671_10162796 Ga0207671_101627962 489
593 3300025921 Ga0207652_10199399 Ga0207652_101993991 489
594 3300025922 Ga0207646_10254108 Ga0207646_102541081 489
595 3300025929 Ga0207664_10000532 Ga0207664_100005321 489
596 3300027671 Ga0209588_1005352 Ga0209588_10053523 489
597 3300035119 Ga0373956_0008131 Ga0373956_0008131_1970_3466 489
598 3300035120 Ga0373957_0007236 Ga0373957_0007236_232_1728 489
599 3300035171 Ga0373946_0005395 Ga0373946_0005395_2741_4237 489
600 3300035692 Ga0373935_0013755 Ga0373935_0013755_1367_2863 489
601 3300035695 Ga0373927_0005612 Ga0373927_0005612_90_1586 489
602 3300046477 Ga0495664_0002704 Ga0495664_0002704_2274_3770 489
603 3300046517 Ga0495630_0016477 Ga0495630_0016477_3127_4623 489
604 3300046690 Ga0495624_0032867 Ga0495624_0032867_377_1873 489
605 3300047319 Ga0495674_0008394 Ga0495674_0008394_6035_7531 489
606 3300048906 Ga0496103_0000987 Ga0496103_0000987_5154_6647 489
607 3300049572 Ga0501036_0065766 Ga0501036_0065766_61_1557 489
608 3300050513 nmdc:mga0rr50_15163_c1 nmdc:mga0rr50_15163_c1_2794_4287 489
609 3300050514 nmdc:mga08x19_82009_c1 nmdc:mga08x19_82009_c1_365_1858 489
610 3300054114 Ga0501084_0228900 Ga0501084_0228900_18_1505 489
611 3300005329 Ga0070683_100008769 Ga0070683_1000087692 490
612 3300005329 Ga0070683_100070557 Ga0070683_1000705572 490
613 3300005330 Ga0070690_100028588 Ga0070690_1000285882 490
614 3300005331 Ga0070670_100017726 Ga0070670_1000177263 490
615 3300005338 Ga0068868_100001960 Ga0068868_1000019609 490
616 3300005338 Ga0068868_100007353 Ga0068868_1000073533 490
617 3300005344 Ga0070661_100171148 Ga0070661_1001711481 490
618 3300005458 Ga0070681_10000055 Ga0070681_1000005520 490
619 3300005458 Ga0070681_10029576 Ga0070681_100295763 490
620 3300005458 Ga0070681_10059518 Ga0070681_100595182 490
621 3300005530 Ga0070679_100146930 Ga0070679_1001469302 490
622 3300005535 Ga0070684_100007024 Ga0070684_1000070246 490
623 3300005535 Ga0070684_100075978 Ga0070684_1000759781 490
624 3300005547 Ga0070693_100037881 Ga0070693_1000378812 490
625 3300005563 Ga0068855_100001077 Ga0068855_1000010773 490
626 3300005563 Ga0068855_100002871 Ga0068855_10000287111 490
627 3300005564 Ga0070664_100001803 Ga0070664_10000180313 490
628 3300005577 Ga0068857_100000041 Ga0068857_10000004134 490
629 3300005578 Ga0068854_100005254 Ga0068854_1000052547 490
630 3300005578 Ga0068854_100027125 Ga0068854_1000271254 490
631 3300005614 Ga0068856_100000355 Ga0068856_10000035514 490
632 3300005614 Ga0068856_100001245 Ga0068856_10000124514 490
633 3300005614 Ga0068856_100001397 Ga0068856_10000139716 490
634 3300005614 Ga0068856_100087961 Ga0068856_1000879613 490
635 3300005617 Ga0068859_100000959 Ga0068859_1000009597 490
636 3300005618 Ga0068864_100005434 Ga0068864_1000054344 490
637 3300005618 Ga0068864_100006890 Ga0068864_1000068905 490
638 3300005719 Ga0068861_100006960 Ga0068861_1000069604 490
639 3300005840 Ga0068870_10015992 Ga0068870_100159922 490
640 3300005842 Ga0068858_100028183 Ga0068858_1000281833 490
641 3300005843 Ga0068860_100002847 Ga0068860_1000028477 490
642 3300005843 Ga0068860_100038275 Ga0068860_1000382752 490
643 3300006237 Ga0097621_100000533 Ga0097621_1000005339 490
644 3300006237 Ga0097621_100000581 Ga0097621_10000058114 490
645 3300006237 Ga0097621_100119678 Ga0097621_1001196782 490
646 3300006358 Ga0068871_100000221 Ga0068871_10000022130 490
647 3300006358 Ga0068871_100000664 Ga0068871_10000066414 490
648 3300006881 Ga0068865_100029088 Ga0068865_1000290883 490
649 3300006931 Ga0097620_100000959 Ga0097620_10000095920 490
650 3300009093 Ga0105240_10034349 Ga0105240_100343495 490
651 3300009093 Ga0105240_10043737 Ga0105240_100437377 490
652 3300009093 Ga0105240_10181339 Ga0105240_101813392 490
653 3300009098 Ga0105245_10055647 Ga0105245_100556473 490
654 3300009176 Ga0105242_10001107 Ga0105242_100011075 490
655 3300009177 Ga0105248_10013857 Ga0105248_100138574 490
656 3300009177 Ga0105248_10034229 Ga0105248_100342293 490
657 3300009177 Ga0105248_10151317 Ga0105248_101513172 490
