F480947
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 790 | 309 | 790 | 482 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_10151317|Ga0105248_101513172 |
| Length | 573 |
| Sequence | MDAAGGRRQRRRDHQHGDRPCDDISHVCPPGSASVPTSTTEITEKSPHVWLGALSVLGGEGSELRNNSSPPEMPAHVLGIDVGTGGTRAVVVDQGGRIVASATEEHEAFASLQIGWAEQRPEDWWRAAGAAIRRALAHARLRGTDISCVGLTGQMHGAVMLDASGDAVRPAPIWCDVRTSRQCAELTERIGAQRIIQWTCNPALANFTLTKLLWVQQHEPGLWSRVRAVMLPKDYVRFRLTGEKATDVADASGTLMLDVARRRWSEEMLQAAGIDRMVLPSLHESPDVCGTISKAGADASGLAAGTPVVAGAGDQAAGALGLGIVSPXAVSATIGTSGVVFAATDRPAVDPRGRLHTFCHAIPGRWHVMGVTQAAGLSLRWFRDQFARDGDAGGPASYDQLTEEAAAVSPGSEGLLWAPYLMGERTPHLDPDARGALVGLTASHTRAHAVRAVLEGVAFSLKDTLTILSEMDVPMTTIRLGGGGARSPLWRQIQADAYARDVEIVEAEEGAAYGAAILAGVGGGLWPSVDAACASVVRVAAGVRPNERGAAAMTTGYAAYRRVYPAIKSIFRT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 77 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 176 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 177 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 178 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 189 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 200 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 201 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 204 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 211 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 212 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 213 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 214 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 307 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.87 |
| Metatranscriptomes | 0.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.52 |
| Nodule | 0 |
| Rhizoplane | 3.54 |
| Rhizosphere | 94.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2054937 | 2162886007 | Unclassified | 2372 |
| 2 | rootH2_10071456 | 3300003320 | Bacteria | 8644 |
| 3 | Ga0065704_10078208 | 3300005289 | Bacteria | 4497 |
| 4 | Ga0065712_10071722 | 3300005290 | Bacteria | 5098 |
| 5 | Ga0065712_10085738 | 3300005290 | Unclassified | 2649 |
| 6 | Ga0065715_10099289 | 3300005293 | Bacteria | 3431 |
| 7 | Ga0065715_10109053 | 3300005293 | Bacteria | 2683 |
| 8 | Ga0065707_10002876 | 3300005295 | Bacteria | 5654 |
| 9 | Ga0065707_10082532 | 3300005295 | Bacteria | 14047 |
| 10 | Ga0070658_10002614 | 3300005327 | Bacteria | 15008 |
| 11 | Ga0070683_100006910 | 3300005329 | Bacteria | 9535 |
| 12 | Ga0070683_100008769 | 3300005329 | Bacteria | 8596 |
| 13 | Ga0070683_100021572 | 3300005329 | Bacteria | 5749 |
| 14 | Ga0070683_100070557 | 3300005329 | Bacteria | 3259 |
| 15 | Ga0070690_100028588 | 3300005330 | Bacteria | 3453 |
| 16 | Ga0070670_100017726 | 3300005331 | Bacteria | 6109 |
| 17 | Ga0068869_100020910 | 3300005334 | Unclassified | 4496 |
| 18 | Ga0070666_10003842 | 3300005335 | Bacteria | 9113 |
| 19 | Ga0070666_10042742 | 3300005335 | Bacteria | 3033 |
| 20 | Ga0070680_100018455 | 3300005336 | Bacteria | 5510 |
| 21 | Ga0070680_100031524 | 3300005336 | Bacteria | 4263 |
| 22 | Ga0070680_100137248 | 3300005336 | Bacteria | 2049 |
| 23 | Ga0068868_100001960 | 3300005338 | Bacteria | 14101 |
| 24 | Ga0068868_100007353 | 3300005338 | Bacteria | 7843 |
| 25 | Ga0068868_100014059 | 3300005338 | Bacteria | 5892 |
| 26 | Ga0068868_100015308 | 3300005338 | Bacteria | 5670 |
| 27 | Ga0070689_100016063 | 3300005340 | Bacteria | 5475 |
| 28 | Ga0070689_100035853 | 3300005340 | Bacteria | 3791 |
| 29 | Ga0070661_100004719 | 3300005344 | Bacteria | 9377 |
| 30 | Ga0070661_100171148 | 3300005344 | Unclassified | 1649 |
| 31 | Ga0070669_100042973 | 3300005353 | Bacteria | 3290 |
| 32 | Ga0070669_100164441 | 3300005353 | Bacteria | 1726 |
| 33 | Ga0070675_100082844 | 3300005354 | Bacteria | 2677 |
| 34 | Ga0070673_100128151 | 3300005364 | Unclassified | 2126 |
| 35 | Ga0070659_100013438 | 3300005366 | Bacteria | 6094 |
| 36 | Ga0070659_100068315 | 3300005366 | Bacteria | 2819 |
| 37 | Ga0070703_10013902 | 3300005406 | Bacteria | 2287 |
| 38 | Ga0070709_10072226 | 3300005434 | Bacteria | 2230 |
| 39 | Ga0070709_10093478 | 3300005434 | Bacteria | 1988 |
| 40 | Ga0070714_100000065 | 3300005435 | Bacteria | 96459 |
| 41 | Ga0070714_100009692 | 3300005435 | Bacteria | 7584 |
| 42 | Ga0070714_100115807 | 3300005435 | Bacteria | 2379 |
| 43 | Ga0070714_100178423 | 3300005435 | Unclassified | 1931 |
| 44 | Ga0070713_100010317 | 3300005436 | Bacteria | 6746 |
| 45 | Ga0070713_100052784 | 3300005436 | Unclassified | 3367 |
| 46 | Ga0070713_100067191 | 3300005436 | Unclassified | 3018 |
| 47 | Ga0070701_10021017 | 3300005438 | Bacteria | 3108 |
| 48 | Ga0070701_10039158 | 3300005438 | Bacteria | 2403 |
| 49 | Ga0070711_100000441 | 3300005439 | Bacteria | 21555 |
| 50 | Ga0070711_100010131 | 3300005439 | Bacteria | 5825 |
| 51 | Ga0070711_100011410 | 3300005439 | Bacteria | 5516 |
| 52 | Ga0070711_100012830 | 3300005439 | Bacteria | 5247 |
| 53 | Ga0070711_100020844 | 3300005439 | Bacteria | 4231 |
| 54 | Ga0070705_100003449 | 3300005440 | Bacteria | 7755 |
| 55 | Ga0070700_100011097 | 3300005441 | Bacteria | 4983 |
| 56 | Ga0070700_100044426 | 3300005441 | Bacteria | 2736 |
| 57 | Ga0070694_100002059 | 3300005444 | Bacteria | 11922 |
| 58 | Ga0070694_100002458 | 3300005444 | Bacteria | 10936 |
| 59 | Ga0070694_100020215 | 3300005444 | Bacteria | 4243 |
| 60 | Ga0070708_100002019 | 3300005445 | Bacteria | 15622 |
| 61 | Ga0070708_100002323 | 3300005445 | Bacteria | 14714 |
| 62 | Ga0070708_100002603 | 3300005445 | Bacteria | 13958 |
| 63 | Ga0070708_100094548 | 3300005445 | Unclassified | 2727 |
| 64 | Ga0070678_100049829 | 3300005456 | Bacteria | 3024 |
| 65 | Ga0070681_10000055 | 3300005458 | Bacteria | 80179 |
| 66 | Ga0070681_10029576 | 3300005458 | Bacteria | 5501 |
| 67 | Ga0070681_10059518 | 3300005458 | Unclassified | 3800 |
| 68 | Ga0070681_10060176 | 3300005458 | Bacteria | 3776 |
| 69 | Ga0070681_10160339 | 3300005458 | Bacteria | 2173 |
| 70 | Ga0068867_100019588 | 3300005459 | Bacteria | 4820 |
| 71 | Ga0068867_100043396 | 3300005459 | Bacteria | 3292 |
| 72 | Ga0070685_10048476 | 3300005466 | Bacteria | 2446 |
| 73 | Ga0070706_100002696 | 3300005467 | Bacteria | 17765 |
| 74 | Ga0070706_100006514 | 3300005467 | Bacteria | 11020 |
| 75 | Ga0070707_100003997 | 3300005468 | Bacteria | 13883 |
| 76 | Ga0070707_100026349 | 3300005468 | Bacteria | 5519 |
| 77 | Ga0070707_100126963 | 3300005468 | Bacteria | 2478 |
| 78 | Ga0070707_100156409 | 3300005468 | Unclassified | 2220 |
| 79 | Ga0070707_100244129 | 3300005468 | Unclassified | 1748 |
| 80 | Ga0070698_100000200 | 3300005471 | Bacteria | 57460 |
| 81 | Ga0070698_100034000 | 3300005471 | Bacteria | 5281 |
| 82 | Ga0070698_100086646 | 3300005471 | Bacteria | 3118 |
| 83 | Ga0070698_100088872 | 3300005471 | Unclassified | 3074 |
| 84 | Ga0070698_100094262 | 3300005471 | Bacteria | 2973 |
| 85 | Ga0070698_100096294 | 3300005471 | Bacteria | 2936 |
| 86 | Ga0070699_100000156 | 3300005518 | Bacteria | 64338 |
| 87 | Ga0070699_100024708 | 3300005518 | Bacteria | 5180 |
| 88 | Ga0070699_100051478 | 3300005518 | Bacteria | 3565 |
| 89 | Ga0070699_100084372 | 3300005518 | Bacteria | 2772 |
| 90 | Ga0070679_100016382 | 3300005530 | Bacteria | 7148 |
| 91 | Ga0070679_100146930 | 3300005530 | Unclassified | 2335 |
| 92 | Ga0070679_100212057 | 3300005530 | Bacteria | 1900 |
| 93 | Ga0070684_100007024 | 3300005535 | Bacteria | 8750 |
| 94 | Ga0070684_100075978 | 3300005535 | Bacteria | 2964 |
| 95 | Ga0070697_100000235 | 3300005536 | Bacteria | 44962 |
| 96 | Ga0070697_100012862 | 3300005536 | Bacteria | 6558 |
| 97 | Ga0070697_100030767 | 3300005536 | Bacteria | 4314 |
| 98 | Ga0070697_100066894 | 3300005536 | Bacteria | 2938 |
| 99 | Ga0070697_100207316 | 3300005536 | Bacteria | 1668 |
| 100 | Ga0068853_100064113 | 3300005539 | Bacteria | 3185 |
| 101 | Ga0068853_100091158 | 3300005539 | Unclassified | 2680 |
| 102 | Ga0070672_100103052 | 3300005543 | Unclassified | 2317 |
| 103 | Ga0070686_100015781 | 3300005544 | Bacteria | 4384 |
| 104 | Ga0070695_100003121 | 3300005545 | Bacteria | 9649 |
| 105 | Ga0070695_100073059 | 3300005545 | Bacteria | 2250 |
| 106 | Ga0070696_100017071 | 3300005546 | Bacteria | 4898 |
| 107 | Ga0070693_100037881 | 3300005547 | Unclassified | 2692 |
| 108 | Ga0070693_100039810 | 3300005547 | Bacteria | 2635 |
| 109 | Ga0070665_100028955 | 3300005548 | Bacteria | 5576 |
| 110 | Ga0070665_100051409 | 3300005548 | Bacteria | 4133 |
| 111 | Ga0070665_100156110 | 3300005548 | Unclassified | 2284 |
| 112 | Ga0070704_100025720 | 3300005549 | Bacteria | 3879 |
| 113 | Ga0068855_100001077 | 3300005563 | Bacteria | 33925 |
| 114 | Ga0068855_100002871 | 3300005563 | Bacteria | 21140 |
| 115 | Ga0068855_100037082 | 3300005563 | Bacteria | 5800 |
| 116 | Ga0068855_100066292 | 3300005563 | Bacteria | 4210 |
| 117 | Ga0070664_100001803 | 3300005564 | Bacteria | 17165 |
| 118 | Ga0070664_100007698 | 3300005564 | Bacteria | 8699 |
| 119 | Ga0068857_100000041 | 3300005577 | Bacteria | 70173 |
| 120 | Ga0068857_100147381 | 3300005577 | Bacteria | 2130 |
| 121 | Ga0068854_100005254 | 3300005578 | Bacteria | 8168 |
| 122 | Ga0068854_100027125 | 3300005578 | Unclassified | 3945 |
| 123 | Ga0068854_100066423 | 3300005578 | Bacteria | 2625 |
| 124 | Ga0068856_100000355 | 3300005614 | Bacteria | 49986 |
| 125 | Ga0068856_100001245 | 3300005614 | Bacteria | 26739 |
| 126 | Ga0068856_100001397 | 3300005614 | Bacteria | 25289 |
| 127 | Ga0068856_100046450 | 3300005614 | Bacteria | 4277 |
| 128 | Ga0068856_100061884 | 3300005614 | Bacteria | 3697 |
| 129 | Ga0068856_100087222 | 3300005614 | Bacteria | 3102 |
| 130 | Ga0068856_100087961 | 3300005614 | Bacteria | 3089 |
| 131 | Ga0068856_100193573 | 3300005614 | Bacteria | 2047 |
| 132 | Ga0068852_100046839 | 3300005616 | Bacteria | 3686 |
| 133 | Ga0068859_100000959 | 3300005617 | Bacteria | 29530 |
| 134 | Ga0068859_100005424 | 3300005617 | Bacteria | 12967 |
| 135 | Ga0068859_100015114 | 3300005617 | Bacteria | 7747 |
| 136 | Ga0068859_100027605 | 3300005617 | Bacteria | 5693 |
| 137 | Ga0068859_100029316 | 3300005617 | Bacteria | 5522 |
| 138 | Ga0068859_100033126 | 3300005617 | Bacteria | 5190 |
| 139 | Ga0068859_100079723 | 3300005617 | Bacteria | 3315 |
| 140 | Ga0068859_100192529 | 3300005617 | Bacteria | 2124 |
| 141 | Ga0068864_100000940 | 3300005618 | Bacteria | 24377 |
| 142 | Ga0068864_100005434 | 3300005618 | Bacteria | 10446 |
| 143 | Ga0068864_100006890 | 3300005618 | Bacteria | 9315 |
| 144 | Ga0068861_100006960 | 3300005719 | Bacteria | 7726 |
| 145 | Ga0068861_100038189 | 3300005719 | Bacteria | 3574 |
| 146 | Ga0068870_10015992 | 3300005840 | Bacteria | 3574 |
| 147 | Ga0068863_100070331 | 3300005841 | Bacteria | 3310 |
| 148 | Ga0068863_100127068 | 3300005841 | Bacteria | 2433 |
| 149 | Ga0068863_100176469 | 3300005841 | Unclassified | 2051 |
| 150 | Ga0068858_100028183 | 3300005842 | Bacteria | 5218 |
| 151 | Ga0068858_100035131 | 3300005842 | Unclassified | 4649 |
| 152 | Ga0068858_100061145 | 3300005842 | Bacteria | 3482 |
| 153 | Ga0068858_100187227 | 3300005842 | Bacteria | 1955 |
| 154 | Ga0068860_100002847 | 3300005843 | Bacteria | 17956 |
| 155 | Ga0068860_100038275 | 3300005843 | Bacteria | 4588 |
| 156 | Ga0068860_100121345 | 3300005843 | Bacteria | 2503 |
| 157 | Ga0068862_100016749 | 3300005844 | Bacteria | 6102 |
| 158 | Ga0068862_100091064 | 3300005844 | Bacteria | 2655 |
| 159 | Ga0081455_10066861 | 3300005937 | Bacteria | 2998 |
| 160 | Ga0070717_10000558 | 3300006028 | Bacteria | 23672 |
| 161 | Ga0070717_10002266 | 3300006028 | Bacteria | 13490 |
| 162 | Ga0070717_10003199 | 3300006028 | Bacteria | 11700 |
| 163 | Ga0070717_10004158 | 3300006028 | Bacteria | 10434 |
| 164 | Ga0070717_10012524 | 3300006028 | Bacteria | 6469 |
| 165 | Ga0070717_10031206 | 3300006028 | Bacteria | 4285 |
| 166 | Ga0075364_10063086 | 3300006051 | Bacteria | 2432 |
| 167 | Ga0070715_10000032 | 3300006163 | Bacteria | 83594 |
| 168 | Ga0070716_100002392 | 3300006173 | Bacteria | 8635 |
| 169 | Ga0070716_100050396 | 3300006173 | Unclassified | 2363 |
| 170 | Ga0070716_100060558 | 3300006173 | Unclassified | 2187 |
| 171 | Ga0070712_100000849 | 3300006175 | Bacteria | 18182 |
| 172 | Ga0070712_100001921 | 3300006175 | Bacteria | 12720 |
| 173 | Ga0070712_100005692 | 3300006175 | Bacteria | 7705 |
| 174 | Ga0070712_100023513 | 3300006175 | Unclassified | 4072 |
| 175 | Ga0070712_100039273 | 3300006175 | Bacteria | 3239 |
| 176 | Ga0070712_100049404 | 3300006175 | Bacteria | 2921 |
| 177 | Ga0075367_10049947 | 3300006178 | Bacteria | 2467 |
| 178 | Ga0075366_10000144 | 3300006195 | Bacteria | 29999 |
| 179 | Ga0075366_10010326 | 3300006195 | Bacteria | 5241 |
| 180 | Ga0097621_100000533 | 3300006237 | Bacteria | 26715 |
| 181 | Ga0097621_100000581 | 3300006237 | Bacteria | 25739 |
| 182 | Ga0097621_100002271 | 3300006237 | Bacteria | 13157 |
| 183 | Ga0097621_100003948 | 3300006237 | Bacteria | 10274 |
| 184 | Ga0097621_100061367 | 3300006237 | Bacteria | 3083 |
| 185 | Ga0097621_100119678 | 3300006237 | Unclassified | 2232 |
| 186 | Ga0075370_10045341 | 3300006353 | Bacteria | 2487 |
| 187 | Ga0068871_100000221 | 3300006358 | Bacteria | 40089 |
| 188 | Ga0068871_100000664 | 3300006358 | Bacteria | 23618 |
| 189 | Ga0068871_100004354 | 3300006358 | Bacteria | 9840 |
| 190 | Ga0068871_100009590 | 3300006358 | Bacteria | 7026 |
| 191 | Ga0068871_100025464 | 3300006358 | Bacteria | 4604 |
| 192 | Ga0068871_100056040 | 3300006358 | Unclassified | 3203 |
| 193 | Ga0068871_100058610 | 3300006358 | Bacteria | 3136 |
| 194 | Ga0075428_100087856 | 3300006844 | Bacteria | 3391 |
| 195 | Ga0075428_100139940 | 3300006844 | Unclassified | 2631 |