658 3300009551 Ga0105238_10000533 Ga0105238_100005336 490
659 3300009551 Ga0105238_10006729 Ga0105238_100067295 490
660 3300013102 Ga0157371_10021289 Ga0157371_100212895 490
661 3300013104 Ga0157370_10017861 Ga0157370_100178613 490
662 3300013105 Ga0157369_10000170 Ga0157369_1000017031 490
663 3300013105 Ga0157369_10009253 Ga0157369_100092533 490
664 3300013296 Ga0157374_10000316 Ga0157374_1000031614 490
665 3300013296 Ga0157374_10000330 Ga0157374_1000033031 490
666 3300013296 Ga0157374_10000533 Ga0157374_1000053318 490
667 3300013297 Ga0157378_10000071 Ga0157378_100000716 490
668 3300013297 Ga0157378_10000085 Ga0157378_1000008553 490
669 3300013297 Ga0157378_10000182 Ga0157378_1000018211 490
670 3300013297 Ga0157378_10079407 Ga0157378_100794071 490
671 3300013307 Ga0157372_10000620 Ga0157372_1000062017 490
672 3300013307 Ga0157372_10001563 Ga0157372_100015637 490
673 3300013307 Ga0157372_10002374 Ga0157372_1000237411 490
674 3300013307 Ga0157372_10322166 Ga0157372_103221661 490
675 3300014325 Ga0163163_10076691 Ga0163163_100766911 490
676 3300014969 Ga0157376_10060623 Ga0157376_100606231 490
677 3300025912 Ga0207707_10000739 Ga0207707_1000073920 490
678 3300025912 Ga0207707_10005345 Ga0207707_100053457 490
679 3300025913 Ga0207695_10047422 Ga0207695_100474225 490
680 3300025913 Ga0207695_10050832 Ga0207695_100508322 490
681 3300025913 Ga0207695_10076754 Ga0207695_100767542 490
682 3300025915 Ga0207693_10027726 Ga0207693_100277261 490
683 3300025924 Ga0207694_10001172 Ga0207694_100011725 490
684 3300025932 Ga0207690_10157266 Ga0207690_101572661 490
685 3300025941 Ga0207711_10042283 Ga0207711_100422832 490
686 3300025944 Ga0207661_10045539 Ga0207661_100455392 490
687 3300025949 Ga0207667_10000785 Ga0207667_1000078517 490
688 3300025949 Ga0207667_10003707 Ga0207667_100037078 490
689 3300025949 Ga0207667_10060404 Ga0207667_100604042 490
690 3300025981 Ga0207640_10004787 Ga0207640_100047876 490
691 3300026023 Ga0207677_10009392 Ga0207677_100093923 490
692 3300026023 Ga0207677_10045304 Ga0207677_100453041 490
693 3300026035 Ga0207703_10019982 Ga0207703_100199825 490
694 3300026035 Ga0207703_10021921 Ga0207703_100219214 490
695 3300026078 Ga0207702_10000089 Ga0207702_1000008929 490
696 3300026078 Ga0207702_10000759 Ga0207702_100007596 490
697 3300026078 Ga0207702_10049880 Ga0207702_100498803 490
698 3300026089 Ga0207648_10005354 Ga0207648_100053547 490
699 3300026095 Ga0207676_10008246 Ga0207676_100082466 490
700 3300026116 Ga0207674_10000309 Ga0207674_1000030927 490
701 3300026116 Ga0207674_10005897 Ga0207674_1000589711 490
702 3300026118 Ga0207675_100008562 Ga0207675_1000085625 490
703 3300032002 Ga0307416_100013345 Ga0307416_1000133454 490
704 3300035691 Ga0373931_0085551 Ga0373931_0085551_137_1627 490
705 3300035724 Ga0373933_0075830 Ga0373933_0075830_178_1683 490
706 3300045836 Ga0466958_0017067 Ga0466958_0017067_969_2459 490
707 3300047471 Ga0495684_0089050 Ga0495684_0089050_656_2146 490
708 3300048088 Ga0495602_0091332 Ga0495602_0091332_454_1944 490
709 3300048905 Ga0496102_0058742 Ga0496102_0058742_1108_2616 490
710 3300048905 Ga0496102_0260574 Ga0496102_0260574_30_1520 490
711 3300048909 Ga0496106_0075998 Ga0496106_0075998_431_1939 490
712 3300048915 Ga0496112_0151877 Ga0496112_0151877_518_2026 490
713 3300048918 Ga0496115_0063353 Ga0496115_0063353_354_1844 490
714 3300053139 Ga0500568_0010180 Ga0500568_0010180_1425_2939 490
715 3300006844 Ga0075428_100087856 Ga0075428_1000878562 491
716 3300042876 Ga0451577_0020122 Ga0451577_0020122_107_1582 491
717 3300044712 Ga0453684_0131019 Ga0453684_0131019_737_2212 491
718 3300005336 Ga0070680_100031524 Ga0070680_1000315242 492
719 3300005366 Ga0070659_100013438 Ga0070659_1000134384 492
720 3300005445 Ga0070708_100002603 Ga0070708_1000026039 492
721 3300005458 Ga0070681_10060176 Ga0070681_100601762 492
722 3300005467 Ga0070706_100006514 Ga0070706_1000065141 492
723 3300005471 Ga0070698_100000200 Ga0070698_10000020040 492
724 3300005518 Ga0070699_100000156 Ga0070699_10000015616 492
725 3300005536 Ga0070697_100000235 Ga0070697_10000023516 492