| 196 | Ga0075431_100007696 | 3300006847 | Bacteria | 10728 |
| 197 | Ga0075431_100008530 | 3300006847 | Bacteria | 10261 |
| 198 | Ga0075433_10000957 | 3300006852 | Bacteria | 20408 |
| 199 | Ga0075433_10002695 | 3300006852 | Bacteria | 13559 |
| 200 | Ga0075433_10030368 | 3300006852 | Bacteria | 4610 |
| 201 | Ga0075434_100000557 | 3300006871 | Bacteria | 28585 |
| 202 | Ga0075434_100017276 | 3300006871 | Bacteria | 6948 |
| 203 | Ga0075434_100034773 | 3300006871 | Bacteria | 4979 |
| 204 | Ga0075434_100131160 | 3300006871 | Unclassified | 2525 |
| 205 | Ga0075434_100230089 | 3300006871 | Bacteria | 1873 |
| 206 | Ga0075429_100057680 | 3300006880 | Bacteria | 3381 |
| 207 | Ga0068865_100015086 | 3300006881 | Bacteria | 4923 |
| 208 | Ga0068865_100016076 | 3300006881 | Unclassified | 4779 |
| 209 | Ga0068865_100029088 | 3300006881 | Bacteria | 3662 |
| 210 | Ga0068865_100077081 | 3300006881 | Bacteria | 2381 |
| 211 | Ga0068865_100113486 | 3300006881 | Bacteria | 2003 |
| 212 | Ga0075436_100001203 | 3300006914 | Bacteria | 17612 |
| 213 | Ga0075436_100006202 | 3300006914 | Bacteria | 8198 |
| 214 | Ga0075436_100010366 | 3300006914 | Bacteria | 6385 |
| 215 | Ga0075436_100015949 | 3300006914 | Bacteria | 5142 |
| 216 | Ga0075436_100031768 | 3300006914 | Bacteria | 3637 |
| 217 | Ga0075436_100063164 | 3300006914 | Bacteria | 2560 |
| 218 | Ga0097620_100000959 | 3300006931 | Bacteria | 29530 |
| 219 | Ga0097620_100005424 | 3300006931 | Bacteria | 12967 |
| 220 | Ga0097620_100015114 | 3300006931 | Bacteria | 7747 |
| 221 | Ga0097620_100027605 | 3300006931 | Bacteria | 5693 |
| 222 | Ga0097620_100029316 | 3300006931 | Bacteria | 5522 |
| 223 | Ga0097620_100033120 | 3300006931 | Bacteria | 5190 |
| 224 | Ga0097620_100079723 | 3300006931 | Bacteria | 3315 |
| 225 | Ga0097620_100192531 | 3300006931 | Bacteria | 2124 |
| 226 | Ga0075435_100000616 | 3300007076 | Bacteria | 21880 |
| 227 | Ga0075435_100005304 | 3300007076 | Bacteria | 8979 |
| 228 | Ga0075435_100007747 | 3300007076 | Bacteria | 7675 |
| 229 | Ga0075435_100018223 | 3300007076 | Bacteria | 5332 |
| 230 | Ga0075435_100027121 | 3300007076 | Bacteria | 4477 |
| 231 | Ga0099794_10000677 | 3300007265 | Bacteria | 11399 |
| 232 | Ga0099794_10005123 | 3300007265 | Bacteria | 5227 |
| 233 | Ga0105240_10000178 | 3300009093 | Bacteria | 129018 |
| 234 | Ga0105240_10034349 | 3300009093 | Bacteria | 6541 |
| 235 | Ga0105240_10043737 | 3300009093 | Bacteria | 5695 |
| 236 | Ga0105240_10057800 | 3300009093 | Bacteria | 4844 |
| 237 | Ga0105240_10097442 | 3300009093 | Bacteria | 3583 |
| 238 | Ga0105240_10099641 | 3300009093 | Bacteria | 3537 |
| 239 | Ga0105240_10181339 | 3300009093 | Bacteria | 2485 |
| 240 | Ga0111539_10001532 | 3300009094 | Bacteria | 30761 |
| 241 | Ga0111539_10005248 | 3300009094 | Bacteria | 16787 |
| 242 | Ga0111539_10014193 | 3300009094 | Bacteria | 9949 |
| 243 | Ga0111539_10014823 | 3300009094 | Bacteria | 9723 |
| 244 | Ga0111539_10017378 | 3300009094 | Bacteria | 8903 |
| 245 | Ga0111539_10122332 | 3300009094 | Unclassified | 3050 |
| 246 | Ga0105245_10001723 | 3300009098 | Bacteria | 19950 |
| 247 | Ga0105245_10004878 | 3300009098 | Bacteria | 11802 |
| 248 | Ga0105245_10042333 | 3300009098 | Bacteria | 4063 |
| 249 | Ga0105245_10055647 | 3300009098 | Bacteria | 3554 |
| 250 | Ga0105247_10043136 | 3300009101 | Bacteria | 2763 |
| 251 | Ga0114129_10008657 | 3300009147 | Bacteria | 14506 |
| 252 | Ga0114129_10011241 | 3300009147 | Bacteria | 12763 |
| 253 | Ga0114129_10022378 | 3300009147 | Bacteria | 8974 |
| 254 | Ga0114129_10033594 | 3300009147 | Bacteria | 7248 |
| 255 | Ga0114129_10084691 | 3300009147 | Bacteria | 4401 |
| 256 | Ga0114129_10119081 | 3300009147 | Bacteria | 3637 |
| 257 | Ga0114129_10124090 | 3300009147 | Bacteria | 3552 |
| 258 | Ga0105241_10011619 | 3300009174 | Bacteria | 6457 |
| 259 | Ga0105241_10020850 | 3300009174 | Bacteria | 4844 |
| 260 | Ga0105241_10026728 | 3300009174 | Bacteria | 4295 |
| 261 | Ga0105241_10043050 | 3300009174 | Bacteria | 3419 |
| 262 | Ga0105242_10001107 | 3300009176 | Bacteria | 21243 |
| 263 | Ga0105242_10071676 | 3300009176 | Bacteria | 2876 |
| 264 | Ga0105242_10089304 | 3300009176 | Bacteria | 2590 |
| 265 | Ga0105242_10197872 | 3300009176 | Bacteria | 1783 |
| 266 | Ga0105248_10001527 | 3300009177 | Bacteria | 25763 |
| 267 | Ga0105248_10012017 | 3300009177 | Bacteria | 9548 |
| 268 | Ga0105248_10013857 | 3300009177 | Bacteria | 8870 |
| 269 | Ga0105248_10030942 | 3300009177 | Bacteria | 5979 |
| 270 | Ga0105248_10034229 | 3300009177 | Bacteria | 5680 |
| 271 | Ga0105248_10075736 | 3300009177 | Bacteria | 3782 |
| 272 | Ga0105248_10151317 | 3300009177 | Bacteria | 2618 |
| 273 | Ga0105237_10011654 | 3300009545 | Bacteria | 9302 |
| 274 | Ga0105237_10015644 | 3300009545 | Bacteria | 7886 |
| 275 | Ga0105237_10194924 | 3300009545 | Bacteria | 2025 |
| 276 | Ga0105238_10000533 | 3300009551 | Bacteria | 39822 |
| 277 | Ga0105238_10006729 | 3300009551 | Bacteria | 11474 |
| 278 | Ga0105249_10006220 | 3300009553 | Bacteria | 10365 |
| 279 | Ga0105239_10025091 | 3300010375 | Bacteria | 6567 |
| 280 | Ga0105239_10031318 | 3300010375 | Bacteria | 5850 |
| 281 | Ga0105239_10270093 | 3300010375 | Bacteria | 1913 |
| 282 | Ga0105246_10050293 | 3300011119 | Bacteria | 2858 |
| 283 | Ga0105246_10100141 | 3300011119 | Unclassified | 2108 |
| 284 | Ga0157373_10001055 | 3300013100 | Bacteria | 21221 |
| 285 | Ga0157373_10069536 | 3300013100 | Bacteria | 2489 |
| 286 | Ga0157371_10021289 | 3300013102 | Bacteria | 4762 |
| 287 | Ga0157370_10017861 | 3300013104 | Bacteria | 7148 |
| 288 | Ga0157369_10000170 | 3300013105 | Bacteria | 91583 |
| 289 | Ga0157369_10009253 | 3300013105 | Bacteria | 11271 |
| 290 | Ga0157369_10021941 | 3300013105 | Bacteria | 7138 |
| 291 | Ga0157369_10034498 | 3300013105 | Bacteria | 5553 |
| 292 | Ga0157369_10048297 | 3300013105 | Bacteria | 4618 |
| 293 | Ga0157369_10050261 | 3300013105 | Bacteria | 4516 |
| 294 | Ga0157369_10071926 | 3300013105 | Unclassified | 3712 |
| 295 | Ga0157369_10112657 | 3300013105 | Bacteria | 2890 |
| 296 | Ga0157374_10000316 | 3300013296 | Bacteria | 44946 |
| 297 | Ga0157374_10000330 | 3300013296 | Bacteria | 43615 |
| 298 | Ga0157374_10000533 | 3300013296 | Bacteria | 34093 |
| 299 | Ga0157374_10004887 | 3300013296 | Bacteria | 11247 |
| 300 | Ga0157374_10007459 | 3300013296 | Bacteria | 9327 |
| 301 | Ga0157374_10022691 | 3300013296 | Bacteria | 5602 |
| 302 | Ga0157374_10138388 | 3300013296 | Bacteria | 2362 |
| 303 | Ga0157374_10233318 | 3300013296 | Bacteria | 1808 |
| 304 | Ga0157378_10000071 | 3300013297 | Bacteria | 91313 |
| 305 | Ga0157378_10000085 | 3300013297 | Bacteria | 87651 |
| 306 | Ga0157378_10000182 | 3300013297 | Bacteria | 60024 |
| 307 | Ga0157378_10013955 | 3300013297 | Bacteria | 7028 |
| 308 | Ga0157378_10079407 | 3300013297 | Bacteria | 2963 |
| 309 | Ga0163162_10000147 | 3300013306 | Bacteria | 64948 |
| 310 | Ga0163162_10002317 | 3300013306 | Bacteria | 17858 |
| 311 | Ga0163162_10010881 | 3300013306 | Bacteria | 8856 |
| 312 | Ga0163162_10013390 | 3300013306 | Bacteria | 8009 |
| 313 | Ga0157372_10000620 | 3300013307 | Bacteria | 38778 |
| 314 | Ga0157372_10001563 | 3300013307 | Bacteria | 24933 |
| 315 | Ga0157372_10001829 | 3300013307 | Bacteria | 23049 |
| 316 | Ga0157372_10002374 | 3300013307 | Bacteria | 20377 |
| 317 | Ga0157372_10020625 | 3300013307 | Bacteria | 7112 |
| 318 | Ga0157372_10023041 | 3300013307 | Bacteria | 6748 |
| 319 | Ga0157372_10026600 | 3300013307 | Bacteria | 6296 |
| 320 | Ga0157372_10028884 | 3300013307 | Bacteria | 6052 |
| 321 | Ga0157372_10035796 | 3300013307 | Bacteria | 5467 |
| 322 | Ga0157372_10184378 | 3300013307 | Bacteria | 2417 |
| 323 | Ga0157372_10236277 | 3300013307 | Bacteria | 2120 |
| 324 | Ga0157372_10322166 | 3300013307 | Bacteria | 1799 |
| 325 | Ga0157375_10023986 | 3300013308 | Bacteria | 5638 |
| 326 | Ga0157375_10128081 | 3300013308 | Bacteria | 2656 |
| 327 | Ga0157375_10180581 | 3300013308 | Bacteria | 2261 |
| 328 | Ga0163163_10002642 | 3300014325 | Bacteria | 15164 |
| 329 | Ga0163163_10058820 | 3300014325 | Bacteria | 3800 |
| 330 | Ga0163163_10073522 | 3300014325 | Bacteria | 3410 |
| 331 | Ga0163163_10076691 | 3300014325 | Unclassified | 3338 |
| 332 | Ga0163163_10201541 | 3300014325 | Bacteria | 2038 |
| 333 | Ga0157380_10000849 | 3300014326 | Bacteria | 19156 |
| 334 | Ga0157380_10012184 | 3300014326 | Bacteria | 6229 |
| 335 | Ga0157380_10058476 | 3300014326 | Bacteria | 3073 |
| 336 | Ga0157380_10184968 | 3300014326 | Bacteria | 1834 |
| 337 | Ga0157377_10028727 | 3300014745 | Bacteria | 2996 |
| 338 | Ga0157379_10004057 | 3300014968 | Bacteria | 12492 |
| 339 | Ga0157379_10023546 | 3300014968 | Bacteria | 5465 |
| 340 | Ga0157376_10000005 | 3300014969 | Bacteria | 443695 |
| 341 | Ga0157376_10000991 | 3300014969 | Bacteria | 18517 |
| 342 | Ga0157376_10059100 | 3300014969 | Bacteria | 3214 |
| 343 | Ga0157376_10060623 | 3300014969 | Unclassified | 3178 |
| 344 | Ga0157376_10069227 | 3300014969 | Bacteria | 2991 |
| 345 | Ga0157376_10127200 | 3300014969 | Unclassified | 2268 |
| 346 | Ga0163161_10018819 | 3300017792 | Bacteria | 4840 |
| 347 | Ga0228598_1000070 | 3300024227 | Bacteria | 15225 |
| 348 | Ga0228598_1000423 | 3300024227 | Bacteria | 8603 |
| 349 | Ga0207653_10004400 | 3300025885 | Bacteria | 4417 |
| 350 | Ga0207692_10046550 | 3300025898 | Unclassified | 2175 |
| 351 | Ga0207642_10050730 | 3300025899 | Bacteria | 1873 |
| 352 | Ga0207688_10060600 | 3300025901 | Bacteria | 2132 |
| 353 | Ga0207680_10002337 | 3300025903 | Bacteria | 8821 |
| 354 | Ga0207647_10003151 | 3300025904 | Bacteria | 12371 |
| 355 | Ga0207647_10022443 | 3300025904 | Bacteria | 4192 |
| 356 | Ga0207685_10000016 | 3300025905 | Bacteria | 151990 |
| 357 | Ga0207699_10004889 | 3300025906 | Bacteria | 6414 |
| 358 | Ga0207699_10030224 | 3300025906 | Bacteria | 3030 |
| 359 | Ga0207699_10031428 | 3300025906 | Bacteria | 2981 |
| 360 | Ga0207705_10022321 | 3300025909 | Bacteria | 4513 |
| 361 | Ga0207684_10000260 | 3300025910 | Bacteria | 78456 |
| 362 | Ga0207684_10004777 | 3300025910 | Bacteria | 12691 |
| 363 | Ga0207684_10038756 | 3300025910 | Bacteria | 4044 |
| 364 | Ga0207684_10078233 | 3300025910 | Bacteria | 2813 |
| 365 | Ga0207684_10127292 | 3300025910 | Bacteria | 2186 |
| 366 | Ga0207684_10163002 | 3300025910 | Bacteria | 1920 |
| 367 | Ga0207707_10000739 | 3300025912 | Bacteria | 32307 |
| 368 | Ga0207707_10005345 | 3300025912 | Bacteria | 11220 |
| 369 | Ga0207707_10086333 | 3300025912 | Bacteria | 2742 |
| 370 | Ga0207707_10095021 | 3300025912 | Bacteria | 2605 |
| 371 | Ga0207695_10000249 | 3300025913 | Bacteria | 140258 |
| 372 | Ga0207695_10047422 | 3300025913 | Bacteria | 4547 |
| 373 | Ga0207695_10050832 | 3300025913 | Bacteria | 4358 |
| 374 | Ga0207695_10073020 | 3300025913 | Bacteria | 3497 |
| 375 | Ga0207695_10076754 | 3300025913 | Unclassified | 3395 |
| 376 | Ga0207695_10118499 | 3300025913 | Bacteria | 2618 |
| 377 | Ga0207671_10030492 | 3300025914 | Bacteria | 4022 |
| 378 | Ga0207671_10162796 | 3300025914 | Bacteria | 1728 |
| 379 | Ga0207693_10000777 | 3300025915 | Bacteria | 28620 |
| 380 | Ga0207693_10001973 | 3300025915 | Bacteria | 17983 |
| 381 | Ga0207693_10009884 | 3300025915 | Bacteria | 7758 |
| 382 | Ga0207693_10016287 | 3300025915 | Bacteria | 5944 |
| 383 | Ga0207693_10027726 | 3300025915 | Bacteria | 4477 |
| 384 | Ga0207693_10039903 | 3300025915 | Bacteria | 3697 |
| 385 | Ga0207693_10040788 | 3300025915 | Unclassified | 3656 |
| 386 | Ga0207693_10080755 | 3300025915 | Bacteria | 2545 |
| 387 | Ga0207663_10001682 | 3300025916 | Bacteria | 10396 |
| 388 | Ga0207663_10019745 | 3300025916 | Bacteria | 3804 |
| 389 | Ga0207660_10028269 | 3300025917 | Unclassified | 3834 |
| 390 | Ga0207660_10085859 | 3300025917 | Bacteria | 2322 |
| 391 | Ga0207652_10066349 | 3300025921 | Bacteria | 3127 |
| 392 | Ga0207652_10199399 | 3300025921 | Bacteria | 1801 |
| 393 | Ga0207646_10000261 | 3300025922 | Bacteria | 71826 |
| 394 | Ga0207646_10001014 | 3300025922 | Bacteria | 35904 |
| 395 | Ga0207646_10003367 | 3300025922 | Bacteria | 18111 |
| 396 | Ga0207646_10005136 | 3300025922 | Bacteria | 13879 |
| 397 | Ga0207646_10008426 | 3300025922 | Bacteria | 10340 |
| 398 | Ga0207646_10016437 | 3300025922 | Bacteria | 6943 |
| 399 | Ga0207646_10074042 | 3300025922 | Bacteria | 3042 |
| 400 | Ga0207646_10254108 | 3300025922 | Unclassified | 1588 |
| 401 | Ga0207694_10001172 | 3300025924 | Bacteria | 22716 |
| 402 | Ga0207694_10088549 | 3300025924 | Bacteria | 2440 |
| 403 | Ga0207659_10072645 | 3300025926 | Bacteria | 2516 |
| 404 | Ga0207687_10000622 | 3300025927 | Bacteria | 23930 |
| 405 | Ga0207687_10004348 | 3300025927 | Bacteria | 9454 |
| 406 | Ga0207687_10102430 | 3300025927 | Unclassified | 2109 |
| 407 | Ga0207700_10041011 | 3300025928 | Unclassified | 3383 |
| 408 | Ga0207700_10045123 | 3300025928 | Bacteria | 3250 |
| 409 | Ga0207700_10144480 | 3300025928 | Unclassified | 1959 |
| 410 | Ga0207664_10000532 | 3300025929 | Bacteria | 27088 |
| 411 | Ga0207664_10016554 | 3300025929 | Bacteria | 5382 |
| 412 | Ga0207664_10036249 | 3300025929 | Unclassified | 3811 |
| 413 | Ga0207690_10157266 | 3300025932 | Unclassified | 1691 |
| 414 | Ga0207706_10028239 | 3300025933 | Bacteria | 5011 |
| 415 | Ga0207706_10084543 | 3300025933 | Bacteria | 2790 |
| 416 | Ga0207686_10000141 | 3300025934 | Bacteria | 56428 |
| 417 | Ga0207686_10010141 | 3300025934 | Bacteria | 5122 |
| 418 | Ga0207686_10046554 | 3300025934 | Bacteria | 2676 |
| 419 | Ga0207704_10119060 | 3300025938 | Bacteria | 1802 |