726 3300005539 Ga0068853_100064113 Ga0068853_1000641132 492
727 3300005564 Ga0070664_100007698 Ga0070664_1000076983 492
728 3300005577 Ga0068857_100147381 Ga0068857_1001473811 492
729 3300013100 Ga0157373_10069536 Ga0157373_100695362 492
730 3300014325 Ga0163163_10073522 Ga0163163_100735223 492
731 3300024227 Ga0228598_1000070 Ga0228598_10000706 492
732 3300025910 Ga0207684_10000260 Ga0207684_100002606 492
733 3300025917 Ga0207660_10085859 Ga0207660_100858591 492
734 3300025922 Ga0207646_10000261 Ga0207646_1000026127 492
735 3300025945 Ga0207679_10028975 Ga0207679_100289752 492
736 3300025949 Ga0207667_10168824 Ga0207667_101688242 492
737 3300026041 Ga0207639_10014034 Ga0207639_100140344 492
738 3300026095 Ga0207676_10034969 Ga0207676_100349693 492
739 3300026116 Ga0207674_10000469 Ga0207674_100004696 492
740 3300026116 Ga0207674_10153683 Ga0207674_101536832 492
741 3300036401 Ga0373937_0188893 Ga0373937_0188893_375_1874 492
742 3300046460 Ga0495638_0022118 Ga0495638_0022118_347_1861 492
743 3300048903 Ga0496100_0071778 Ga0496100_0071778_686_2185 492
744 3300050513 nmdc:mga0rr50_5571_c1 nmdc:mga0rr50_5571_c1_141_1631 492
745 3300006847 Ga0075431_100007696 Ga0075431_1000076963 493
746 3300049742 Ga0501080_0089718 Ga0501080_0089718_516_2057 493
747 3300050510 nmdc:mga06r32_8085_c1 nmdc:mga06r32_8085_c1_3374_4882 493
748 3300005435 Ga0070714_100009692 Ga0070714_1000096922 494
749 3300005617 Ga0068859_100029316 Ga0068859_1000293162 494
750 3300006173 Ga0070716_100050396 Ga0070716_1000503963 494
751 3300006931 Ga0097620_100029316 Ga0097620_1000293162 494
752 3300025906 Ga0207699_10030224 Ga0207699_100302242 494
753 3300025928 Ga0207700_10045123 Ga0207700_100451232 494
754 3300025929 Ga0207664_10016554 Ga0207664_100165545 494
755 3300025939 Ga0207665_10051697 Ga0207665_100516973 494
756 3300049571 Ga0501034_0085258 Ga0501034_0085258_945_2447 494
757 3300049572 Ga0501036_0048793 Ga0501036_0048793_256_1758 494
758 3300049581 Ga0501047_0014526 Ga0501047_0014526_421_1923 494
759 3300049586 Ga0501070_0144853 Ga0501070_0144853_386_1888 494
760 3300049587 Ga0501071_0041281 Ga0501071_0041281_483_1967 494
761 3300049588 Ga0501072_0092327 Ga0501072_0092327_876_2360 494
762 3300049591 Ga0501075_0113100 Ga0501075_0113100_60_1544 494
763 3300049742 Ga0501080_0080690 Ga0501080_0080690_284_1786 494
764 3300060353 Ga0501082_0038130 Ga0501082_0038130_648_2150 494
765 3300060353 Ga0501082_0074498 Ga0501082_0074498_450_1934 494
766 3300005444 Ga0070694_100002059 Ga0070694_1000020593 495
767 3300006852 Ga0075433_10030368 Ga0075433_100303682 495
768 3300009093 Ga0105240_10097442 Ga0105240_100974423 495
769 3300013105 Ga0157369_10048297 Ga0157369_100482974 495
770 3300013105 Ga0157369_10112657 Ga0157369_101126573 495
771 3300013307 Ga0157372_10001829 Ga0157372_1000182911 495
772 3300013307 Ga0157372_10023041 Ga0157372_100230414 495
773 3300025913 Ga0207695_10073020 Ga0207695_100730202 495
774 3300049574 Ga0501038_0001977 Ga0501038_0001977_15349_16875 495
775 3300013296 Ga0157374_10233318 Ga0157374_102333181 496
776 3300044694 Ga0466963_0011667 Ga0466963_0011667_2562_4088 496
777 3300049576 Ga0501040_0077806 Ga0501040_0077806_30_1520 496
778 3300049591 Ga0501075_0087112 Ga0501075_0087112_150_1640 496
779 3300049592 Ga0501076_0033736 Ga0501076_0033736_1594_3084 496
780 3300049742 Ga0501080_0057345 Ga0501080_0057345_540_2030 496
781 3300049743 Ga0501081_0018651 Ga0501081_0018651_22_1512 496
782 3300054114 Ga0501084_0203873 Ga0501084_0203873_128_1618 496
783 3300061734 Ga0530510_0089031 Ga0530510_0089031_117_1607 496
784 2162886007 SwRhRL2b_contig_2054937 SwRhRL2b_0345.00004080 499
785 3300005289 Ga0065704_10078208 Ga0065704_100782082 499
786 3300005295 Ga0065707_10082532 Ga0065707_100825328 499
787 3300005445 Ga0070708_100002323 Ga0070708_10000232313 499
788 3300009094 Ga0111539_10001532 Ga0111539_1000153224 499
789 3300027907 Ga0207428_10026180 Ga0207428_100261803 499
790 3300050511 nmdc:mga08y16_34764_c1 nmdc:mga08y16_34764_c1_1283_2782 499