| 420 | Ga0207704_10142126 | 3300025938 | Unclassified | 1681 |
| 421 | Ga0207665_10005264 | 3300025939 | Bacteria | 8642 |
| 422 | Ga0207665_10035687 | 3300025939 | Bacteria | 3302 |
| 423 | Ga0207665_10051697 | 3300025939 | Bacteria | 2766 |
| 424 | Ga0207665_10058385 | 3300025939 | Unclassified | 2609 |
| 425 | Ga0207665_10139273 | 3300025939 | Bacteria | 1728 |
| 426 | Ga0207691_10020128 | 3300025940 | Bacteria | 6312 |
| 427 | Ga0207691_10043105 | 3300025940 | Bacteria | 4159 |
| 428 | Ga0207691_10059852 | 3300025940 | Unclassified | 3462 |
| 429 | Ga0207691_10186561 | 3300025940 | Bacteria | 1810 |
| 430 | Ga0207711_10005197 | 3300025941 | Bacteria | 11022 |
| 431 | Ga0207711_10042283 | 3300025941 | Bacteria | 3883 |
| 432 | Ga0207711_10045713 | 3300025941 | Bacteria | 3742 |
| 433 | Ga0207711_10195444 | 3300025941 | Unclassified | 1845 |
| 434 | Ga0207689_10002264 | 3300025942 | Bacteria | 18044 |
| 435 | Ga0207689_10013848 | 3300025942 | Bacteria | 6872 |
| 436 | Ga0207689_10015206 | 3300025942 | Bacteria | 6517 |
| 437 | Ga0207689_10100188 | 3300025942 | Unclassified | 2380 |
| 438 | Ga0207689_10161124 | 3300025942 | Bacteria | 1848 |
| 439 | Ga0207661_10045539 | 3300025944 | Bacteria | 3473 |
| 440 | Ga0207679_10028975 | 3300025945 | Bacteria | 3850 |
| 441 | Ga0207667_10000785 | 3300025949 | Bacteria | 41249 |
| 442 | Ga0207667_10003707 | 3300025949 | Bacteria | 18846 |
| 443 | Ga0207667_10007973 | 3300025949 | Bacteria | 12629 |
| 444 | Ga0207667_10012221 | 3300025949 | Bacteria | 9917 |
| 445 | Ga0207667_10060404 | 3300025949 | Bacteria | 3968 |
| 446 | Ga0207667_10168824 | 3300025949 | Bacteria | 2249 |
| 447 | Ga0207668_10055321 | 3300025972 | Bacteria | 2758 |
| 448 | Ga0207640_10004787 | 3300025981 | Bacteria | 7350 |
| 449 | Ga0207640_10051211 | 3300025981 | Bacteria | 2683 |
| 450 | Ga0207677_10009392 | 3300026023 | Bacteria | 5504 |
| 451 | Ga0207677_10017039 | 3300026023 | Unclassified | 4320 |
| 452 | Ga0207677_10045304 | 3300026023 | Unclassified | 2937 |
| 453 | Ga0207677_10071183 | 3300026023 | Unclassified | 2453 |
| 454 | Ga0207703_10001398 | 3300026035 | Bacteria | 21976 |
| 455 | Ga0207703_10009935 | 3300026035 | Bacteria | 7466 |
| 456 | Ga0207703_10019982 | 3300026035 | Bacteria | 5233 |
| 457 | Ga0207703_10021476 | 3300026035 | Bacteria | 5054 |
| 458 | Ga0207703_10021921 | 3300026035 | Bacteria | 5003 |
| 459 | Ga0207703_10036937 | 3300026035 | Bacteria | 3891 |
| 460 | Ga0207639_10014034 | 3300026041 | Bacteria | 5623 |
| 461 | Ga0207639_10187084 | 3300026041 | Unclassified | 1766 |
| 462 | Ga0207678_10010352 | 3300026067 | Bacteria | 8186 |
| 463 | Ga0207678_10027757 | 3300026067 | Bacteria | 4942 |
| 464 | Ga0207708_10160211 | 3300026075 | Bacteria | 1777 |
| 465 | Ga0207702_10000089 | 3300026078 | Bacteria | 105440 |
| 466 | Ga0207702_10000759 | 3300026078 | Bacteria | 34304 |
| 467 | Ga0207702_10013451 | 3300026078 | Bacteria | 6802 |
| 468 | Ga0207702_10049880 | 3300026078 | Bacteria | 3533 |
| 469 | Ga0207702_10074260 | 3300026078 | Bacteria | 2935 |
| 470 | Ga0207641_10001723 | 3300026088 | Bacteria | 21130 |
| 471 | Ga0207641_10030588 | 3300026088 | Bacteria | 4461 |
| 472 | Ga0207648_10005354 | 3300026089 | Bacteria | 12938 |
| 473 | Ga0207648_10010915 | 3300026089 | Bacteria | 8584 |
| 474 | Ga0207648_10028057 | 3300026089 | Bacteria | 4993 |
| 475 | Ga0207648_10043163 | 3300026089 | Bacteria | 3959 |
| 476 | Ga0207676_10008246 | 3300026095 | Bacteria | 7411 |
| 477 | Ga0207676_10018710 | 3300026095 | Bacteria | 5041 |
| 478 | Ga0207676_10034969 | 3300026095 | Bacteria | 3808 |
| 479 | Ga0207676_10097316 | 3300026095 | Bacteria | 2431 |
| 480 | Ga0207674_10000309 | 3300026116 | Bacteria | 62067 |
| 481 | Ga0207674_10000469 | 3300026116 | Bacteria | 52895 |
| 482 | Ga0207674_10005897 | 3300026116 | Bacteria | 14522 |
| 483 | Ga0207674_10056840 | 3300026116 | Bacteria | 3970 |
| 484 | Ga0207674_10153683 | 3300026116 | Bacteria | 2257 |
| 485 | Ga0207675_100008562 | 3300026118 | Bacteria | 9623 |
| 486 | Ga0207675_100097627 | 3300026118 | Bacteria | 2767 |
| 487 | Ga0207675_100103457 | 3300026118 | Bacteria | 2683 |
| 488 | Ga0207683_10031671 | 3300026121 | Bacteria | 4590 |
| 489 | Ga0209588_1002048 | 3300027671 | Bacteria | 5439 |
| 490 | Ga0209588_1005352 | 3300027671 | Bacteria | 3674 |
| 491 | Ga0207428_10015554 | 3300027907 | Bacteria | 6577 |
| 492 | Ga0207428_10026180 | 3300027907 | Unclassified | 4871 |
| 493 | Ga0207428_10039352 | 3300027907 | Bacteria | 3840 |
| 494 | Ga0268265_10058794 | 3300028380 | Bacteria | 2938 |
| 495 | Ga0268265_10151173 | 3300028380 | Bacteria | 1958 |
| 496 | Ga0268264_10043592 | 3300028381 | Bacteria | 3718 |
| 497 | Ga0265319_1002942 | 3300028563 | Bacteria | 9067 |
| 498 | Ga0265334_10037472 | 3300028573 | Bacteria | 1911 |
| 499 | Ga0265318_10005219 | 3300028577 | Bacteria | 6123 |
| 500 | Ga0265318_10011748 | 3300028577 | Bacteria | 3752 |
| 501 | Ga0265338_10003433 | 3300028800 | Bacteria | 22326 |
| 502 | Ga0265338_10004350 | 3300028800 | Bacteria | 19176 |
| 503 | Ga0265338_10005938 | 3300028800 | Bacteria | 15728 |
| 504 | Ga0265338_10015852 | 3300028800 | Bacteria | 8249 |
| 505 | Ga0265762_1001799 | 3300030760 | Bacteria | 3895 |
| 506 | Ga0265330_10000194 | 3300031235 | Bacteria | 47211 |
| 507 | Ga0265330_10000507 | 3300031235 | Bacteria | 26079 |
| 508 | Ga0265330_10047557 | 3300031235 | Bacteria | 1888 |
| 509 | Ga0265332_10002649 | 3300031238 | Bacteria | 8989 |
| 510 | Ga0265328_10000568 | 3300031239 | Bacteria | 17163 |
| 511 | Ga0265320_10000032 | 3300031240 | Bacteria | 141785 |
| 512 | Ga0265320_10006993 | 3300031240 | Bacteria | 7037 |
| 513 | Ga0265325_10000167 | 3300031241 | Bacteria | 46417 |
| 514 | Ga0265325_10000239 | 3300031241 | Bacteria | 39004 |
| 515 | Ga0265325_10006458 | 3300031241 | Bacteria | 7109 |
| 516 | Ga0265325_10006922 | 3300031241 | Bacteria | 6843 |
| 517 | Ga0265329_10005856 | 3300031242 | Bacteria | 4932 |
| 518 | Ga0265340_10001152 | 3300031247 | Bacteria | 15114 |
| 519 | Ga0265340_10004426 | 3300031247 | Bacteria | 7853 |
| 520 | Ga0265340_10026524 | 3300031247 | Bacteria | 2928 |
| 521 | Ga0265339_10001113 | 3300031249 | Bacteria | 20339 |
| 522 | Ga0265339_10003514 | 3300031249 | Bacteria | 10952 |
| 523 | Ga0265339_10024272 | 3300031249 | Bacteria | 3496 |
| 524 | Ga0265339_10037352 | 3300031249 | Bacteria | 2715 |
| 525 | Ga0265339_10041400 | 3300031249 | Bacteria | 2557 |
| 526 | Ga0265331_10000512 | 3300031250 | Bacteria | 36326 |
| 527 | Ga0265331_10012216 | 3300031250 | Bacteria | 4660 |
| 528 | Ga0265316_10001849 | 3300031344 | Bacteria | 22260 |
| 529 | Ga0265316_10004004 | 3300031344 | Bacteria | 14756 |
| 530 | Ga0265316_10004612 | 3300031344 | Bacteria | 13670 |
| 531 | Ga0265316_10061796 | 3300031344 | Bacteria | 2908 |
| 532 | Ga0307513_10003815 | 3300031456 | Bacteria | 20322 |
| 533 | Ga0265313_10000349 | 3300031595 | Bacteria | 50279 |
| 534 | Ga0265313_10000894 | 3300031595 | Bacteria | 29941 |
| 535 | Ga0265313_10001760 | 3300031595 | Bacteria | 19846 |
| 536 | Ga0316579_10042784 | 3300031691 | Bacteria | 2105 |
| 537 | Ga0265314_10000231 | 3300031711 | Bacteria | 83338 |
| 538 | Ga0265314_10000713 | 3300031711 | Bacteria | 40163 |
| 539 | Ga0265314_10012791 | 3300031711 | Bacteria | 6822 |
| 540 | Ga0265342_10000686 | 3300031712 | Bacteria | 35395 |
| 541 | Ga0265342_10000782 | 3300031712 | Bacteria | 32235 |
| 542 | Ga0265342_10079086 | 3300031712 | Bacteria | 1902 |
| 543 | Ga0316578_10086679 | 3300031728 | Bacteria | 1867 |
| 544 | Ga0307416_100013345 | 3300032002 | Bacteria | 5580 |
| 545 | Ga0373926_0002560 | 3300035083 | Bacteria | 5777 |
| 546 | Ga0373934_0007018 | 3300035086 | Bacteria | 4178 |
| 547 | Ga0373923_0026268 | 3300035111 | Bacteria | 2316 |
| 548 | Ga0373936_0003622 | 3300035113 | Bacteria | 5804 |
| 549 | Ga0373936_0013395 | 3300035113 | Bacteria | 3130 |
| 550 | Ga0373954_0002808 | 3300035118 | Bacteria | 7332 |
| 551 | Ga0373954_0019753 | 3300035118 | Bacteria | 3041 |
| 552 | Ga0373956_0008131 | 3300035119 | Bacteria | 4245 |
| 553 | Ga0373957_0003665 | 3300035120 | Bacteria | 4580 |
| 554 | Ga0373957_0007236 | 3300035120 | Bacteria | 3545 |
| 555 | Ga0373946_0005395 | 3300035171 | Bacteria | 4609 |
| 556 | Ga0373946_0015994 | 3300035171 | Bacteria | 2854 |
| 557 | Ga0373955_0006586 | 3300035172 | Bacteria | 5298 |
| 558 | Ga0373955_0008811 | 3300035172 | Bacteria | 4702 |
| 559 | Ga0373955_0017844 | 3300035172 | Bacteria | 3518 |
| 560 | Ga0373955_0091673 | 3300035172 | Unclassified | 1732 |
| 561 | Ga0373931_0029217 | 3300035691 | Unclassified | 2828 |
| 562 | Ga0373931_0085551 | 3300035691 | Unclassified | 1748 |
| 563 | Ga0373935_0013755 | 3300035692 | Bacteria | 4886 |
| 564 | Ga0373935_0115991 | 3300035692 | Bacteria | 1783 |
| 565 | Ga0373927_0005612 | 3300035695 | Bacteria | 8621 |
| 566 | Ga0373927_0047319 | 3300035695 | Bacteria | 2782 |
| 567 | Ga0373927_0178843 | 3300035695 | Bacteria | 1391 |
| 568 | Ga0373933_0011538 | 3300035724 | Bacteria | 4875 |
| 569 | Ga0373933_0075830 | 3300035724 | Bacteria | 2053 |
| 570 | Ga0373947_0006387 | 3300035725 | Bacteria | 6850 |
| 571 | Ga0373947_0054965 | 3300035725 | Unclassified | 2404 |
| 572 | Ga0373947_0061910 | 3300035725 | Bacteria | 2275 |
| 573 | Ga0373937_0015641 | 3300036401 | Bacteria | 6716 |
| 574 | Ga0373937_0188893 | 3300036401 | Bacteria | 1935 |
| 575 | Ga0316582_0000018 | 3300036647 | Bacteria | 39444 |
| 576 | Ga0373925_0005926 | 3300037068 | Bacteria | 9061 |
| 577 | Ga0373925_0024087 | 3300037068 | Bacteria | 4443 |
| 578 | Ga0395900_0288985 | 3300037418 | Unclassified | 1629 |
| 579 | Ga0395905_0206051 | 3300037471 | Unclassified | 1843 |
| 580 | Ga0436365_0126746 | 3300039437 | Bacteria | 2891 |
| 581 | Ga0436360_0434407 | 3300039438 | Bacteria | 2848 |
| 582 | Ga0436363_0052375 | 3300039450 | Bacteria | 3042 |
| 583 | Ga0436362_0461762 | 3300039453 | Bacteria | 5323 |
| 584 | Ga0450908_004534 | 3300042184 | Bacteria | 2675 |
| 585 | Ga0439464_0006622 | 3300042439 | Bacteria | 3023 |
| 586 | Ga0451577_0020122 | 3300042876 | Bacteria | 6128 |
| 587 | Ga0451577_0026254 | 3300042876 | Bacteria | 5276 |
| 588 | Ga0451577_0128704 | 3300042876 | Bacteria | 2270 |
| 589 | Ga0466972_0002988 | 3300044658 | Bacteria | 8374 |
| 590 | Ga0466961_0179717 | 3300044693 | Bacteria | 1314 |
| 591 | Ga0466963_0011667 | 3300044694 | Bacteria | 5354 |
| 592 | Ga0453684_0020898 | 3300044712 | Bacteria | 9823 |
| 593 | Ga0453684_0052207 | 3300044712 | Bacteria | 5349 |
| 594 | Ga0453684_0131019 | 3300044712 | Bacteria | 3008 |
| 595 | Ga0466960_0007624 | 3300044901 | Bacteria | 4405 |
| 596 | Ga0451576_0113632 | 3300045051 | Bacteria | 2819 |
| 597 | Ga0466958_0017067 | 3300045836 | Bacteria | 4191 |
| 598 | Ga0466967_0023138 | 3300045976 | Bacteria | 5088 |
| 599 | Ga0495638_0022118 | 3300046460 | Bacteria | 4176 |
| 600 | Ga0495580_0002375 | 3300046472 | Bacteria | 16435 |
| 601 | Ga0495580_0004333 | 3300046472 | Bacteria | 11913 |
| 602 | Ga0495580_0011661 | 3300046472 | Bacteria | 6795 |
| 603 | Ga0495582_0000143 | 3300046473 | Bacteria | 38449 |
| 604 | Ga0495582_0046150 | 3300046473 | Bacteria | 2400 |
| 605 | Ga0495664_0002704 | 3300046477 | Bacteria | 9539 |
| 606 | Ga0495584_0045530 | 3300046491 | Bacteria | 2213 |
| 607 | Ga0495608_0004886 | 3300046511 | Bacteria | 9592 |
| 608 | Ga0495630_0016477 | 3300046517 | Bacteria | 5402 |
| 609 | Ga0495666_0040319 | 3300046526 | Unclassified | 2265 |
| 610 | Ga0495652_0080183 | 3300046529 | Bacteria | 2697 |
| 611 | Ga0495665_0001194 | 3300046531 | Bacteria | 13831 |
| 612 | Ga0495587_0001500 | 3300046536 | Bacteria | 15512 |
| 613 | Ga0495645_0014894 | 3300046543 | Bacteria | 5525 |
| 614 | Ga0495667_0053150 | 3300046559 | Bacteria | 2668 |
| 615 | Ga0495635_0059297 | 3300046663 | Bacteria | 2632 |
| 616 | Ga0495657_0113848 | 3300046675 | Bacteria | 1710 |
| 617 | Ga0495613_0019741 | 3300046689 | Bacteria | 5023 |
| 618 | Ga0495624_0032867 | 3300046690 | Bacteria | 3362 |
| 619 | Ga0495600_0034985 | 3300046809 | Bacteria | 3262 |
| 620 | Ga0495581_0029740 | 3300047315 | Bacteria | 3166 |
| 621 | Ga0495604_0010694 | 3300047317 | Bacteria | 7283 |
| 622 | Ga0495674_0008394 | 3300047319 | Bacteria | 9844 |
| 623 | Ga0495674_0184483 | 3300047319 | Bacteria | 1736 |
| 624 | Ga0495684_0089050 | 3300047471 | Bacteria | 2339 |
| 625 | Ga0495684_0099311 | 3300047471 | Bacteria | 2201 |
| 626 | Ga0495593_0074061 | 3300047673 | Bacteria | 1766 |
| 627 | Ga0495602_0002361 | 3300048088 | Bacteria | 19105 |
| 628 | Ga0495602_0091332 | 3300048088 | Bacteria | 2526 |
| 629 | Ga0496100_0071778 | 3300048903 | Unclassified | 2313 |
| 630 | Ga0496102_0000641 | 3300048905 | Bacteria | 35434 |
| 631 | Ga0496102_0058742 | 3300048905 | Bacteria | 3515 |
| 632 | Ga0496102_0260574 | 3300048905 | Unclassified | 1635 |
| 633 | Ga0496103_0000987 | 3300048906 | Bacteria | 20071 |
| 634 | Ga0496104_0013455 | 3300048907 | Bacteria | 7372 |
| 635 | Ga0496104_0030486 | 3300048907 | Bacteria | 5012 |
| 636 | Ga0496104_0061528 | 3300048907 | Bacteria | 3560 |
| 637 | Ga0496105_0117664 | 3300048908 | Bacteria | 2192 |
| 638 | Ga0496106_0075998 | 3300048909 | Bacteria | 2574 |
| 639 | Ga0496106_0241090 | 3300048909 | Bacteria | 1445 |
| 640 | Ga0496107_0207178 | 3300048910 | Bacteria | 1458 |
| 641 | Ga0496108_0000009 | 3300048911 | Bacteria | 276390 |
| 642 | Ga0496108_0065744 | 3300048911 | Bacteria | 3057 |
| 643 | Ga0496109_0019210 | 3300048912 | Bacteria | 6020 |
| 644 | Ga0496110_0045619 | 3300048913 | Bacteria | 3832 |
| 645 | Ga0496112_0053191 | 3300048915 | Bacteria | 3976 |
| 646 | Ga0496112_0083501 | 3300048915 | Bacteria | 3159 |
| 647 | Ga0496112_0089484 | 3300048915 | Unclassified | 3047 |
| 648 | Ga0496112_0101967 | 3300048915 | Unclassified | 2840 |
| 649 | Ga0496112_0151877 | 3300048915 | Bacteria | 2283 |
| 650 | Ga0496112_0295136 | 3300048915 | Bacteria | 1567 |
| 651 | Ga0496113_0100874 | 3300048916 | Bacteria | 2237 |
| 652 | Ga0496114_0001138 | 3300048917 | Bacteria | 20094 |
| 653 | Ga0496114_0022395 | 3300048917 | Bacteria | 5149 |
| 654 | Ga0496115_0010873 | 3300048918 | Bacteria | 6813 |
| 655 | Ga0496115_0044671 | 3300048918 | Bacteria | 3536 |
| 656 | Ga0496115_0063353 | 3300048918 | Bacteria | 2983 |
| 657 | Ga0496126_0000074 | 3300048929 | Bacteria | 235643 |
| 658 | Ga0501031_0001966 | 3300049568 | Bacteria | 12970 |
| 659 | Ga0501031_0103351 | 3300049568 | Bacteria | 1859 |
| 660 | Ga0501032_0003101 | 3300049569 | Bacteria | 12813 |
| 661 | Ga0501032_0012270 | 3300049569 | Bacteria | 6131 |
| 662 | Ga0501032_0045989 | 3300049569 | Bacteria | 2950 |
| 663 | Ga0501033_0001096 | 3300049570 | Bacteria | 24540 |
| 664 | Ga0501033_0005773 | 3300049570 | Bacteria | 9743 |
| 665 | Ga0501033_0006344 | 3300049570 | Bacteria | 9268 |
| 666 | Ga0501033_0009768 | 3300049570 | Bacteria | 7370 |
| 667 | Ga0501034_0010575 | 3300049571 | Bacteria | 9602 |
| 668 | Ga0501034_0018789 | 3300049571 | Bacteria | 7083 |
| 669 | Ga0501034_0072741 | 3300049571 | Bacteria | 3446 |
| 670 | Ga0501034_0085258 | 3300049571 | Bacteria | 3160 |
| 671 | Ga0501036_0001195 | 3300049572 | Bacteria | 19790 |
| 672 | Ga0501036_0005799 | 3300049572 | Bacteria | 10008 |
| 673 | Ga0501036_0048793 | 3300049572 | Bacteria | 3584 |
| 674 | Ga0501036_0065766 | 3300049572 | Bacteria | 3068 |
| 675 | Ga0501037_0002133 | 3300049573 | Bacteria | 14321 |
| 676 | Ga0501037_0005157 | 3300049573 | Bacteria | 9505 |
| 677 | Ga0501037_0008661 | 3300049573 | Bacteria | 7460 |
| 678 | Ga0501038_0001977 | 3300049574 | Bacteria | 18932 |
| 679 | Ga0501038_0024503 | 3300049574 | Bacteria | 5382 |
| 680 | Ga0501038_0054283 | 3300049574 | Bacteria | 3446 |
| 681 | Ga0501039_0027515 | 3300049575 | Bacteria | 4372 |
| 682 | Ga0501039_0042516 | 3300049575 | Bacteria | 3510 |
| 683 | Ga0501040_0024283 | 3300049576 | Bacteria | 4067 |
| 684 | Ga0501040_0077806 | 3300049576 | Unclassified | 2295 |
| 685 | Ga0501043_0003562 | 3300049579 | Bacteria | 12779 |
| 686 | Ga0501043_0008126 | 3300049579 | Bacteria | 8280 |
| 687 | Ga0501043_0009092 | 3300049579 | Bacteria | 7814 |
| 688 | Ga0501046_0003257 | 3300049580 | Bacteria | 14902 |
| 689 | Ga0501046_0006694 | 3300049580 | Bacteria | 10175 |
| 690 | Ga0501046_0010405 | 3300049580 | Bacteria | 7992 |
| 691 | Ga0501046_0014221 | 3300049580 | Bacteria | 6720 |
| 692 | Ga0501047_0003666 | 3300049581 | Bacteria | 14477 |
| 693 | Ga0501047_0003728 | 3300049581 | Bacteria | 14349 |
| 694 | Ga0501047_0014526 | 3300049581 | Bacteria | 7489 |
| 695 | Ga0501047_0025582 | 3300049581 | Bacteria | 5674 |
| 696 | Ga0501047_0034946 | 3300049581 | Bacteria | 4853 |
| 697 | Ga0501048_0001404 | 3300049582 | Bacteria | 18280 |
| 698 | Ga0501048_0001416 | 3300049582 | Bacteria | 18138 |
| 699 | Ga0501048_0002224 | 3300049582 | Bacteria | 14778 |
| 700 | Ga0501067_0003313 | 3300049583 | Bacteria | 8859 |
| 701 | Ga0501067_0009909 | 3300049583 | Bacteria | 5277 |
| 702 | Ga0501067_0053166 | 3300049583 | Bacteria | 2244 |
| 703 | Ga0501068_0008669 | 3300049584 | Bacteria | 5669 |
| 704 | Ga0501070_0012750 | 3300049586 | Bacteria | 7085 |
| 705 | Ga0501070_0015454 | 3300049586 | Bacteria | 6422 |
| 706 | Ga0501070_0144853 | 3300049586 | Bacteria | 1961 |
| 707 | Ga0501071_0041281 | 3300049587 | Bacteria | 3304 |
| 708 | Ga0501071_0043532 | 3300049587 | Bacteria | 3219 |
| 709 | Ga0501072_0054835 | 3300049588 | Bacteria | 3142 |
| 710 | Ga0501072_0092327 | 3300049588 | Bacteria | 2404 |
| 711 | Ga0501073_0009670 | 3300049589 | Bacteria | 7108 |
| 712 | Ga0501074_0000241 | 3300049590 | Bacteria | 30651 |
| 713 | Ga0501074_0001199 | 3300049590 | Bacteria | 17037 |
| 714 | Ga0501074_0039329 | 3300049590 | Bacteria | 3426 |
| 715 | Ga0501075_0087112 | 3300049591 | Unclassified | 2367 |
| 716 | Ga0501075_0113100 | 3300049591 | Bacteria | 2064 |
| 717 | Ga0501076_0033736 | 3300049592 | Bacteria | 3997 |
| 718 | Ga0501079_0001813 | 3300049741 | Bacteria | 15266 |
| 719 | Ga0501079_0003433 | 3300049741 | Bacteria | 11635 |
| 720 | Ga0501079_0020680 | 3300049741 | Bacteria | 5031 |
| 721 | Ga0501080_0014267 | 3300049742 | Bacteria | 7317 |
| 722 | Ga0501080_0016012 | 3300049742 | Bacteria | 6919 |
| 723 | Ga0501080_0048020 | 3300049742 | Bacteria | 3974 |
| 724 | Ga0501080_0057345 | 3300049742 | Bacteria | 3626 |
| 725 | Ga0501080_0080690 | 3300049742 | Bacteria | 3023 |
| 726 | Ga0501080_0089718 | 3300049742 | Bacteria | 2856 |
| 727 | Ga0501081_0017759 | 3300049743 | Bacteria | 4715 |
| 728 | Ga0501081_0018651 | 3300049743 | Bacteria | 4611 |
| 729 | Ga0501083_0007965 | 3300049744 | Bacteria | 7502 |
| 730 | Ga0501083_0008460 | 3300049744 | Bacteria | 7270 |
| 731 | Ga0501083_0083237 | 3300049744 | Bacteria | 2119 |
| 732 | Ga0501035_0002125 | 3300049822 | Bacteria | 19716 |
| 733 | Ga0501035_0007030 | 3300049822 | Bacteria | 10516 |
| 734 | Ga0501044_0025473 | 3300049823 | Bacteria | 6269 |
| 735 | Ga0501044_0056260 | 3300049823 | Bacteria | 4038 |
| 736 | Ga0501045_0014147 | 3300049824 | Bacteria | 5651 |
| 737 | Ga0501045_0025895 | 3300049824 | Bacteria | 4217 |
| 738 | Ga0501045_0150248 | 3300049824 | Bacteria | 1733 |
| 739 | nmdc:mga00v17_131664_c1 | 3300050491 | Bacteria | 1599 |
| 740 | nmdc:mga0yw44_96256_c1 | 3300050492 | Bacteria | 1879 |
| 741 | nmdc:mga0k408_10800_c1 | 3300050493 | Bacteria | 4951 |
| 742 | nmdc:mga0k408_3793_c1 | 3300050493 | Bacteria | 8010 |
| 743 | nmdc:mga06z11_37534_c1 | 3300050494 | Bacteria | 2400 |
| 744 | nmdc:mga07m45_37453_c1 | 3300050496 | Bacteria | 2705 |
| 745 | nmdc:mga05p37_115958_c1 | 3300050507 | Bacteria | 3292 |
| 746 | nmdc:mga05p37_16678_c1 | 3300050507 | Bacteria | 5080 |
| 747 | nmdc:mga05p37_35213_c1 | 3300050507 | Bacteria | 6137 |
| 748 | nmdc:mga05p37_3603_c1 | 3300050507 | Bacteria | 18091 |
| 749 | nmdc:mga05p37_7639_c1 | 3300050507 | Bacteria | 12758 |
| 750 | nmdc:mga09592_8755_c1 | 3300050508 | Bacteria | 8234 |
| 751 | nmdc:mga06r32_8085_c1 | 3300050510 | Bacteria | 9462 |
| 752 | nmdc:mga08y16_12239_c1 | 3300050511 | Bacteria | 9016 |
| 753 | nmdc:mga08y16_34764_c1 | 3300050511 | Bacteria | 5295 |
| 754 | nmdc:mga08y16_36774_c1 | 3300050511 | Bacteria | 5141 |
| 755 | nmdc:mga08y16_70051_c1 | 3300050511 | Bacteria | 3656 |
| 756 | nmdc:mga0n895_112789_c1 | 3300050512 | Unclassified | 2736 |
| 757 | nmdc:mga0n895_21342_c1 | 3300050512 | Bacteria | 6053 |
| 758 | nmdc:mga0n895_28812_c1 | 3300050512 | Bacteria | 5287 |
| 759 | nmdc:mga0n895_34219_c1 | 3300050512 | Bacteria | 4889 |
| 760 | nmdc:mga0n895_62898_c1 | 3300050512 | Bacteria | 3669 |
| 761 | nmdc:mga0rr50_108201_c1 | 3300050513 | Unclassified | 2196 |
| 762 | nmdc:mga0rr50_1304_c1 | 3300050513 | Bacteria | 13612 |
| 763 | nmdc:mga0rr50_15163_c1 | 3300050513 | Bacteria | 5080 |
| 764 | nmdc:mga0rr50_3575_c1 | 3300050513 | Bacteria | 8979 |
| 765 | nmdc:mga0rr50_5571_c1 | 3300050513 | Bacteria | 7531 |
| 766 | nmdc:mga08x19_10097_c1 | 3300050514 | Bacteria | 5663 |
| 767 | nmdc:mga08x19_3993_c1 | 3300050514 | Bacteria | 8778 |
| 768 | nmdc:mga08x19_5216_c1 | 3300050514 | Bacteria | 7687 |
| 769 | nmdc:mga08x19_82009_c1 | 3300050514 | Bacteria | 2119 |
| 770 | nmdc:mga08x19_9583_c2 | 3300050514 | Bacteria | 4833 |
| 771 | nmdc:mga0a205_115835_c1 | 3300050515 | Bacteria | 2578 |
| 772 | nmdc:mga0a205_3661_c1 | 3300050515 | Bacteria | 13766 |
| 773 | nmdc:mga0a205_58221_c1 | 3300050515 | Bacteria | 3732 |
| 774 | nmdc:mga0a205_5839_c1 | 3300050515 | Bacteria | 11089 |
| 775 | nmdc:mga0a205_649_c2 | 3300050515 | Bacteria | 19623 |
| 776 | Ga0495601_0062613 | 3300053077 | Bacteria | 2363 |
| 777 | Ga0495612_0015322 | 3300053078 | Bacteria | 3074 |
| 778 | Ga0495619_0008599 | 3300053085 | Bacteria | 6459 |
| 779 | Ga0500568_0010180 | 3300053139 | Bacteria | 4419 |
| 780 | Ga0501084_0002244 | 3300054114 | Bacteria | 15503 |
| 781 | Ga0501084_0014669 | 3300054114 | Bacteria | 6498 |
| 782 | Ga0501084_0203873 | 3300054114 | Bacteria | 1669 |
| 783 | Ga0501084_0228900 | 3300054114 | Bacteria | 1569 |
| 784 | Ga0501082_0001883 | 3300060353 | Bacteria | 18464 |
| 785 | Ga0501082_0004549 | 3300060353 | Bacteria | 12105 |
| 786 | Ga0501082_0027217 | 3300060353 | Bacteria | 4924 |
| 787 | Ga0501082_0038130 | 3300060353 | Bacteria | 4145 |
| 788 | Ga0501082_0074498 | 3300060353 | Bacteria | 2924 |
| 789 | Ga0501082_0078520 | 3300060353 | Bacteria | 2847 |
| 790 | Ga0530510_0089031 | 3300061734 | Unclassified | 2251 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0054965 | Ga0373947_0054965_34_1299 | 386 |
| 2 | 3300050513 | nmdc:mga0rr50_108201_c1 | nmdc:mga0rr50_108201_c1_17_1279 | 387 |
| 3 | 3300027671 | Ga0209588_1002048 | Ga0209588_10020485 | 388 |
| 4 | 3300035083 | Ga0373926_0002560 | Ga0373926_0002560_1263_2516 | 394 |
| 5 | 3300035113 | Ga0373936_0003622 | Ga0373936_0003622_2194_3447 | 394 |
| 6 | 3300035171 | Ga0373946_0015994 | Ga0373946_0015994_1453_2706 | 394 |
| 7 | 3300035692 | Ga0373935_0115991 | Ga0373935_0115991_262_1515 | 394 |
| 8 | 3300035695 | Ga0373927_0047319 | Ga0373927_0047319_442_1695 | 394 |
| 9 | 3300035695 | Ga0373927_0178843 | Ga0373927_0178843_29_1282 | 394 |
| 10 | 3300035725 | Ga0373947_0006387 | Ga0373947_0006387_265_1518 | 394 |
| 11 | 3300037068 | Ga0373925_0024087 | Ga0373925_0024087_41_1294 | 394 |
| 12 | 3300046472 | Ga0495580_0002375 | Ga0495580_0002375_3265_4518 | 394 |
| 13 | 3300046473 | Ga0495582_0000143 | Ga0495582_0000143_20491_21744 | 394 |
| 14 | 3300046526 | Ga0495666_0040319 | Ga0495666_0040319_641_1894 | 394 |
| 15 | 3300046531 | Ga0495665_0001194 | Ga0495665_0001194_1473_2726 | 394 |
| 16 | 3300047315 | Ga0495581_0029740 | Ga0495581_0029740_1626_2879 | 394 |
| 17 | 3300047319 | Ga0495674_0184483 | Ga0495674_0184483_114_1367 | 394 |
| 18 | 3300047673 | Ga0495593_0074061 | Ga0495593_0074061_187_1440 | 394 |
| 19 | 3300048915 | Ga0496112_0295136 | Ga0496112_0295136_265_1518 | 394 |
| 20 | 3300050513 | nmdc:mga0rr50_1304_c1 | nmdc:mga0rr50_1304_c1_2894_4147 | 394 |
| 21 | 3300050514 | nmdc:mga08x19_5216_c1 | nmdc:mga08x19_5216_c1_3055_4308 | 394 |
| 22 | 3300050507 | nmdc:mga05p37_16678_c1 | nmdc:mga05p37_16678_c1_55_1326 | 395 |
| 23 | 3300048915 | Ga0496112_0053191 | Ga0496112_0053191_235_1482 | 398 |
| 24 | 3300044693 | Ga0466961_0179717 | Ga0466961_0179717_48_1295 | 403 |
| 25 | 3300048910 | Ga0496107_0207178 | Ga0496107_0207178_193_1440 | 408 |
| 26 | 3300045051 | Ga0451576_0113632 | Ga0451576_0113632_1424_2677 | 410 |
| 27 | 3300005439 | Ga0070711_100012830 | Ga0070711_1000128304 | 411 |
| 28 | 3300006175 | Ga0070712_100005692 | Ga0070712_1000056926 | 411 |
| 29 | 3300025915 | Ga0207693_10009884 | Ga0207693_100098842 | 411 |
| 30 | 3300005617 | Ga0068859_100005424 | Ga0068859_1000054247 | 412 |
| 31 | 3300006931 | Ga0097620_100005424 | Ga0097620_1000054247 | 412 |
| 32 | 3300025927 | Ga0207687_10004348 | Ga0207687_100043483 | 412 |
| 33 | 3300025941 | Ga0207711_10005197 | Ga0207711_100051975 | 412 |
| 34 | 3300005547 | Ga0070693_100039810 | Ga0070693_1000398102 | 413 |
| 35 | 3300007265 | Ga0099794_10005123 | Ga0099794_100051232 | 413 |
| 36 | 3300048909 | Ga0496106_0241090 | Ga0496106_0241090_153_1406 | 413 |
| 37 | 3300048915 | Ga0496112_0089484 | Ga0496112_0089484_55_1308 | 413 |
| 38 | 3300050492 | nmdc:mga0yw44_96256_c1 | nmdc:mga0yw44_96256_c1_24_1319 | 415 |
| 39 | 3300005340 | Ga0070689_100016063 | Ga0070689_1000160632 | 421 |
| 40 | 3300025901 | Ga0207688_10060600 | Ga0207688_100606002 | 430 |
| 41 | 3300026118 | Ga0207675_100103457 | Ga0207675_1001034571 | 430 |
| 42 | 3300037471 | Ga0395905_0206051 | Ga0395905_0206051_130_1452 | 433 |
| 43 | 3300037418 | Ga0395900_0288985 | Ga0395900_0288985_257_1588 | 436 |
| 44 | 3300046491 | Ga0495584_0045530 | Ga0495584_0045530_257_1633 | 441 |
| 45 | 3300028800 | Ga0265338_10015852 | Ga0265338_100158527 | 443 |
| 46 | 3300031711 | Ga0265314_10000231 | Ga0265314_1000023151 | 443 |
| 47 | 3300031712 | Ga0265342_10079086 | Ga0265342_100790861 | 445 |
| 48 | 3300028577 | Ga0265318_10011748 | Ga0265318_100117482 | 447 |
| 49 | 3300028800 | Ga0265338_10003433 | Ga0265338_1000343317 | 447 |
| 50 | 3300031235 | Ga0265330_10000194 | Ga0265330_1000019412 | 447 |
| 51 | 3300031238 | Ga0265332_10002649 | Ga0265332_100026493 | 447 |
| 52 | 3300031239 | Ga0265328_10000568 | Ga0265328_100005683 | 447 |
| 53 | 3300031240 | Ga0265320_10006993 | Ga0265320_100069935 | 447 |
| 54 | 3300031241 | Ga0265325_10006458 | Ga0265325_100064585 | 447 |
| 55 | 3300031242 | Ga0265329_10005856 | Ga0265329_100058562 | 447 |
| 56 | 3300031247 | Ga0265340_10001152 | Ga0265340_1000115211 | 447 |
| 57 | 3300031249 | Ga0265339_10001113 | Ga0265339_1000111314 | 447 |
| 58 | 3300031344 | Ga0265316_10004612 | Ga0265316_100046129 | 447 |
| 59 | 3300031595 | Ga0265313_10001760 | Ga0265313_1000176013 | 447 |
| 60 | 3300031712 | Ga0265342_10000782 | Ga0265342_1000078212 | 447 |
| 61 | 3300006358 | Ga0068871_100004354 | Ga0068871_1000043545 | 448 |
| 62 | 3300014968 | Ga0157379_10023546 | Ga0157379_100235465 | 448 |
| 63 | 3300014969 | Ga0157376_10000005 | Ga0157376_10000005128 | 448 |
| 64 | 3300035725 | Ga0373947_0061910 | Ga0373947_0061910_509_2038 | 448 |
| 65 | 3300048917 | Ga0496114_0001138 | Ga0496114_0001138_15482_16930 | 448 |
| 66 | 3300048918 | Ga0496115_0010873 | Ga0496115_0010873_2654_4102 | 448 |
| 67 | 3300006175 | Ga0070712_100039273 | Ga0070712_1000392733 | 449 |