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00370

FGGY_N

FGGY family of carbohydrate kinases, N-terminal domain

76

321

0.98

PF02782

FGGY_C

FGGY family of carbohydrate kinases, C-terminal domain

330

523

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6k76-assembly1.cif.gz_A glycerol kinase form thermococcus kodakarensis, complex structure with substrate. 0.9383 4 480
2zf5-assembly1.cif.gz_O crystal structure of highly thermostable glycerol kinase from a hyperthermophilic archaeon 0.9377 2 481
3h45-assembly1.cif.gz_O glycerol kinase h232e with ethylene glycol 0.9317 2 487
1gll-assembly1.cif.gz_O escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion 0.931 2 483
3flc-assembly1.cif.gz_X crystal structure of the his-tagged h232r mutant of glycerol kinase from enterococcus casseliflavus with glycerol 0.9285 2 483
ID Description Score Start End Superfamily
af_P37677_1_241_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9643 1 237 3.30.420.40
5vm1D01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9496 3 247 3.30.420.40
af_Q2G205_1_247_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9464 1 241 3.30.420.40
3ifrA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9457 3 239 3.30.420.40
af_P37677_1_241_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9448 1 237 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A2N2NH27-F1-model_v4 Carbohydrate kinase FGGY N-terminal domain-containing protein 0.9923 1 242 GO:0005975
GO:0016301
AF-A0A535VT70-F1-model_v4 Xylulokinase 0.992 1 272 GO:0005975
GO:0016301
GO:0016773
AF-W4VBX3-F1-model_v4 Xylulose kinase 0.9911 140 241 GO:0005975
GO:0016301
AF-A0A7C2J5C0-F1-model_v4 Xylulokinase 0.9875 3 255 GO:0005975
GO:0016301
AF-C5H4P8-F1-model_v4 Putative xylulokinase 0.9826 2 219 GO:0005975
GO:0016301

Feature Viewer

pLDDT pTM Quality
95.62 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map