| 68 | 3300006871 | Ga0075434_100034773 | Ga0075434_1000347734 | 449 |
| 69 | 3300006871 | Ga0075434_100230089 | Ga0075434_1002300891 | 449 |
| 70 | 3300006880 | Ga0075429_100057680 | Ga0075429_1000576802 | 449 |
| 71 | 3300007076 | Ga0075435_100027121 | Ga0075435_1000271212 | 449 |
| 72 | 3300025915 | Ga0207693_10039903 | Ga0207693_100399032 | 449 |
| 73 | 3300025922 | Ga0207646_10003367 | Ga0207646_1000336713 | 449 |
| 74 | 3300025939 | Ga0207665_10035687 | Ga0207665_100356873 | 449 |
| 75 | 3300050512 | nmdc:mga0n895_28812_c1 | nmdc:mga0n895_28812_c1_71_1522 | 449 |
| 76 | 3300025927 | Ga0207687_10000622 | Ga0207687_100006227 | 450 |
| 77 | 3300046675 | Ga0495657_0113848 | Ga0495657_0113848_257_1636 | 451 |
| 78 | 3300006028 | Ga0070717_10000558 | Ga0070717_100005588 | 452 |
| 79 | 3300014326 | Ga0157380_10184968 | Ga0157380_101849682 | 452 |
| 80 | 3300026035 | Ga0207703_10009935 | Ga0207703_100099354 | 452 |
| 81 | 3300048911 | Ga0496108_0000009 | Ga0496108_0000009_54151_55671 | 452 |
| 82 | 3300005617 | Ga0068859_100015114 | Ga0068859_1000151142 | 453 |
| 83 | 3300006931 | Ga0097620_100015114 | Ga0097620_1000151142 | 453 |
| 84 | 3300053078 | Ga0495612_0015322 | Ga0495612_0015322_1503_3008 | 453 |
| 85 | 3300005354 | Ga0070675_100082844 | Ga0070675_1000828442 | 456 |
| 86 | 3300006852 | Ga0075433_10000957 | Ga0075433_1000095717 | 456 |
| 87 | 3300006871 | Ga0075434_100000557 | Ga0075434_1000005573 | 456 |
| 88 | 3300006914 | Ga0075436_100015949 | Ga0075436_1000159494 | 456 |
| 89 | 3300007076 | Ga0075435_100000616 | Ga0075435_1000006164 | 456 |
| 90 | 3300025926 | Ga0207659_10072645 | Ga0207659_100726452 | 456 |
| 91 | 3300050512 | nmdc:mga0n895_112789_c1 | nmdc:mga0n895_112789_c1_1156_2661 | 456 |
| 92 | 3300050514 | nmdc:mga08x19_10097_c1 | nmdc:mga08x19_10097_c1_1404_2909 | 456 |
| 93 | 3300050515 | nmdc:mga0a205_649_c2 | nmdc:mga0a205_649_c2_17666_19171 | 456 |
| 94 | 3300014326 | Ga0157380_10000849 | Ga0157380_100008499 | 458 |
| 95 | 3300050512 | nmdc:mga0n895_62898_c1 | nmdc:mga0n895_62898_c1_1937_3433 | 458 |
| 96 | 3300039438 | Ga0436360_0434407 | Ga0436360_0434407_309_1766 | 459 |
| 97 | 3300005545 | Ga0070695_100003121 | Ga0070695_1000031213 | 460 |
| 98 | 3300006914 | Ga0075436_100006202 | Ga0075436_1000062027 | 460 |
| 99 | 3300013307 | Ga0157372_10020625 | Ga0157372_100206258 | 460 |
| 100 | 3300050514 | nmdc:mga08x19_3993_c1 | nmdc:mga08x19_3993_c1_2071_3597 | 460 |
| 101 | 3300005545 | Ga0070695_100073059 | Ga0070695_1000730592 | 461 |
| 102 | 3300009094 | Ga0111539_10122332 | Ga0111539_101223321 | 461 |
| 103 | 3300048912 | Ga0496109_0019210 | Ga0496109_0019210_159_1724 | 461 |
| 104 | 3300005327 | Ga0070658_10002614 | Ga0070658_100026149 | 462 |
| 105 | 3300013105 | Ga0157369_10034498 | Ga0157369_100344984 | 462 |
| 106 | 3300013307 | Ga0157372_10184378 | Ga0157372_101843781 | 462 |
| 107 | 3300025909 | Ga0207705_10022321 | Ga0207705_100223213 | 462 |
| 108 | 3300031456 | Ga0307513_10003815 | Ga0307513_100038153 | 462 |
| 109 | 3300005614 | Ga0068856_100193573 | Ga0068856_1001935732 | 463 |
| 110 | 3300009147 | Ga0114129_10124090 | Ga0114129_101240902 | 463 |
| 111 | 3300048907 | Ga0496104_0061528 | Ga0496104_0061528_185_1681 | 463 |
| 112 | 3300006163 | Ga0070715_10000032 | Ga0070715_1000003216 | 464 |
| 113 | 3300006871 | Ga0075434_100131160 | Ga0075434_1001311602 | 464 |
| 114 | 3300025905 | Ga0207685_10000016 | Ga0207685_1000001646 | 464 |
| 115 | 3300025942 | Ga0207689_10100188 | Ga0207689_101001882 | 464 |
| 116 | 3300005329 | Ga0070683_100006910 | Ga0070683_1000069105 | 465 |
| 117 | 3300005353 | Ga0070669_100042973 | Ga0070669_1000429731 | 465 |
| 118 | 3300005439 | Ga0070711_100011410 | Ga0070711_1000114101 | 465 |
| 119 | 3300005459 | Ga0068867_100019588 | Ga0068867_1000195881 | 465 |
| 120 | 3300005518 | Ga0070699_100024708 | Ga0070699_1000247083 | 465 |
| 121 | 3300005546 | Ga0070696_100017071 | Ga0070696_1000170715 | 465 |
| 122 | 3300005844 | Ga0068862_100016749 | Ga0068862_1000167492 | 465 |
| 123 | 3300006175 | Ga0070712_100049404 | Ga0070712_1000494042 | 465 |
| 124 | 3300006358 | Ga0068871_100058610 | Ga0068871_1000586102 | 465 |
| 125 | 3300006881 | Ga0068865_100015086 | Ga0068865_1000150862 | 465 |
| 126 | 3300006881 | Ga0068865_100077081 | Ga0068865_1000770812 | 465 |
| 127 | 3300009094 | Ga0111539_10014193 | Ga0111539_100141935 | 465 |
| 128 | 3300009098 | Ga0105245_10001723 | Ga0105245_100017237 | 465 |
| 129 | 3300009098 | Ga0105245_10042333 | Ga0105245_100423332 | 465 |
| 130 | 3300009545 | Ga0105237_10011654 | Ga0105237_100116543 | 465 |
| 131 | 3300009553 | Ga0105249_10006220 | Ga0105249_100062205 | 465 |
| 132 | 3300010375 | Ga0105239_10031318 | Ga0105239_100313183 | 465 |
| 133 | 3300013105 | Ga0157369_10071926 | Ga0157369_100719263 | 465 |
| 134 | 3300013296 | Ga0157374_10138388 | Ga0157374_101383881 | 465 |
| 135 | 3300013307 | Ga0157372_10035796 | Ga0157372_100357964 | 465 |
| 136 | 3300025915 | Ga0207693_10016287 | Ga0207693_100162874 | 465 |
| 137 | 3300025915 | Ga0207693_10080755 | Ga0207693_100807552 | 465 |
| 138 | 3300025933 | Ga0207706_10084543 | Ga0207706_100845432 | 465 |
| 139 | 3300025934 | Ga0207686_10010141 | Ga0207686_100101413 | 465 |
| 140 | 3300026089 | Ga0207648_10028057 | Ga0207648_100280572 | 465 |
| 141 | 3300026089 | Ga0207648_10043163 | Ga0207648_100431632 | 465 |
| 142 | 3300035086 | Ga0373934_0007018 | Ga0373934_0007018_2119_3624 | 465 |
| 143 | 3300035111 | Ga0373923_0026268 | Ga0373923_0026268_166_1671 | 465 |
| 144 | 3300035118 | Ga0373954_0002808 | Ga0373954_0002808_3527_5032 | 465 |
| 145 | 3300035118 | Ga0373954_0019753 | Ga0373954_0019753_504_2009 | 465 |
| 146 | 3300035120 | Ga0373957_0003665 | Ga0373957_0003665_2792_4297 | 465 |
| 147 | 3300035172 | Ga0373955_0006586 | Ga0373955_0006586_1925_3430 | 465 |
| 148 | 3300035172 | Ga0373955_0008811 | Ga0373955_0008811_155_1660 | 465 |
| 149 | 3300035724 | Ga0373933_0011538 | Ga0373933_0011538_909_2414 | 465 |
| 150 | 3300036401 | Ga0373937_0015641 | Ga0373937_0015641_2866_4371 | 465 |
| 151 | 3300045976 | Ga0466967_0023138 | Ga0466967_0023138_3126_4601 | 465 |
| 152 | 3300046472 | Ga0495580_0011661 | Ga0495580_0011661_2094_3599 | 465 |
| 153 | 3300046511 | Ga0495608_0004886 | Ga0495608_0004886_5204_6709 | 465 |
| 154 | 3300046529 | Ga0495652_0080183 | Ga0495652_0080183_118_1623 | 465 |
| 155 | 3300046536 | Ga0495587_0001500 | Ga0495587_0001500_207_1712 | 465 |
| 156 | 3300046559 | Ga0495667_0053150 | Ga0495667_0053150_973_2478 | 465 |
| 157 | 3300046689 | Ga0495613_0019741 | Ga0495613_0019741_2489_3994 | 465 |
| 158 | 3300047317 | Ga0495604_0010694 | Ga0495604_0010694_2229_3734 | 465 |
| 159 | 3300048088 | Ga0495602_0002361 | Ga0495602_0002361_2792_4297 | 465 |
| 160 | 3300050511 | nmdc:mga08y16_36774_c1 | nmdc:mga08y16_36774_c1_354_1787 | 465 |
| 161 | 3300050515 | nmdc:mga0a205_58221_c1 | nmdc:mga0a205_58221_c1_46_1542 | 465 |
| 162 | 3300003320 | rootH2_10071456 | rootH2_100714567 | 466 |
| 163 | 3300005336 | Ga0070680_100018455 | Ga0070680_1000184554 | 466 |
| 164 | 3300005434 | Ga0070709_10072226 | Ga0070709_100722262 | 466 |
| 165 | 3300005439 | Ga0070711_100020844 | Ga0070711_1000208443 | 466 |
| 166 | 3300005468 | Ga0070707_100156409 | Ga0070707_1001564091 | 466 |
| 167 | 3300005471 | Ga0070698_100088872 | Ga0070698_1000888722 | 466 |
| 168 | 3300005530 | Ga0070679_100016382 | Ga0070679_1000163822 | 466 |
| 169 | 3300005543 | Ga0070672_100103052 | Ga0070672_1001030522 | 466 |
| 170 | 3300005548 | Ga0070665_100051409 | Ga0070665_1000514093 | 466 |
| 171 | 3300005614 | Ga0068856_100087222 | Ga0068856_1000872222 | 466 |
| 172 | 3300005617 | Ga0068859_100033126 | Ga0068859_1000331262 | 466 |
| 173 | 3300006028 | Ga0070717_10002266 | Ga0070717_100022667 | 466 |
| 174 | 3300006175 | Ga0070712_100000849 | Ga0070712_1000008495 | 466 |
| 175 | 3300006931 | Ga0097620_100033120 | Ga0097620_1000331202 | 466 |
| 176 | 3300009093 | Ga0105240_10057800 | Ga0105240_100578002 | 466 |
| 177 | 3300013105 | Ga0157369_10050261 | Ga0157369_100502614 | 466 |
| 178 | 3300013296 | Ga0157374_10022691 | Ga0157374_100226914 | 466 |
| 179 | 3300025910 | Ga0207684_10038756 | Ga0207684_100387562 | 466 |
| 180 | 3300025912 | Ga0207707_10086333 | Ga0207707_100863333 | 466 |
| 181 | 3300025913 | Ga0207695_10118499 | Ga0207695_101184992 | 466 |
| 182 | 3300025915 | Ga0207693_10001973 | Ga0207693_100019735 | 466 |
| 183 | 3300025916 | Ga0207663_10019745 | Ga0207663_100197452 | 466 |
| 184 | 3300025917 | Ga0207660_10028269 | Ga0207660_100282692 | 466 |
| 185 | 3300025921 | Ga0207652_10066349 | Ga0207652_100663491 | 466 |
| 186 | 3300025924 | Ga0207694_10088549 | Ga0207694_100885493 | 466 |
| 187 | 3300025933 | Ga0207706_10028239 | Ga0207706_100282392 | 466 |
| 188 | 3300025940 | Ga0207691_10059852 | Ga0207691_100598522 | 466 |
| 189 | 3300025949 | Ga0207667_10012221 | Ga0207667_100122212 | 466 |
| 190 | 3300026078 | Ga0207702_10074260 | Ga0207702_100742602 | 466 |
| 191 | 3300026116 | Ga0207674_10056840 | Ga0207674_100568403 | 466 |
| 192 | 3300046472 | Ga0495580_0004333 | Ga0495580_0004333_3473_4963 | 466 |
| 193 | 3300013308 | Ga0157375_10180581 | Ga0157375_101805812 | 467 |
| 194 | 3300025922 | Ga0207646_10074042 | Ga0207646_100740421 | 467 |
| 195 | 3300005445 | Ga0070708_100002019 | Ga0070708_10000201911 | 468 |
| 196 | 3300005539 | Ga0068853_100091158 | Ga0068853_1000911581 | 468 |
| 197 | 3300005617 | Ga0068859_100079723 | Ga0068859_1000797232 | 468 |
| 198 | 3300006028 | Ga0070717_10012524 | Ga0070717_100125243 | 468 |
| 199 | 3300006173 | Ga0070716_100060558 | Ga0070716_1000605581 | 468 |
| 200 | 3300006881 | Ga0068865_100016076 | Ga0068865_1000160762 | 468 |
| 201 | 3300006931 | Ga0097620_100079723 | Ga0097620_1000797232 | 468 |
| 202 | 3300010375 | Ga0105239_10025091 | Ga0105239_100250915 | 468 |
| 203 | 3300011119 | Ga0105246_10100141 | Ga0105246_101001412 | 468 |
| 204 | 3300013306 | Ga0163162_10013390 | Ga0163162_100133902 | 468 |
| 205 | 3300013308 | Ga0157375_10023986 | Ga0157375_100239863 | 468 |
| 206 | 3300014325 | Ga0163163_10002642 | Ga0163163_100026425 | 468 |
| 207 | 3300025904 | Ga0207647_10003151 | Ga0207647_100031513 | 468 |
| 208 | 3300025904 | Ga0207647_10022443 | Ga0207647_100224431 | 468 |
| 209 | 3300025927 | Ga0207687_10102430 | Ga0207687_101024302 | 468 |
| 210 | 3300025939 | Ga0207665_10058385 | Ga0207665_100583852 | 468 |
| 211 | 3300025942 | Ga0207689_10002264 | Ga0207689_1000226411 | 468 |
| 212 | 3300026023 | Ga0207677_10071183 | Ga0207677_100711831 | 468 |
| 213 | 3300026035 | Ga0207703_10036937 | Ga0207703_100369372 | 468 |
| 214 | 3300026041 | Ga0207639_10187084 | Ga0207639_101870841 | 468 |
| 215 | 3300028800 | Ga0265338_10004350 | Ga0265338_1000435011 | 468 |
| 216 | 3300048907 | Ga0496104_0030486 | Ga0496104_0030486_3154_4680 | 468 |
| 217 | 3300048915 | Ga0496112_0083501 | Ga0496112_0083501_368_1864 | 468 |
| 218 | 3300005436 | Ga0070713_100010317 | Ga0070713_1000103174 | 470 |
| 219 | 3300005439 | Ga0070711_100000441 | Ga0070711_10000044110 | 470 |
| 220 | 3300005439 | Ga0070711_100010131 | Ga0070711_1000101314 | 470 |
| 221 | 3300006028 | Ga0070717_10004158 | Ga0070717_100041584 | 470 |
| 222 | 3300006175 | Ga0070712_100001921 | Ga0070712_1000019213 | 470 |
| 223 | 3300009174 | Ga0105241_10026728 | Ga0105241_100267282 | 470 |
| 224 | 3300013306 | Ga0163162_10000147 | Ga0163162_1000014751 | 470 |
| 225 | 3300013306 | Ga0163162_10010881 | Ga0163162_100108814 | 470 |
| 226 | 3300025915 | Ga0207693_10000777 | Ga0207693_1000077718 | 470 |
| 227 | 3300025916 | Ga0207663_10001682 | Ga0207663_100016823 | 470 |
| 228 | 3300025928 | Ga0207700_10144480 | Ga0207700_101444802 | 470 |
| 229 | 3300025929 | Ga0207664_10036249 | Ga0207664_100362492 | 470 |
| 230 | 3300048917 | Ga0496114_0022395 | Ga0496114_0022395_3472_5001 | 470 |
| 231 | 3300005336 | Ga0070680_100137248 | Ga0070680_1001372481 | 471 |
| 232 | 3300005344 | Ga0070661_100004719 | Ga0070661_1000047191 | 471 |
| 233 | 3300005435 | Ga0070714_100178423 | Ga0070714_1001784231 | 471 |
| 234 | 3300005445 | Ga0070708_100094548 | Ga0070708_1000945483 | 471 |
| 235 | 3300005616 | Ga0068852_100046839 | Ga0068852_1000468392 | 471 |
| 236 | 3300006173 | Ga0070716_100002392 | Ga0070716_1000023925 | 471 |
| 237 | 3300006175 | Ga0070712_100023513 | Ga0070712_1000235132 | 471 |
| 238 | 3300006914 | Ga0075436_100010366 | Ga0075436_1000103663 | 471 |
| 239 | 3300007076 | Ga0075435_100007747 | Ga0075435_1000077475 | 471 |
| 240 | 3300025898 | Ga0207692_10046550 | Ga0207692_100465502 | 471 |
| 241 | 3300025906 | Ga0207699_10004889 | Ga0207699_100048894 | 471 |
| 242 | 3300025915 | Ga0207693_10040788 | Ga0207693_100407882 | 471 |
| 243 | 3300025928 | Ga0207700_10041011 | Ga0207700_100410111 | 471 |
| 244 | 3300025939 | Ga0207665_10005264 | Ga0207665_100052644 | 471 |
| 245 | 3300025942 | Ga0207689_10161124 | Ga0207689_101611241 | 471 |
| 246 | 3300039450 | Ga0436363_0052375 | Ga0436363_0052375_1512_2999 | 471 |
| 247 | 3300048929 | Ga0496126_0000074 | Ga0496126_0000074_52162_53787 | 471 |
| 248 | 3300005366 | Ga0070659_100068315 | Ga0070659_1000683151 | 472 |
| 249 | 3300005436 | Ga0070713_100067191 | Ga0070713_1000671913 | 472 |
| 250 | 3300005563 | Ga0068855_100037082 | Ga0068855_1000370822 | 472 |
| 251 | 3300005563 | Ga0068855_100066292 | Ga0068855_1000662922 | 472 |
| 252 | 3300005614 | Ga0068856_100046450 | Ga0068856_1000464501 | 472 |
| 253 | 3300006028 | Ga0070717_10003199 | Ga0070717_100031997 | 472 |
| 254 | 3300009093 | Ga0105240_10000178 | Ga0105240_1000017839 | 472 |
| 255 | 3300013307 | Ga0157372_10026600 | Ga0157372_100266007 | 472 |
| 256 | 3300013307 | Ga0157372_10236277 | Ga0157372_102362771 | 472 |
| 257 | 3300025913 | Ga0207695_10000249 | Ga0207695_1000024990 | 472 |
| 258 | 3300025949 | Ga0207667_10007973 | Ga0207667_100079736 | 472 |
| 259 | 3300035113 | Ga0373936_0013395 | Ga0373936_0013395_923_2434 | 472 |
| 260 | 3300039453 | Ga0436362_0461762 | Ga0436362_0461762_3172_4698 | 472 |
| 261 | 3300047471 | Ga0495684_0099311 | Ga0495684_0099311_623_2098 | 472 |
| 262 | 3300005444 | Ga0070694_100020215 | Ga0070694_1000202151 | 473 |
| 263 | 3300005471 | Ga0070698_100096294 | Ga0070698_1000962943 | 473 |
| 264 | 3300005536 | Ga0070697_100207316 | Ga0070697_1002073162 | 473 |
| 265 | 3300009147 | Ga0114129_10022378 | Ga0114129_100223783 | 473 |
| 266 | 3300014969 | Ga0157376_10127200 | Ga0157376_101272002 | 473 |
| 267 | 3300050507 | nmdc:mga05p37_3603_c1 | nmdc:mga05p37_3603_c1_14434_15867 | 473 |
| 268 | 3300005338 | Ga0068868_100015308 | Ga0068868_1000153085 | 474 |
| 269 | 3300005406 | Ga0070703_10013902 | Ga0070703_100139022 | 474 |
| 270 | 3300005518 | Ga0070699_100051478 | Ga0070699_1000514782 | 474 |
| 271 | 3300005536 | Ga0070697_100030767 | Ga0070697_1000307673 | 474 |
| 272 | 3300005548 | Ga0070665_100156110 | Ga0070665_1001561102 | 474 |
| 273 | 3300005614 | Ga0068856_100061884 | Ga0068856_1000618842 | 474 |
| 274 | 3300006358 | Ga0068871_100056040 | Ga0068871_1000560402 | 474 |
| 275 | 3300006871 | Ga0075434_100017276 | Ga0075434_1000172764 | 474 |
| 276 | 3300006914 | Ga0075436_100063164 | Ga0075436_1000631643 | 474 |
| 277 | 3300007076 | Ga0075435_100005304 | Ga0075435_1000053043 | 474 |
| 278 | 3300009094 | Ga0111539_10014823 | Ga0111539_100148234 | 474 |
| 279 | 3300009098 | Ga0105245_10004878 | Ga0105245_100048788 | 474 |
| 280 | 3300009147 | Ga0114129_10011241 | Ga0114129_100112418 | 474 |
| 281 | 3300009174 | Ga0105241_10011619 | Ga0105241_100116194 | 474 |
| 282 | 3300009174 | Ga0105241_10043050 | Ga0105241_100430503 | 474 |
| 283 | 3300009177 | Ga0105248_10001527 | Ga0105248_100015278 | 474 |
| 284 | 3300011119 | Ga0105246_10050293 | Ga0105246_100502932 | 474 |
| 285 | 3300013100 | Ga0157373_10001055 | Ga0157373_1000105512 | 474 |
| 286 | 3300013307 | Ga0157372_10028884 | Ga0157372_100288845 | 474 |
| 287 | 3300014969 | Ga0157376_10000991 | Ga0157376_100009918 | 474 |
| 288 | 3300025885 | Ga0207653_10004400 | Ga0207653_100044002 | 474 |
| 289 | 3300026078 | Ga0207702_10013451 | Ga0207702_100134515 | 474 |
| 290 | 3300031691 | Ga0316579_10042784 | Ga0316579_100427842 | 474 |
| 291 | 3300042876 | Ga0451577_0128704 | Ga0451577_0128704_131_1621 | 474 |
| 292 | 3300048918 | Ga0496115_0044671 | Ga0496115_0044671_930_2438 | 474 |
| 293 | 3300049570 | Ga0501033_0005773 | Ga0501033_0005773_4160_5662 | 474 |
| 294 | 3300049581 | Ga0501047_0003666 | Ga0501047_0003666_5630_7132 | 474 |
| 295 | 3300049744 | Ga0501083_0008460 | Ga0501083_0008460_4550_6052 | 474 |
| 296 | 3300049744 | Ga0501083_0083237 | Ga0501083_0083237_555_2057 | 474 |
| 297 | 3300049824 | Ga0501045_0150248 | Ga0501045_0150248_37_1539 | 474 |
| 298 | 3300050507 | nmdc:mga05p37_115958_c1 | nmdc:mga05p37_115958_c1_988_2436 | 474 |
| 299 | 3300050512 | nmdc:mga0n895_34219_c1 | nmdc:mga0n895_34219_c1_2025_3533 | 474 |
| 300 | 3300050513 | nmdc:mga0rr50_3575_c1 | nmdc:mga0rr50_3575_c1_1018_2526 | 474 |
| 301 | 3300050514 | nmdc:mga08x19_9583_c2 | nmdc:mga08x19_9583_c2_1000_2508 | 474 |
| 302 | 3300050515 | nmdc:mga0a205_115835_c1 | nmdc:mga0a205_115835_c1_902_2413 | 474 |
| 303 | 3300006237 | Ga0097621_100003948 | Ga0097621_1000039486 | 475 |
| 304 | 3300009147 | Ga0114129_10119081 | Ga0114129_101190812 | 475 |
| 305 | 3300009545 | Ga0105237_10015644 | Ga0105237_100156445 | 475 |
| 306 | 3300025914 | Ga0207671_10030492 | Ga0207671_100304923 | 475 |
| 307 | 3300044712 | Ga0453684_0020898 | Ga0453684_0020898_6057_7547 | 475 |
| 308 | 3300048915 | Ga0496112_0101967 | Ga0496112_0101967_1016_2515 | 475 |
| 309 | 3300049569 | Ga0501032_0045989 | Ga0501032_0045989_1373_2875 | 475 |
| 310 | 3300049571 | Ga0501034_0010575 | Ga0501034_0010575_7682_9184 | 475 |
| 311 | 3300049574 | Ga0501038_0054283 | Ga0501038_0054283_1501_3003 | 475 |
| 312 | 3300049575 | Ga0501039_0042516 | Ga0501039_0042516_1349_2851 | 475 |
| 313 | 3300049580 | Ga0501046_0014221 | Ga0501046_0014221_4942_6444 | 475 |
| 314 | 3300049581 | Ga0501047_0003728 | Ga0501047_0003728_11534_13036 | 475 |
| 315 | 3300049583 | Ga0501067_0053166 | Ga0501067_0053166_649_2151 | 475 |
| 316 | 3300049742 | Ga0501080_0014267 | Ga0501080_0014267_5102_6604 | 475 |
| 317 | 3300049823 | Ga0501044_0056260 | Ga0501044_0056260_2314_3816 | 475 |
| 318 | 3300060353 | Ga0501082_0078520 | Ga0501082_0078520_699_2201 | 475 |
| 319 | 3300005335 | Ga0070666_10003842 | Ga0070666_100038423 | 476 |
| 320 | 3300006237 | Ga0097621_100002271 | Ga0097621_1000022719 | 476 |
| 321 | 3300025903 | Ga0207680_10002337 | Ga0207680_100023373 | 476 |
| 322 | 3300025939 | Ga0207665_10139273 | Ga0207665_101392731 | 476 |
| 323 | 3300026035 | Ga0207703_10001398 | Ga0207703_1000139816 | 476 |
| 324 | 3300028573 | Ga0265334_10037472 | Ga0265334_100374721 | 476 |
| 325 | 3300031240 | Ga0265320_10000032 | Ga0265320_1000003230 | 476 |
| 326 | 3300042439 | Ga0439464_0006622 | Ga0439464_0006622_148_1677 | 476 |
| 327 | 3300046473 | Ga0495582_0046150 | Ga0495582_0046150_503_2008 | 476 |
| 328 | 3300005295 | Ga0065707_10002876 | Ga0065707_100028762 | 477 |
| 329 | 3300005467 | Ga0070706_100002696 | Ga0070706_1000026969 | 477 |
| 330 | 3300005468 | Ga0070707_100003997 | Ga0070707_1000039972 | 477 |
| 331 | 3300005471 | Ga0070698_100034000 | Ga0070698_1000340003 | 477 |
| 332 | 3300006847 | Ga0075431_100008530 | Ga0075431_1000085303 | 477 |
| 333 | 3300009147 | Ga0114129_10033594 | Ga0114129_100335942 | 477 |
| 334 | 3300009174 | Ga0105241_10020850 | Ga0105241_100208502 | 477 |
| 335 | 3300010375 | Ga0105239_10270093 | Ga0105239_102700931 | 477 |
| 336 | 3300014326 | Ga0157380_10012184 | Ga0157380_100121843 | 477 |
| 337 | 3300014968 | Ga0157379_10004057 | Ga0157379_100040574 | 477 |
| 338 | 3300025910 | Ga0207684_10004777 | Ga0207684_100047777 | 477 |
| 339 | 3300025922 | Ga0207646_10005136 | Ga0207646_1000513613 | 477 |
| 340 | 3300025922 | Ga0207646_10016437 | Ga0207646_100164372 | 477 |
| 341 | 3300028577 | Ga0265318_10005219 | Ga0265318_100052192 | 477 |
| 342 | 3300031235 | Ga0265330_10047557 | Ga0265330_100475572 | 477 |
| 343 | 3300031250 | Ga0265331_10012216 | Ga0265331_100122161 | 477 |
| 344 | 3300035691 | Ga0373931_0029217 | Ga0373931_0029217_326_1819 | 477 |
| 345 | 3300044712 | Ga0453684_0052207 | Ga0453684_0052207_921_2429 | 477 |
| 346 | 3300048905 | Ga0496102_0000641 | Ga0496102_0000641_26765_28258 | 477 |
| 347 | 3300048907 | Ga0496104_0013455 | Ga0496104_0013455_3126_4619 | 477 |
| 348 | 3300048908 | Ga0496105_0117664 | Ga0496105_0117664_222_1715 | 477 |
| 349 | 3300050507 | nmdc:mga05p37_35213_c1 | nmdc:mga05p37_35213_c1_1290_2810 | 477 |
| 350 | 3300005436 | Ga0070713_100052784 | Ga0070713_1000527842 | 478 |
| 351 | 3300005518 | Ga0070699_100084372 | Ga0070699_1000843722 | 478 |
| 352 | 3300005937 | Ga0081455_10066861 | Ga0081455_100668613 | 478 |
| 353 | 3300024227 | Ga0228598_1000423 | Ga0228598_10004233 | 478 |
| 354 | 3300025910 | Ga0207684_10127292 | Ga0207684_101272922 | 478 |
| 355 | 3300028563 | Ga0265319_1002942 | Ga0265319_10029427 | 478 |
| 356 | 3300042876 | Ga0451577_0026254 | Ga0451577_0026254_2261_3757 | 478 |
| 357 | 3300046543 | Ga0495645_0014894 | Ga0495645_0014894_3783_5291 | 478 |
| 358 | 3300049568 | Ga0501031_0103351 | Ga0501031_0103351_95_1600 | 478 |
| 359 | 3300049569 | Ga0501032_0012270 | Ga0501032_0012270_2432_3937 | 478 |
| 360 | 3300049570 | Ga0501033_0006344 | Ga0501033_0006344_5127_6632 | 478 |
| 361 | 3300049571 | Ga0501034_0018789 | Ga0501034_0018789_1909_3414 | 478 |
| 362 | 3300049573 | Ga0501037_0008661 | Ga0501037_0008661_1184_2689 | 478 |
| 363 | 3300049574 | Ga0501038_0024503 | Ga0501038_0024503_734_2239 | 478 |
| 364 | 3300049579 | Ga0501043_0003562 | Ga0501043_0003562_5550_7055 | 478 |
| 365 | 3300049580 | Ga0501046_0010405 | Ga0501046_0010405_4390_5895 | 478 |
| 366 | 3300049581 | Ga0501047_0025582 | Ga0501047_0025582_2998_4503 | 478 |
| 367 | 3300049582 | Ga0501048_0001404 | Ga0501048_0001404_14138_15643 | 478 |
| 368 | 3300049583 | Ga0501067_0009909 | Ga0501067_0009909_495_2000 | 478 |
| 369 | 3300049586 | Ga0501070_0012750 | Ga0501070_0012750_5329_6834 | 478 |
| 370 | 3300049741 | Ga0501079_0020680 | Ga0501079_0020680_2090_3595 | 478 |
| 371 | 3300049742 | Ga0501080_0016012 | Ga0501080_0016012_5255_6760 | 478 |
| 372 | 3300053077 | Ga0495601_0062613 | Ga0495601_0062613_167_1675 | 478 |
| 373 | 3300009101 | Ga0105247_10043136 | Ga0105247_100431363 | 479 |
| 374 | 3300031235 | Ga0265330_10000507 | Ga0265330_100005078 | 479 |
| 375 | 3300031241 | Ga0265325_10000167 | Ga0265325_100001676 | 479 |
| 376 | 3300031241 | Ga0265325_10000239 | Ga0265325_1000023929 | 479 |
| 377 | 3300031249 | Ga0265339_10003514 | Ga0265339_100035143 | 479 |
| 378 | 3300031249 | Ga0265339_10041400 | Ga0265339_100414002 | 479 |
| 379 | 3300031250 | Ga0265331_10000512 | Ga0265331_100005122 | 479 |
| 380 | 3300031344 | Ga0265316_10001849 | Ga0265316_100018497 | 479 |
| 381 | 3300031595 | Ga0265313_10000349 | Ga0265313_1000034910 | 479 |
| 382 | 3300031595 | Ga0265313_10000894 | Ga0265313_100008948 | 479 |
| 383 | 3300031711 | Ga0265314_10000713 | Ga0265314_1000071326 | 479 |
| 384 | 3300031712 | Ga0265342_10000686 | Ga0265342_100006864 | 479 |
| 385 | 3300031728 | Ga0316578_10086679 | Ga0316578_100866791 | 479 |
| 386 | 3300005329 | Ga0070683_100021572 | Ga0070683_1000215726 | 480 |
| 387 | 3300025912 | Ga0207707_10095021 | Ga0207707_100950212 | 480 |
| 388 | 3300025940 | Ga0207691_10186561 | Ga0207691_101865612 | 480 |
| 389 | 3300005842 | Ga0068858_100035131 | Ga0068858_1000351314 | 481 |
| 390 | 3300006844 | Ga0075428_100139940 | Ga0075428_1001399401 | 481 |
| 391 | 3300009094 | Ga0111539_10005248 | Ga0111539_100052483 | 481 |
| 392 | 3300013296 | Ga0157374_10004887 | Ga0157374_100048878 | 481 |
| 393 | 3300005441 | Ga0070700_100044426 | Ga0070700_1000444262 | 482 |
| 394 | 3300005459 | Ga0068867_100043396 | Ga0068867_1000433962 | 482 |
| 395 | 3300005842 | Ga0068858_100187227 | Ga0068858_1001872272 | 482 |
| 396 | 3300009147 | Ga0114129_10084691 | Ga0114129_100846912 | 482 |
| 397 | 3300009176 | Ga0105242_10089304 | Ga0105242_100893042 | 482 |
| 398 | 3300026075 | Ga0207708_10160211 | Ga0207708_101602111 | 482 |
| 399 | 3300031241 | Ga0265325_10006922 | Ga0265325_100069226 | 482 |
| 400 | 3300031247 | Ga0265340_10004426 | Ga0265340_100044264 | 482 |
| 401 | 3300031247 | Ga0265340_10026524 | Ga0265340_100265244 | 482 |
| 402 | 3300031249 | Ga0265339_10037352 | Ga0265339_100373522 | 482 |
| 403 | 3300031344 | Ga0265316_10061796 | Ga0265316_100617963 | 482 |
| 404 | 3300035172 | Ga0373955_0091673 | Ga0373955_0091673_153_1649 | 482 |
| 405 | 3300046663 | Ga0495635_0059297 | Ga0495635_0059297_1036_2532 | 482 |
| 406 | 3300005340 | Ga0070689_100035853 | Ga0070689_1000358533 | 483 |
| 407 | 3300005440 | Ga0070705_100003449 | Ga0070705_1000034497 | 483 |
| 408 | 3300005544 | Ga0070686_100015781 | Ga0070686_1000157812 | 483 |
| 409 | 3300005578 | Ga0068854_100066423 | Ga0068854_1000664232 | 483 |
| 410 | 3300006852 | Ga0075433_10002695 | Ga0075433_100026957 | 483 |
| 411 | 3300014745 | Ga0157377_10028727 | Ga0157377_100287272 | 483 |
| 412 | 3300025981 | Ga0207640_10051211 | Ga0207640_100512111 | 483 |
| 413 | 3300026067 | Ga0207678_10010352 | Ga0207678_100103524 | 483 |
| 414 | 3300026089 | Ga0207648_10010915 | Ga0207648_100109152 | 483 |
| 415 | 3300031344 | Ga0265316_10004004 | Ga0265316_100040049 | 483 |
| 416 | 3300039437 | Ga0436365_0126746 | Ga0436365_0126746_531_2039 | 483 |
| 417 | 3300049569 | Ga0501032_0003101 | Ga0501032_0003101_290_1795 | 483 |
| 418 | 3300049570 | Ga0501033_0001096 | Ga0501033_0001096_5198_6703 | 483 |
| 419 | 3300049571 | Ga0501034_0072741 | Ga0501034_0072741_1599_3104 | 483 |
| 420 | 3300049572 | Ga0501036_0001195 | Ga0501036_0001195_4111_5616 | 483 |
| 421 | 3300049573 | Ga0501037_0002133 | Ga0501037_0002133_12692_14197 | 483 |
| 422 | 3300049579 | Ga0501043_0008126 | Ga0501043_0008126_6217_7722 | 483 |
| 423 | 3300049580 | Ga0501046_0003257 | Ga0501046_0003257_2915_4420 | 483 |
| 424 | 3300049581 | Ga0501047_0034946 | Ga0501047_0034946_3071_4576 | 483 |
| 425 | 3300049582 | Ga0501048_0001416 | Ga0501048_0001416_2533_4038 | 483 |
| 426 | 3300049586 | Ga0501070_0015454 | Ga0501070_0015454_1374_2879 | 483 |
| 427 | 3300049589 | Ga0501073_0009670 | Ga0501073_0009670_3071_4576 | 483 |
| 428 | 3300049590 | Ga0501074_0001199 | Ga0501074_0001199_2534_4039 | 483 |
| 429 | 3300049741 | Ga0501079_0001813 | Ga0501079_0001813_13687_15192 | 483 |
| 430 | 3300049742 | Ga0501080_0048020 | Ga0501080_0048020_238_1743 | 483 |
| 431 | 3300049744 | Ga0501083_0007965 | Ga0501083_0007965_1599_3104 | 483 |
| 432 | 3300049822 | Ga0501035_0002125 | Ga0501035_0002125_2532_4037 | 483 |
| 433 | 3300049823 | Ga0501044_0025473 | Ga0501044_0025473_2533_4038 | 483 |
| 434 | 3300050515 | nmdc:mga0a205_3661_c1 | nmdc:mga0a205_3661_c1_926_2446 | 483 |
| 435 | 3300054114 | Ga0501084_0002244 | Ga0501084_0002244_9051_10556 | 483 |
| 436 | 3300060353 | Ga0501082_0001883 | Ga0501082_0001883_12445_13950 | 483 |
| 437 | 3300006178 | Ga0075367_10049947 | Ga0075367_100499473 | 484 |
| 438 | 3300006195 | Ga0075366_10010326 | Ga0075366_100103262 | 484 |
| 439 | 3300006353 | Ga0075370_10045341 | Ga0075370_100453412 | 484 |
| 440 | 3300028800 | Ga0265338_10005938 | Ga0265338_1000593813 | 484 |
| 441 | 3300031249 | Ga0265339_10024272 | Ga0265339_100242722 | 484 |
| 442 | 3300031711 | Ga0265314_10012791 | Ga0265314_100127915 | 484 |
| 443 | 3300042184 | Ga0450908_004534 | Ga0450908_004534_358_1857 | 484 |
| 444 | 3300049568 | Ga0501031_0001966 | Ga0501031_0001966_5075_6577 | 484 |
| 445 | 3300049570 | Ga0501033_0009768 | Ga0501033_0009768_611_2113 | 484 |
| 446 | 3300049572 | Ga0501036_0005799 | Ga0501036_0005799_5065_6567 | 484 |
| 447 | 3300049573 | Ga0501037_0005157 | Ga0501037_0005157_1925_3427 | 484 |
| 448 | 3300049575 | Ga0501039_0027515 | Ga0501039_0027515_744_2246 | 484 |
| 449 | 3300049579 | Ga0501043_0009092 | Ga0501043_0009092_2743_4245 | 484 |
| 450 | 3300049580 | Ga0501046_0006694 | Ga0501046_0006694_31_1533 | 484 |
| 451 | 3300049582 | Ga0501048_0002224 | Ga0501048_0002224_4245_5747 | 484 |
| 452 | 3300049583 | Ga0501067_0003313 | Ga0501067_0003313_905_2407 | 484 |
| 453 | 3300049584 | Ga0501068_0008669 | Ga0501068_0008669_1345_2847 | 484 |
| 454 | 3300049587 | Ga0501071_0043532 | Ga0501071_0043532_1235_2737 | 484 |
| 455 | 3300049588 | Ga0501072_0054835 | Ga0501072_0054835_525_2027 | 484 |
| 456 | 3300049590 | Ga0501074_0000241 | Ga0501074_0000241_21979_23481 | 484 |
| 457 | 3300049741 | Ga0501079_0003433 | Ga0501079_0003433_8361_9863 | 484 |
| 458 | 3300049822 | Ga0501035_0007030 | Ga0501035_0007030_2285_3787 | 484 |
| 459 | 3300049824 | Ga0501045_0014147 | Ga0501045_0014147_3507_5009 | 484 |
| 460 | 3300050494 | nmdc:mga06z11_37534_c1 | nmdc:mga06z11_37534_c1_139_1638 | 484 |
| 461 | 3300050496 | nmdc:mga07m45_37453_c1 | nmdc:mga07m45_37453_c1_821_2320 | 484 |
| 462 | 3300054114 | Ga0501084_0014669 | Ga0501084_0014669_2533_4035 | 484 |
| 463 | 3300060353 | Ga0501082_0004549 | Ga0501082_0004549_4146_5648 | 484 |
| 464 | 3300005456 | Ga0070678_100049829 | Ga0070678_1000498292 | 485 |
| 465 | 3300005536 | Ga0070697_100066894 | Ga0070697_1000668942 | 485 |
| 466 | 3300005549 | Ga0070704_100025720 | Ga0070704_1000257204 | 485 |
| 467 | 3300005841 | Ga0068863_100127068 | Ga0068863_1001270682 | 485 |
| 468 | 3300006028 | Ga0070717_10031206 | Ga0070717_100312063 | 485 |
| 469 | 3300006881 | Ga0068865_100113486 | Ga0068865_1001134862 | 485 |
| 470 | 3300014325 | Ga0163163_10058820 | Ga0163163_100588203 | 485 |
| 471 | 3300025940 | Ga0207691_10020128 | Ga0207691_100201284 | 485 |
| 472 | 3300025972 | Ga0207668_10055321 | Ga0207668_100553212 | 485 |
| 473 | 3300026067 | Ga0207678_10027757 | Ga0207678_100277573 | 485 |
| 474 | 3300026088 | Ga0207641_10030588 | Ga0207641_100305883 | 485 |
| 475 | 3300026095 | Ga0207676_10097316 | Ga0207676_100973162 | 485 |
| 476 | 3300044658 | Ga0466972_0002988 | Ga0466972_0002988_1473_2987 | 485 |
| 477 | 3300044901 | Ga0466960_0007624 | Ga0466960_0007624_65_1579 | 485 |
| 478 | 3300005438 | Ga0070701_10021017 | Ga0070701_100210173 | 486 |
| 479 | 3300005843 | Ga0068860_100121345 | Ga0068860_1001213452 | 486 |
| 480 | 3300005844 | Ga0068862_100091064 | Ga0068862_1000910642 | 486 |
| 481 | 3300006195 | Ga0075366_10000144 | Ga0075366_100001449 | 486 |
| 482 | 3300009094 | Ga0111539_10017378 | Ga0111539_100173782 | 486 |
| 483 | 3300009147 | Ga0114129_10008657 | Ga0114129_1000865711 | 486 |
| 484 | 3300009177 | Ga0105248_10012017 | Ga0105248_100120174 | 486 |
| 485 | 3300013308 | Ga0157375_10128081 | Ga0157375_101280811 | 486 |
| 486 | 3300014326 | Ga0157380_10058476 | Ga0157380_100584763 | 486 |
| 487 | 3300025940 | Ga0207691_10043105 | Ga0207691_100431054 | 486 |
| 488 | 3300025942 | Ga0207689_10013848 | Ga0207689_100138484 | 486 |
| 489 | 3300027907 | Ga0207428_10015554 | Ga0207428_100155542 | 486 |
| 490 | 3300027907 | Ga0207428_10039352 | Ga0207428_100393522 | 486 |
| 491 | 3300028380 | Ga0268265_10151173 | Ga0268265_101511732 | 486 |
| 492 | 3300028381 | Ga0268264_10043592 | Ga0268264_100435923 | 486 |
| 493 | 3300049576 | Ga0501040_0024283 | Ga0501040_0024283_1663_3204 | 486 |
| 494 | 3300049590 | Ga0501074_0039329 | Ga0501074_0039329_1011_2552 | 486 |
| 495 | 3300049743 | Ga0501081_0017759 | Ga0501081_0017759_665_2206 | 486 |
| 496 | 3300049824 | Ga0501045_0025895 | Ga0501045_0025895_521_2062 | 486 |
| 497 | 3300050493 | nmdc:mga0k408_10800_c1 | nmdc:mga0k408_10800_c1_270_1781 | 486 |
| 498 | 3300050507 | nmdc:mga05p37_7639_c1 | nmdc:mga05p37_7639_c1_2469_3962 | 486 |
| 499 | 3300050508 | nmdc:mga09592_8755_c1 | nmdc:mga09592_8755_c1_6625_8136 | 486 |
| 500 | 3300050511 | nmdc:mga08y16_12239_c1 | nmdc:mga08y16_12239_c1_383_1894 | 486 |
| 501 | 3300050511 | nmdc:mga08y16_70051_c1 | nmdc:mga08y16_70051_c1_1429_2925 | 486 |
| 502 | 3300060353 | Ga0501082_0027217 | Ga0501082_0027217_646_2187 | 486 |
| 503 | 3300005290 | Ga0065712_10071722 | Ga0065712_100717222 | 487 |
| 504 | 3300005293 | Ga0065715_10109053 | Ga0065715_101090532 | 487 |
| 505 | 3300005334 | Ga0068869_100020910 | Ga0068869_1000209102 | 487 |
| 506 | 3300005353 | Ga0070669_100164441 | Ga0070669_1001644411 | 487 |
| 507 | 3300005438 | Ga0070701_10039158 | Ga0070701_100391582 | 487 |
| 508 | 3300005466 | Ga0070685_10048476 | Ga0070685_100484762 | 487 |
| 509 | 3300005468 | Ga0070707_100126963 | Ga0070707_1001269631 | 487 |
| 510 | 3300005471 | Ga0070698_100094262 | Ga0070698_1000942622 | 487 |
| 511 | 3300005536 | Ga0070697_100012862 | Ga0070697_1000128622 | 487 |
| 512 | 3300005719 | Ga0068861_100038189 | Ga0068861_1000381892 | 487 |
| 513 | 3300005841 | Ga0068863_100070331 | Ga0068863_1000703312 | 487 |
| 514 | 3300006237 | Ga0097621_100061367 | Ga0097621_1000613672 | 487 |
| 515 | 3300006358 | Ga0068871_100009590 | Ga0068871_1000095904 | 487 |
| 516 | 3300009176 | Ga0105242_10071676 | Ga0105242_100716762 | 487 |
| 517 | 3300009176 | Ga0105242_10197872 | Ga0105242_101978722 | 487 |
| 518 | 3300009177 | Ga0105248_10075736 | Ga0105248_100757363 | 487 |
| 519 | 3300013296 | Ga0157374_10007459 | Ga0157374_100074597 | 487 |
| 520 | 3300014969 | Ga0157376_10069227 | Ga0157376_100692272 | 487 |
| 521 | 3300017792 | Ga0163161_10018819 | Ga0163161_100188192 | 487 |
| 522 | 3300025899 | Ga0207642_10050730 | Ga0207642_100507302 | 487 |
| 523 | 3300025910 | Ga0207684_10078233 | Ga0207684_100782331 | 487 |
| 524 | 3300025910 | Ga0207684_10163002 | Ga0207684_101630021 | 487 |
| 525 | 3300025922 | Ga0207646_10001014 | Ga0207646_1000101425 | 487 |
| 526 | 3300025922 | Ga0207646_10008426 | Ga0207646_100084264 | 487 |
| 527 | 3300025934 | Ga0207686_10046554 | Ga0207686_100465542 | 487 |
| 528 | 3300025938 | Ga0207704_10119060 | Ga0207704_101190602 | 487 |
| 529 | 3300025942 | Ga0207689_10015206 | Ga0207689_100152062 | 487 |
| 530 | 3300026118 | Ga0207675_100097627 | Ga0207675_1000976272 | 487 |
| 531 | 3300026121 | Ga0207683_10031671 | Ga0207683_100316713 | 487 |
| 532 | 3300028380 | Ga0268265_10058794 | Ga0268265_100587942 | 487 |
| 533 | 3300030760 | Ga0265762_1001799 | Ga0265762_10017991 | 487 |
| 534 | 3300035172 | Ga0373955_0017844 | Ga0373955_0017844_1377_2867 | 487 |
| 535 | 3300036647 | Ga0316582_0000018 | Ga0316582_0000018_8639_10123 | 487 |
| 536 | 3300046809 | Ga0495600_0034985 | Ga0495600_0034985_1484_2974 | 487 |
| 537 | 3300048911 | Ga0496108_0065744 | Ga0496108_0065744_538_2028 | 487 |
| 538 | 3300048913 | Ga0496110_0045619 | Ga0496110_0045619_1317_2807 | 487 |
| 539 | 3300048916 | Ga0496113_0100874 | Ga0496113_0100874_124_1614 | 487 |
| 540 | 3300050515 | nmdc:mga0a205_5839_c1 | nmdc:mga0a205_5839_c1_8231_9742 | 487 |
| 541 | 3300053085 | Ga0495619_0008599 | Ga0495619_0008599_4153_5643 | 487 |
| 542 | 3300005290 | Ga0065712_10085738 | Ga0065712_100857382 | 488 |
| 543 | 3300005293 | Ga0065715_10099289 | Ga0065715_100992893 | 488 |
| 544 | 3300005335 | Ga0070666_10042742 | Ga0070666_100427421 | 488 |
| 545 | 3300005338 | Ga0068868_100014059 | Ga0068868_1000140592 | 488 |
| 546 | 3300005364 | Ga0070673_100128151 | Ga0070673_1001281511 | 488 |
| 547 | 3300005468 | Ga0070707_100026349 | Ga0070707_1000263491 | 488 |
| 548 | 3300005548 | Ga0070665_100028955 | Ga0070665_1000289554 | 488 |
| 549 | 3300005617 | Ga0068859_100027605 | Ga0068859_1000276053 | 488 |
| 550 | 3300005617 | Ga0068859_100192529 | Ga0068859_1001925292 | 488 |
| 551 | 3300005618 | Ga0068864_100000940 | Ga0068864_10000094014 | 488 |
| 552 | 3300005841 | Ga0068863_100176469 | Ga0068863_1001764692 | 488 |
| 553 | 3300005842 | Ga0068858_100061145 | Ga0068858_1000611452 | 488 |
| 554 | 3300006051 | Ga0075364_10063086 | Ga0075364_100630862 | 488 |
| 555 | 3300006358 | Ga0068871_100025464 | Ga0068871_1000254642 | 488 |
| 556 | 3300006931 | Ga0097620_100027605 | Ga0097620_1000276053 | 488 |
| 557 | 3300006931 | Ga0097620_100192531 | Ga0097620_1001925312 | 488 |
| 558 | 3300009177 | Ga0105248_10030942 | Ga0105248_100309422 | 488 |
| 559 | 3300013105 | Ga0157369_10021941 | Ga0157369_100219414 | 488 |
| 560 | 3300013297 | Ga0157378_10013955 | Ga0157378_100139555 | 488 |
| 561 | 3300013306 | Ga0163162_10002317 | Ga0163162_100023177 | 488 |
| 562 | 3300014969 | Ga0157376_10059100 | Ga0157376_100591002 | 488 |
| 563 | 3300025934 | Ga0207686_10000141 | Ga0207686_1000014121 | 488 |
| 564 | 3300025938 | Ga0207704_10142126 | Ga0207704_101421261 | 488 |
| 565 | 3300025941 | Ga0207711_10045713 | Ga0207711_100457133 | 488 |
| 566 | 3300025941 | Ga0207711_10195444 | Ga0207711_101954441 | 488 |
| 567 | 3300026023 | Ga0207677_10017039 | Ga0207677_100170393 | 488 |
| 568 | 3300026035 | Ga0207703_10021476 | Ga0207703_100214762 | 488 |
| 569 | 3300026088 | Ga0207641_10001723 | Ga0207641_100017239 | 488 |
| 570 | 3300026095 | Ga0207676_10018710 | Ga0207676_100187102 | 488 |
| 571 | 3300037068 | Ga0373925_0005926 | Ga0373925_0005926_605_2089 | 488 |
| 572 | 3300050491 | nmdc:mga00v17_131664_c1 | nmdc:mga00v17_131664_c1_31_1530 | 488 |
| 573 | 3300050493 | nmdc:mga0k408_3793_c1 | nmdc:mga0k408_3793_c1_842_2341 | 488 |
| 574 | 3300050512 | nmdc:mga0n895_21342_c1 | nmdc:mga0n895_21342_c1_3264_4784 | 488 |
| 575 | 3300005434 | Ga0070709_10093478 | Ga0070709_100934781 | 489 |
| 576 | 3300005435 | Ga0070714_100000065 | Ga0070714_10000006518 | 489 |
| 577 | 3300005435 | Ga0070714_100115807 | Ga0070714_1001158072 | 489 |
| 578 | 3300005441 | Ga0070700_100011097 | Ga0070700_1000110974 | 489 |
| 579 | 3300005444 | Ga0070694_100002458 | Ga0070694_1000024583 | 489 |
| 580 | 3300005458 | Ga0070681_10160339 | Ga0070681_101603391 | 489 |
| 581 | 3300005468 | Ga0070707_100244129 | Ga0070707_1002441292 | 489 |
| 582 | 3300005471 | Ga0070698_100086646 | Ga0070698_1000866462 | 489 |
| 583 | 3300005530 | Ga0070679_100212057 | Ga0070679_1002120571 | 489 |
| 584 | 3300006914 | Ga0075436_100001203 | Ga0075436_10000120312 | 489 |
| 585 | 3300006914 | Ga0075436_100031768 | Ga0075436_1000317682 | 489 |
| 586 | 3300007076 | Ga0075435_100018223 | Ga0075435_1000182233 | 489 |
| 587 | 3300007265 | Ga0099794_10000677 | Ga0099794_100006774 | 489 |
| 588 | 3300009093 | Ga0105240_10099641 | Ga0105240_100996413 | 489 |
| 589 | 3300009545 | Ga0105237_10194924 | Ga0105237_101949242 | 489 |
| 590 | 3300014325 | Ga0163163_10201541 | Ga0163163_102015411 | 489 |
| 591 | 3300025906 | Ga0207699_10031428 | Ga0207699_100314282 | 489 |
| 592 | 3300025914 | Ga0207671_10162796 | Ga0207671_101627962 | 489 |
| 593 | 3300025921 | Ga0207652_10199399 | Ga0207652_101993991 | 489 |
| 594 | 3300025922 | Ga0207646_10254108 | Ga0207646_102541081 | 489 |
| 595 | 3300025929 | Ga0207664_10000532 | Ga0207664_100005321 | 489 |
| 596 | 3300027671 | Ga0209588_1005352 | Ga0209588_10053523 | 489 |
| 597 | 3300035119 | Ga0373956_0008131 | Ga0373956_0008131_1970_3466 | 489 |
| 598 | 3300035120 | Ga0373957_0007236 | Ga0373957_0007236_232_1728 | 489 |
| 599 | 3300035171 | Ga0373946_0005395 | Ga0373946_0005395_2741_4237 | 489 |
| 600 | 3300035692 | Ga0373935_0013755 | Ga0373935_0013755_1367_2863 | 489 |
| 601 | 3300035695 | Ga0373927_0005612 | Ga0373927_0005612_90_1586 | 489 |
| 602 | 3300046477 | Ga0495664_0002704 | Ga0495664_0002704_2274_3770 | 489 |
| 603 | 3300046517 | Ga0495630_0016477 | Ga0495630_0016477_3127_4623 | 489 |
| 604 | 3300046690 | Ga0495624_0032867 | Ga0495624_0032867_377_1873 | 489 |
| 605 | 3300047319 | Ga0495674_0008394 | Ga0495674_0008394_6035_7531 | 489 |
| 606 | 3300048906 | Ga0496103_0000987 | Ga0496103_0000987_5154_6647 | 489 |
| 607 | 3300049572 | Ga0501036_0065766 | Ga0501036_0065766_61_1557 | 489 |
| 608 | 3300050513 | nmdc:mga0rr50_15163_c1 | nmdc:mga0rr50_15163_c1_2794_4287 | 489 |
| 609 | 3300050514 | nmdc:mga08x19_82009_c1 | nmdc:mga08x19_82009_c1_365_1858 | 489 |
| 610 | 3300054114 | Ga0501084_0228900 | Ga0501084_0228900_18_1505 | 489 |
| 611 | 3300005329 | Ga0070683_100008769 | Ga0070683_1000087692 | 490 |
| 612 | 3300005329 | Ga0070683_100070557 | Ga0070683_1000705572 | 490 |
| 613 | 3300005330 | Ga0070690_100028588 | Ga0070690_1000285882 | 490 |
| 614 | 3300005331 | Ga0070670_100017726 | Ga0070670_1000177263 | 490 |
| 615 | 3300005338 | Ga0068868_100001960 | Ga0068868_1000019609 | 490 |
| 616 | 3300005338 | Ga0068868_100007353 | Ga0068868_1000073533 | 490 |
| 617 | 3300005344 | Ga0070661_100171148 | Ga0070661_1001711481 | 490 |
| 618 | 3300005458 | Ga0070681_10000055 | Ga0070681_1000005520 | 490 |
| 619 | 3300005458 | Ga0070681_10029576 | Ga0070681_100295763 | 490 |
| 620 | 3300005458 | Ga0070681_10059518 | Ga0070681_100595182 | 490 |
| 621 | 3300005530 | Ga0070679_100146930 | Ga0070679_1001469302 | 490 |
| 622 | 3300005535 | Ga0070684_100007024 | Ga0070684_1000070246 | 490 |
| 623 | 3300005535 | Ga0070684_100075978 | Ga0070684_1000759781 | 490 |
| 624 | 3300005547 | Ga0070693_100037881 | Ga0070693_1000378812 | 490 |
| 625 | 3300005563 | Ga0068855_100001077 | Ga0068855_1000010773 | 490 |
| 626 | 3300005563 | Ga0068855_100002871 | Ga0068855_10000287111 | 490 |
| 627 | 3300005564 | Ga0070664_100001803 | Ga0070664_10000180313 | 490 |
| 628 | 3300005577 | Ga0068857_100000041 | Ga0068857_10000004134 | 490 |
| 629 | 3300005578 | Ga0068854_100005254 | Ga0068854_1000052547 | 490 |
| 630 | 3300005578 | Ga0068854_100027125 | Ga0068854_1000271254 | 490 |
| 631 | 3300005614 | Ga0068856_100000355 | Ga0068856_10000035514 | 490 |
| 632 | 3300005614 | Ga0068856_100001245 | Ga0068856_10000124514 | 490 |
| 633 | 3300005614 | Ga0068856_100001397 | Ga0068856_10000139716 | 490 |
| 634 | 3300005614 | Ga0068856_100087961 | Ga0068856_1000879613 | 490 |
| 635 | 3300005617 | Ga0068859_100000959 | Ga0068859_1000009597 | 490 |
| 636 | 3300005618 | Ga0068864_100005434 | Ga0068864_1000054344 | 490 |
| 637 | 3300005618 | Ga0068864_100006890 | Ga0068864_1000068905 | 490 |
| 638 | 3300005719 | Ga0068861_100006960 | Ga0068861_1000069604 | 490 |
| 639 | 3300005840 | Ga0068870_10015992 | Ga0068870_100159922 | 490 |
| 640 | 3300005842 | Ga0068858_100028183 | Ga0068858_1000281833 | 490 |
| 641 | 3300005843 | Ga0068860_100002847 | Ga0068860_1000028477 | 490 |
| 642 | 3300005843 | Ga0068860_100038275 | Ga0068860_1000382752 | 490 |
| 643 | 3300006237 | Ga0097621_100000533 | Ga0097621_1000005339 | 490 |
| 644 | 3300006237 | Ga0097621_100000581 | Ga0097621_10000058114 | 490 |
| 645 | 3300006237 | Ga0097621_100119678 | Ga0097621_1001196782 | 490 |
| 646 | 3300006358 | Ga0068871_100000221 | Ga0068871_10000022130 | 490 |
| 647 | 3300006358 | Ga0068871_100000664 | Ga0068871_10000066414 | 490 |
| 648 | 3300006881 | Ga0068865_100029088 | Ga0068865_1000290883 | 490 |
| 649 | 3300006931 | Ga0097620_100000959 | Ga0097620_10000095920 | 490 |
| 650 | 3300009093 | Ga0105240_10034349 | Ga0105240_100343495 | 490 |
| 651 | 3300009093 | Ga0105240_10043737 | Ga0105240_100437377 | 490 |
| 652 | 3300009093 | Ga0105240_10181339 | Ga0105240_101813392 | 490 |
| 653 | 3300009098 | Ga0105245_10055647 | Ga0105245_100556473 | 490 |
| 654 | 3300009176 | Ga0105242_10001107 | Ga0105242_100011075 | 490 |
| 655 | 3300009177 | Ga0105248_10013857 | Ga0105248_100138574 | 490 |
| 656 | 3300009177 | Ga0105248_10034229 | Ga0105248_100342293 | 490 |
| 657 | 3300009177 | Ga0105248_10151317 | Ga0105248_101513172 | 490 |
| 658 | 3300009551 | Ga0105238_10000533 | Ga0105238_100005336 | 490 |
| 659 | 3300009551 | Ga0105238_10006729 | Ga0105238_100067295 | 490 |
| 660 | 3300013102 | Ga0157371_10021289 | Ga0157371_100212895 | 490 |
| 661 | 3300013104 | Ga0157370_10017861 | Ga0157370_100178613 | 490 |
| 662 | 3300013105 | Ga0157369_10000170 | Ga0157369_1000017031 | 490 |
| 663 | 3300013105 | Ga0157369_10009253 | Ga0157369_100092533 | 490 |
| 664 | 3300013296 | Ga0157374_10000316 | Ga0157374_1000031614 | 490 |
| 665 | 3300013296 | Ga0157374_10000330 | Ga0157374_1000033031 | 490 |
| 666 | 3300013296 | Ga0157374_10000533 | Ga0157374_1000053318 | 490 |
| 667 | 3300013297 | Ga0157378_10000071 | Ga0157378_100000716 | 490 |
| 668 | 3300013297 | Ga0157378_10000085 | Ga0157378_1000008553 | 490 |
| 669 | 3300013297 | Ga0157378_10000182 | Ga0157378_1000018211 | 490 |
| 670 | 3300013297 | Ga0157378_10079407 | Ga0157378_100794071 | 490 |
| 671 | 3300013307 | Ga0157372_10000620 | Ga0157372_1000062017 | 490 |
| 672 | 3300013307 | Ga0157372_10001563 | Ga0157372_100015637 | 490 |
| 673 | 3300013307 | Ga0157372_10002374 | Ga0157372_1000237411 | 490 |
| 674 | 3300013307 | Ga0157372_10322166 | Ga0157372_103221661 | 490 |
| 675 | 3300014325 | Ga0163163_10076691 | Ga0163163_100766911 | 490 |
| 676 | 3300014969 | Ga0157376_10060623 | Ga0157376_100606231 | 490 |
| 677 | 3300025912 | Ga0207707_10000739 | Ga0207707_1000073920 | 490 |
| 678 | 3300025912 | Ga0207707_10005345 | Ga0207707_100053457 | 490 |
| 679 | 3300025913 | Ga0207695_10047422 | Ga0207695_100474225 | 490 |
| 680 | 3300025913 | Ga0207695_10050832 | Ga0207695_100508322 | 490 |
| 681 | 3300025913 | Ga0207695_10076754 | Ga0207695_100767542 | 490 |
| 682 | 3300025915 | Ga0207693_10027726 | Ga0207693_100277261 | 490 |
| 683 | 3300025924 | Ga0207694_10001172 | Ga0207694_100011725 | 490 |
| 684 | 3300025932 | Ga0207690_10157266 | Ga0207690_101572661 | 490 |
| 685 | 3300025941 | Ga0207711_10042283 | Ga0207711_100422832 | 490 |
| 686 | 3300025944 | Ga0207661_10045539 | Ga0207661_100455392 | 490 |
| 687 | 3300025949 | Ga0207667_10000785 | Ga0207667_1000078517 | 490 |
| 688 | 3300025949 | Ga0207667_10003707 | Ga0207667_100037078 | 490 |
| 689 | 3300025949 | Ga0207667_10060404 | Ga0207667_100604042 | 490 |
| 690 | 3300025981 | Ga0207640_10004787 | Ga0207640_100047876 | 490 |
| 691 | 3300026023 | Ga0207677_10009392 | Ga0207677_100093923 | 490 |
| 692 | 3300026023 | Ga0207677_10045304 | Ga0207677_100453041 | 490 |
| 693 | 3300026035 | Ga0207703_10019982 | Ga0207703_100199825 | 490 |
| 694 | 3300026035 | Ga0207703_10021921 | Ga0207703_100219214 | 490 |
| 695 | 3300026078 | Ga0207702_10000089 | Ga0207702_1000008929 | 490 |
| 696 | 3300026078 | Ga0207702_10000759 | Ga0207702_100007596 | 490 |
| 697 | 3300026078 | Ga0207702_10049880 | Ga0207702_100498803 | 490 |
| 698 | 3300026089 | Ga0207648_10005354 | Ga0207648_100053547 | 490 |
| 699 | 3300026095 | Ga0207676_10008246 | Ga0207676_100082466 | 490 |
| 700 | 3300026116 | Ga0207674_10000309 | Ga0207674_1000030927 | 490 |
| 701 | 3300026116 | Ga0207674_10005897 | Ga0207674_1000589711 | 490 |
| 702 | 3300026118 | Ga0207675_100008562 | Ga0207675_1000085625 | 490 |
| 703 | 3300032002 | Ga0307416_100013345 | Ga0307416_1000133454 | 490 |
| 704 | 3300035691 | Ga0373931_0085551 | Ga0373931_0085551_137_1627 | 490 |
| 705 | 3300035724 | Ga0373933_0075830 | Ga0373933_0075830_178_1683 | 490 |
| 706 | 3300045836 | Ga0466958_0017067 | Ga0466958_0017067_969_2459 | 490 |
| 707 | 3300047471 | Ga0495684_0089050 | Ga0495684_0089050_656_2146 | 490 |
| 708 | 3300048088 | Ga0495602_0091332 | Ga0495602_0091332_454_1944 | 490 |
| 709 | 3300048905 | Ga0496102_0058742 | Ga0496102_0058742_1108_2616 | 490 |
| 710 | 3300048905 | Ga0496102_0260574 | Ga0496102_0260574_30_1520 | 490 |
| 711 | 3300048909 | Ga0496106_0075998 | Ga0496106_0075998_431_1939 | 490 |
| 712 | 3300048915 | Ga0496112_0151877 | Ga0496112_0151877_518_2026 | 490 |
| 713 | 3300048918 | Ga0496115_0063353 | Ga0496115_0063353_354_1844 | 490 |
| 714 | 3300053139 | Ga0500568_0010180 | Ga0500568_0010180_1425_2939 | 490 |
| 715 | 3300006844 | Ga0075428_100087856 | Ga0075428_1000878562 | 491 |
| 716 | 3300042876 | Ga0451577_0020122 | Ga0451577_0020122_107_1582 | 491 |
| 717 | 3300044712 | Ga0453684_0131019 | Ga0453684_0131019_737_2212 | 491 |
| 718 | 3300005336 | Ga0070680_100031524 | Ga0070680_1000315242 | 492 |
| 719 | 3300005366 | Ga0070659_100013438 | Ga0070659_1000134384 | 492 |
| 720 | 3300005445 | Ga0070708_100002603 | Ga0070708_1000026039 | 492 |
| 721 | 3300005458 | Ga0070681_10060176 | Ga0070681_100601762 | 492 |
| 722 | 3300005467 | Ga0070706_100006514 | Ga0070706_1000065141 | 492 |
| 723 | 3300005471 | Ga0070698_100000200 | Ga0070698_10000020040 | 492 |
| 724 | 3300005518 | Ga0070699_100000156 | Ga0070699_10000015616 | 492 |
| 725 | 3300005536 | Ga0070697_100000235 | Ga0070697_10000023516 | 492 |
| 726 | 3300005539 | Ga0068853_100064113 | Ga0068853_1000641132 | 492 |
| 727 | 3300005564 | Ga0070664_100007698 | Ga0070664_1000076983 | 492 |
| 728 | 3300005577 | Ga0068857_100147381 | Ga0068857_1001473811 | 492 |
| 729 | 3300013100 | Ga0157373_10069536 | Ga0157373_100695362 | 492 |
| 730 | 3300014325 | Ga0163163_10073522 | Ga0163163_100735223 | 492 |
| 731 | 3300024227 | Ga0228598_1000070 | Ga0228598_10000706 | 492 |
| 732 | 3300025910 | Ga0207684_10000260 | Ga0207684_100002606 | 492 |
| 733 | 3300025917 | Ga0207660_10085859 | Ga0207660_100858591 | 492 |
| 734 | 3300025922 | Ga0207646_10000261 | Ga0207646_1000026127 | 492 |
| 735 | 3300025945 | Ga0207679_10028975 | Ga0207679_100289752 | 492 |
| 736 | 3300025949 | Ga0207667_10168824 | Ga0207667_101688242 | 492 |
| 737 | 3300026041 | Ga0207639_10014034 | Ga0207639_100140344 | 492 |
| 738 | 3300026095 | Ga0207676_10034969 | Ga0207676_100349693 | 492 |
| 739 | 3300026116 | Ga0207674_10000469 | Ga0207674_100004696 | 492 |
| 740 | 3300026116 | Ga0207674_10153683 | Ga0207674_101536832 | 492 |
| 741 | 3300036401 | Ga0373937_0188893 | Ga0373937_0188893_375_1874 | 492 |
| 742 | 3300046460 | Ga0495638_0022118 | Ga0495638_0022118_347_1861 | 492 |
| 743 | 3300048903 | Ga0496100_0071778 | Ga0496100_0071778_686_2185 | 492 |
| 744 | 3300050513 | nmdc:mga0rr50_5571_c1 | nmdc:mga0rr50_5571_c1_141_1631 | 492 |
| 745 | 3300006847 | Ga0075431_100007696 | Ga0075431_1000076963 | 493 |
| 746 | 3300049742 | Ga0501080_0089718 | Ga0501080_0089718_516_2057 | 493 |
| 747 | 3300050510 | nmdc:mga06r32_8085_c1 | nmdc:mga06r32_8085_c1_3374_4882 | 493 |
| 748 | 3300005435 | Ga0070714_100009692 | Ga0070714_1000096922 | 494 |
| 749 | 3300005617 | Ga0068859_100029316 | Ga0068859_1000293162 | 494 |
| 750 | 3300006173 | Ga0070716_100050396 | Ga0070716_1000503963 | 494 |
| 751 | 3300006931 | Ga0097620_100029316 | Ga0097620_1000293162 | 494 |
| 752 | 3300025906 | Ga0207699_10030224 | Ga0207699_100302242 | 494 |
| 753 | 3300025928 | Ga0207700_10045123 | Ga0207700_100451232 | 494 |
| 754 | 3300025929 | Ga0207664_10016554 | Ga0207664_100165545 | 494 |
| 755 | 3300025939 | Ga0207665_10051697 | Ga0207665_100516973 | 494 |
| 756 | 3300049571 | Ga0501034_0085258 | Ga0501034_0085258_945_2447 | 494 |
| 757 | 3300049572 | Ga0501036_0048793 | Ga0501036_0048793_256_1758 | 494 |
| 758 | 3300049581 | Ga0501047_0014526 | Ga0501047_0014526_421_1923 | 494 |
| 759 | 3300049586 | Ga0501070_0144853 | Ga0501070_0144853_386_1888 | 494 |
| 760 | 3300049587 | Ga0501071_0041281 | Ga0501071_0041281_483_1967 | 494 |
| 761 | 3300049588 | Ga0501072_0092327 | Ga0501072_0092327_876_2360 | 494 |
| 762 | 3300049591 | Ga0501075_0113100 | Ga0501075_0113100_60_1544 | 494 |
| 763 | 3300049742 | Ga0501080_0080690 | Ga0501080_0080690_284_1786 | 494 |
| 764 | 3300060353 | Ga0501082_0038130 | Ga0501082_0038130_648_2150 | 494 |
| 765 | 3300060353 | Ga0501082_0074498 | Ga0501082_0074498_450_1934 | 494 |
| 766 | 3300005444 | Ga0070694_100002059 | Ga0070694_1000020593 | 495 |
| 767 | 3300006852 | Ga0075433_10030368 | Ga0075433_100303682 | 495 |
| 768 | 3300009093 | Ga0105240_10097442 | Ga0105240_100974423 | 495 |
| 769 | 3300013105 | Ga0157369_10048297 | Ga0157369_100482974 | 495 |
| 770 | 3300013105 | Ga0157369_10112657 | Ga0157369_101126573 | 495 |
| 771 | 3300013307 | Ga0157372_10001829 | Ga0157372_1000182911 | 495 |
| 772 | 3300013307 | Ga0157372_10023041 | Ga0157372_100230414 | 495 |
| 773 | 3300025913 | Ga0207695_10073020 | Ga0207695_100730202 | 495 |
| 774 | 3300049574 | Ga0501038_0001977 | Ga0501038_0001977_15349_16875 | 495 |
| 775 | 3300013296 | Ga0157374_10233318 | Ga0157374_102333181 | 496 |
| 776 | 3300044694 | Ga0466963_0011667 | Ga0466963_0011667_2562_4088 | 496 |
| 777 | 3300049576 | Ga0501040_0077806 | Ga0501040_0077806_30_1520 | 496 |
| 778 | 3300049591 | Ga0501075_0087112 | Ga0501075_0087112_150_1640 | 496 |
| 779 | 3300049592 | Ga0501076_0033736 | Ga0501076_0033736_1594_3084 | 496 |
| 780 | 3300049742 | Ga0501080_0057345 | Ga0501080_0057345_540_2030 | 496 |
| 781 | 3300049743 | Ga0501081_0018651 | Ga0501081_0018651_22_1512 | 496 |
| 782 | 3300054114 | Ga0501084_0203873 | Ga0501084_0203873_128_1618 | 496 |
| 783 | 3300061734 | Ga0530510_0089031 | Ga0530510_0089031_117_1607 | 496 |
| 784 | 2162886007 | SwRhRL2b_contig_2054937 | SwRhRL2b_0345.00004080 | 499 |
| 785 | 3300005289 | Ga0065704_10078208 | Ga0065704_100782082 | 499 |
| 786 | 3300005295 | Ga0065707_10082532 | Ga0065707_100825328 | 499 |
| 787 | 3300005445 | Ga0070708_100002323 | Ga0070708_10000232313 | 499 |
| 788 | 3300009094 | Ga0111539_10001532 | Ga0111539_1000153224 | 499 |
| 789 | 3300027907 | Ga0207428_10026180 | Ga0207428_100261803 | 499 |
| 790 | 3300050511 | nmdc:mga08y16_34764_c1 | nmdc:mga08y16_34764_c1_1283_2782 | 499 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6k76-assembly1.cif.gz_A | glycerol kinase form thermococcus kodakarensis, complex structure with substrate. | 0.9383 | 4 | 480 |
| 2zf5-assembly1.cif.gz_O | crystal structure of highly thermostable glycerol kinase from a hyperthermophilic archaeon | 0.9377 | 2 | 481 |
| 3h45-assembly1.cif.gz_O | glycerol kinase h232e with ethylene glycol | 0.9317 | 2 | 487 |
| 1gll-assembly1.cif.gz_O | escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion | 0.931 | 2 | 483 |
| 3flc-assembly1.cif.gz_X | crystal structure of the his-tagged h232r mutant of glycerol kinase from enterococcus casseliflavus with glycerol | 0.9285 | 2 | 483 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37677_1_241_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9643 | 1 | 237 | 3.30.420.40 |
| 5vm1D01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9496 | 3 | 247 | 3.30.420.40 |
| af_Q2G205_1_247_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9464 | 1 | 241 | 3.30.420.40 |
| 3ifrA01 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9457 | 3 | 239 | 3.30.420.40 |
| af_P37677_1_241_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9448 | 1 | 237 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N2NH27-F1-model_v4 | Carbohydrate kinase FGGY N-terminal domain-containing protein | 0.9923 | 1 | 242 |
GO:0005975
GO:0016301 |
| AF-A0A535VT70-F1-model_v4 | Xylulokinase | 0.992 | 1 | 272 |
GO:0005975
GO:0016301 GO:0016773 |
| AF-W4VBX3-F1-model_v4 | Xylulose kinase | 0.9911 | 140 | 241 |
GO:0005975
GO:0016301 |
| AF-A0A7C2J5C0-F1-model_v4 | Xylulokinase | 0.9875 | 3 | 255 |
GO:0005975
GO:0016301 |
| AF-C5H4P8-F1-model_v4 | Putative xylulokinase | 0.9826 | 2 | 219 |
GO:0005975
GO:0016301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar